2IWCA

Benzylpenicilloyl-acylated mecr1 extracellular antibiotic-sensor domain.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
255
structure length
255
Chain Sequence
GHMSAHVQQDKYETNVSYKKLNQLAPYFKGFDGSFVLYNEREQAYSIYNEPESKQRYSPNSTYKIYLALMAFDQNLLSLNHTEQQWDKHQYPFKEWNQDQNLNSSMKYSVNWYYENLNKHLRQDEVKSYLDLIEYGNEEISGNENYWNESSLKISAIEQVNLLKNMKQHNMHFDNKAIEKVENSMTLKQKDTYKYVGKTGTGIVNHKEANGWFVGYVETKDNTYYFATHLKGEDNANGEKAQQISERILKEMELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Unbound and Acylated Structures of the Mecr1 Extracellular Antibiotic-Sensor Domain Provide Insights Into the Signal-Transduction System that Triggers Methicillin Resistance.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus n315
molecule tags Antibiotic resistance
molecule keywords METHICILLIN RESISTANCE MECR1 PROTEIN
total genus 91
structure length 255
sequence length 255
ec nomenclature
pdb deposition date 2006-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2iwcA00
3PBNA 3G2ZA 1XX2A 3NCKA 3ZG9B 5CEBA 4N92A 3WS2A 4JF5A 3VP2A 1BZAA 4B88A 4GKUA 1TDGA 3BFEA 1K55A 4PM8A 1ESIA 3BEBA 3UN7A 3UDIA 3UNWA 3GQZA 2Q9NA 3CMZA 3Q81A 3Q7VA 4FSFA 3VSKA 1IYQA 3N4IA 5HAQA 3OCNA 5FAPA 3ZNYA 1SDEA 1ERMA 4WEKA 1VM1A 4PM6A 4LV1A 5TR7A 1J9MA 2XFSA 3BFFA 3BYDA 4P6BA 1LHYA 5FATA 1MWRA 5CECA 4WM9A 2ZM0A 3OPHA 2WZXA 1XA7A 1ES3A 4MLLA 1WYBA 1MKIA 2BLSA 2R9XA 2WAEA 3PAGA 4S2PA 5FAOA 5KZHA 4P85A 5GL9A 2JC7A 1W5DA 3MZEA 1AXBA 1PI5A 1XP4A 5DVAA 2WAFA 5E2HA 1L2SA 1BLCA 3BRMA 3GRJA 3MZFA 2EX6A 4OQGA 3OPRA 2Z2MB 2H10A 3TG9A 4S2OA 4S2MA 2XF3A 1ONHA 3C4PA 2UWXA 1PWGA 1JTGA 1IEMA 3EQVA 1K57A 1E25A 1KVLA 4YINA 3IWOA 5AQ7A 4E3LA 4PM5A 2X01A 1BULA 3G32A 4E3IA 5EVIA 3FKVA 1GHMA 3HL9A 2Y4AA 2P74A 5EUAA 3IH9A 3O86A 4L0LA 4BLMA 3V50A 3PBTA 3D4FA 5DF8A 3UE1A 4FH2A 4IVKA 1HD8A 3VOZA 4R1GA 4EWFA 2C6WB 4HBUA 1S6RA 3PBQA 4ZJ3A 3WS1A 5M18A 3NC8A 4WMCA 4ZJ2A 4OOLA 4UA9A 2ZM2A 2CC1A 2ZQAA 1KGEA 1LLBA 1WYCA 1MXOA 4GZBA 3FKWA 1RGYA 5EOOA 3WS0A 5GHXA 1HTZA 4R4RA 3WS4A 3JYIA 1Y54A 1CI9A 5U47A 4XUXA 1G6AA 5CTNA 3A3FA 3LY4A 3MFDA 4EV4A 2XFTA 2WGWA 3Q82A 4KZ3A 4IVIA 4WBGA 2XLNA 3GV9A 3M2JA 3ZG5A 2E8IA 1GHIA 3QNBA 5CERA 1G68A 1BUEA 4DKIA 1LL9A 3PTEA 5AQBA 3WS5A 1YMSA 3GTCA 1W8YA 5E2GA 3G2YA 1K4FA 3GVBA 1ZC2A 4KZ9A 1ZKJA 4KZ6A 4E3KA 4DXBA 2V1ZA 1IYPA 4Z9QA 1KE4A 4GD8A 2Y2NA 1LI0A 1JWZA 3HUOA 3OC2A 1YLPA 4PM9A 4OVDA 5I94A 3N8RA 2X71A 1FCOA 2VGKA 5GLAA 2OLVA 3OCLA 1KE3A 3A3DA 5GLBA 3UDFA 2HDSA 3ZG8B 3FWLA 4O7DA 3S1YA 4S2NC 2B5RA 1LI9A 4IEDA 4LV2A 5HX9A 4RYEA 5F83A 1YLWA 3S4XA 3IH8A 4KG5A 5GLCA 4IBXA 3TOIA 1Q2QA 3IF5A 4GD6A 4Y7PA 3Q7VB 4NK3A 1FQGA 2HP9A 3ZGAB 1H8YA 2ZC7A 3CJMA 4OP5A 3WRTA 3RXWA 3A3EA 4KZBA 5KSCA 4K0WA 4N9LA 4X56A 5E2EA 3DWKA 3DW0A 1NXYA 5CEDA 2Q9MA 3AGFA 3BFGA 3BLMA 2A49A 3LEZA 1FCNA 3PAEA 1CK3A 4KZ4A 2ZQ7A 4FH4A 4WZ5A 5FA7A 4E6XA 4R3JA 3VP1A 4X53A 4R23A 1MY8A 4F94A 3W4OA 3BFCA 1YQSA 2H0YA 3A3JA 3HREA 2Y59A 1W8QA 5HW3A 5L2FA 3HLCA 4JF6A 4YFMA 1HVBA 3QHYA 5TGFA 4DE1A 1H8ZA 3CG5A 4P87A 5FAQA 3S22A 2HDRA 5FI7A 3IWQA 4GB7A 2HPBA 3NDEA 2DCFA 1JWVA 3HLDA 4QJGA 1JWPA 1OMEA 3C4OA 1TVFA 5GHZA 2IWDA 3Q1FA 1SKFA 1ZG6A 4NETA 1PWCA 3SS4A 2ZC4B 4KG2A 1Q2PA 4JLFA 1K6SA 1WE4A 3VSLA 3IF6A 3ZG0A 2WGIA 4JXSA 4C3QA 4GNUA 2C5WB 5FQKA 4LV0A 2EFUA 3C7VA 3ITBA 4B4XA 1K38A 2J8YA 4JBFA 4WZ4A 1BLHA 1K56A 2XGNA 1RP5A 3A3IA 4GDNA 1QMEA 4BL3A 3PBSA 1GA0A 5DTKA 1RGZA 1NY0A 2ZC5B 4OQHA 4PMAA 5FQJA 2Y2LA 3V3RA 5FQ9A 3G31A 2FFYA 5A91A 5CRFA 3EQUA 5EPHA 5EECA 4Y0TA 4OPQA 1VQQA 3HLFA 3RXXA 1PYYA 1SCWA 1I2WA 2P9VB 4DDYA 3IHBA 2Y2IA 3N8SA 3IXGA 4BD1A 1K4EA 1YM1A 5FASA 3N7WA 4M3KA 3VP4A 4B4ZA 2ZC6B 1YLZA 2GDNA 5D3OA 2H5SA 4LCLA 4E3NA 1E3UA 1IKGA 2JCHA 3DTMA 4QB8A 1YMXA 3SH9A 1EROA 1N9BA 3GMWA 2WZZA 4XUZA 4E3MA 4RA7A 5CHJA 2JE5A 4WMCD 3MBZA 5A93A 3W8KA 5JYOA 5KSHA 3NI9A 4KZ5A 5G18A 2WKIA 1KGGA 1XA1A 2Y2PA 2J9OA 2ZLYA 1XKZA 1H5XA 2PU4A 2VGJA 3SH8A 1NRFA 4DE0A 2HDQA 5EE8A 4QHCA 4FCFA 5HAIA 2WKEA 4S2IA 1K54C 2XK1A 4K91A 3LCEA 2EXAA 2WADA 2RL3A 3MKEA 5FQMA 2ZQ8A 4X6TA 1EI5A 1DJAA 2ZMAA 3IF6B 1EWZA 3IT9A 4BENA 4BQMA 1GHPA 3VP0A 4MBHA 3ZDJA 1IELA 4X68A 1YLTA 1ES4A 5CXWA 3SS5A 3IWIA 3IXHA 1M40A 4JPMA 4JF4A 4CJNA 1MPLA 3N8LA 3UPPA 1YLJA 3BLSA 4EBNA 1K56D 4LENA 1BT5A 1PIOA 5CGSA 4E3OA 4OH0A 1C3BA 4EQIA 5HARA 2XQZA 2V20A 2Y2JA 4JKTA 5FI2A 3LO7A 5IHVA 1RCJA 5CHUA 2WUQA 2WKHA 4QD4A 4DRTA 4EBPA 3UE3A 4Q8IA 1K57C 3IXDA 2XH9A 2DNSA 1XXMA 4S2NA 3AGDA 2A3UA 1K6RA 2H0TA 3ISGA 2EX8A 4MNRA 3MKFA 4OKPA 5GHYA 5EOEA 2Z2LB 5F1GA 2IWBA 3IQAA 4WYYA 3UO9A 4OOMA 4CPKA 1MBLA 4RVAA 3IXBA 3HUNA 3M6HA 2OSUA 1K25A 1XGIA 1PI4A 1O7EA 2X02A 3P98A 3MXRA 4KQRA 4ZBEA 4EBLA 2HP6A 2OLUA 1E3UD 4JXGA 3OZHA 1IYSA 3Q7ZA 1NYYA 2PU2A 4XXRA 3V3SA 3VFHA 4OOYA 1K55C 1TEMA 2Y2GA 4N1HA 4R0QA 3ZG7B 4ZDXA 2HP5A 4DDSA 5E2FA 1NZUA 1E4DA 3QNCA 3HBRA 3IF6C 4OPRA 3ZCZA 3FZCA 5CGWA 1ES5A 1I5QA 4JXVA 2J7VA 3GR2A 3M2KA 4Y0OA 5F82A 5FQQA 1S0WA 1KDSA 2ZD8A 4S2LA 5KMWA 3HLBA 2ZJ9A 3E2KA 4OLDA 2P9VA 3DWZA 2JBFA 1W7FA 2G2UA 4QU3A 1BLPA 1IYOA 2WK0A 1L0GA 1M6KA 4KZ7A 1PW1A 1PW8A 4X69A 4OLGA 4GN2A 4E3JA 3N6IA 1IKIA 1LL5A 4IBRA 4KENB 1FOFA 1QMFA 3NDGA 1ES2A 3C7UA 5DF9A 3UPNA 4U0XA 4PPRA 1DJBA 3O87A 3E2LA 2G2WA 5DTTA 3G30A 4KZAA 4FD8A 3UE0A 3G34A 4S2KA 3B3XA 4WZ5C 3O3VA 1PZOA 3HVFA 4MBKA 4S2JA 5HFOA 2XDMA 4MBFA 3HLEA 1L0FA 3UY6A 2EX9A 2EFXA 1NJ4A 5E43A 5EVLA 5FI6A 5EVIC 3GSGA 1CI8A 3PBOA 4R3BA 3G4PA 4UHUA 3V5MA 5HL1A 4JXWA 2XD5A 3AGEA 4ZJ1A 4EUZA 3BECA 4UAAA 5EVID 2BG1A 3SH7A 3VFFA 2Y2OA 4OQ0A 4R4SA 3LY3A 2ZQCA 5BOHA 5A90A 4HBTA 2XEPA 4UA7A 2XD1A 3W4QA 3PBRA 1CEGA 1XPBA 3UPOA 3FV7A 4K0XA 3ZVTA 1FCMA 2R9WA 5FQIA 3Q07A 2Y55A 3RJUA 1FR1A 4WELA 4LCMA 2QMIA 2Y2KA 1KE0A 4E6WA 3V39A 4ID4A 4U3TA 3BM6A 2Y2HA 4OQIA 2ZM8A 4OPZA 5A92A 1BLSA 1SDNA 3C5AA 1XGJA 1ZG4A 3IHAA 1K54A 2QZ6A 1I2SA 2Y91A 1MWTA 1ONGA 4DE2A 1TDLA 4LV3A 2WGVA 4ZAMA 1YLYA 3NBLA 4DE3A 3MXSA 3VMAA 2WGWB 3CZDA 5CGXA 4N9KA 1DJCA 3I7JA 2ZQDA 3W4PA 1JTDA 3VP3A 4U0TA 4OP8A 1ALQA 2OV5A 1W79A 1MWUA 3NY4A 4DF6A 4WEJA 3SS3A 3BFDA 1PZPA 4X55A 3HUMA 1Z6FA 4KG6A 5CHMA 1FSYA 3G35A 1MWSA 3WRZA 4N1XA 3ZNTA 4BJPA 5AQ9A 1ESUA 3WWXA 4GDBA 2EXBA 2WYXA 2Y2QA 2I72A 2XR0A 1GCEA 5EVIB 3TSGA 4A5RA 3MZDA 4OPYA 1BTLA 4PM7A 5FSRA 1NZOA 4MEZA 5GLDA 1BSGA 1KDWA 3P09A 3OPLA 4HEFA 3VOYA 5HAPA 1HZOA 1KVMA 3HLWA 2V2FF 2J9PA 5J8XA 5M1AA 4OONA 4H8RA 4RX3A 5FDHA 1JVJA 4UA6A 1FR6A 3SOIA 2PBYA 4RX2A 1KGFA 1L0EA 4D2OA 2EX2A 3OPPA 1FSWA 4BL2A 4ZTKA 3M6BA 1NYMA 5AQAA 1O07A 4C6YA 5JYPA 4HESA 4Y0UA 4DXCA 1N4OA 4QY5A 5TFQA 2ZC3B 2QPNA 2FFFB 3O88A 5DTSA 5DF7A 3UDXA 2HDUA 4KQQA 5M19A 3ZVWA 3ZHHA 1DY6A 4KZ8A 4GOGA 5F1FA 4KQOA 1SHVA 2DRWA 1PWDA 4P0MA 1GA9A 2Y2MA 4C75A 1CEFA 3ZFZA 3NIAA 2ZQ9A 2RCXA 4BD0A 3HLGA 5CTMA 3FYZA 2IWCA 1L0DA 3ITAA 1YT4A 4QY6A 1ERQA 1U60A
chains in the Genus database with same CATH superfamily
3PBNA 3WS2A 4GHIA 3T4LA 3BFEA 4PM8A 3K3CA 2OAQ1 3UDIA 2JKRM 4FSFA 5HAQA 4LPZA 3ZNYA 4DJ3A 1VM1A 4PM6A 4LV1A 4HH3A 1J9MA 4P6BA 3BYDA 1G5UA 3CITA 1VEUB 5GL9A 1W5DA 2MJ6A 1PI5A 2WAFA 3TRCA 4WLAA 4L9GA 4EERA 3OPRA 3TG9A 3OOVA 1KVLA 3IWOA 2A24A 2R78A 4MDZA 5AJGA 4H6JB 3G32A 5EVIA 3E98A 1GHMA 4KQDA 3V50A 4EWFA 5AVEA 4ZJ2A 4UA9A 1JNUA 1KGEA 1WYCA 5EOOA 3FKWA 1RGYA 3H9WA 3WS0A 5GHXA 1HTZA 2W3HA 1CI9A 1G6AA 3MFDA 5TBMA 1L3LA 3GV9A 2E8IA 1GHIA 3TW8A 3QNBA 5CERA 4DKIA 3IX3A 3GTCA 1IOUA 1ZC2A 1IYPA 2M7UA 2QKPA 4LRXC 2X71A 1TD5A 3OCLA 3QP5A 4CLCE 1PNEA 1J3WA 5GLCA 3Q7VB 1FQGA 2D02A 3E0YA 2P7JA 4K0WA 2OWJA 5FEFA 1FCNA 2ZQ7A 4WZ5A 5FA7A 3TJZC 3VP1A 4E6XA 3D9YA 5DKLA 4EXOA 4F94A 1NLZA 3BFCA 4HI4A 3LIDA 2QWSA 4DE1A 3ULFA 4BBTA 2HPBA 3SW1A 3HLDA 3IBRA 1TVFA 4NETA 1ZG6A 3SS4A 4JLFA 3VSLA 3UE6A 2DMWA 5FQKA 3LR3A 3ITBA 4JBFA 2ZOIA 1K56A 1RP5A 3GDIA 4NXGA 3PBSA 5DTKA 1RGZA 5FQJA 2Y2LA 3V3RA 5I5LA 2FFYA 5CRFA 1PYYA 3KSIA 3IHBA 4GS9B 3N8SA 4HNBA 3IXGA 3CUEA 1YM1A 5FASA 4M3KA 1YLZA 3A0VA 3DTMA 4QB8A 2WZZA 2JE5A 4HP4A 3MBZA 2XA7S 3W8KA 5A93A 4G3KA 5KSHA 2WKIA 4CLCA 2IA2A 1XKZA 2PU4A 2VGJA 2VGLM 4KUOA 3LR0A 5EE8A 2K7SA 4S2IA 3MKEA 2VZWA 1TF1A 4BQMA 3ZDJA 4X68A 1ES4A 5CXWA 3SS5A 1M40A 4JPMA 1YLJA 1K56D 2XQZA 2Y2JA 4QPRA 2WUQA 2V1AA 2WKHA 4QD4A 4Y5FA 4DRTA 3FPVA 3NOUC 5F68A 4S2NA 1TS6A 2A3UA 4MNRA 4ME4A 3UO9A 1ZTUA 4CQHA 1K25A 1PI4A 3MXRA 3KYZA 3H82A 2HP6A 5DFXA 4JXGA 3OZHA 1IYSA 2PU2A 4XXRA 4DDSA 3OLOA 5E2FA 2W1TB 3QNCA 3HBRA 3FZCA 2OOLA 4JGPA 4HP9A 2J7VA 3GR2A 3M2KA 1KDSA 4S2LA 3HLBA 2ZJ9A 4EEPA 2P9VA 3DWZA 3D72A 1IYOA 1M6KA 4GN2A 4E3JA 4IBRA 1QMFA 2JKFA 3C7UA 5DF9A 5HSQA 1DJBA 2VA0A 3O87A 2PAVP 5DTTA 3UE0A 4WZ5C 3B3XA 4L9FA 3F1NA 4MBKA 5EFWA 3U4LP 2VX8A 1L0FA 3MQOA 1MC0A 4LGWA 3GSGA 1CI8A 3PBOA 4R3BA 5HL1A 3LR5A 5EM0A 4ZJ1A 2HJEA 4EUZA 4UAAA 3QP6A 2ZQCA 3BY9A 1CEGA 1XPBA 3UPOA 5F6AA 1FCMA 2PD7A 3KSGA 1KE0A 2EWVA 2VK3A 4E6WA 3BM6A 4OQIA 2ZM8A 1BLSA 2QZ6A 2Y91A 1ONGA 2Z6CA 1TDLA 4LV3A 2WGVA 1F2KA 5AVFA 4CLCC 3VMAA 4ARZB 1F5MA 4N9KA 4U0TA 4CLCB 4WEJA 4X25A 2YKHA 1PZPA 4KG6A 4Y3IA 3V67A 3G35A 1YKDA 2ZMVA 1MWSA 3WRZA 4K08A 2EXBA 4OPYA 4IUKA 3JPUA 4MEZA 3GECA 3OPLA 3BWLA 5EM1A 4RX3A 1JVJA 4UA6A 3SOIA 2AVXA 4RX2A 1KGFA 4D2OA 2EX2A 1OTDA 4BL2A 3NHQA 3F1OB 4C6YA 4HESA 4Y0UA 1DP6A 3LGOA 1VHMA 2XSSA 4GOGA 1YPRA 1GA9A 2Y2MA 4C75A 2L4RA 2ZQ9A 4BD0A 1BYWA 2INWA 2IWCA 4QY6A 1ERQA 5EUAA 1XX2A 3NCKA 3ZG9B 5CEBA 3LIBA 3DTEA 3MFXA 4JF5A 3R4KA 1K55A 3BEBA 3IX4A 3UNWA 3N4IA 3OCNA 2B95A 4HIAA 5TR7A 3BFFA 5TJJA 5FATA 1MWRA 5CECA 3OPHA 2WZXA 1WYBA 1MKIA 3EEAA 2BLSA 3PAGA 2WAEA 4S2PA 4P85A 3JVVA 2JC7A 1TS0A 1XP4A 2LB5A 5E2HA 1K0KA 1BLCA 1L2SA 4DN0A 1FILA 1PFLA 4S2OA 1XFQA 4S2MA 1ONHA 3C4PA 3L7HA 1PWGA 3MQ0A 1IEMA 4HJ4A 3T4SA 5AQ7A 4E3LA 3E4OA 3W2ZA 4E3IA 1BULA 3HL9A 2Y4AA 5HPFA 2P74A 4BLMA 5DF8A 5HDSA 3UE1A 4FH2A 4IVKA 1ODVA 3DAVA 4UQIS 3WS1A 3NC8A 4WMCA 4OOLA 4R3AA 5EV0A 1MXOA 4MN6A 1Y54A 4XUXA 3F1OA 3LY4A 4EV4A 4WBGA 3M2JA 1V9ZA 2Y79A 3LR4A 3T4KA 1G68A 1LL9A 5AQBA 3WS5A 2I9VA 2OAP1 2PR6A 3MXQA 2GJ3A 2L1MA 5E2GA 4WUJA 1K4FA 3GVBA 4HHDA 4KZ9A 1ZKJA 4DXBA 4E3KA 4Z9QA 4GD8A 1JWZA 3HUOA 5GLAA 5GLBA 3UDFA 2PYPA 1YSQA 3T1QB 3FWLA 4O7DA 3S1YA 4S2NC 1T1CA 1LI9A 5HX9A 4RYEA 1YLWA 2J80A 1LSXA 3S4XA 4IBXA 1Q2QA 4Y7PA 4EESA 3HJIA 5L09A 2VLGA 3RXWA 1S67L 4N9LA 1S4SA 3DW0A 1NXYA 3BLMA 3AGFA 1KOUA 1OJ5A 3BFGA 3PAEA 3EEHA 1YSPA 4R3JA 4X53A 1MY8A 3W4OA 5C5KA 2HJ9C 3T4OA 3EOIA 3QHYA 2FZ0A 5FAQA 2Q0OA 3IWQA 2DCFA 1JWVA 1OMEA 3C4OA 4G3VA 1S4RA 2IWDA 3Q1FA 5HD5A 1PWCA 5HPIA 1Q2PA 3ZG0A 4GNUA 2NUPC 1GSXA 3PXPA 1D7EA 4NXEA 2XGNA 3FG8A 2JKGA 4GDNA 3BQAA 1X0OA 1XJ6A 2ZC5B 1NY0A 2WKRA 3G31A 4UEYA 5A91A 2BTFP 5EECA 2KLIA 3RXXA 3HCYA 1I2WA 4DDYA 3KSFA 2XROA 4BD1A 3MF0A 4BMWA 3IBJA 2ZC6B 2UV0E 4E3NA 4LCLA 1IKGA 3SH9A 1YMXA 3RFBA 4B9OA 2EWWA 5G18A 3T1XA 1Z09A 3FC7A 1H5XA 5FEGA 1LT0A 2HDQA 4QHCA 4FCFA 1K54C 2XK1A 4K91A 3RTYA 1N9OA 2ZQ8A 1EI5A 2ZMAA 3UB8A 4MBHA 1IELA 1GSVA 3IWIA 1SKOA 5CGSA 2Y8HA 4I3IA 2V20A 5CHUA 4EUVA 3R7WA 2K2NA 3UE3A 3IXDA 2Z2LB 3T1SA 1NLYA 4OOMA 4PKYG 3FPWA 2E8JA 2OSUA 3S7PA 1O7EA 4MN7A 4ZBEA 2B18A 4EBLA 4GCZA 4ARZA 4I38A 4P6ZM 3Q7ZA 1NYYA 1OT6A 4OOYA 1TEMA 2JKTM 3NJAA 3L9KA 3QP2A 1ZHHB 2XRNA 3IF6C 3ZCZA 3P7NA 3CI6A 3G6OA 2KOIA 1I5QA 4JXVA 4ZDXA 5F82A 1S0WA 2ZD8A 2JBFA 4QU3A 4X69A 1PW1A 2ZBBA 1LL5A 2WKQA 1FOFA 3UPNA 4PPRA 3E2LA 3G34A 3O3VA 1UWNX 5HFOA 1AWIA 4MBFA 3V5MA 4JXWA 3BECA 3CPTA 3SH7A 4Y17A 3VFFA 3KSHA 1W63M 2YKFA 3LY3A 5BOHA 4HBTA 2XD1A 4I3AA 3MR0A 3PBRA 4KUKA 3FV7A 4K0XA 3SZTA 5A8BA 2R9WA 5FQIA 1H8MA 1STZA 4EETB 2Y55A 1FR1A 4WELA 4LCMA 4YNRA 1UWPX 3O5YA 4OPZA 3RH8B 5A92A 3C5AA 1SDNA 3IHAA 5J7EA 1MWTA 3NBLA 3MXSA 4NKPA 2WGWB 3CZDA 5CGXA 1DJCA 2GX5A 3VV4A 1JTDA 3VP3A 4OP8A 3NY4A 3LIAA 3BFDA 4D60A 4XT2B 1MKMA 1Z6FA 5CHMA 3QP8A 3ICYA 3WWXA 2Y2QA 1ACFA 3MS6A 3E4PA 2PYRA 5FSRA 1WA9A 3UB7A 1NZOA 2BASA 1BSGA 4HEFA 4MCWA 2M7VA 3VOYA 1KVMA 2J9PA 5J8XA 4OONA 3C38A 3LYXA 3OPPA 2GZAA 4ZTKA 5IU1A 2J3WA 5JYPA 1T1AA 4DXCA 1N4OA 2QPNA 4O8GA 3UMDA 3O88A 3D3OA 3F1PA 2ZL1A 4KZ8A 3DTIA 5F1FA 4KQOA 4P0MA 3NIAA 2RCXA 3HLGA 2KDKA 1L0DA 2ZMFA 2W0NA 1U60A 5HZHA 3LIEA 3G2ZA 4N92A 4IHQA 3VP2A 3CLOA 4B88A 3T12B 4GKUA 1TDGA 3UN7A 1ESIA 3GQZA 3Q81A 2JHEA 3Q7VA 3VSKA 1P9WA 1SDEA 4WEKA 4GW9A 4BBVA 2O9CA 1ES3A 4FOFA 3K3DA 1GSWA 1N9LA 3MZEA 3BRMA 2Z2MB 1DP9A 2A2LA 1JTGA 2K31A 3BW6A 4DMZA 1YAXA 4YINA 3KYEA 1DP8A 2X01A 3FKVA 3IH9A 3O86A 3PBTA 3D4FA 4PHTA 1HD8A 3VOZA 4R1GA 4MMNA 4LRYC 2C6WB 4I5SA 3PBQA 4ZJ3A 5M18A 3DBAA 2ZM2A 2CC1A 2ZQAA 4Y15A 1LLBA 5HDCA 3WS4A 5HWWA 3JYIA 5CTNA 3A3FA 4BBUA 2XFTA 3Q82A 4KZ3A 3ZG5A 1F9IA 1LSVA 1BUEA 3PTEA 2ZL1B 3T50A 2V9AA 4KZ6A 2V1ZA 3NOPC 5FL3A 1KE4A 2Y2NA 4X1LA 4PM9A 3HJKA 4OVDA 3N8RA 2OLVA 3NOTC 1T19A 2B5RA 3TOIA 3LUQA 1XFNA 4GD6A 3UB5P 1OTEA 4NK3A 3ZGAB 2ZC7A 4OP5A 5DFYA 3TE8A 4KZBA 2XA7M 4X56A 5E2EA 2Q9MA 4KZ4A 2A49A 5F5YA 4GHIB 4FH4A 4R23A 5IT5A 1N9NA 3MSHA 3R7WB 3A3JA 3HREA 4Q0HA 1W8QA 4JF6A 4YFMA 5TGFA 5KIZA 4P87A 2HDRA 3E4QA 5FI7A 1VETB 4GB7A 3NDEA 2V0UA 4QJGA 1JWPA 3F1PB 1SKFA 4KG2A 5L8MA 1WE4A 3IF6A 4JXSA 1UGUA 3C7VA 2J8YA 4WZ4A 2HV1A 3H7WA 4O0PA 4B93A 4BL3A 2JKRI 3ZYTA 1GA0A 4OQHA 3U2AA 3NULA 3UMEA 5EPHA 3EQUA 1A0KA 4OPQA 3HLFA 1SCWA 2P9VB 4M4XA 2B02A 2KX6A 3N7WA 3QP1A 3VP4A 4B4ZA 1P0ZA 2GDNA 1E3UA 2JCHA 1S1YA 1N9BA 3GMWA 3B42A 4RA7A 2QJ7A 1H3QA 3UB6A 5JYOA 3F1NB 3MQQA 3NI9A 4KZ5A 2J9OA 2ZLYA 3SH8A 4DE0A 3LI9A 5HAIA 4I3JA 2WKEA 1S1ZA 4IJGA 3IS2A 2PD8A 2RL3A 4HOIA 4X6TA 4BWIA 2ZOHA 1EWZA 3IT9A 4BENA 1XJ2A 2QJ5A 3VP0A 1SZVA 1YLTA 3IXHA 4JGRA 1MPLA 1F98A 3BLSA 4EBNA 4LENA 4E3OA 1PIOA 4OH0A 1C3BA 2PT7A 5HARA 2M1CA 5FI2A 3LO7A 5IHVA 3LFVA 4EBPA 4Q8IA 5HDDA 1K57C 2XH9A 1G6OA 1OTAA 2DNSA 3QP4A 2H0TA 2EX8A 3MKFA 5F1GA 2IWBA 4WYYA 4CPKA 2V8CA 1MBLA 1G28A 4RVAA 3M6HA 4XT2A 2X02A 4L9EA 1E3UD 1K55C 2V8FA 4N1HA 3EGXC 3ZG7B 2HP5A 3H7WB 4F3LB 1V9YA 3MJQA 5KMWA 2VV8A 3E2KA 4OLDA 1D1JA 1W7FA 2VJWA 5HL6A 2G2UA 5J4EA 2WK0A 1PW8A 1SKOB 1NWZA 4OLGA 3N6IA 4EW7A 1ES2A 4U0XA 2NUTC 3H82B 3G30A 4KZAA 2FH5A 1PZOA 4AFIA 4H6JA 4S2JA 2V1BA 2XDMA 3UY6A 2EX9A 2EFXA 1NJ4A 3P01A 5FI6A 1Y28A 4UHUA 3G4PA 2XD5A 3AGEA 3KO6A 5HWTA 2Y2OA 1VETA 4R4SA 2XEPA 4UA7A 3W4QA 2W3DA 1DRMA 3ZVTA 2PRFA 3B47A 5J3WA 2QMIA 2Y2KA 3V39A 4U3TA 5G4ZA 2H28A 1XGJA 1K54A 4ZAMA 4I39A 1YLYA 4DE3A 3I7JA 2ZQDA 3W4PA 1ALQA 2OV5A 1W79A 1MWUA 3HUMA 4WF0A 2L0WA 3ZNTA 1ESUA 3NECA 4GDBA 2I72A 5LBRA 3UB9A 4HH2A 5L10A 3KYQA 3TSGA 1BTLA 5DKKA 5GLDA 2O9AA 1HZOA 2V2FF 4H8RA 4R38A 1T18A 1L0EA 1NYMA 1O07A 2CMNA 1OT9A 4QY5A 4E04A 2FFFB 5DTSA 5DF7A 3UDXA 4KQQA 3LICA 5M19A 3ZVWA 2VKSA 1H0MA 1SHVA 2DRWA 1PWDA 2VV7A 3T1RA 2A24B 4ETZA 1NRJA 4FTXA 3FYZA 3MMHA 1YT4A 4Q0JA 2P04A 1BZAA 1P97A 1CQAA 2W27A 5HD3A 2Q9NA 1TS8A 3CMZA 1IYQA 4ETXA 4EEUA 1VB6A 5FAPA 4GJ4A 1ERMA 3CPTB 2O99A 2XFSA 1LHYA 4WM9A 2ZM0A 1XA7A 4MLLA 2R9XA 2GNXA 5FAOA 5KZHA 3A0RA 1AXBA 2D01A 4R6LA 1OTIA 5DVAA 2PR5A 3MZFA 3GRJA 2EX6A 4OQGA 1XJ3A 2O9BA 3ZQ5A 2H10A 2XF3A 4PKYA 2UWXA 3S7NA 3EQVA 1K57A 1E25A 4PM5A 4GS9A 5CX7A 4L0LA 2QHKA 2LB9A 4R70A 4HBUA 1S6RA 3S7QA 4GZBA 1FIKA 4R4RA 5U47A 1MZUA 2EA9A 2WGWA 4IVIA 2XLNA 4HJ3A 1IFQA 1YMSA 4LRZE 3VE4A 1W63Q 1W8YA 4IUHA 4PAUA 3G2YA 2G7UA 4O01A 2V0WA 4JGQA 1LI0A 1XJ4A 3OC2A 1YLPA 5I94A 1FCOA 2VGKA 1KE3A 3A3DA 3ZG8B 2HDSA 4IEDA 4LV2A 2JKTI 5F83A 2J3TC 3IH8A 4KG5A 4Y13A 3IF5A 2J3TD 2HP9A 5F69A 1H8YA 1VEUA 3CJMA 2OWHA 3WRTA 3A3EA 5KSCA 2PBDP 3DWKA 5CEDA 3EGDC 3LEZA 1CF0A 1CK3A 5HWVA 2VGLS 3BQ8A 4Z1WA 4LLOB 3PHYA 1YQSA 2H0YA 2Y59A 5HW3A 5L2FA 4UQIM 4ZRRA 3HLCA 1HVBA 1P9RA 1H8ZA 3CG5A 3BJNA 3S22A 3LIFA 4G3WA 4HY8A 4NG2A 5GHZA 4HQAA 2ZC4B 3T4TA 1K6SA 1CJFA 2WGIA 4C3QA 2C5WB 2VV6A 2EFUA 4LV0A 4B4XA 3LEQA 1K38A 1PRQA 1BLHA 3A3IA 3K2NA 1QMEA 4PMAA 5FQ9A 1T1BA 3VOLA 4Y0TA 1TS7A 1VQQA 4WN5A 2Y2IA 1LSWA 1K4EA 4P6ZS 4YOFA 3CHWP 3CAXA 4F3LA 5IS1A 5G4YA 4WL9A 5D3OA 2H5SA 3C8CA 1D06A 4LFUA 1EROA 4XUZA 4E3MA 5CHJA 4WMCD 4CLCD 5L07A 3A0SA 1KGGA 5FDSA 1XA1A 2Y2PA 2W1RA 1NRFA 4FUWA 3LCEA 2EXAA 1LL8A 2WADA 5FQMA 1DJAA 3IF6B 1OJGA 3PR6A 4ESPA 2Z6DA 1GHPA 3T4JA 4EU0A 4JF4A 4CJNA 3UPPA 3N8LA 1BT5A 4EQIA 4NEED 4JKTA 1RCJA 4II7A 2ACGA 1XXMA 3AGDA 4MN5A 1K6RA 3CUEC 3ISGA 4OKPA 5GHYA 5EOEA 3IQAA 2HGVA 3IXBA 3HUNA 5K5BA 5EVEA 1XGIA 4Y2FA 3KX0X 3P98A 4KQRA 2O0YA 2OLUA 3V3SA 5DJUA 3VFHA 2Y2GA 3BY8A 4R0QA 1NZUA 1E4DA 3VE3A 4OPRA 2HF6A 5CGWA 1ES5A 5FQQA 4Y0OA 3JVUA 3CWFA 1L0GA 1BLPA 4KZ7A 4GLQA 3B33A 1IKIA 4KENB 3NDGA 4NXBA 2G2WA 4Q0IA 4FD8A 4S2KA 3HVFA 2HZ5A 1OPXA 3HLEA 3S7OA 5E43A 5EVLA 5EVIC 4RQ9A 5EVID 2BG1A 3T4QA 4OQ0A 5A90A 1EW0A 3Q07A 3RJUA 4YWZA 4ID4A 2Y2HA 3EWKA 4JGOA 1ZG4A 4NXFA 1I2SA 4DE2A 2WKPA 3DTKA 5DJTA 1OTBA 1HLUP 4X1MA 4DF6A 3SS3A 4X55A 1FSYA 3LI8A 4N1XA 4BJPA 5AQ9A 2WYXA 2XR0A 1GCEA 2W3GA 3C2WA 5EVIB 4A5RA 3MZDA 4PM7A 2VEAA 4QWOA 4HJ6A 5MC7A 1KDWA 3P09A 5HAPA 2W1TA 3HLWA 5M1AA 5FDHA 2P08A 3IS2B 1FR6A 4DJ2A 2PBYA 3OBFA 3C30A 2JN7A 1FSWA 2QYBA 3M6BA 5AQAA 2PHYA 5TFQA 2ZC3B 2W3EA 1S66L 4EQ1A 2HDUA 3PYPA 3ZHHA 1DY6A 3IX8A 1CEFA 3ZFZA 2PDRA 5TBMB 2W3FA 5CTMA 3ITAA 1Y4OA
chains in the Genus database with same CATH topology
3PBNA 3G2ZA 1XX2A 3NCKA 3ZG9B 5CEBA 4N92A 3WS2A 4JF5A 3VP2A 1BZAA 4B88A 4GKUA 1TDGA 3BFEA 1K55A 4PM8A 1ESIA 3BEBA 3UN7A 3UDIA 3UNWA 3GQZA 2Q9NA 3CMZA 3Q81A 3Q7VA 4FSFA 3VSKA 1IYQA 3N4IA 5HAQA 3OCNA 5FAPA 3ZNYA 1SDEA 1ERMA 4WEKA 1VM1A 4PM6A 4LV1A 5TR7A 1J9MA 2XFSA 3BFFA 3BYDA 4P6BA 1LHYA 5FATA 1MWRA 5CECA 4WM9A 2ZM0A 3OPHA 2WZXA 1XA7A 1ES3A 4MLLA 1WYBA 1MKIA 2BLSA 2R9XA 2WAEA 3PAGA 4S2PA 5FAOA 5KZHA 4P85A 5GL9A 2JC7A 1W5DA 3MZEA 1AXBA 1PI5A 1XP4A 5DVAA 2WAFA 5E2HA 1L2SA 1BLCA 3BRMA 3GRJA 3MZFA 2EX6A 4OQGA 3OPRA 2Z2MB 2H10A 3TG9A 4S2OA 4S2MA 2XF3A 1ONHA 3C4PA 2UWXA 1PWGA 1JTGA 1IEMA 3EQVA 1K57A 1E25A 1KVLA 4YINA 3IWOA 5AQ7A 4E3LA 4PM5A 2X01A 1BULA 3G32A 4E3IA 5EVIA 3FKVA 1GHMA 3HL9A 2Y4AA 2P74A 5EUAA 3IH9A 3O86A 4L0LA 4BLMA 3V50A 3PBTA 3D4FA 5DF8A 3UE1A 4FH2A 4IVKA 1HD8A 3VOZA 4R1GA 4EWFA 2C6WB 4HBUA 1S6RA 3PBQA 4ZJ3A 3WS1A 5M18A 3NC8A 4WMCA 4ZJ2A 4OOLA 4UA9A 2ZM2A 2CC1A 2ZQAA 1KGEA 1LLBA 1WYCA 1MXOA 4GZBA 3FKWA 1RGYA 5EOOA 3WS0A 5GHXA 1HTZA 4R4RA 3WS4A 3JYIA 1Y54A 1CI9A 5U47A 4XUXA 1G6AA 5CTNA 3A3FA 3LY4A 3MFDA 4EV4A 2XFTA 2WGWA 3Q82A 4KZ3A 4IVIA 4WBGA 2XLNA 3GV9A 3M2JA 3ZG5A 2E8IA 1GHIA 3QNBA 5CERA 1G68A 1BUEA 4DKIA 1LL9A 3PTEA 5AQBA 3WS5A 1YMSA 3GTCA 1W8YA 5E2GA 3G2YA 1K4FA 3GVBA 1ZC2A 4KZ9A 1ZKJA 4KZ6A 4E3KA 4DXBA 2V1ZA 1IYPA 4Z9QA 1KE4A 4GD8A 2Y2NA 1LI0A 1JWZA 3HUOA 3OC2A 1YLPA 4PM9A 4OVDA 5I94A 3N8RA 2X71A 1FCOA 2VGKA 5GLAA 2OLVA 3OCLA 1KE3A 3A3DA 5GLBA 3UDFA 2HDSA 3ZG8B 3FWLA 4O7DA 3S1YA 4S2NC 2B5RA 1LI9A 4IEDA 4LV2A 5HX9A 4RYEA 5F83A 1YLWA 3S4XA 3IH8A 4KG5A 5GLCA 4IBXA 3TOIA 1Q2QA 3IF5A 4GD6A 4Y7PA 3Q7VB 4NK3A 1FQGA 2HP9A 3ZGAB 1H8YA 2ZC7A 3CJMA 4OP5A 3WRTA 3RXWA 3A3EA 4KZBA 5KSCA 4K0WA 4N9LA 4X56A 5E2EA 3DWKA 3DW0A 1NXYA 5CEDA 2Q9MA 3AGFA 3BFGA 3BLMA 2A49A 3LEZA 1FCNA 3PAEA 1CK3A 4KZ4A 2ZQ7A 4FH4A 4WZ5A 5FA7A 4E6XA 4R3JA 3VP1A 4X53A 4R23A 1MY8A 4F94A 3W4OA 3BFCA 1YQSA 2H0YA 3A3JA 3HREA 2Y59A 1W8QA 5HW3A 5L2FA 3HLCA 4JF6A 4YFMA 1HVBA 3QHYA 5TGFA 4DE1A 1H8ZA 3CG5A 4P87A 5FAQA 3S22A 2HDRA 5FI7A 3IWQA 4GB7A 2HPBA 3NDEA 2DCFA 1JWVA 3HLDA 4QJGA 1JWPA 1OMEA 3C4OA 1TVFA 5GHZA 2IWDA 3Q1FA 1SKFA 1ZG6A 4NETA 1PWCA 3SS4A 2ZC4B 4KG2A 1Q2PA 4JLFA 1K6SA 1WE4A 3VSLA 3IF6A 3ZG0A 2WGIA 4JXSA 4C3QA 4GNUA 2C5WB 5FQKA 4LV0A 2EFUA 3C7VA 3ITBA 4B4XA 1K38A 2J8YA 4JBFA 4WZ4A 1BLHA 1K56A 2XGNA 1RP5A 3A3IA 4GDNA 1QMEA 4BL3A 3PBSA 1GA0A 5DTKA 1RGZA 1NY0A 2ZC5B 4OQHA 4PMAA 5FQJA 2Y2LA 3V3RA 5FQ9A 3G31A 2FFYA 5A91A 5CRFA 3EQUA 5EPHA 5EECA 4Y0TA 4OPQA 1VQQA 3HLFA 3RXXA 1PYYA 1SCWA 1I2WA 2P9VB 4DDYA 3IHBA 2Y2IA 3N8SA 3IXGA 4BD1A 1K4EA 1YM1A 5FASA 3N7WA 4M3KA 3VP4A 4B4ZA 2ZC6B 1YLZA 2GDNA 5D3OA 2H5SA 4LCLA 4E3NA 1E3UA 1IKGA 2JCHA 3DTMA 4QB8A 1YMXA 3SH9A 1EROA 1N9BA 3GMWA 2WZZA 4XUZA 4E3MA 4RA7A 5CHJA 2JE5A 4WMCD 3MBZA 5A93A 3W8KA 5JYOA 5KSHA 3NI9A 4KZ5A 5G18A 2WKIA 1KGGA 1XA1A 2Y2PA 2J9OA 2ZLYA 1XKZA 1H5XA 2PU4A 2VGJA 3SH8A 1NRFA 4DE0A 2HDQA 5EE8A 4QHCA 4FCFA 5HAIA 2WKEA 4S2IA 1K54C 2XK1A 4K91A 3LCEA 2EXAA 2WADA 2RL3A 3MKEA 5FQMA 2ZQ8A 4X6TA 1EI5A 1DJAA 2ZMAA 3IF6B 1EWZA 3IT9A 4BENA 4BQMA 1GHPA 3VP0A 4MBHA 3ZDJA 1IELA 4X68A 1YLTA 1ES4A 5CXWA 3SS5A 3IWIA 3IXHA 1M40A 4JPMA 4JF4A 4CJNA 1MPLA 3N8LA 3UPPA 1YLJA 3BLSA 4EBNA 1K56D 4LENA 1BT5A 1PIOA 5CGSA 4E3OA 4OH0A 1C3BA 4EQIA 5HARA 2XQZA 2V20A 2Y2JA 4JKTA 5FI2A 3LO7A 5IHVA 1RCJA 5CHUA 2WUQA 2WKHA 4QD4A 4DRTA 4EBPA 3UE3A 4Q8IA 1K57C 3IXDA 2XH9A 2DNSA 1XXMA 4S2NA 3AGDA 2A3UA 1K6RA 2H0TA 3ISGA 2EX8A 4MNRA 3MKFA 4OKPA 5GHYA 5EOEA 2Z2LB 5F1GA 2IWBA 3IQAA 4WYYA 3UO9A 4OOMA 4CPKA 1MBLA 4RVAA 3IXBA 3HUNA 3M6HA 2OSUA 1K25A 1XGIA 1PI4A 1O7EA 2X02A 3P98A 3MXRA 4KQRA 4ZBEA 4EBLA 2HP6A 2OLUA 1E3UD 4JXGA 3OZHA 1IYSA 3Q7ZA 1NYYA 2PU2A 4XXRA 3V3SA 3VFHA 4OOYA 1K55C 1TEMA 2Y2GA 4N1HA 4R0QA 3ZG7B 4ZDXA 2HP5A 4DDSA 5E2FA 1NZUA 1E4DA 3QNCA 3HBRA 3IF6C 4OPRA 3ZCZA 3FZCA 5CGWA 1ES5A 1I5QA 4JXVA 2J7VA 3GR2A 3M2KA 4Y0OA 5F82A 5FQQA 1S0WA 1KDSA 2ZD8A 4S2LA 5KMWA 3HLBA 2ZJ9A 3E2KA 4OLDA 2P9VA 3DWZA 2JBFA 1W7FA 2G2UA 4QU3A 1BLPA 1IYOA 2WK0A 1L0GA 1M6KA 4KZ7A 1PW1A 1PW8A 4X69A 4OLGA 4GN2A 4E3JA 3N6IA 1IKIA 1LL5A 4IBRA 4KENB 1FOFA 1QMFA 3NDGA 1ES2A 3C7UA 5DF9A 3UPNA 4U0XA 4PPRA 1DJBA 3O87A 3E2LA 2G2WA 5DTTA 3G30A 4KZAA 4FD8A 3UE0A 3G34A 4S2KA 3B3XA 4WZ5C 3O3VA 1PZOA 3HVFA 4MBKA 4S2JA 5HFOA 2XDMA 4MBFA 3HLEA 1L0FA 3UY6A 2EX9A 2EFXA 1NJ4A 5E43A 5EVLA 5FI6A 5EVIC 3GSGA 1CI8A 3PBOA 4R3BA 3G4PA 4UHUA 3V5MA 5HL1A 4JXWA 2XD5A 3AGEA 4ZJ1A 4EUZA 3BECA 4UAAA 5EVID 2BG1A 3SH7A 3VFFA 2Y2OA 4OQ0A 4R4SA 3LY3A 2ZQCA 5BOHA 5A90A 4HBTA 2XEPA 4UA7A 2XD1A 3W4QA 3PBRA 1CEGA 1XPBA 3UPOA 3FV7A 4K0XA 3ZVTA 1FCMA 2R9WA 5FQIA 3Q07A 2Y55A 3RJUA 1FR1A 4WELA 4LCMA 2QMIA 2Y2KA 1KE0A 4E6WA 3V39A 4ID4A 4U3TA 3BM6A 2Y2HA 4OQIA 2ZM8A 4OPZA 5A92A 1BLSA 1SDNA 3C5AA 1XGJA 1ZG4A 3IHAA 1K54A 2QZ6A 1I2SA 2Y91A 1MWTA 1ONGA 4DE2A 1TDLA 4LV3A 2WGVA 4ZAMA 1YLYA 3NBLA 4DE3A 3MXSA 3VMAA 2WGWB 3CZDA 5CGXA 4N9KA 1DJCA 3I7JA 2ZQDA 3W4PA 1JTDA 3VP3A 4U0TA 4OP8A 1ALQA 2OV5A 1W79A 1MWUA 3NY4A 4DF6A 4WEJA 3SS3A 3BFDA 1PZPA 4X55A 3HUMA 1Z6FA 4KG6A 5CHMA 1FSYA 3G35A 1MWSA 3WRZA 4N1XA 3ZNTA 4BJPA 5AQ9A 1ESUA 3WWXA 4GDBA 2EXBA 2WYXA 2Y2QA 2I72A 2XR0A 1GCEA 5EVIB 3TSGA 4A5RA 3MZDA 4OPYA 1BTLA 4PM7A 5FSRA 1NZOA 4MEZA 5GLDA 1BSGA 1KDWA 3P09A 3OPLA 4HEFA 3VOYA 5HAPA 1HZOA 1KVMA 3HLWA 2V2FF 2J9PA 5J8XA 5M1AA 4OONA 4H8RA 4RX3A 5FDHA 1JVJA 4UA6A 1FR6A 3SOIA 2PBYA 4RX2A 1KGFA 1L0EA 4D2OA 2EX2A 3OPPA 1FSWA 4BL2A 4ZTKA 3M6BA 1NYMA 5AQAA 1O07A 4C6YA 5JYPA 4HESA 4Y0UA 4DXCA 1N4OA 4QY5A 5TFQA 2ZC3B 2QPNA 2FFFB 3O88A 5DTSA 5DF7A 3UDXA 2HDUA 4KQQA 5M19A 3ZVWA 3ZHHA 1DY6A 4KZ8A 4GOGA 5F1FA 4KQOA 1SHVA 2DRWA 1PWDA 4P0MA 1GA9A 2Y2MA 4C75A 1CEFA 3ZFZA 3NIAA 2ZQ9A 2RCXA 4BD0A 3HLGA 5CTMA 3FYZA 2IWCA 1L0DA 3ITAA 1YT4A 4QY6A 1ERQA 1U60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PBN A;  3G2Z A;  1XX2 A;  3NCK A;  3ZG9 B;  5CEB A;  4N92 A;  3WS2 A;  4JF5 A;  3VP2 A;  1BZA A;  4B88 A;  4GKU A;  1TDG A;  3BFE A;  1K55 A;  4PM8 A;  1ESI A;  3BEB A;  3UN7 A;  3UDI A;  3UNW A;  3GQZ A;  2Q9N A;  3CMZ A;  3Q81 A;  3Q7V A;  4FSF A;  3VSK A;  1IYQ A;  3N4I A;  5HAQ A;  3OCN A;  5FAP A;  3ZNY A;  1SDE A;  1ERM A;  4WEK A;  1VM1 A;  4PM6 A;  4LV1 A;  5TR7 A;  1J9M A;  2XFS A;  3BFF A;  3BYD A;  4P6B A;  1LHY A;  5FAT A;  1MWR A;  5CEC A;  4WM9 A;  2ZM0 A;  3OPH A;  2WZX A;  1XA7 A;  1ES3 A;  4MLL A;  1WYB A;  1MKI A;  2BLS A;  2R9X A;  2WAE A;  3PAG A;  4S2P A;  5FAO A;  5KZH A;  4P85 A;  5GL9 A;  2JC7 A;  1W5D A;  3MZE A;  1AXB A;  1PI5 A;  1XP4 A;  5DVA A;  2WAF A;  5E2H A;  1L2S A;  1BLC A;  3BRM A;  3GRJ A;  3MZF A;  2EX6 A;  4OQG A;  3OPR A;  2Z2M B;  2H10 A;  3TG9 A;  4S2O A;  4S2M A;  2XF3 A;  1ONH A;  3C4P A;  2UWX A;  1PWG A;  1JTG A;  1IEM A;  3EQV A;  1K57 A;  1E25 A;  1KVL A;  4YIN A;  3IWO A;  5AQ7 A;  4E3L A;  4PM5 A;  2X01 A;  1BUL A;  3G32 A;  4E3I A;  5EVI A;  3FKV A;  1GHM A;  3HL9 A;  2Y4A A;  2P74 A;  5EUA A;  3IH9 A;  3O86 A;  4L0L A;  4BLM A;  3V50 A;  3PBT A;  3D4F A;  5DF8 A;  3UE1 A;  4FH2 A;  4IVK A;  1HD8 A;  3VOZ A;  4R1G A;  4EWF A;  2C6W B;  4HBU A;  1S6R A;  3PBQ A;  4ZJ3 A;  3WS1 A;  5M18 A;  3NC8 A;  4WMC A;  4ZJ2 A;  4OOL A;  4UA9 A;  2ZM2 A;  2CC1 A;  2ZQA A;  1KGE A;  1LLB A;  1WYC A;  1MXO A;  4GZB A;  3FKW A;  1RGY A;  5EOO A;  3WS0 A;  5GHX A;  1HTZ A;  4R4R A;  3WS4 A;  3JYI A;  1Y54 A;  1CI9 A;  5U47 A;  4XUX A;  1G6A A;  5CTN A;  3A3F A;  3LY4 A;  3MFD A;  4EV4 A;  2XFT A;  2WGW A;  3Q82 A;  4KZ3 A;  4IVI A;  4WBG A;  2XLN A;  3GV9 A;  3M2J A;  3ZG5 A;  2E8I A;  1GHI A;  3QNB A;  5CER A;  1G68 A;  1BUE A;  4DKI A;  1LL9 A;  3PTE A;  5AQB A;  3WS5 A;  1YMS A;  3GTC A;  1W8Y A;  5E2G A;  3G2Y A;  1K4F A;  3GVB A;  1ZC2 A;  4KZ9 A;  1ZKJ A;  4KZ6 A;  4E3K A;  4DXB A;  2V1Z A;  1IYP A;  4Z9Q A;  1KE4 A;  4GD8 A;  2Y2N A;  1LI0 A;  1JWZ A;  3HUO A;  3OC2 A;  1YLP A;  4PM9 A;  4OVD A;  5I94 A;  3N8R A;  2X71 A;  1FCO A;  2VGK A;  5GLA A;  2OLV A;  3OCL A;  1KE3 A;  3A3D A;  5GLB A;  3UDF A;  2HDS A;  3ZG8 B;  3FWL A;  4O7D A;  3S1Y A;  4S2N C;  2B5R A;  1LI9 A;  4IED A;  4LV2 A;  5HX9 A;  4RYE A;  5F83 A;  1YLW A;  3S4X A;  3IH8 A;  4KG5 A;  5GLC A;  4IBX A;  3TOI A;  1Q2Q A;  3IF5 A;  4GD6 A;  4Y7P A;  3Q7V B;  4NK3 A;  1FQG A;  2HP9 A;  3ZGA B;  1H8Y A;  2ZC7 A;  3CJM A;  4OP5 A;  3WRT A;  3RXW A;  3A3E A;  4KZB A;  5KSC A;  4K0W A;  4N9L A;  4X56 A;  5E2E A;  3DWK A;  3DW0 A;  1NXY A;  5CED A;  2Q9M A;  3AGF A;  3BFG A;  3BLM A;  2A49 A;  3LEZ A;  1FCN A;  3PAE A;  1CK3 A;  4KZ4 A;  2ZQ7 A;  4FH4 A;  4WZ5 A;  5FA7 A;  4E6X A;  4R3J A;  3VP1 A;  4X53 A;  4R23 A;  1MY8 A;  4F94 A;  3W4O A;  3BFC A;  1YQS A;  2H0Y A;  3A3J A;  3HRE A;  2Y59 A;  1W8Q A;  5HW3 A;  5L2F A;  3HLC A;  4JF6 A;  4YFM A;  1HVB A;  3QHY A;  5TGF A;  4DE1 A;  1H8Z A;  3CG5 A;  4P87 A;  5FAQ A;  3S22 A;  2HDR A;  5FI7 A;  3IWQ A;  4GB7 A;  2HPB A;  3NDE A;  2DCF A;  1JWV A;  3HLD A;  4QJG A;  1JWP A;  1OME A;  3C4O A;  1TVF A;  5GHZ A;  2IWD A;  3Q1F A;  1SKF A;  1ZG6 A;  4NET A;  1PWC A;  3SS4 A;  2ZC4 B;  4KG2 A;  1Q2P A;  4JLF A;  1K6S A;  1WE4 A;  3VSL A;  3IF6 A;  3ZG0 A;  2WGI A;  4JXS A;  4C3Q A;  4GNU A;  2C5W B;  5FQK A;  4LV0 A;  2EFU A;  3C7V A;  3ITB A;  4B4X A;  1K38 A;  2J8Y A;  4JBF A;  4WZ4 A;  1BLH A;  1K56 A;  2XGN A;  1RP5 A;  3A3I A;  4GDN A;  1QME A;  4BL3 A;  3PBS A;  1GA0 A;  5DTK A;  1RGZ A;  1NY0 A;  2ZC5 B;  4OQH A;  4PMA A;  5FQJ A;  2Y2L A;  3V3R A;  5FQ9 A;  3G31 A;  2FFY A;  5A91 A;  5CRF A;  3EQU A;  5EPH A;  5EEC A;  4Y0T A;  4OPQ A;  1VQQ A;  3HLF A;  3RXX A;  1PYY A;  1SCW A;  1I2W A;  2P9V B;  4DDY A;  3IHB A;  2Y2I A;  3N8S A;  3IXG A;  4BD1 A;  1K4E A;  1YM1 A;  5FAS A;  3N7W A;  4M3K A;  3VP4 A;  4B4Z A;  2ZC6 B;  1YLZ A;  2GDN A;  5D3O A;  2H5S A;  4LCL A;  4E3N A;  1E3U A;  1IKG A;  2JCH A;  3DTM A;  4QB8 A;  1YMX A;  3SH9 A;  1ERO A;  1N9B A;  3GMW A;  2WZZ A;  4XUZ A;  4E3M A;  4RA7 A;  5CHJ A;  2JE5 A;  4WMC D;  3MBZ A;  5A93 A;  3W8K A;  5JYO A;  5KSH A;  3NI9 A;  4KZ5 A;  5G18 A;  2WKI A;  1KGG A;  1XA1 A;  2Y2P A;  2J9O A;  2ZLY A;  1XKZ A;  1H5X A;  2PU4 A;  2VGJ A;  3SH8 A;  1NRF A;  4DE0 A;  2HDQ A;  5EE8 A;  4QHC A;  4FCF A;  5HAI A;  2WKE A;  4S2I A;  1K54 C;  2XK1 A;  4K91 A;  3LCE A;  2EXA A;  2WAD A;  2RL3 A;  3MKE A;  5FQM A;  2ZQ8 A;  4X6T A;  1EI5 A;  1DJA A;  2ZMA A;  3IF6 B;  1EWZ A;  3IT9 A;  4BEN A;  4BQM A;  1GHP A;  3VP0 A;  4MBH A;  3ZDJ A;  1IEL A;  4X68 A;  1YLT A;  1ES4 A;  5CXW A;  3SS5 A;  3IWI A;  3IXH A;  1M40 A;  4JPM A;  4JF4 A;  4CJN A;  1MPL A;  3N8L A;  3UPP A;  1YLJ A;  3BLS A;  4EBN A;  1K56 D;  4LEN A;  1BT5 A;  1PIO A;  5CGS A;  4E3O A;  4OH0 A;  1C3B A;  4EQI A;  5HAR A;  2XQZ A;  2V20 A;  2Y2J A;  4JKT A;  5FI2 A;  3LO7 A;  5IHV A;  1RCJ A;  5CHU A;  2WUQ A;  2WKH A;  4QD4 A;  4DRT A;  4EBP A;  3UE3 A;  4Q8I A;  1K57 C;  3IXD A;  2XH9 A;  2DNS A;  1XXM A;  4S2N A;  3AGD A;  2A3U A;  1K6R A;  2H0T A;  3ISG A;  2EX8 A;  4MNR A;  3MKF A;  4OKP A;  5GHY A;  5EOE A;  2Z2L B;  5F1G A;  2IWB A;  3IQA A;  4WYY A;  3UO9 A;  4OOM A;  4CPK A;  1MBL A;  4RVA A;  3IXB A;  3HUN A;  3M6H A;  2OSU A;  1K25 A;  1XGI A;  1PI4 A;  1O7E A;  2X02 A;  3P98 A;  3MXR A;  4KQR A;  4ZBE A;  4EBL A;  2HP6 A;  2OLU A;  1E3U D;  4JXG A;  3OZH A;  1IYS A;  3Q7Z A;  1NYY A;  2PU2 A;  4XXR A;  3V3S A;  3VFH A;  4OOY A;  1K55 C;  1TEM A;  2Y2G A;  4N1H A;  4R0Q A;  3ZG7 B;  4ZDX A;  2HP5 A;  4DDS A;  5E2F A;  1NZU A;  1E4D A;  3QNC A;  3HBR A;  3IF6 C;  4OPR A;  3ZCZ A;  3FZC A;  5CGW A;  1ES5 A;  1I5Q A;  4JXV A;  2J7V A;  3GR2 A;  3M2K A;  4Y0O A;  5F82 A;  5FQQ A;  1S0W A;  1KDS A;  2ZD8 A;  4S2L A;  5KMW A;  3HLB A;  2ZJ9 A;  3E2K A;  4OLD A;  2P9V A;  3DWZ A;  2JBF A;  1W7F A;  2G2U A;  4QU3 A;  1BLP A;  1IYO A;  2WK0 A;  1L0G A;  1M6K A;  4KZ7 A;  1PW1 A;  1PW8 A;  4X69 A;  4OLG A;  4GN2 A;  4E3J A;  3N6I A;  1IKI A;  1LL5 A;  4IBR A;  4KEN B;  1FOF A;  1QMF A;  3NDG A;  1ES2 A;  3C7U A;  5DF9 A;  3UPN A;  4U0X A;  4PPR A;  1DJB A;  3O87 A;  3E2L A;  2G2W A;  5DTT A;  3G30 A;  4KZA A;  4FD8 A;  3UE0 A;  3G34 A;  4S2K A;  3B3X A;  4WZ5 C;  3O3V A;  1PZO A;  3HVF A;  4MBK A;  4S2J A;  5HFO A;  2XDM A;  4MBF A;  3HLE A;  1L0F A;  3UY6 A;  2EX9 A;  2EFX A;  1NJ4 A;  5E43 A;  5EVL A;  5FI6 A;  5EVI C;  3GSG A;  1CI8 A;  3PBO A;  4R3B A;  3G4P A;  4UHU A;  3V5M A;  5HL1 A;  4JXW A;  2XD5 A;  3AGE A;  4ZJ1 A;  4EUZ A;  3BEC A;  4UAA A;  5EVI D;  2BG1 A;  3SH7 A;  3VFF A;  2Y2O A;  4OQ0 A;  4R4S A;  3LY3 A;  2ZQC A;  5BOH A;  5A90 A;  4HBT A;  2XEP A;  4UA7 A;  2XD1 A;  3W4Q A;  3PBR A;  1CEG A;  1XPB A;  3UPO A;  3FV7 A;  4K0X A;  3ZVT A;  1FCM A;  2R9W A;  5FQI A;  3Q07 A;  2Y55 A;  3RJU A;  1FR1 A;  4WEL A;  4LCM A;  2QMI A;  2Y2K A;  1KE0 A;  4E6W A;  3V39 A;  4ID4 A;  4U3T A;  3BM6 A;  2Y2H A;  4OQI A;  2ZM8 A;  4OPZ A;  5A92 A;  1BLS A;  1SDN A;  3C5A A;  1XGJ A;  1ZG4 A;  3IHA A;  1K54 A;  2QZ6 A;  1I2S A;  2Y91 A;  1MWT A;  1ONG A;  4DE2 A;  1TDL A;  4LV3 A;  2WGV A;  4ZAM A;  1YLY A;  3NBL A;  4DE3 A;  3MXS A;  3VMA A;  2WGW B;  3CZD A;  5CGX A;  4N9K A;  1DJC A;  3I7J A;  2ZQD A;  3W4P A;  1JTD A;  3VP3 A;  4U0T A;  4OP8 A;  1ALQ A;  2OV5 A;  1W79 A;  1MWU A;  3NY4 A;  4DF6 A;  4WEJ A;  3SS3 A;  3BFD A;  1PZP A;  4X55 A;  3HUM A;  1Z6F A;  4KG6 A;  5CHM A;  1FSY A;  3G35 A;  1MWS A;  3WRZ A;  4N1X A;  3ZNT A;  4BJP A;  5AQ9 A;  1ESU A;  3WWX A;  4GDB A;  2EXB A;  2WYX A;  2Y2Q A;  2I72 A;  2XR0 A;  1GCE A;  5EVI B;  3TSG A;  4A5R A;  3MZD A;  4OPY A;  1BTL A;  4PM7 A;  5FSR A;  1NZO A;  4MEZ A;  5GLD A;  1BSG A;  1KDW A;  3P09 A;  3OPL A;  4HEF A;  3VOY A;  5HAP A;  1HZO A;  1KVM A;  3HLW A;  2V2F F;  2J9P A;  5J8X A;  5M1A A;  4OON A;  4H8R A;  4RX3 A;  5FDH A;  1JVJ A;  4UA6 A;  1FR6 A;  3SOI A;  2PBY A;  4RX2 A;  1KGF A;  1L0E A;  4D2O A;  2EX2 A;  3OPP A;  1FSW A;  4BL2 A;  4ZTK A;  3M6B A;  1NYM A;  5AQA A;  1O07 A;  4C6Y A;  5JYP A;  4HES A;  4Y0U A;  4DXC A;  1N4O A;  4QY5 A;  5TFQ A;  2ZC3 B;  2QPN A;  2FFF B;  3O88 A;  5DTS A;  5DF7 A;  3UDX A;  2HDU A;  4KQQ A;  5M19 A;  3ZVW A;  3ZHH A;  1DY6 A;  4KZ8 A;  4GOG A;  5F1F A;  4KQO A;  1SHV A;  2DRW A;  1PWD A;  4P0M A;  1GA9 A;  2Y2M A;  4C75 A;  1CEF A;  3ZFZ A;  3NIA A;  2ZQ9 A;  2RCX A;  4BD0 A;  3HLG A;  5CTM A;  3FYZ A;  2IWC A;  1L0D A;  3ITA A;  1YT4 A;  4QY6 A;  1ERQ A;  1U60 A; 
#chains in the Genus database with same CATH topology
 3PBN A;  3WS2 A;  4GHI A;  3T4L A;  3BFE A;  4PM8 A;  3K3C A;  2OAQ 1;  3UDI A;  2JKR M;  4FSF A;  5HAQ A;  4LPZ A;  3ZNY A;  4DJ3 A;  1VM1 A;  4PM6 A;  4LV1 A;  4HH3 A;  1J9M A;  4P6B A;  3BYD A;  1G5U A;  3CIT A;  1VEU B;  5GL9 A;  1W5D A;  2MJ6 A;  1PI5 A;  2WAF A;  3TRC A;  4WLA A;  4L9G A;  4EER A;  3OPR A;  3TG9 A;  3OOV A;  1KVL A;  3IWO A;  2A24 A;  2R78 A;  4MDZ A;  5AJG A;  4H6J B;  3G32 A;  5EVI A;  3E98 A;  1GHM A;  4KQD A;  3V50 A;  4EWF A;  5AVE A;  4ZJ2 A;  4UA9 A;  1JNU A;  1KGE A;  1WYC A;  5EOO A;  3FKW A;  1RGY A;  3H9W A;  3WS0 A;  5GHX A;  1HTZ A;  2W3H A;  1CI9 A;  1G6A A;  3MFD A;  5TBM A;  1L3L A;  3GV9 A;  2E8I A;  1GHI A;  3TW8 A;  3QNB A;  5CER A;  4DKI A;  3IX3 A;  3GTC A;  1IOU A;  1ZC2 A;  1IYP A;  2M7U A;  2QKP A;  4LRX C;  2X71 A;  1TD5 A;  3OCL A;  3QP5 A;  4CLC E;  1PNE A;  1J3W A;  5GLC A;  3Q7V B;  1FQG A;  2D02 A;  3E0Y A;  2P7J A;  4K0W A;  2OWJ A;  5FEF A;  1FCN A;  2ZQ7 A;  4WZ5 A;  5FA7 A;  3TJZ C;  3VP1 A;  4E6X A;  3D9Y A;  5DKL A;  4EXO A;  4F94 A;  1NLZ A;  3BFC A;  4HI4 A;  3LID A;  2QWS A;  4DE1 A;  3ULF A;  4BBT A;  2HPB A;  3SW1 A;  3HLD A;  3IBR A;  1TVF A;  4NET A;  1ZG6 A;  3SS4 A;  4JLF A;  3VSL A;  3UE6 A;  2DMW A;  5FQK A;  3LR3 A;  3ITB A;  4JBF A;  2ZOI A;  1K56 A;  1RP5 A;  3GDI A;  4NXG A;  3PBS A;  5DTK A;  1RGZ A;  5FQJ A;  2Y2L A;  3V3R A;  5I5L A;  2FFY A;  5CRF A;  1PYY A;  3KSI A;  3IHB A;  4GS9 B;  3N8S A;  4HNB A;  3IXG A;  3CUE A;  1YM1 A;  5FAS A;  4M3K A;  1YLZ A;  3A0V A;  3DTM A;  4QB8 A;  2WZZ A;  2JE5 A;  4HP4 A;  3MBZ A;  2XA7 S;  3W8K A;  5A93 A;  4G3K A;  5KSH A;  2WKI A;  4CLC A;  2IA2 A;  1XKZ A;  2PU4 A;  2VGJ A;  2VGL M;  4KUO A;  3LR0 A;  5EE8 A;  2K7S A;  4S2I A;  3MKE A;  2VZW A;  1TF1 A;  4BQM A;  3ZDJ A;  4X68 A;  1ES4 A;  5CXW A;  3SS5 A;  1M40 A;  4JPM A;  1YLJ A;  1K56 D;  2XQZ A;  2Y2J A;  4QPR A;  2WUQ A;  2V1A A;  2WKH A;  4QD4 A;  4Y5F A;  4DRT A;  3FPV A;  3NOU C;  5F68 A;  4S2N A;  1TS6 A;  2A3U A;  4MNR A;  4ME4 A;  3UO9 A;  1ZTU A;  4CQH A;  1K25 A;  1PI4 A;  3MXR A;  3KYZ A;  3H82 A;  2HP6 A;  5DFX A;  4JXG A;  3OZH A;  1IYS A;  2PU2 A;  4XXR A;  4DDS A;  3OLO A;  5E2F A;  2W1T B;  3QNC A;  3HBR A;  3FZC A;  2OOL A;  4JGP A;  4HP9 A;  2J7V A;  3GR2 A;  3M2K A;  1KDS A;  4S2L A;  3HLB A;  2ZJ9 A;  4EEP A;  2P9V A;  3DWZ A;  3D72 A;  1IYO A;  1M6K A;  4GN2 A;  4E3J A;  4IBR A;  1QMF A;  2JKF A;  3C7U A;  5DF9 A;  5HSQ A;  1DJB A;  2VA0 A;  3O87 A;  2PAV P;  5DTT A;  3UE0 A;  4WZ5 C;  3B3X A;  4L9F A;  3F1N A;  4MBK A;  5EFW A;  3U4L P;  2VX8 A;  1L0F A;  3MQO A;  1MC0 A;  4LGW A;  3GSG A;  1CI8 A;  3PBO A;  4R3B A;  5HL1 A;  3LR5 A;  5EM0 A;  4ZJ1 A;  2HJE A;  4EUZ A;  4UAA A;  3QP6 A;  2ZQC A;  3BY9 A;  1CEG A;  1XPB A;  3UPO A;  5F6A A;  1FCM A;  2PD7 A;  3KSG A;  1KE0 A;  2EWV A;  2VK3 A;  4E6W A;  3BM6 A;  4OQI A;  2ZM8 A;  1BLS A;  2QZ6 A;  2Y91 A;  1ONG A;  2Z6C A;  1TDL A;  4LV3 A;  2WGV A;  1F2K A;  5AVF A;  4CLC C;  3VMA A;  4ARZ B;  1F5M A;  4N9K A;  4U0T A;  4CLC B;  4WEJ A;  4X25 A;  2YKH A;  1PZP A;  4KG6 A;  4Y3I A;  3V67 A;  3G35 A;  1YKD A;  2ZMV A;  1MWS A;  3WRZ A;  4K08 A;  2EXB A;  4OPY A;  4IUK A;  3JPU A;  4MEZ A;  3GEC A;  3OPL A;  3BWL A;  5EM1 A;  4RX3 A;  1JVJ A;  4UA6 A;  3SOI A;  2AVX A;  4RX2 A;  1KGF A;  4D2O A;  2EX2 A;  1OTD A;  4BL2 A;  3NHQ A;  3F1O B;  4C6Y A;  4HES A;  4Y0U A;  1DP6 A;  3LGO A;  1VHM A;  2XSS A;  4GOG A;  1YPR A;  1GA9 A;  2Y2M A;  4C75 A;  2L4R A;  2ZQ9 A;  4BD0 A;  1BYW A;  2INW A;  2IWC A;  4QY6 A;  1ERQ A;  5EUA A;  1XX2 A;  3NCK A;  3ZG9 B;  5CEB A;  3LIB A;  3DTE A;  3MFX A;  4JF5 A;  3R4K A;  1K55 A;  3BEB A;  3IX4 A;  3UNW A;  3N4I A;  3OCN A;  2B95 A;  4HIA A;  5TR7 A;  3BFF A;  5TJJ A;  5FAT A;  1MWR A;  5CEC A;  3OPH A;  2WZX A;  1WYB A;  1MKI A;  3EEA A;  2BLS A;  3PAG A;  2WAE A;  4S2P A;  4P85 A;  3JVV A;  2JC7 A;  1TS0 A;  1XP4 A;  2LB5 A;  5E2H A;  1K0K A;  1BLC A;  1L2S A;  4DN0 A;  1FIL A;  1PFL A;  4S2O A;  1XFQ A;  4S2M A;  1ONH A;  3C4P A;  3L7H A;  1PWG A;  3MQ0 A;  1IEM A;  4HJ4 A;  3T4S A;  5AQ7 A;  4E3L A;  3E4O A;  3W2Z A;  4E3I A;  1BUL A;  3HL9 A;  2Y4A A;  5HPF A;  2P74 A;  4BLM A;  5DF8 A;  5HDS A;  3UE1 A;  4FH2 A;  4IVK A;  1ODV A;  3DAV A;  4UQI S;  3WS1 A;  3NC8 A;  4WMC A;  4OOL A;  4R3A A;  5EV0 A;  1MXO A;  4MN6 A;  1Y54 A;  4XUX A;  3F1O A;  3LY4 A;  4EV4 A;  4WBG A;  3M2J A;  1V9Z A;  2Y79 A;  3LR4 A;  3T4K A;  1G68 A;  1LL9 A;  5AQB A;  3WS5 A;  2I9V A;  2OAP 1;  2PR6 A;  3MXQ A;  2GJ3 A;  2L1M A;  5E2G A;  4WUJ A;  1K4F A;  3GVB A;  4HHD A;  4KZ9 A;  1ZKJ A;  4DXB A;  4E3K A;  4Z9Q A;  4GD8 A;  1JWZ A;  3HUO A;  5GLA A;  5GLB A;  3UDF A;  2PYP A;  1YSQ A;  3T1Q B;  3FWL A;  4O7D A;  3S1Y A;  4S2N C;  1T1C A;  1LI9 A;  5HX9 A;  4RYE A;  1YLW A;  2J80 A;  1LSX A;  3S4X A;  4IBX A;  1Q2Q A;  4Y7P A;  4EES A;  3HJI A;  5L09 A;  2VLG A;  3RXW A;  1S67 L;  4N9L A;  1S4S A;  3DW0 A;  1NXY A;  3BLM A;  3AGF A;  1KOU A;  1OJ5 A;  3BFG A;  3PAE A;  3EEH A;  1YSP A;  4R3J A;  4X53 A;  1MY8 A;  3W4O A;  5C5K A;  2HJ9 C;  3T4O A;  3EOI A;  3QHY A;  2FZ0 A;  5FAQ A;  2Q0O A;  3IWQ A;  2DCF A;  1JWV A;  1OME A;  3C4O A;  4G3V A;  1S4R A;  2IWD A;  3Q1F A;  5HD5 A;  1PWC A;  5HPI A;  1Q2P A;  3ZG0 A;  4GNU A;  2NUP C;  1GSX A;  3PXP A;  1D7E A;  4NXE A;  2XGN A;  3FG8 A;  2JKG A;  4GDN A;  3BQA A;  1X0O A;  1XJ6 A;  2ZC5 B;  1NY0 A;  2WKR A;  3G31 A;  4UEY A;  5A91 A;  2BTF P;  5EEC A;  2KLI A;  3RXX A;  3HCY A;  1I2W A;  4DDY A;  3KSF A;  2XRO A;  4BD1 A;  3MF0 A;  4BMW A;  3IBJ A;  2ZC6 B;  2UV0 E;  4E3N A;  4LCL A;  1IKG A;  3SH9 A;  1YMX A;  3RFB A;  4B9O A;  2EWW A;  5G18 A;  3T1X A;  1Z09 A;  3FC7 A;  1H5X A;  5FEG A;  1LT0 A;  2HDQ A;  4QHC A;  4FCF A;  1K54 C;  2XK1 A;  4K91 A;  3RTY A;  1N9O A;  2ZQ8 A;  1EI5 A;  2ZMA A;  3UB8 A;  4MBH A;  1IEL A;  1GSV A;  3IWI A;  1SKO A;  5CGS A;  2Y8H A;  4I3I A;  2V20 A;  5CHU A;  4EUV A;  3R7W A;  2K2N A;  3UE3 A;  3IXD A;  2Z2L B;  3T1S A;  1NLY A;  4OOM A;  4PKY G;  3FPW A;  2E8J A;  2OSU A;  3S7P A;  1O7E A;  4MN7 A;  4ZBE A;  2B18 A;  4EBL A;  4GCZ A;  4ARZ A;  4I38 A;  4P6Z M;  3Q7Z A;  1NYY A;  1OT6 A;  4OOY A;  1TEM A;  2JKT M;  3NJA A;  3L9K A;  3QP2 A;  1ZHH B;  2XRN A;  3IF6 C;  3ZCZ A;  3P7N A;  3CI6 A;  3G6O A;  2KOI A;  1I5Q A;  4JXV A;  4ZDX A;  5F82 A;  1S0W A;  2ZD8 A;  2JBF A;  4QU3 A;  4X69 A;  1PW1 A;  2ZBB A;  1LL5 A;  2WKQ A;  1FOF A;  3UPN A;  4PPR A;  3E2L A;  3G34 A;  3O3V A;  1UWN X;  5HFO A;  1AWI A;  4MBF A;  3V5M A;  4JXW A;  3BEC A;  3CPT A;  3SH7 A;  4Y17 A;  3VFF A;  3KSH A;  1W63 M;  2YKF A;  3LY3 A;  5BOH A;  4HBT A;  2XD1 A;  4I3A A;  3MR0 A;  3PBR A;  4KUK A;  3FV7 A;  4K0X A;  3SZT A;  5A8B A;  2R9W A;  5FQI A;  1H8M A;  1STZ A;  4EET B;  2Y55 A;  1FR1 A;  4WEL A;  4LCM A;  4YNR A;  1UWP X;  3O5Y A;  4OPZ A;  3RH8 B;  5A92 A;  3C5A A;  1SDN A;  3IHA A;  5J7E A;  1MWT A;  3NBL A;  3MXS A;  4NKP A;  2WGW B;  3CZD A;  5CGX A;  1DJC A;  2GX5 A;  3VV4 A;  1JTD A;  3VP3 A;  4OP8 A;  3NY4 A;  3LIA A;  3BFD A;  4D60 A;  4XT2 B;  1MKM A;  1Z6F A;  5CHM A;  3QP8 A;  3ICY A;  3WWX A;  2Y2Q A;  1ACF A;  3MS6 A;  3E4P A;  2PYR A;  5FSR A;  1WA9 A;  3UB7 A;  1NZO A;  2BAS A;  1BSG A;  4HEF A;  4MCW A;  2M7V A;  3VOY A;  1KVM A;  2J9P A;  5J8X A;  4OON A;  3C38 A;  3LYX A;  3OPP A;  2GZA A;  4ZTK A;  5IU1 A;  2J3W A;  5JYP A;  1T1A A;  4DXC A;  1N4O A;  2QPN A;  4O8G A;  3UMD A;  3O88 A;  3D3O A;  3F1P A;  2ZL1 A;  4KZ8 A;  3DTI A;  5F1F A;  4KQO A;  4P0M A;  3NIA A;  2RCX A;  3HLG A;  2KDK A;  1L0D A;  2ZMF A;  2W0N A;  1U60 A;  5HZH A;  3LIE A;  3G2Z A;  4N92 A;  4IHQ A;  3VP2 A;  3CLO A;  4B88 A;  3T12 B;  4GKU A;  1TDG A;  3UN7 A;  1ESI A;  3GQZ A;  3Q81 A;  2JHE A;  3Q7V A;  3VSK A;  1P9W A;  1SDE A;  4WEK A;  4GW9 A;  4BBV A;  2O9C A;  1ES3 A;  4FOF A;  3K3D A;  1GSW A;  1N9L A;  3MZE A;  3BRM A;  2Z2M B;  1DP9 A;  2A2L A;  1JTG A;  2K31 A;  3BW6 A;  4DMZ A;  1YAX A;  4YIN A;  3KYE A;  1DP8 A;  2X01 A;  3FKV A;  3IH9 A;  3O86 A;  3PBT A;  3D4F A;  4PHT A;  1HD8 A;  3VOZ A;  4R1G A;  4MMN A;  4LRY C;  2C6W B;  4I5S A;  3PBQ A;  4ZJ3 A;  5M18 A;  3DBA A;  2ZM2 A;  2CC1 A;  2ZQA A;  4Y15 A;  1LLB A;  5HDC A;  3WS4 A;  5HWW A;  3JYI A;  5CTN A;  3A3F A;  4BBU A;  2XFT A;  3Q82 A;  4KZ3 A;  3ZG5 A;  1F9I A;  1LSV A;  1BUE A;  3PTE A;  2ZL1 B;  3T50 A;  2V9A A;  4KZ6 A;  2V1Z A;  3NOP C;  5FL3 A;  1KE4 A;  2Y2N A;  4X1L A;  4PM9 A;  3HJK A;  4OVD A;  3N8R A;  2OLV A;  3NOT C;  1T19 A;  2B5R A;  3TOI A;  3LUQ A;  1XFN A;  4GD6 A;  3UB5 P;  1OTE A;  4NK3 A;  3ZGA B;  2ZC7 A;  4OP5 A;  5DFY A;  3TE8 A;  4KZB A;  2XA7 M;  4X56 A;  5E2E A;  2Q9M A;  4KZ4 A;  2A49 A;  5F5Y A;  4GHI B;  4FH4 A;  4R23 A;  5IT5 A;  1N9N A;  3MSH A;  3R7W B;  3A3J A;  3HRE A;  4Q0H A;  1W8Q A;  4JF6 A;  4YFM A;  5TGF A;  5KIZ A;  4P87 A;  2HDR A;  3E4Q A;  5FI7 A;  1VET B;  4GB7 A;  3NDE A;  2V0U A;  4QJG A;  1JWP A;  3F1P B;  1SKF A;  4KG2 A;  5L8M A;  1WE4 A;  3IF6 A;  4JXS A;  1UGU A;  3C7V A;  2J8Y A;  4WZ4 A;  2HV1 A;  3H7W A;  4O0P A;  4B93 A;  4BL3 A;  2JKR I;  3ZYT A;  1GA0 A;  4OQH A;  3U2A A;  3NUL A;  3UME A;  5EPH A;  3EQU A;  1A0K A;  4OPQ A;  3HLF A;  1SCW A;  2P9V B;  4M4X A;  2B02 A;  2KX6 A;  3N7W A;  3QP1 A;  3VP4 A;  4B4Z A;  1P0Z A;  2GDN A;  1E3U A;  2JCH A;  1S1Y A;  1N9B A;  3GMW A;  3B42 A;  4RA7 A;  2QJ7 A;  1H3Q A;  3UB6 A;  5JYO A;  3F1N B;  3MQQ A;  3NI9 A;  4KZ5 A;  2J9O A;  2ZLY A;  3SH8 A;  4DE0 A;  3LI9 A;  5HAI A;  4I3J A;  2WKE A;  1S1Z A;  4IJG A;  3IS2 A;  2PD8 A;  2RL3 A;  4HOI A;  4X6T A;  4BWI A;  2ZOH A;  1EWZ A;  3IT9 A;  4BEN A;  1XJ2 A;  2QJ5 A;  3VP0 A;  1SZV A;  1YLT A;  3IXH A;  4JGR A;  1MPL A;  1F98 A;  3BLS A;  4EBN A;  4LEN A;  4E3O A;  1PIO A;  4OH0 A;  1C3B A;  2PT7 A;  5HAR A;  2M1C A;  5FI2 A;  3LO7 A;  5IHV A;  3LFV A;  4EBP A;  4Q8I A;  5HDD A;  1K57 C;  2XH9 A;  1G6O A;  1OTA A;  2DNS A;  3QP4 A;  2H0T A;  2EX8 A;  3MKF A;  5F1G A;  2IWB A;  4WYY A;  4CPK A;  2V8C A;  1MBL A;  1G28 A;  4RVA A;  3M6H A;  4XT2 A;  2X02 A;  4L9E A;  1E3U D;  1K55 C;  2V8F A;  4N1H A;  3EGX C;  3ZG7 B;  2HP5 A;  3H7W B;  4F3L B;  1V9Y A;  3MJQ A;  5KMW A;  2VV8 A;  3E2K A;  4OLD A;  1D1J A;  1W7F A;  2VJW A;  5HL6 A;  2G2U A;  5J4E A;  2WK0 A;  1PW8 A;  1SKO B;  1NWZ A;  4OLG A;  3N6I A;  4EW7 A;  1ES2 A;  4U0X A;  2NUT C;  3H82 B;  3G30 A;  4KZA A;  2FH5 A;  1PZO A;  4AFI A;  4H6J A;  4S2J A;  2V1B A;  2XDM A;  3UY6 A;  2EX9 A;  2EFX A;  1NJ4 A;  3P01 A;  5FI6 A;  1Y28 A;  4UHU A;  3G4P A;  2XD5 A;  3AGE A;  3KO6 A;  5HWT A;  2Y2O A;  1VET A;  4R4S A;  2XEP A;  4UA7 A;  3W4Q A;  2W3D A;  1DRM A;  3ZVT A;  2PRF A;  3B47 A;  5J3W A;  2QMI A;  2Y2K A;  3V39 A;  4U3T A;  5G4Z A;  2H28 A;  1XGJ A;  1K54 A;  4ZAM A;  4I39 A;  1YLY A;  4DE3 A;  3I7J A;  2ZQD A;  3W4P A;  1ALQ A;  2OV5 A;  1W79 A;  1MWU A;  3HUM A;  4WF0 A;  2L0W A;  3ZNT A;  1ESU A;  3NEC A;  4GDB A;  2I72 A;  5LBR A;  3UB9 A;  4HH2 A;  5L10 A;  3KYQ A;  3TSG A;  1BTL A;  5DKK A;  5GLD A;  2O9A A;  1HZO A;  2V2F F;  4H8R A;  4R38 A;  1T18 A;  1L0E A;  1NYM A;  1O07 A;  2CMN A;  1OT9 A;  4QY5 A;  4E04 A;  2FFF B;  5DTS A;  5DF7 A;  3UDX A;  4KQQ A;  3LIC A;  5M19 A;  3ZVW A;  2VKS A;  1H0M A;  1SHV A;  2DRW A;  1PWD A;  2VV7 A;  3T1R A;  2A24 B;  4ETZ A;  1NRJ A;  4FTX A;  3FYZ A;  3MMH A;  1YT4 A;  4Q0J A;  2P04 A;  1BZA A;  1P97 A;  1CQA A;  2W27 A;  5HD3 A;  2Q9N A;  1TS8 A;  3CMZ A;  1IYQ A;  4ETX A;  4EEU A;  1VB6 A;  5FAP A;  4GJ4 A;  1ERM A;  3CPT B;  2O99 A;  2XFS A;  1LHY A;  4WM9 A;  2ZM0 A;  1XA7 A;  4MLL A;  2R9X A;  2GNX A;  5FAO A;  5KZH A;  3A0R A;  1AXB A;  2D01 A;  4R6L A;  1OTI A;  5DVA A;  2PR5 A;  3MZF A;  3GRJ A;  2EX6 A;  4OQG A;  1XJ3 A;  2O9B A;  3ZQ5 A;  2H10 A;  2XF3 A;  4PKY A;  2UWX A;  3S7N A;  3EQV A;  1K57 A;  1E25 A;  4PM5 A;  4GS9 A;  5CX7 A;  4L0L A;  2QHK A;  2LB9 A;  4R70 A;  4HBU A;  1S6R A;  3S7Q A;  4GZB A;  1FIK A;  4R4R A;  5U47 A;  1MZU A;  2EA9 A;  2WGW A;  4IVI A;  2XLN A;  4HJ3 A;  1IFQ A;  1YMS A;  4LRZ E;  3VE4 A;  1W63 Q;  1W8Y A;  4IUH A;  4PAU A;  3G2Y A;  2G7U A;  4O01 A;  2V0W A;  4JGQ A;  1LI0 A;  1XJ4 A;  3OC2 A;  1YLP A;  5I94 A;  1FCO A;  2VGK A;  1KE3 A;  3A3D A;  3ZG8 B;  2HDS A;  4IED A;  4LV2 A;  2JKT I;  5F83 A;  2J3T C;  3IH8 A;  4KG5 A;  4Y13 A;  3IF5 A;  2J3T D;  2HP9 A;  5F69 A;  1H8Y A;  1VEU A;  3CJM A;  2OWH A;  3WRT A;  3A3E A;  5KSC A;  2PBD P;  3DWK A;  5CED A;  3EGD C;  3LEZ A;  1CF0 A;  1CK3 A;  5HWV A;  2VGL S;  3BQ8 A;  4Z1W A;  4LLO B;  3PHY A;  1YQS A;  2H0Y A;  2Y59 A;  5HW3 A;  5L2F A;  4UQI M;  4ZRR A;  3HLC A;  1HVB A;  1P9R A;  1H8Z A;  3CG5 A;  3BJN A;  3S22 A;  3LIF A;  4G3W A;  4HY8 A;  4NG2 A;  5GHZ A;  4HQA A;  2ZC4 B;  3T4T A;  1K6S A;  1CJF A;  2WGI A;  4C3Q A;  2C5W B;  2VV6 A;  2EFU A;  4LV0 A;  4B4X A;  3LEQ A;  1K38 A;  1PRQ A;  1BLH A;  3A3I A;  3K2N A;  1QME A;  4PMA A;  5FQ9 A;  1T1B A;  3VOL A;  4Y0T A;  1TS7 A;  1VQQ A;  4WN5 A;  2Y2I A;  1LSW A;  1K4E A;  4P6Z S;  4YOF A;  3CHW P;  3CAX A;  4F3L A;  5IS1 A;  5G4Y A;  4WL9 A;  5D3O A;  2H5S A;  3C8C A;  1D06 A;  4LFU A;  1ERO A;  4XUZ A;  4E3M A;  5CHJ A;  4WMC D;  4CLC D;  5L07 A;  3A0S A;  1KGG A;  5FDS A;  1XA1 A;  2Y2P A;  2W1R A;  1NRF A;  4FUW A;  3LCE A;  2EXA A;  1LL8 A;  2WAD A;  5FQM A;  1DJA A;  3IF6 B;  1OJG A;  3PR6 A;  4ESP A;  2Z6D A;  1GHP A;  3T4J A;  4EU0 A;  4JF4 A;  4CJN A;  3UPP A;  3N8L A;  1BT5 A;  4EQI A;  4NEE D;  4JKT A;  1RCJ A;  4II7 A;  2ACG A;  1XXM A;  3AGD A;  4MN5 A;  1K6R A;  3CUE C;  3ISG A;  4OKP A;  5GHY A;  5EOE A;  3IQA A;  2HGV A;  3IXB A;  3HUN A;  5K5B A;  5EVE A;  1XGI A;  4Y2F A;  3KX0 X;  3P98 A;  4KQR A;  2O0Y A;  2OLU A;  3V3S A;  5DJU A;  3VFH A;  2Y2G A;  3BY8 A;  4R0Q A;  1NZU A;  1E4D A;  3VE3 A;  4OPR A;  2HF6 A;  5CGW A;  1ES5 A;  5FQQ A;  4Y0O A;  3JVU A;  3CWF A;  1L0G A;  1BLP A;  4KZ7 A;  4GLQ A;  3B33 A;  1IKI A;  4KEN B;  3NDG A;  4NXB A;  2G2W A;  4Q0I A;  4FD8 A;  4S2K A;  3HVF A;  2HZ5 A;  1OPX A;  3HLE A;  3S7O A;  5E43 A;  5EVL A;  5EVI C;  4RQ9 A;  5EVI D;  2BG1 A;  3T4Q A;  4OQ0 A;  5A90 A;  1EW0 A;  3Q07 A;  3RJU A;  4YWZ A;  4ID4 A;  2Y2H A;  3EWK A;  4JGO A;  1ZG4 A;  4NXF A;  1I2S A;  4DE2 A;  2WKP A;  3DTK A;  5DJT A;  1OTB A;  1HLU P;  4X1M A;  4DF6 A;  3SS3 A;  4X55 A;  1FSY A;  3LI8 A;  4N1X A;  4BJP A;  5AQ9 A;  2WYX A;  2XR0 A;  1GCE A;  2W3G A;  3C2W A;  5EVI B;  4A5R A;  3MZD A;  4PM7 A;  2VEA A;  4QWO A;  4HJ6 A;  5MC7 A;  1KDW A;  3P09 A;  5HAP A;  2W1T A;  3HLW A;  5M1A A;  5FDH A;  2P08 A;  3IS2 B;  1FR6 A;  4DJ2 A;  2PBY A;  3OBF A;  3C30 A;  2JN7 A;  1FSW A;  2QYB A;  3M6B A;  5AQA A;  2PHY A;  5TFQ A;  2ZC3 B;  2W3E A;  1S66 L;  4EQ1 A;  2HDU A;  3PYP A;  3ZHH A;  1DY6 A;  3IX8 A;  1CEF A;  3ZFZ A;  2PDR A;  5TBM B;  2W3F A;  5CTM A;  3ITA A;  1Y4O A; 
#chains in the Genus database with same CATH homology
 3PBN A;  3G2Z A;  1XX2 A;  3NCK A;  3ZG9 B;  5CEB A;  4N92 A;  3WS2 A;  4JF5 A;  3VP2 A;  1BZA A;  4B88 A;  4GKU A;  1TDG A;  3BFE A;  1K55 A;  4PM8 A;  1ESI A;  3BEB A;  3UN7 A;  3UDI A;  3UNW A;  3GQZ A;  2Q9N A;  3CMZ A;  3Q81 A;  3Q7V A;  4FSF A;  3VSK A;  1IYQ A;  3N4I A;  5HAQ A;  3OCN A;  5FAP A;  3ZNY A;  1SDE A;  1ERM A;  4WEK A;  1VM1 A;  4PM6 A;  4LV1 A;  5TR7 A;  1J9M A;  2XFS A;  3BFF A;  3BYD A;  4P6B A;  1LHY A;  5FAT A;  1MWR A;  5CEC A;  4WM9 A;  2ZM0 A;  3OPH A;  2WZX A;  1XA7 A;  1ES3 A;  4MLL A;  1WYB A;  1MKI A;  2BLS A;  2R9X A;  2WAE A;  3PAG A;  4S2P A;  5FAO A;  5KZH A;  4P85 A;  5GL9 A;  2JC7 A;  1W5D A;  3MZE A;  1AXB A;  1PI5 A;  1XP4 A;  5DVA A;  2WAF A;  5E2H A;  1L2S A;  1BLC A;  3BRM A;  3GRJ A;  3MZF A;  2EX6 A;  4OQG A;  3OPR A;  2Z2M B;  2H10 A;  3TG9 A;  4S2O A;  4S2M A;  2XF3 A;  1ONH A;  3C4P A;  2UWX A;  1PWG A;  1JTG A;  1IEM A;  3EQV A;  1K57 A;  1E25 A;  1KVL A;  4YIN A;  3IWO A;  5AQ7 A;  4E3L A;  4PM5 A;  2X01 A;  1BUL A;  3G32 A;  4E3I A;  5EVI A;  3FKV A;  1GHM A;  3HL9 A;  2Y4A A;  2P74 A;  5EUA A;  3IH9 A;  3O86 A;  4L0L A;  4BLM A;  3V50 A;  3PBT A;  3D4F A;  5DF8 A;  3UE1 A;  4FH2 A;  4IVK A;  1HD8 A;  3VOZ A;  4R1G A;  4EWF A;  2C6W B;  4HBU A;  1S6R A;  3PBQ A;  4ZJ3 A;  3WS1 A;  5M18 A;  3NC8 A;  4WMC A;  4ZJ2 A;  4OOL A;  4UA9 A;  2ZM2 A;  2CC1 A;  2ZQA A;  1KGE A;  1LLB A;  1WYC A;  1MXO A;  4GZB A;  3FKW A;  1RGY A;  5EOO A;  3WS0 A;  5GHX A;  1HTZ A;  4R4R A;  3WS4 A;  3JYI A;  1Y54 A;  1CI9 A;  5U47 A;  4XUX A;  1G6A A;  5CTN A;  3A3F A;  3LY4 A;  3MFD A;  4EV4 A;  2XFT A;  2WGW A;  3Q82 A;  4KZ3 A;  4IVI A;  4WBG A;  2XLN A;  3GV9 A;  3M2J A;  3ZG5 A;  2E8I A;  1GHI A;  3QNB A;  5CER A;  1G68 A;  1BUE A;  4DKI A;  1LL9 A;  3PTE A;  5AQB A;  3WS5 A;  1YMS A;  3GTC A;  1W8Y A;  5E2G A;  3G2Y A;  1K4F A;  3GVB A;  1ZC2 A;  4KZ9 A;  1ZKJ A;  4KZ6 A;  4E3K A;  4DXB A;  2V1Z A;  1IYP A;  4Z9Q A;  1KE4 A;  4GD8 A;  2Y2N A;  1LI0 A;  1JWZ A;  3HUO A;  3OC2 A;  1YLP A;  4PM9 A;  4OVD A;  5I94 A;  3N8R A;  2X71 A;  1FCO A;  2VGK A;  5GLA A;  2OLV A;  3OCL A;  1KE3 A;  3A3D A;  5GLB A;  3UDF A;  2HDS A;  3ZG8 B;  3FWL A;  4O7D A;  3S1Y A;  4S2N C;  2B5R A;  1LI9 A;  4IED A;  4LV2 A;  5HX9 A;  4RYE A;  5F83 A;  1YLW A;  3S4X A;  3IH8 A;  4KG5 A;  5GLC A;  4IBX A;  3TOI A;  1Q2Q A;  3IF5 A;  4GD6 A;  4Y7P A;  3Q7V B;  4NK3 A;  1FQG A;  2HP9 A;  3ZGA B;  1H8Y A;  2ZC7 A;  3CJM A;  4OP5 A;  3WRT A;  3RXW A;  3A3E A;  4KZB A;  5KSC A;  4K0W A;  4N9L A;  4X56 A;  5E2E A;  3DWK A;  3DW0 A;  1NXY A;  5CED A;  2Q9M A;  3AGF A;  3BFG A;  3BLM A;  2A49 A;  3LEZ A;  1FCN A;  3PAE A;  1CK3 A;  4KZ4 A;  2ZQ7 A;  4FH4 A;  4WZ5 A;  5FA7 A;  4E6X A;  4R3J A;  3VP1 A;  4X53 A;  4R23 A;  1MY8 A;  4F94 A;  3W4O A;  3BFC A;  1YQS A;  2H0Y A;  3A3J A;  3HRE A;  2Y59 A;  1W8Q A;  5HW3 A;  5L2F A;  3HLC A;  4JF6 A;  4YFM A;  1HVB A;  3QHY A;  5TGF A;  4DE1 A;  1H8Z A;  3CG5 A;  4P87 A;  5FAQ A;  3S22 A;  2HDR A;  5FI7 A;  3IWQ A;  4GB7 A;  2HPB A;  3NDE A;  2DCF A;  1JWV A;  3HLD A;  4QJG A;  1JWP A;  1OME A;  3C4O A;  1TVF A;  5GHZ A;  2IWD A;  3Q1F A;  1SKF A;  1ZG6 A;  4NET A;  1PWC A;  3SS4 A;  2ZC4 B;  4KG2 A;  1Q2P A;  4JLF A;  1K6S A;  1WE4 A;  3VSL A;  3IF6 A;  3ZG0 A;  2WGI A;  4JXS A;  4C3Q A;  4GNU A;  2C5W B;  5FQK A;  4LV0 A;  2EFU A;  3C7V A;  3ITB A;  4B4X A;  1K38 A;  2J8Y A;  4JBF A;  4WZ4 A;  1BLH A;  1K56 A;  2XGN A;  1RP5 A;  3A3I A;  4GDN A;  1QME A;  4BL3 A;  3PBS A;  1GA0 A;  5DTK A;  1RGZ A;  1NY0 A;  2ZC5 B;  4OQH A;  4PMA A;  5FQJ A;  2Y2L A;  3V3R A;  5FQ9 A;  3G31 A;  2FFY A;  5A91 A;  5CRF A;  3EQU A;  5EPH A;  5EEC A;  4Y0T A;  4OPQ A;  1VQQ A;  3HLF A;  3RXX A;  1PYY A;  1SCW A;  1I2W A;  2P9V B;  4DDY A;  3IHB A;  2Y2I A;  3N8S A;  3IXG A;  4BD1 A;  1K4E A;  1YM1 A;  5FAS A;  3N7W A;  4M3K A;  3VP4 A;  4B4Z A;  2ZC6 B;  1YLZ A;  2GDN A;  5D3O A;  2H5S A;  4LCL A;  4E3N A;  1E3U A;  1IKG A;  2JCH A;  3DTM A;  4QB8 A;  1YMX A;  3SH9 A;  1ERO A;  1N9B A;  3GMW A;  2WZZ A;  4XUZ A;  4E3M A;  4RA7 A;  5CHJ A;  2JE5 A;  4WMC D;  3MBZ A;  5A93 A;  3W8K A;  5JYO A;  5KSH A;  3NI9 A;  4KZ5 A;  5G18 A;  2WKI A;  1KGG A;  1XA1 A;  2Y2P A;  2J9O A;  2ZLY A;  1XKZ A;  1H5X A;  2PU4 A;  2VGJ A;  3SH8 A;  1NRF A;  4DE0 A;  2HDQ A;  5EE8 A;  4QHC A;  4FCF A;  5HAI A;  2WKE A;  4S2I A;  1K54 C;  2XK1 A;  4K91 A;  3LCE A;  2EXA A;  2WAD A;  2RL3 A;  3MKE A;  5FQM A;  2ZQ8 A;  4X6T A;  1EI5 A;  1DJA A;  2ZMA A;  3IF6 B;  1EWZ A;  3IT9 A;  4BEN A;  4BQM A;  1GHP A;  3VP0 A;  4MBH A;  3ZDJ A;  1IEL A;  4X68 A;  1YLT A;  1ES4 A;  5CXW A;  3SS5 A;  3IWI A;  3IXH A;  1M40 A;  4JPM A;  4JF4 A;  4CJN A;  1MPL A;  3N8L A;  3UPP A;  1YLJ A;  3BLS A;  4EBN A;  1K56 D;  4LEN A;  1BT5 A;  1PIO A;  5CGS A;  4E3O A;  4OH0 A;  1C3B A;  4EQI A;  5HAR A;  2XQZ A;  2V20 A;  2Y2J A;  4JKT A;  5FI2 A;  3LO7 A;  5IHV A;  1RCJ A;  5CHU A;  2WUQ A;  2WKH A;  4QD4 A;  4DRT A;  4EBP A;  3UE3 A;  4Q8I A;  1K57 C;  3IXD A;  2XH9 A;  2DNS A;  1XXM A;  4S2N A;  3AGD A;  2A3U A;  1K6R A;  2H0T A;  3ISG A;  2EX8 A;  4MNR A;  3MKF A;  4OKP A;  5GHY A;  5EOE A;  2Z2L B;  5F1G A;  2IWB A;  3IQA A;  4WYY A;  3UO9 A;  4OOM A;  4CPK A;  1MBL A;  4RVA A;  3IXB A;  3HUN A;  3M6H A;  2OSU A;  1K25 A;  1XGI A;  1PI4 A;  1O7E A;  2X02 A;  3P98 A;  3MXR A;  4KQR A;  4ZBE A;  4EBL A;  2HP6 A;  2OLU A;  1E3U D;  4JXG A;  3OZH A;  1IYS A;  3Q7Z A;  1NYY A;  2PU2 A;  4XXR A;  3V3S A;  3VFH A;  4OOY A;  1K55 C;  1TEM A;  2Y2G A;  4N1H A;  4R0Q A;  3ZG7 B;  4ZDX A;  2HP5 A;  4DDS A;  5E2F A;  1NZU A;  1E4D A;  3QNC A;  3HBR A;  3IF6 C;  4OPR A;  3ZCZ A;  3FZC A;  5CGW A;  1ES5 A;  1I5Q A;  4JXV A;  2J7V A;  3GR2 A;  3M2K A;  4Y0O A;  5F82 A;  5FQQ A;  1S0W A;  1KDS A;  2ZD8 A;  4S2L A;  5KMW A;  3HLB A;  2ZJ9 A;  3E2K A;  4OLD A;  2P9V A;  3DWZ A;  2JBF A;  1W7F A;  2G2U A;  4QU3 A;  1BLP A;  1IYO A;  2WK0 A;  1L0G A;  1M6K A;  4KZ7 A;  1PW1 A;  1PW8 A;  4X69 A;  4OLG A;  4GN2 A;  4E3J A;  3N6I A;  1IKI A;  1LL5 A;  4IBR A;  4KEN B;  1FOF A;  1QMF A;  3NDG A;  1ES2 A;  3C7U A;  5DF9 A;  3UPN A;  4U0X A;  4PPR A;  1DJB A;  3O87 A;  3E2L A;  2G2W A;  5DTT A;  3G30 A;  4KZA A;  4FD8 A;  3UE0 A;  3G34 A;  4S2K A;  3B3X A;  4WZ5 C;  3O3V A;  1PZO A;  3HVF A;  4MBK A;  4S2J A;  5HFO A;  2XDM A;  4MBF A;  3HLE A;  1L0F A;  3UY6 A;  2EX9 A;  2EFX A;  1NJ4 A;  5E43 A;  5EVL A;  5FI6 A;  5EVI C;  3GSG A;  1CI8 A;  3PBO A;  4R3B A;  3G4P A;  4UHU A;  3V5M A;  5HL1 A;  4JXW A;  2XD5 A;  3AGE A;  4ZJ1 A;  4EUZ A;  3BEC A;  4UAA A;  5EVI D;  2BG1 A;  3SH7 A;  3VFF A;  2Y2O A;  4OQ0 A;  4R4S A;  3LY3 A;  2ZQC A;  5BOH A;  5A90 A;  4HBT A;  2XEP A;  4UA7 A;  2XD1 A;  3W4Q A;  3PBR A;  1CEG A;  1XPB A;  3UPO A;  3FV7 A;  4K0X A;  3ZVT A;  1FCM A;  2R9W A;  5FQI A;  3Q07 A;  2Y55 A;  3RJU A;  1FR1 A;  4WEL A;  4LCM A;  2QMI A;  2Y2K A;  1KE0 A;  4E6W A;  3V39 A;  4ID4 A;  4U3T A;  3BM6 A;  2Y2H A;  4OQI A;  2ZM8 A;  4OPZ A;  5A92 A;  1BLS A;  1SDN A;  3C5A A;  1XGJ A;  1ZG4 A;  3IHA A;  1K54 A;  2QZ6 A;  1I2S A;  2Y91 A;  1MWT A;  1ONG A;  4DE2 A;  1TDL A;  4LV3 A;  2WGV A;  4ZAM A;  1YLY A;  3NBL A;  4DE3 A;  3MXS A;  3VMA A;  2WGW B;  3CZD A;  5CGX A;  4N9K A;  1DJC A;  3I7J A;  2ZQD A;  3W4P A;  1JTD A;  3VP3 A;  4U0T A;  4OP8 A;  1ALQ A;  2OV5 A;  1W79 A;  1MWU A;  3NY4 A;  4DF6 A;  4WEJ A;  3SS3 A;  3BFD A;  1PZP A;  4X55 A;  3HUM A;  1Z6F A;  4KG6 A;  5CHM A;  1FSY A;  3G35 A;  1MWS A;  3WRZ A;  4N1X A;  3ZNT A;  4BJP A;  5AQ9 A;  1ESU A;  3WWX A;  4GDB A;  2EXB A;  2WYX A;  2Y2Q A;  2I72 A;  2XR0 A;  1GCE A;  5EVI B;  3TSG A;  4A5R A;  3MZD A;  4OPY A;  1BTL A;  4PM7 A;  5FSR A;  1NZO A;  4MEZ A;  5GLD A;  1BSG A;  1KDW A;  3P09 A;  3OPL A;  4HEF A;  3VOY A;  5HAP A;  1HZO A;  1KVM A;  3HLW A;  2V2F F;  2J9P A;  5J8X A;  5M1A A;  4OON A;  4H8R A;  4RX3 A;  5FDH A;  1JVJ A;  4UA6 A;  1FR6 A;  3SOI A;  2PBY A;  4RX2 A;  1KGF A;  1L0E A;  4D2O A;  2EX2 A;  3OPP A;  1FSW A;  4BL2 A;  4ZTK A;  3M6B A;  1NYM A;  5AQA A;  1O07 A;  4C6Y A;  5JYP A;  4HES A;  4Y0U A;  4DXC A;  1N4O A;  4QY5 A;  5TFQ A;  2ZC3 B;  2QPN A;  2FFF B;  3O88 A;  5DTS A;  5DF7 A;  3UDX A;  2HDU A;  4KQQ A;  5M19 A;  3ZVW A;  3ZHH A;  1DY6 A;  4KZ8 A;  4GOG A;  5F1F A;  4KQO A;  1SHV A;  2DRW A;  1PWD A;  4P0M A;  1GA9 A;  2Y2M A;  4C75 A;  1CEF A;  3ZFZ A;  3NIA A;  2ZQ9 A;  2RCX A;  4BD0 A;  3HLG A;  5CTM A;  3FYZ A;  2IWC A;  1L0D A;  3ITA A;  1YT4 A;  4QY6 A;  1ERQ A;  1U60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...