2IWCA

Benzylpenicilloyl-acylated mecr1 extracellular antibiotic-sensor domain.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
255
structure length
255
Chain Sequence
GHMSAHVQQDKYETNVSYKKLNQLAPYFKGFDGSFVLYNEREQAYSIYNEPESKQRYSPNSTYKIYLALMAFDQNLLSLNHTEQQWDKHQYPFKEWNQDQNLNSSMKYSVNWYYENLNKHLRQDEVKSYLDLIEYGNEEISGNENYWNESSLKISAIEQVNLLKNMKQHNMHFDNKAIEKVENSMTLKQKDTYKYVGKTGTGIVNHKEANGWFVGYVETKDNTYYFATHLKGEDNANGEKAQQISERILKEMELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Unbound and Acylated Structures of the Mecr1 Extracellular Antibiotic-Sensor Domain Provide Insights Into the Signal-Transduction System that Triggers Methicillin Resistance.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus n315
molecule tags Antibiotic resistance
molecule keywords METHICILLIN RESISTANCE MECR1 PROTEIN
total genus 91
structure length 255
sequence length 255
ec nomenclature
pdb deposition date 2006-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2iwcA00
1HZOA 1YLYA 2GDNA 3ISGA 4OP5A 1K57A 3HBRA 2V2FF 4N9KA 3N8LA 1ES4A 4LV3A 5FATA 2WGVA 1XX2A 1PWCA 4KQRA 2XGNA 3UE0A 4GD6A 1KE3A 2C5WB 1NRFA 4D2OA 1CEFA 1PWDA 2PU4A 2P9VA 3Q7VA 2EX9A 5CEBA 1MY8A 3SH8A 3Q7ZA 3RXWA 3VSKA 3AGFA 2Y2LA 3IF5A 3OPRA 3CG5A 5FQQA 2RCXA 1RGZA 3G32A 4RVAA 5CEDA 1BZAA 2ZQ8A 3UE3A 5FASA 4S2OA 4X68A 4DDYA 4OPZA 1BT5A 3BYDA 1I2WA 3SOIA 5AQ9A 3UNWA 4QJGA 3C7VA 1KE4A 1TEMA 4ZJ3A 5EECA 4R23A 4UA9A 5FAQA 1ONHA 3NCKA 3W8KA 3WS2A 2ZJ9A 3HL9A 2XH9A 3FKVA 4OONA 1GHIA 2G2WA 4RYEA 2WZXA 5CGSA 4S2IA 2ZC6B 4GD8A 4KZ4A 4OPYA 3WS1A 5A92A 5BOHA 4E3IA 5D3OA 1HD8A 3NIAA 1Q2QA 3MXSA 5E43A 4JXSA 2Y4AA 4U0XA 1SCWA 1KGFA 1RCJA 3GRJA 1TVFA 1VM1A 4E6WA 1IYQA 1JTGA 3A3IA 3N4IA 2IWDA 4JXWA 4U0TA 4GNUA 2Y2MA 3W4OA 3Q1FA 3VP0A 3OPHA 4ZBEA 1H5XA 1Y54A 5CHUA 5A93A 3BFEA 5L2FA 1RP5A 1PW8A 1O07A 3IF6C 3PAEA 1W8YA 1U60A 3OC2A 1L0GA 4KZBA 3DWKA 3PBNA 3TSGA 1PI5A 4JPMA 3MZDA 3Q7VB 3IWOA 4BENA 2WGWA 1PI4A 5IHVA 1L0DA 3GVBA 3HLCA 1ONGA 1W8QA 3LO7A 1NYYA 3OZHA 1EWZA 5DVAA 5GLDA 4BLMA 3LY4A 5JYOA 3OPLA 3O87A 5CGWA 1N4OA 1MWUA 2EFUA 5M1AA 4EBPA 2XK1A 5CECA 1RGYA 3ZNYA 1BLHA 3LEZA 3RJUA 2FFFB 4R1GA 4XXRA 2BLSA 2XFSA 3SS5A 4YINA 2J7VA 4Y0TA 4IVIA 1W5DA 5FAPA 2ZQAA 3UE1A 2P9VB 4P87A 1LI9A 2OLVA 2Y2GA 1KE0A 1OMEA 4UHUA 3B3XA 1ESUA 3VP3A 5CHJA 2HDQA 3PBQA 3Q81A 1K55A 3IXBA 4MLLA 3NI9A 4OLGA 4DKIA 4HESA 4R4RA 5AQAA 5EE8A 3BFCA 4OVDA 5EOOA 4DE1A 5EVLA 1K6RA 3PAGA 1XP4A 3IF6B 4ZTKA 2QPNA 3IHAA 1ZG6A 1J9MA 2B5RA 2ZC4B 3P98A 1NXYA 4DXBA 2HPBA 2XD5A 4MBKA 4N1XA 3PTEA 5GHYA 1YLTA 3N6IA 4KZ9A 4DE0A 2A49A 4OQIA 2OLUA 5CRFA 4JF5A 3Q82A 4QU3A 1Q2PA 1KVMA 1K57C 4HBTA 1C3BA 3HUMA 4DE3A 4PM5A 3NDEA 1ZG4A 1YM1A 1SHVA 5CTNA 2V1ZA 1NY0A 1H8YA 4IBRA 3MZFA 5FI7A 1PZPA 5A90A 2J8YA 2ZQDA 5FDHA 4B4ZA 3PBOA 2V20A 3BFGA 1JVJA 1XA7A 1TDLA 4B88A 4OQHA 3SH9A 3P09A 3PBSA 4NETA 4U3TA 2WADA 1MWRA 1YLPA 4KENB 2ZC5B 3GMWA 1ES5A 1I5QA 3MBZA 3V50A 1W7FA 2J9OA 5EVIC 4OPRA 3ZG7B 1DJCA 1FCMA 1BLPA 2J9PA 5AQBA 4LENA 1BSGA 5JYPA 1ZKJA 1YLJA 4KZ6A 4KQQA 2EXAA 4KZ7A 1AXBA 5U47A 4BD1A 3G34A 4UA7A 2DRWA 1YLZA 4PM6A 4C3QA 3GV9A 1IYOA 4DRTA 4R0QA 4C75A 1WYBA 1I2SA 2FFYA 5FI6A 1XGJA 2C6WB 3HLWA 5F83A 4X53A 1LL5A 4DE2A 3E2KA 1ERQA 1PZOA 1FQGA 2HDUA 2XLNA 3G2ZA 1BTLA 1GA9A 4FSFA 1PYYA 2DNSA 3WS4A 1BUEA 1Z6FA 1EI5A 1JWZA 4GN2A 5CXWA 5DF7A 4DDSA 4P0MA 2ZQCA 1E3UA 3GTCA 3Q07A 3IF6A 5TFQA 1FOFA 4LCLA 2VGJA 3FZCA 4BL2A 4N92A 1MXOA 3FV7A 2OV5A 1KGEA 4IVKA 5HX9A 3BFFA 3UO9A 2Y2PA 1BULA 4Y0UA 3DW0A 5EOEA 3WS0A 5J8XA 4WMCD 2ZMAA 1IYSA 1FR6A 1VQQA 1WE4A 1YMSA 2WKEA 3N8RA 2JBFA 3O3VA 4H8RA 3TOIA 2WGWB 3A3DA 3SH7A 3QNBA 3V5MA 3G2YA 3O88A 4XUXA 1IELA 5EVIA 1LHYA 4R3JA 3S22A 1NZUA 4WEKA 4Y0OA 1PW1A 4E3KA 1ES3A 1K54A 4GDBA 1QMFA 3SS3A 5FQJA 4WMCA 3IXHA 4QHCA 4ZAMA 4GDNA 2XEPA 3OCNA 3BLSA 4E3NA 5CGXA 2HDSA 3ZHHA 1W79A 2Z2MB 3LCEA 3FWLA 4GKUA 3UDXA 1K55C 4KG2A 3BEBA 4E3LA 4KZ5A 4KZ3A 3OCLA 4JXVA 5HAQA 1BLCA 4HBUA 1XGIA 2ZM8A 2EX8A 4WZ5C 5CERA 3ZCZA 1KVLA 4FH2A 2Y91A 3IWQA 1K54C 3UDIA 2HP5A 3ZVWA 4EWFA 3DWZA 4XUZA 2Y2KA 5FSRA 3G31A 4OQ0A 3MZEA 3V3RA 2QMIA 2ZC7A 3IXGA 2Q9NA 3HLEA 2VGKA 2PU2A 4FCFA 3QNCA 2ZD8A 4JLFA 4GZBA 2R9WA 3WWXA 3CZDA 3HREA 4K0XA 5AQ7A 5GLAA 1FSYA 3M6BA 4HEFA 3IH9A 4ID4A 4WZ4A 1SDNA 3MKFA 5GHXA 3OPPA 3BLMA 5FQKA 4CPKA 3UPOA 4N9LA 4BQMA 4MNRA 4OQGA 1TDGA 4EQIA 5M19A 5F82A 1QMEA 5EUAA 2ZQ9A 3A3EA 4E3OA 4LV0A 3ZG0A 5F1FA 4JF4A 4RX3A 3CJMA 3IQAA 3M6HA 2ZC3B 2RL3A 1KDWA 3AGDA 3CMZA 3VMAA 4X6TA 3V39A 2EFXA 4EUZA 4KZ8A 3VSLA 2E8IA 2XQZA 3SS4A 4JF6A 1CK3A 4KQOA 5FI2A 4PMAA 4E6XA 4ZDXA 3VP2A 4X56A 3TG9A 1JTDA 2Y2QA 3G30A 1KGGA 4LCMA 4BD0A 2UWXA 5KSHA 4S2MA 4WZ5A 3BRMA 1DJBA 3ZDJA 1IKGA 4CJNA 2BG1A 3FYZA 4EBNA 4OKPA 1HVBA 3C5AA 3UY6A 2JE5A 1XXMA 3W4PA 4P85A 1MBLA 4S2PA 3LY3A 5GHZA 5FAOA 1SKFA 3VFHA 2HDRA 1K38A 4JXGA 1ALQA 3MXRA 5DF8A 3WS5A 4PM8A 1LI0A 3ZG5A 1NJ4A 5EVIB 5CTMA 3VP4A 4E3JA 4KG6A 5DTKA 5M18A 4FH4A 1CI9A 3BFDA 4OH0A 4RA7A 2Y2HA 5FQIA 4WM9A 4YFMA 1K4EA 5I94A 4PPRA 2G2UA 2WZZA 1K6SA 1YMXA 4C6YA 1L0FA 3IXDA 3EQUA 2H0TA 2WKIA 2WAFA 3UDFA 5E2FA 2XF3A 4GOGA 4LV2A 3BECA 4S2NC 4P6BA 4B4XA 2WUQA 5KSCA 4BJPA 2Y55A 2EX6A 5DTTA 2XD1A 1WYCA 1DJAA 3IT9A 3JYIA 1N9BA 2X71A 3PBRA 4GB7A 4OLDA 3RXXA 5G18A 1IKIA 3ZNTA 1KDSA 1YLWA 3ZG8B 3HLDA 4BL3A 1XA1A 5E2HA 1L0EA 2JCHA 3VP1A 1K4FA 1CEGA 2IWCA 4OOYA 3WRZA 2IWBA 4EBLA 3NBLA 5EVID 2X01A 4IEDA 1ES2A 1JWPA 5FQMA 3I7JA 1G6AA 4L0LA 4OOLA 4A5RA 4S2KA 4ZJ2A 1GHMA 1XKZA 4JKTA 2P74A 1GA0A 4IBXA 1G68A 3HLFA 4E3MA 3AGEA 3MKEA 2I72A 4FD8A 3HUNA 2A3UA 2Q9MA 1S0WA 3S1YA 1E4DA 4DF6A 3C4OA 3G4PA 4KZAA 1YT4A 1K56A 2EX2A 2R9XA 3ITAA 4MBFA 2ZM0A 3UN7A 3UPPA 1O7EA 2Y2OA 2Y2JA 3A3JA 1LLBA 4K91A 5HAIA 3W4QA 2WK0A 1HTZA 3MFDA 2ZLYA 5DF9A 4UAAA 1L2SA 5HW3A 1NZOA 4WBGA 1FR1A 3A3FA 5TR7A 3DTMA 3IHBA 1ERMA 4S2NA 3NY4A 1EROA 1FSWA 4QD4A 3ZFZA 2WKHA 3VFFA 3ZGAB 4WYYA 1JWVA 2WAEA 3E2LA 3O86A 3HLGA 2DCFA 2Z2LB 4DXCA 4ZJ1A 1FCNA 2H10A 4Q8IA 2WGIA 2HP9A 5FA7A 4WELA 5A91A 5HL1A 1NYMA 3FKWA 1SDEA 2H5SA 4OPQA 2X02A 4Y7PA 3GQZA 5KMWA 3M2JA 3EQVA 2ZQ7A 4S2LA 2OSUA 4MEZA 1PWGA 1ZC2A 4OOMA 2HP6A 4M3KA 5CHMA 4EV4A 4K0WA 2CC1A 5EPHA 5GL9A 1E25A 4F94A 1E3UD 4S2JA 2PBYA 3ITBA 3C4PA 3IH8A 5HARA 1M6KA 3HLBA 3NC8A 3D4FA 3IWIA 1MKIA 2Y59A 3G35A 1M40A 1GCEA 2WYXA 1ESIA 5FQ9A 4O7DA 3NDGA 4PM9A 3WRTA 3QHYA 1PIOA 3HVFA 4N1HA 2ZM2A 4JBFA 5DTSA 3S4XA 3N7WA 1K56D 1IEMA 5F1GA 2EXBA 4R3BA 1BLSA 4QB8A 3GSGA 3ZG9B 3UPNA 5TGFA 4Z9QA 1DY6A 5KZHA 1XPBA 4QY5A 2QZ6A 1FCOA 4PM7A 3VOYA 1MWTA 3V3SA 1MPLA 4RX2A 5GLBA 3M2KA 3N8SA 4X55A 3VOZA 2Y2NA 4KG5A 2XR0A 1K25A 5HAPA 4LV1A 4NK3A 4OP8A 2Y2IA 1GHPA 4R4SA 1MWSA 5E2GA 5E2EA 1CI8A 3HUOA 1YQSA 4UA6A 1S6RA 1LL9A 3PBTA 1IYPA 2JC7A 4WEJA 1H8ZA 2H0YA 2XDMA 3BM6A 2XFTA 4MBHA 5GLCA 3ZVTA 4QY6A 4X69A 3GR2A 5HFOA 3C7UA
chains in the Genus database with same CATH superfamily
2GDNA 4OP5A 3HBRA 1ES4A 1XX2A 4I3AA 4D2OA 1GSVA 2P9VA 5CEBA 3Q7ZA 4JGQA 2Y2LA 5FASA 4X68A 4YWZA 1BT5A 3BYDA 4NXBA 3UNWA 4QJGA 3C7VA 1TEMA 3H82B 2QYBA 1VETA 3W8KA 2PAVP 2XRNA 2B18A 4QWOA 4CLCA 1SKOA 1XFNA 3BY9A 4BWIA 5BOHA 1F2KA 3OLOA 1HD8A 5E43A 4Y5FA 1CQAA 1RCJA 1Y28A 4Y13A 4E6WA 3MSHA 3BY8A 3N4IA 2IWDA 3IBRA 4NXFA 4JXWA 3U2AA 5HWTA 1Y54A 1PW8A 2OWJA 3MQQA 3B33A 3DWKA 3PBNA 2W3HA 2J80A 3GVBA 4MN5A 2K7SA 5GLDA 2OAP1 4EEUA 2W3DA 1N4OA 3MF0A 4EBPA 1RGYA 3K3DA 2FFFB 2XFSA 3IX8A 3SS5A 5FAPA 3B3XA 2JHEA 1K55A 3IXBA 3QP4A 5TJJA 4OLGA 4HESA 4LFUA 5AQAA 4OVDA 5EVLA 3UB5P 3PAGA 1XP4A 4HQAA 2QPNA 1V9ZA 3P98A 2V1BA 3PTEA 4KZ9A 4DE0A 4MDZA 4L9GA 4QU3A 3E4OA 5HZHA 3HUMA 3F1OB 5CTNA 3K3CA 1PZPA 2Y8HA 5FDHA 3JPUA 4B88A 4OQHA 4KENB 5I5LA 3GMWA 1I5QA 2J9OA 5EVIC 1DJCA 4EESA 3W2ZA 5AQBA 1ZKJA 3LI9A 4KQQA 1AXBA 4PM6A 2JKTI 3GV9A 4FTXA 1NLZA 5FI6A 5MC7A 4Z1WA 4DE2A 2HDUA 2XLNA 1BTLA 4FSFA 2DNSA 1Z6FA 1JWZA 5CXWA 5DF7A 4ZRRA 3PYPA 2ZQCA 1E3UA 3GTCA 4WL9A 3T1RA 1FOFA 2VGJA 3FZCA 3TE8A 4BL2A 3FV7A 1KGEA 5HX9A 2VK3A 3UO9A 2Y2PA 4Y0UA 1BYWA 2VLGA 5HDCA 3CUEA 1K0KA 1YMSA 3TOIA 3V5MA 3F1OA 3KO6A 3O88A 1IELA 5EVIA 4R3JA 3S22A 4Y0OA 1QMFA 4IJGA 3IXHA 4ZAMA 4GDNA 2JKGA 3OCNA 2Z2MB 3BEBA 3OCLA 4JXVA 4Y2FA 1XGIA 4WZ5C 4HNBA 3PR6A 3UDIA 1PRQA 2HP5A 2Y2KA 5FSRA 1SKOB 3HLEA 3QNCA 3WWXA 1OJGA 3M6BA 2VV8A 4WZ4A 4CPKA 2W3FA 4ETZA 4E3OA 3A3EA 3F1PB 5F1FA 3T4LA 3H7WA 3IQAA 4EUZA 4X1MA 3GECA 3VSLA 2XQZA 1OTAA 5FI2A 3NECA 3TG9A 3G30A 1Z09A 2A24A 4CJNA 3FYZA 4EBNA 1HVBA 3W4PA 5FAOA 1SKFA 1GSXA 2L1MA 4JXGA 4XT2B 3WS5A 1NJ4A 5EVIB 4E3JA 1CI9A 2XSSA 4PPRA 4IHQA 4PKYA 2XF3A 4GOGA 3A0SA 3DAVA 4P6BA 4B4XA 2B02A 2BASA 2EX6A 3IT9A 3PBRA 5DFYA 5TBMB 3ZNTA 4GW9A 3KSGA 3VP1A 4I3JA 5FEGA 1ES2A 1XJ4A 2VA0A 1G6AA 3I7JA 4L0LA 2GX5A 1OT6A 3P01A 4E3MA 3LIAA 4FD8A 4NXGA 1GSWA 2A3UA 3C4OA 1AWIA 4KZAA 3SZTA 4HI4A 3ITAA 5L07A 5HPIA 3UN7A 2Y2OA 4BBTA 2Y2JA 2VJWA 1X0OA 5DF9A 4B93A 3EWKA 3IHBA 3CPTA 4S2NA 3NY4A 2WKHA 2WAEA 4ZJ1A 2JKRI 1FCNA 1HLUP 4Q8IA 2WGIA 1XFQA 4PHTA 2H5SA 2ZQ7A 4S2LA 4MEZA 3BWLA 1ZC2A 4HJ4A 2HP6A 4M3KA 4K0WA 3UMDA 5DFXA 1M6KA 3HLBA 3IWIA 1MKIA 3G35A 4NXEA 4HHDA 1GCEA 3WRTA 3QHYA 1PIOA 4JBFA 1IEMA 2EXBA 4R3BA 3E4PA 3S7PA 2K31A 1P9RA 2UV0E 1ZHHB 1FCOA 1MPLA 4RX2A 2OWHA 2VKSA 1K25A 3FC7A 4GHIA 4LV1A 4GS9B 2Y2IA 1TF1A 1CI8A 4UA6A 3LIFA 1S6RA 1YPRA 4WN5A 3U4LP 2H0YA 2XFTA 3ZVTA 4X69A 3GR2A 2W27A 1YLYA 4N9KA 3NOPC 1PFLA 1KE3A 2C5WB 5L10A 1CEFA 2EX9A 1T1AA 3QP1A 3IF5A 3OPRA 5FQQA 2RCXA 1RGZA 3UB9A 4RVAA 2JKTM 1BZAA 3DBAA 3IS2A 4S2OA 3OBFA 2ZOHA 4R23A 4UA9A 3T1XA 5AVFA 3NCKA 3WS2A 2ZJ9A 4DMZA 5CGSA 5A92A 3KYEA 1KGFA 3GRJA 3A3IA 2Y2MA 3W4OA 3Q1FA 1CF0A 3VP0A 1H5XA 5LBRA 3O5YA 5A93A 3BFEA 5L2FA 1RP5A 2PT7A 4KUKA 1L0GA 3PXPA 4KZBA 3TSGA 3MZDA 4F3LA 1V9YA 1PI4A 5IHVA 1NWZA 2V9AA 1VB6A 4YOFA 3OZHA 1EWZA 5JYOA 3O87A 4WF0A 5CECA 3ZNYA 2M7UA 3R7WB 1D1JA 4FOFA 1UWNX 2EWVA 1OMEA 2ZBBA 4MCWA 1H0MA 4EU0A 3PBQA 3Q81A 4MLLA 4WLAA 3NI9A 1LT0A 5EE8A 4DE1A 1XJ6A 4GLQA 3LIBA 1ZG6A 1J9MA 2B5RA 4DXBA 2XD5A 4HH3A 4EUVA 1N9LA 2OLUA 4FUWA 1Q2PA 1KVMA 1C3BA 1EW0A 1ZG4A 3MMHA 1P0ZA 2O0YA 3PBOA 2V20A 3NULA 3T4JA 3SH9A 3QP8A 4NETA 3MBZA 1W7FA 4OPRA 3ZYTA 4RQ9A 1BLPA 2J9PA 1OJ5A 5JYPA 5U47A 4I38A 4Y3IA 3G34A 5EM1A 2B95A 1G28A 4O0PA 2HJ9C 1IYOA 4DRTA 1N9NA 1WYBA 1XGJA 2C6WB 3LICA 4X53A 1LL5A 1PZOA 3G2ZA 2YKFA 1LSXA 1PYYA 4BBVA 3WS4A 3SW1A 4P0MA 4NKPA 3LIEA 3NHQA 3H82A 4N92A 2WKRA 4IVKA 1JNUA 5J8XA 4WMCD 2ZMAA 1IYSA 1FR6A 1S1YA 3O3VA 1D7EA 2WGWB 3A3DA 4EERA 3QNBA 3MXQA 4XUXA 1A0KA 1ES3A 1ODVA 4R3AA 4QHCA 2XEPA 1TD5A 3BLSA 4E3NA 5CGXA 4UQIM 3ZHHA 3LCEA 4H6JB 4GKUA 1DP6A 1BLCA 2ZM8A 4X1LA 2EX8A 1KVLA 4CQHA 4FH2A 4EW7A 2V0UA 2VGLM 1K54C 5J3WA 4XUZA 3G31A 4OQ0A 3MZEA 1H3QA 2QMIA 2OAQ1 4NG2A 2PHYA 2R9WA 3HREA 3L9KA 5GLAA 1FSYA 2EA9A 3IH9A 3VV4A 3OPPA 3UPOA 3EOIA 2A24B 3F1PA 4MNRA 4LV0A 3ZG0A 2ZC3B 2RL3A 1KDWA 3VMAA 3V39A 4HIAA 4JF6A 4E6XA 3FPVA 4ZDXA 2NUPC 1JTDA 1KGGA 5KSHA 2KX6A 3BRMA 1IKGA 1F5MA 3KSHA 3C5AA 1IFQA 4S2PA 1FILA 5GHZA 1ALQA 4PM8A 3CPTB 3FPWA 3ZG5A 5CTMA 3VP4A 4KG6A 5DTKA 4FH4A 4RA7A 3BFDA 4OH0A 3VOLA 2Y2HA 4GS9A 4WM9A 1K4EA 2G2UA 2WZZA 3CI6A 4C6YA 1L0FA 3IXDA 2A2LA 5E2FA 2VV6A 5HWWA 3BECA 3NOUC 5G18A 3ZG8B 3HLDA 1XA1A 1VHMA 2IWBA 5EVID 2X01A 4LRXC 1TS8A 4ZJ2A 1GHMA 4JKTA 4IBXA 1G68A 3HLFA 3T4KA 4DN0A 3EEHA 3MKEA 2Q9MA 4DF6A 3CAXA 3JVUA 2EX2A 4MBFA 2ZM0A 3UPPA 1O7EA 4K91A 4NEED 2XROA 1ZTUA 2ZLYA 1MZUA 5L8MA 1MC0A 1L2SA 4WBGA 1FR1A 3A3FA 1EROA 3ZGAB 1JWVA 3O86A 3HCYA 3PHYA 5J7EA 5FA7A 3FKWA 5HDSA 1DP9A 4OPQA 4Y7PA 5IT5A 3GQZA 3EQVA 4OOMA 2ACGA 5CHMA 3HJIA 1E25A 4F94A 4S2JA 2PBYA 3IH8A 3D4FA 3H7WB 1M40A 2V8CA 2WYXA 3MQOA 1ESIA 4O7DA 1KOUA 3MFXA 3S4XA 3HVFA 5IU1A 3F1NB 3CUEC 3MS6A 1XPBA 2QZ6A 4PM7A 3VOYA 3M2KA 3VOZA 4D60A 1GHPA 4R4SA 5E2GA 3HUOA 1YQSA 2XDMA 2PYPA 4MBHA 4B4ZA 4HOIA 1K57A 2K2NA 1PWCA 4KQRA 2XGNA 2DMWA 2W1TB 3NJAA 1MY8A 3KYQA 4ARZA 2W1RA 2HJEA 3VSKA 3AGFA 3CG5A 4X25A 2VZWA 3UE3A 3C30A 1T1CA 4HJ3A 2BTFP 1I2WA 5AQ9A 1T18A 3T12B 2L4RA 5EECA 4B9OA 3RH8B 3CHWP 5AJGA 2PDRA 3HL9A 4ETXA 3FKVA 4OONA 1GHIA 2G2WA 4RYEA 4MMNA 4KZ4A 4GD8A 4OPYA 5FDSA 4IUKA 1Q2QA 3MXSA 2Y4AA 4U0XA 1SCWA 2QWSA 1IYQA 4U0TA 2EWWA 1CJFA 3QP2A 4GNUA 4Q0IA 2Q0OA 3PAEA 1W8YA 1U60A 3A0RA 2VX8A 3Q7VB 4BENA 2PR5A 2WGWA 1L0DA 3UE6A 2Y79A 3LY4A 5G4ZA 5CGWA 4LRYC 1MWUA 5M1AA 4L9EA 4EQ1A 3LEZA 3RJUA 4R1GA 2BLSA 2P04A 3CWFA 2JN7A 4YINA 5DKKA 3TRCA 2ZQAA 1LI9A 3NOTC 4Y15A 3RFBA 1TS7A 5TBMA 2HDQA 4DKIA 5DJUA 5EOOA 1TS0A 1ACFA 2XA7M 4ZTKA 3MQ0A 3LFVA 3LI8A 2ZL1A 2HPBA 4MBKA 5GHYA 3N6IA 2A49A 5CRFA 4JF5A 3Q82A 4BBUA 1F9IA 4PM5A 3R4KA 5EV0A 3P7NA 1H8YA 1S1ZA 4IBRA 5FI7A 3EGXC 5A90A 2J8YA 1VEUB 3B42A 2PBDP 3DTKA 1LSWA 1JVJA 1XA7A 2YKHA 2PD8A 4Q0HA 2WADA 1MWRA 4R70A 1ES5A 3LYXA 3ZG7B 1FCMA 4LENA 1YLJA 2EXAA 4KZ7A 4UA7A 1WA9A 2W3EA 3IS2B 4C3QA 3HJKA 2QHKA 4C75A 2FFYA 3KX0X 3HLWA 2FH5A 3E2KA 1ERQA 5J4EA 1YSPA 2KDKA 4GN2A 4DDSA 4KUOA 2D01A 1L3LA 2ZMFA 5F69A 4EXOA 5TFQA 4LCLA 3S7NA 3BQ8A 3S7QA 2OV5A 3BFFA 3MR0A 1BULA 5EOEA 3WS0A 5F5YA 2OOLA 2WKEA 2JBFA 4H8RA 5HD5A 4GHIB 3G2YA 3LR3A 1LHYA 1NZUA 2ZL1B 1PW1A 4GDBA 3SS3A 2Z6DA 5FQJA 3VE4A 4WMCA 3A0VA 4MN7A 3S7OA 1K55C 4KG2A 4PAUA 5HAQA 4HBUA 3T4TA 3R7WA 5CERA 3UMEA 2HF6A 3ZVWA 4EWFA 3DWZA 2PRFA 2HV1A 2ZOIA 4UEYA 2PU2A 2ZD8A 4JLFA 4P6ZS 5KIZA 4K0XA 5AQ7A 1SDNA 3MKFA 5GHXA 3CLOA 4OQGA 4EQIA 5F82A 1QMEA 2PYRA 4HP9A 4JF4A 4RX3A 4R38A 3AGDA 3LR0A 1W63Q 2EFXA 2VEAA 2I9VA 3UB8A 2E8IA 2VGLS 3SS4A 1CK3A 3T1SA 4DJ2A 1P97A 3VP2A 4LCMA 4BD0A 4WZ5A 1J3WA 1DJBA 1OTDA 2JE5A 2GNXA 4EETB 2NUTC 3QP5A 4O8GA 4JGOA 1LSVA 3CITA 4ME4A 5C5KA 3G6OA 3EEAA 3H9WA 5I94A 5DJTA 5AVEA 4HH2A 1TS6A 3IBJA 3ICYA 3D3OA 3EQUA 2WKIA 2ZMVA 3UDFA 3C2WA 4S2NC 4LRZE 5DTTA 2W1TA 2XD1A 4UQIS 3JYIA 2X71A 1IKIA 3TJZC 1LL8A 2JCHA 1K4FA 2M1CA 1CEGA 2IWCA 4OOYA 3WRZA 4CLCB 3JVVA 5FQMA 4S2KA 4HP4A 3DTIA 2I72A 3HUNA 1S0WA 3OOVA 3S1YA 3QP6A 1YT4A 2R9XA 1LLBA 5HAIA 1YSQA 3MFDA 4I3IA 1STZA 2QJ7A 4II7A 3DTMA 1OTBA 1F98A 1ERMA 1G6OA 4QD4A 3ZFZA 4WYYA 5F6AA 3T1QB 3LGOA 4LLOB 2HP9A 3KYZA 4WELA 4KQDA 5HL1A 2PR6A 1SDEA 2X02A 2H28A 1PWGA 1UGUA 5GL9A 3V67A 1E3UD 1T1BA 3TW8A 2Y59A 5FQ9A 4PM9A 2J3TD 4N1HA 2CMNA 1G5UA 1SZVA 1W63M 3GSGA 3ZG9B 3UPNA 5TGFA 4Z9QA 5KZHA 4HY8A 5F68A 2J3WA 3V3SA 5FL3A 3N8SA 3E98A 4KG5A 3RTYA 1S4RA 4ARZB 5HAPA 4NK3A 4OP8A 4H6JA 5E2EA 1LL9A 3PBTA 2JC7A 5EFWA 1H8ZA 3BW6A 5IS1A 4QY6A 5FEFA 3C7UA 1HZOA 3ISGA 3D72A 3LIDA 2V2FF 3N8LA 4LV3A 5FATA 2WGVA 1OTEA 3UE0A 4AFIA 4GD6A 3GDIA 1NRFA 1PWDA 2PU4A 3Q7VA 2O9CA 3SH8A 3RXWA 3C8CA 2O9BA 3G32A 5CEDA 1XJ3A 2ZQ8A 4DDYA 4OPZA 2QKPA 3SOIA 1KE4A 4ZJ3A 5FAQA 1ONHA 2XH9A 2WZXA 1S66L 4S2IA 2ZC6B 5L09A 3WS1A 4E3IA 5D3OA 3NIAA 4GCZA 3T4OA 3T50A 4JXSA 2WKPA 4O01A 3UB7A 1TVFA 1VM1A 2V8FA 1JTGA 4BMWA 1VETB 1VEUA 1IOUA 3OPHA 4HJ6A 4ZBEA 5CHUA 2Z6CA 2O99A 3LUQA 1O07A 3IF6C 3OC2A 1Y4OA 1PI5A 4JPMA 3IWOA 3HLCA 1ONGA 1W8QA 3LO7A 1NYYA 3LR4A 2HGVA 4ESPA 5DVAA 4BLMA 3OPLA 4JGRA 1OPXA 3C38A 2EFUA 2XK1A 1BLHA 4XXRA 1P9WA 2J7VA 4Y0TA 4IVIA 1W5DA 3UE1A 2P9VB 4P87A 4GJ4A 2OLVA 2Y2GA 1KE0A 2GJ3A 4UHUA 3VP3A 1ESUA 3E4QA 5CHJA 4G3KA 2G7UA 4R4RA 3BFCA 5HWVA 1K6RA 5HPFA 3IF6B 1MKMA 2J3TC 2XA7S 3IHAA 2ZC4B 1NXYA 4N1XA 1YLTA 2MJ6A 4OQIA 4Q0JA 1K57C 4HBTA 4DE3A 3NDEA 2QJ5A 3BQAA 1YM1A 1SHVA 4R6LA 2V1ZA 1NY0A 4XT2A 3MZFA 2ZQDA 3BFGA 1TDLA 4DJ3A 2R78A 3P09A 3PBSA 4U3TA 2VV7A 1YLPA 2ZC5B 3V50A 2W3GA 4I39A 1OT9A 4Y17A 1BSGA 3VE3A 4KZ6A 4BD1A 2DRWA 1YLZA 2FZ0A 4K08A 2GZAA 5HD3A 4R0QA 1I2SA 2W0NA 5EM0A 5F83A 1FQGA 1NLYA 3L7HA 4JGPA 1GA9A 1BUEA 1EI5A 3Q07A 1UWPX 3IF6A 3F1NA 1MXOA 3DW0A 2JKFA 1VQQA 1WE4A 3IX3A 3N8RA 3ULFA 5EVEA 3SH7A 3E0YA 4G3WA 4WEKA 4E3KA 1K54A 3D9YA 4G3VA 1FIKA 2HDSA 1W79A 1YAXA 1T19A 3FWLA 3UDXA 4E3LA 4KZ5A 5HSQA 4KZ3A 5K5BA 1OTIA 3ZCZA 2Y91A 2D02A 2O9AA 3IWQA 2KLIA 3V3RA 2ZC7A 3IXGA 2Q9NA 2VGKA 4FCFA 4PKYG 4GZBA 4F3LB 3UB6A 3CZDA 3BJNA 2P08A 4HEFA 4ID4A 5FQKA 3BLMA 4N9LA 4BQMA 5M19A 1TDGA 5CX7A 5EUAA 2ZQ9A 3CJMA 3M6HA 3ZQ5A 3CMZA 4X6TA 1H8MA 4L9FA 4KZ8A 2E8JA 4KQOA 4PMAA 2INWA 4X56A 2Y2QA 3LR5A 2JKRM 2UWXA 4S2MA 1XJ2A 3ZDJA 2BG1A 2IA2A 4OKPA 3UY6A 1XXMA 4P85A 1MBLA 2M7VA 3LY3A 3VFHA 5DF8A 2HDRA 1K38A 3MXRA 1LI0A 3LEQA 5M18A 5FQIA 4YFMA 5G4YA 3K2NA 3KSIA 1K6SA 1YMXA 3T4SA 2H0TA 2WAFA 4LV2A 2WUQA 5KSCA 2HZ5A 4BJPA 2Y55A 1WYCA 1DJAA 1N9BA 1NRJA 4GB7A 4OLDA 3RXXA 4E04A 2AVXA 1KDSA 3T4QA 1YLWA 4BL3A 5E2HA 1D06A 1L0EA 1N9OA 4EBLA 3NBLA 2P7JA 4IEDA 1JWPA 4CLCE 1S67L 3MJQA 4OOLA 4A5RA 5HDDA 1XKZA 2P74A 4WUJA 1GA0A 3B47A 4EEPA 3AGEA 5DKLA 3FG8A 1E4DA 3G4PA 4QPRA 1K56A 3A3JA 4M4XA 1DP8A 3W4QA 2WK0A 2LB9A 1HTZA 4UAAA 5HW3A 1NZOA 5TR7A 5HL6A 3KSFA 1FSWA 4YNRA 4CLCD 3VFFA 3E2LA 3HLGA 2DCFA 2Z2LB 4DXCA 2H10A 3EGDC 5A91A 1NYMA 5KMWA 3M2JA 2OSUA 4LGWA 2V1AA 2V0WA 4MN6A 5A8BA 4EV4A 2CC1A 5EPHA 3IX4A 3ITBA 3C4PA 5HARA 2PD7A 3NC8A 2WKQA 4I5SA 3NDGA 2L0WA 2ZM2A 5DTSA 3N7WA 1K56D 5F1GA 1PNEA 4IUHA 1BLSA 4P6ZM 4QB8A 2LB5A 1DY6A 4QY5A 1YKDA 1MWTA 5GLBA 4X55A 2Y2NA 2XR0A 4CLCC 1MWSA 1DRMA 1S4SA 3DTEA 2KOIA 4LPZA 1IYPA 4WEJA 3BM6A 5GLCA 5HFOA
chains in the Genus database with same CATH topology
1HZOA 1YLYA 2GDNA 3ISGA 4OP5A 1K57A 3HBRA 2V2FF 4N9KA 3N8LA 1ES4A 4LV3A 5FATA 2WGVA 1XX2A 1PWCA 4KQRA 2XGNA 3UE0A 4GD6A 1KE3A 2C5WB 1NRFA 4D2OA 1CEFA 1PWDA 2PU4A 2P9VA 3Q7VA 2EX9A 5CEBA 1MY8A 3SH8A 3Q7ZA 3RXWA 3VSKA 3AGFA 2Y2LA 3IF5A 3OPRA 3CG5A 5FQQA 2RCXA 1RGZA 3G32A 4RVAA 5CEDA 1BZAA 2ZQ8A 3UE3A 5FASA 4S2OA 4X68A 4DDYA 4OPZA 1BT5A 3BYDA 1I2WA 3SOIA 5AQ9A 3UNWA 4QJGA 3C7VA 1KE4A 1TEMA 4ZJ3A 5EECA 4R23A 4UA9A 5FAQA 1ONHA 3NCKA 3W8KA 3WS2A 2ZJ9A 3HL9A 2XH9A 3FKVA 4OONA 1GHIA 2G2WA 4RYEA 2WZXA 5CGSA 4S2IA 2ZC6B 4GD8A 4KZ4A 4OPYA 3WS1A 5A92A 5BOHA 4E3IA 5D3OA 1HD8A 3NIAA 1Q2QA 3MXSA 5E43A 4JXSA 2Y4AA 4U0XA 1SCWA 1KGFA 1RCJA 3GRJA 1TVFA 1VM1A 4E6WA 1IYQA 1JTGA 3A3IA 3N4IA 2IWDA 4JXWA 4U0TA 4GNUA 2Y2MA 3W4OA 3Q1FA 3VP0A 3OPHA 4ZBEA 1H5XA 1Y54A 5CHUA 5A93A 3BFEA 5L2FA 1RP5A 1PW8A 1O07A 3IF6C 3PAEA 1W8YA 1U60A 3OC2A 1L0GA 4KZBA 3DWKA 3PBNA 3TSGA 1PI5A 4JPMA 3MZDA 3Q7VB 3IWOA 4BENA 2WGWA 1PI4A 5IHVA 1L0DA 3GVBA 3HLCA 1ONGA 1W8QA 3LO7A 1NYYA 3OZHA 1EWZA 5DVAA 5GLDA 4BLMA 3LY4A 5JYOA 3OPLA 3O87A 5CGWA 1N4OA 1MWUA 2EFUA 5M1AA 4EBPA 2XK1A 5CECA 1RGYA 3ZNYA 1BLHA 3LEZA 3RJUA 2FFFB 4R1GA 4XXRA 2BLSA 2XFSA 3SS5A 4YINA 2J7VA 4Y0TA 4IVIA 1W5DA 5FAPA 2ZQAA 3UE1A 2P9VB 4P87A 1LI9A 2OLVA 2Y2GA 1KE0A 1OMEA 4UHUA 3B3XA 1ESUA 3VP3A 5CHJA 2HDQA 3PBQA 3Q81A 1K55A 3IXBA 4MLLA 3NI9A 4OLGA 4DKIA 4HESA 4R4RA 5AQAA 5EE8A 3BFCA 4OVDA 5EOOA 4DE1A 5EVLA 1K6RA 3PAGA 1XP4A 3IF6B 4ZTKA 2QPNA 3IHAA 1ZG6A 1J9MA 2B5RA 2ZC4B 3P98A 1NXYA 4DXBA 2HPBA 2XD5A 4MBKA 4N1XA 3PTEA 5GHYA 1YLTA 3N6IA 4KZ9A 4DE0A 2A49A 4OQIA 2OLUA 5CRFA 4JF5A 3Q82A 4QU3A 1Q2PA 1KVMA 1K57C 4HBTA 1C3BA 3HUMA 4DE3A 4PM5A 3NDEA 1ZG4A 1YM1A 1SHVA 5CTNA 2V1ZA 1NY0A 1H8YA 4IBRA 3MZFA 5FI7A 1PZPA 5A90A 2J8YA 2ZQDA 5FDHA 4B4ZA 3PBOA 2V20A 3BFGA 1JVJA 1XA7A 1TDLA 4B88A 4OQHA 3SH9A 3P09A 3PBSA 4NETA 4U3TA 2WADA 1MWRA 1YLPA 4KENB 2ZC5B 3GMWA 1ES5A 1I5QA 3MBZA 3V50A 1W7FA 2J9OA 5EVIC 4OPRA 3ZG7B 1DJCA 1FCMA 1BLPA 2J9PA 5AQBA 4LENA 1BSGA 5JYPA 1ZKJA 1YLJA 4KZ6A 4KQQA 2EXAA 4KZ7A 1AXBA 5U47A 4BD1A 3G34A 4UA7A 2DRWA 1YLZA 4PM6A 4C3QA 3GV9A 1IYOA 4DRTA 4R0QA 4C75A 1WYBA 1I2SA 2FFYA 5FI6A 1XGJA 2C6WB 3HLWA 5F83A 4X53A 1LL5A 4DE2A 3E2KA 1ERQA 1PZOA 1FQGA 2HDUA 2XLNA 3G2ZA 1BTLA 1GA9A 4FSFA 1PYYA 2DNSA 3WS4A 1BUEA 1Z6FA 1EI5A 1JWZA 4GN2A 5CXWA 5DF7A 4DDSA 4P0MA 2ZQCA 1E3UA 3GTCA 3Q07A 3IF6A 5TFQA 1FOFA 4LCLA 2VGJA 3FZCA 4BL2A 4N92A 1MXOA 3FV7A 2OV5A 1KGEA 4IVKA 5HX9A 3BFFA 3UO9A 2Y2PA 1BULA 4Y0UA 3DW0A 5EOEA 3WS0A 5J8XA 4WMCD 2ZMAA 1IYSA 1FR6A 1VQQA 1WE4A 1YMSA 2WKEA 3N8RA 2JBFA 3O3VA 4H8RA 3TOIA 2WGWB 3A3DA 3SH7A 3QNBA 3V5MA 3G2YA 3O88A 4XUXA 1IELA 5EVIA 1LHYA 4R3JA 3S22A 1NZUA 4WEKA 4Y0OA 1PW1A 4E3KA 1ES3A 1K54A 4GDBA 1QMFA 3SS3A 5FQJA 4WMCA 3IXHA 4QHCA 4ZAMA 4GDNA 2XEPA 3OCNA 3BLSA 4E3NA 5CGXA 2HDSA 3ZHHA 1W79A 2Z2MB 3LCEA 3FWLA 4GKUA 3UDXA 1K55C 4KG2A 3BEBA 4E3LA 4KZ5A 4KZ3A 3OCLA 4JXVA 5HAQA 1BLCA 4HBUA 1XGIA 2ZM8A 2EX8A 4WZ5C 5CERA 3ZCZA 1KVLA 4FH2A 2Y91A 3IWQA 1K54C 3UDIA 2HP5A 3ZVWA 4EWFA 3DWZA 4XUZA 2Y2KA 5FSRA 3G31A 4OQ0A 3MZEA 3V3RA 2QMIA 2ZC7A 3IXGA 2Q9NA 3HLEA 2VGKA 2PU2A 4FCFA 3QNCA 2ZD8A 4JLFA 4GZBA 2R9WA 3WWXA 3CZDA 3HREA 4K0XA 5AQ7A 5GLAA 1FSYA 3M6BA 4HEFA 3IH9A 4ID4A 4WZ4A 1SDNA 3MKFA 5GHXA 3OPPA 3BLMA 5FQKA 4CPKA 3UPOA 4N9LA 4BQMA 4MNRA 4OQGA 1TDGA 4EQIA 5M19A 5F82A 1QMEA 5EUAA 2ZQ9A 3A3EA 4E3OA 4LV0A 3ZG0A 5F1FA 4JF4A 4RX3A 3CJMA 3IQAA 3M6HA 2ZC3B 2RL3A 1KDWA 3AGDA 3CMZA 3VMAA 4X6TA 3V39A 2EFXA 4EUZA 4KZ8A 3VSLA 2E8IA 2XQZA 3SS4A 4JF6A 1CK3A 4KQOA 5FI2A 4PMAA 4E6XA 4ZDXA 3VP2A 4X56A 3TG9A 1JTDA 2Y2QA 3G30A 1KGGA 4LCMA 4BD0A 2UWXA 5KSHA 4S2MA 4WZ5A 3BRMA 1DJBA 3ZDJA 1IKGA 4CJNA 2BG1A 3FYZA 4EBNA 4OKPA 1HVBA 3C5AA 3UY6A 2JE5A 1XXMA 3W4PA 4P85A 1MBLA 4S2PA 3LY3A 5GHZA 5FAOA 1SKFA 3VFHA 2HDRA 1K38A 4JXGA 1ALQA 3MXRA 5DF8A 3WS5A 4PM8A 1LI0A 3ZG5A 1NJ4A 5EVIB 5CTMA 3VP4A 4E3JA 4KG6A 5DTKA 5M18A 4FH4A 1CI9A 3BFDA 4OH0A 4RA7A 2Y2HA 5FQIA 4WM9A 4YFMA 1K4EA 5I94A 4PPRA 2G2UA 2WZZA 1K6SA 1YMXA 4C6YA 1L0FA 3IXDA 3EQUA 2H0TA 2WKIA 2WAFA 3UDFA 5E2FA 2XF3A 4GOGA 4LV2A 3BECA 4S2NC 4P6BA 4B4XA 2WUQA 5KSCA 4BJPA 2Y55A 2EX6A 5DTTA 2XD1A 1WYCA 1DJAA 3IT9A 3JYIA 1N9BA 2X71A 3PBRA 4GB7A 4OLDA 3RXXA 5G18A 1IKIA 3ZNTA 1KDSA 1YLWA 3ZG8B 3HLDA 4BL3A 1XA1A 5E2HA 1L0EA 2JCHA 3VP1A 1K4FA 1CEGA 2IWCA 4OOYA 3WRZA 2IWBA 4EBLA 3NBLA 5EVID 2X01A 4IEDA 1ES2A 1JWPA 5FQMA 3I7JA 1G6AA 4L0LA 4OOLA 4A5RA 4S2KA 4ZJ2A 1GHMA 1XKZA 4JKTA 2P74A 1GA0A 4IBXA 1G68A 3HLFA 4E3MA 3AGEA 3MKEA 2I72A 4FD8A 3HUNA 2A3UA 2Q9MA 1S0WA 3S1YA 1E4DA 4DF6A 3C4OA 3G4PA 4KZAA 1YT4A 1K56A 2EX2A 2R9XA 3ITAA 4MBFA 2ZM0A 3UN7A 3UPPA 1O7EA 2Y2OA 2Y2JA 3A3JA 1LLBA 4K91A 5HAIA 3W4QA 2WK0A 1HTZA 3MFDA 2ZLYA 5DF9A 4UAAA 1L2SA 5HW3A 1NZOA 4WBGA 1FR1A 3A3FA 5TR7A 3DTMA 3IHBA 1ERMA 4S2NA 3NY4A 1EROA 1FSWA 4QD4A 3ZFZA 2WKHA 3VFFA 3ZGAB 4WYYA 1JWVA 2WAEA 3E2LA 3O86A 3HLGA 2DCFA 2Z2LB 4DXCA 4ZJ1A 1FCNA 2H10A 4Q8IA 2WGIA 2HP9A 5FA7A 4WELA 5A91A 5HL1A 1NYMA 3FKWA 1SDEA 2H5SA 4OPQA 2X02A 4Y7PA 3GQZA 5KMWA 3M2JA 3EQVA 2ZQ7A 4S2LA 2OSUA 4MEZA 1PWGA 1ZC2A 4OOMA 2HP6A 4M3KA 5CHMA 4EV4A 4K0WA 2CC1A 5EPHA 5GL9A 1E25A 4F94A 1E3UD 4S2JA 2PBYA 3ITBA 3C4PA 3IH8A 5HARA 1M6KA 3HLBA 3NC8A 3D4FA 3IWIA 1MKIA 2Y59A 3G35A 1M40A 1GCEA 2WYXA 1ESIA 5FQ9A 4O7DA 3NDGA 4PM9A 3WRTA 3QHYA 1PIOA 3HVFA 4N1HA 2ZM2A 4JBFA 5DTSA 3S4XA 3N7WA 1K56D 1IEMA 5F1GA 2EXBA 4R3BA 1BLSA 4QB8A 3GSGA 3ZG9B 3UPNA 5TGFA 4Z9QA 1DY6A 5KZHA 1XPBA 4QY5A 2QZ6A 1FCOA 4PM7A 3VOYA 1MWTA 3V3SA 1MPLA 4RX2A 5GLBA 3M2KA 3N8SA 4X55A 3VOZA 2Y2NA 4KG5A 2XR0A 1K25A 5HAPA 4LV1A 4NK3A 4OP8A 2Y2IA 1GHPA 4R4SA 1MWSA 5E2GA 5E2EA 1CI8A 3HUOA 1YQSA 4UA6A 1S6RA 1LL9A 3PBTA 1IYPA 2JC7A 4WEJA 1H8ZA 2H0YA 2XDMA 3BM6A 2XFTA 4MBHA 5GLCA 3ZVTA 4QY6A 4X69A 3GR2A 5HFOA 3C7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZO A;  1YLY A;  2GDN A;  3ISG A;  4OP5 A;  1K57 A;  3HBR A;  2V2F F;  4N9K A;  3N8L A;  1ES4 A;  4LV3 A;  5FAT A;  2WGV A;  1XX2 A;  1PWC A;  4KQR A;  2XGN A;  3UE0 A;  4GD6 A;  1KE3 A;  2C5W B;  1NRF A;  4D2O A;  1CEF A;  1PWD A;  2PU4 A;  2P9V A;  3Q7V A;  2EX9 A;  5CEB A;  1MY8 A;  3SH8 A;  3Q7Z A;  3RXW A;  3VSK A;  3AGF A;  2Y2L A;  3IF5 A;  3OPR A;  3CG5 A;  5FQQ A;  2RCX A;  1RGZ A;  3G32 A;  4RVA A;  5CED A;  1BZA A;  2ZQ8 A;  3UE3 A;  5FAS A;  4S2O A;  4X68 A;  4DDY A;  4OPZ A;  1BT5 A;  3BYD A;  1I2W A;  3SOI A;  5AQ9 A;  3UNW A;  4QJG A;  3C7V A;  1KE4 A;  1TEM A;  4ZJ3 A;  5EEC A;  4R23 A;  4UA9 A;  5FAQ A;  1ONH A;  3NCK A;  3W8K A;  3WS2 A;  2ZJ9 A;  3HL9 A;  2XH9 A;  3FKV A;  4OON A;  1GHI A;  2G2W A;  4RYE A;  2WZX A;  5CGS A;  4S2I A;  2ZC6 B;  4GD8 A;  4KZ4 A;  4OPY A;  3WS1 A;  5A92 A;  5BOH A;  4E3I A;  5D3O A;  1HD8 A;  3NIA A;  1Q2Q A;  3MXS A;  5E43 A;  4JXS A;  2Y4A A;  4U0X A;  1SCW A;  1KGF A;  1RCJ A;  3GRJ A;  1TVF A;  1VM1 A;  4E6W A;  1IYQ A;  1JTG A;  3A3I A;  3N4I A;  2IWD A;  4JXW A;  4U0T A;  4GNU A;  2Y2M A;  3W4O A;  3Q1F A;  3VP0 A;  3OPH A;  4ZBE A;  1H5X A;  1Y54 A;  5CHU A;  5A93 A;  3BFE A;  5L2F A;  1RP5 A;  1PW8 A;  1O07 A;  3IF6 C;  3PAE A;  1W8Y A;  1U60 A;  3OC2 A;  1L0G A;  4KZB A;  3DWK A;  3PBN A;  3TSG A;  1PI5 A;  4JPM A;  3MZD A;  3Q7V B;  3IWO A;  4BEN A;  2WGW A;  1PI4 A;  5IHV A;  1L0D A;  3GVB A;  3HLC A;  1ONG A;  1W8Q A;  3LO7 A;  1NYY A;  3OZH A;  1EWZ A;  5DVA A;  5GLD A;  4BLM A;  3LY4 A;  5JYO A;  3OPL A;  3O87 A;  5CGW A;  1N4O A;  1MWU A;  2EFU A;  5M1A A;  4EBP A;  2XK1 A;  5CEC A;  1RGY A;  3ZNY A;  1BLH A;  3LEZ A;  3RJU A;  2FFF B;  4R1G A;  4XXR A;  2BLS A;  2XFS A;  3SS5 A;  4YIN A;  2J7V A;  4Y0T A;  4IVI A;  1W5D A;  5FAP A;  2ZQA A;  3UE1 A;  2P9V B;  4P87 A;  1LI9 A;  2OLV A;  2Y2G A;  1KE0 A;  1OME A;  4UHU A;  3B3X A;  1ESU A;  3VP3 A;  5CHJ A;  2HDQ A;  3PBQ A;  3Q81 A;  1K55 A;  3IXB A;  4MLL A;  3NI9 A;  4OLG A;  4DKI A;  4HES A;  4R4R A;  5AQA A;  5EE8 A;  3BFC A;  4OVD A;  5EOO A;  4DE1 A;  5EVL A;  1K6R A;  3PAG A;  1XP4 A;  3IF6 B;  4ZTK A;  2QPN A;  3IHA A;  1ZG6 A;  1J9M A;  2B5R A;  2ZC4 B;  3P98 A;  1NXY A;  4DXB A;  2HPB A;  2XD5 A;  4MBK A;  4N1X A;  3PTE A;  5GHY A;  1YLT A;  3N6I A;  4KZ9 A;  4DE0 A;  2A49 A;  4OQI A;  2OLU A;  5CRF A;  4JF5 A;  3Q82 A;  4QU3 A;  1Q2P A;  1KVM A;  1K57 C;  4HBT A;  1C3B A;  3HUM A;  4DE3 A;  4PM5 A;  3NDE A;  1ZG4 A;  1YM1 A;  1SHV A;  5CTN A;  2V1Z A;  1NY0 A;  1H8Y A;  4IBR A;  3MZF A;  5FI7 A;  1PZP A;  5A90 A;  2J8Y A;  2ZQD A;  5FDH A;  4B4Z A;  3PBO A;  2V20 A;  3BFG A;  1JVJ A;  1XA7 A;  1TDL A;  4B88 A;  4OQH A;  3SH9 A;  3P09 A;  3PBS A;  4NET A;  4U3T A;  2WAD A;  1MWR A;  1YLP A;  4KEN B;  2ZC5 B;  3GMW A;  1ES5 A;  1I5Q A;  3MBZ A;  3V50 A;  1W7F A;  2J9O A;  5EVI C;  4OPR A;  3ZG7 B;  1DJC A;  1FCM A;  1BLP A;  2J9P A;  5AQB A;  4LEN A;  1BSG A;  5JYP A;  1ZKJ A;  1YLJ A;  4KZ6 A;  4KQQ A;  2EXA A;  4KZ7 A;  1AXB A;  5U47 A;  4BD1 A;  3G34 A;  4UA7 A;  2DRW A;  1YLZ A;  4PM6 A;  4C3Q A;  3GV9 A;  1IYO A;  4DRT A;  4R0Q A;  4C75 A;  1WYB A;  1I2S A;  2FFY A;  5FI6 A;  1XGJ A;  2C6W B;  3HLW A;  5F83 A;  4X53 A;  1LL5 A;  4DE2 A;  3E2K A;  1ERQ A;  1PZO A;  1FQG A;  2HDU A;  2XLN A;  3G2Z A;  1BTL A;  1GA9 A;  4FSF A;  1PYY A;  2DNS A;  3WS4 A;  1BUE A;  1Z6F A;  1EI5 A;  1JWZ A;  4GN2 A;  5CXW A;  5DF7 A;  4DDS A;  4P0M A;  2ZQC A;  1E3U A;  3GTC A;  3Q07 A;  3IF6 A;  5TFQ A;  1FOF A;  4LCL A;  2VGJ A;  3FZC A;  4BL2 A;  4N92 A;  1MXO A;  3FV7 A;  2OV5 A;  1KGE A;  4IVK A;  5HX9 A;  3BFF A;  3UO9 A;  2Y2P A;  1BUL A;  4Y0U A;  3DW0 A;  5EOE A;  3WS0 A;  5J8X A;  4WMC D;  2ZMA A;  1IYS A;  1FR6 A;  1VQQ A;  1WE4 A;  1YMS A;  2WKE A;  3N8R A;  2JBF A;  3O3V A;  4H8R A;  3TOI A;  2WGW B;  3A3D A;  3SH7 A;  3QNB A;  3V5M A;  3G2Y A;  3O88 A;  4XUX A;  1IEL A;  5EVI A;  1LHY A;  4R3J A;  3S22 A;  1NZU A;  4WEK A;  4Y0O A;  1PW1 A;  4E3K A;  1ES3 A;  1K54 A;  4GDB A;  1QMF A;  3SS3 A;  5FQJ A;  4WMC A;  3IXH A;  4QHC A;  4ZAM A;  4GDN A;  2XEP A;  3OCN A;  3BLS A;  4E3N A;  5CGX A;  2HDS A;  3ZHH A;  1W79 A;  2Z2M B;  3LCE A;  3FWL A;  4GKU A;  3UDX A;  1K55 C;  4KG2 A;  3BEB A;  4E3L A;  4KZ5 A;  4KZ3 A;  3OCL A;  4JXV A;  5HAQ A;  1BLC A;  4HBU A;  1XGI A;  2ZM8 A;  2EX8 A;  4WZ5 C;  5CER A;  3ZCZ A;  1KVL A;  4FH2 A;  2Y91 A;  3IWQ A;  1K54 C;  3UDI A;  2HP5 A;  3ZVW A;  4EWF A;  3DWZ A;  4XUZ A;  2Y2K A;  5FSR A;  3G31 A;  4OQ0 A;  3MZE A;  3V3R A;  2QMI A;  2ZC7 A;  3IXG A;  2Q9N A;  3HLE A;  2VGK A;  2PU2 A;  4FCF A;  3QNC A;  2ZD8 A;  4JLF A;  4GZB A;  2R9W A;  3WWX A;  3CZD A;  3HRE A;  4K0X A;  5AQ7 A;  5GLA A;  1FSY A;  3M6B A;  4HEF A;  3IH9 A;  4ID4 A;  4WZ4 A;  1SDN A;  3MKF A;  5GHX A;  3OPP A;  3BLM A;  5FQK A;  4CPK A;  3UPO A;  4N9L A;  4BQM A;  4MNR A;  4OQG A;  1TDG A;  4EQI A;  5M19 A;  5F82 A;  1QME A;  5EUA A;  2ZQ9 A;  3A3E A;  4E3O A;  4LV0 A;  3ZG0 A;  5F1F A;  4JF4 A;  4RX3 A;  3CJM A;  3IQA A;  3M6H A;  2ZC3 B;  2RL3 A;  1KDW A;  3AGD A;  3CMZ A;  3VMA A;  4X6T A;  3V39 A;  2EFX A;  4EUZ A;  4KZ8 A;  3VSL A;  2E8I A;  2XQZ A;  3SS4 A;  4JF6 A;  1CK3 A;  4KQO A;  5FI2 A;  4PMA A;  4E6X A;  4ZDX A;  3VP2 A;  4X56 A;  3TG9 A;  1JTD A;  2Y2Q A;  3G30 A;  1KGG A;  4LCM A;  4BD0 A;  2UWX A;  5KSH A;  4S2M A;  4WZ5 A;  3BRM A;  1DJB A;  3ZDJ A;  1IKG A;  4CJN A;  2BG1 A;  3FYZ A;  4EBN A;  4OKP A;  1HVB A;  3C5A A;  3UY6 A;  2JE5 A;  1XXM A;  3W4P A;  4P85 A;  1MBL A;  4S2P A;  3LY3 A;  5GHZ A;  5FAO A;  1SKF A;  3VFH A;  2HDR A;  1K38 A;  4JXG A;  1ALQ A;  3MXR A;  5DF8 A;  3WS5 A;  4PM8 A;  1LI0 A;  3ZG5 A;  1NJ4 A;  5EVI B;  5CTM A;  3VP4 A;  4E3J A;  4KG6 A;  5DTK A;  5M18 A;  4FH4 A;  1CI9 A;  3BFD A;  4OH0 A;  4RA7 A;  2Y2H A;  5FQI A;  4WM9 A;  4YFM A;  1K4E A;  5I94 A;  4PPR A;  2G2U A;  2WZZ A;  1K6S A;  1YMX A;  4C6Y A;  1L0F A;  3IXD A;  3EQU A;  2H0T A;  2WKI A;  2WAF A;  3UDF A;  5E2F A;  2XF3 A;  4GOG A;  4LV2 A;  3BEC A;  4S2N C;  4P6B A;  4B4X A;  2WUQ A;  5KSC A;  4BJP A;  2Y55 A;  2EX6 A;  5DTT A;  2XD1 A;  1WYC A;  1DJA A;  3IT9 A;  3JYI A;  1N9B A;  2X71 A;  3PBR A;  4GB7 A;  4OLD A;  3RXX A;  5G18 A;  1IKI A;  3ZNT A;  1KDS A;  1YLW A;  3ZG8 B;  3HLD A;  4BL3 A;  1XA1 A;  5E2H A;  1L0E A;  2JCH A;  3VP1 A;  1K4F A;  1CEG A;  2IWC A;  4OOY A;  3WRZ A;  2IWB A;  4EBL A;  3NBL A;  5EVI D;  2X01 A;  4IED A;  1ES2 A;  1JWP A;  5FQM A;  3I7J A;  1G6A A;  4L0L A;  4OOL A;  4A5R A;  4S2K A;  4ZJ2 A;  1GHM A;  1XKZ A;  4JKT A;  2P74 A;  1GA0 A;  4IBX A;  1G68 A;  3HLF A;  4E3M A;  3AGE A;  3MKE A;  2I72 A;  4FD8 A;  3HUN A;  2A3U A;  2Q9M A;  1S0W A;  3S1Y A;  1E4D A;  4DF6 A;  3C4O A;  3G4P A;  4KZA A;  1YT4 A;  1K56 A;  2EX2 A;  2R9X A;  3ITA A;  4MBF A;  2ZM0 A;  3UN7 A;  3UPP A;  1O7E A;  2Y2O A;  2Y2J A;  3A3J A;  1LLB A;  4K91 A;  5HAI A;  3W4Q A;  2WK0 A;  1HTZ A;  3MFD A;  2ZLY A;  5DF9 A;  4UAA A;  1L2S A;  5HW3 A;  1NZO A;  4WBG A;  1FR1 A;  3A3F A;  5TR7 A;  3DTM A;  3IHB A;  1ERM A;  4S2N A;  3NY4 A;  1ERO A;  1FSW A;  4QD4 A;  3ZFZ A;  2WKH A;  3VFF A;  3ZGA B;  4WYY A;  1JWV A;  2WAE A;  3E2L A;  3O86 A;  3HLG A;  2DCF A;  2Z2L B;  4DXC A;  4ZJ1 A;  1FCN A;  2H10 A;  4Q8I A;  2WGI A;  2HP9 A;  5FA7 A;  4WEL A;  5A91 A;  5HL1 A;  1NYM A;  3FKW A;  1SDE A;  2H5S A;  4OPQ A;  2X02 A;  4Y7P A;  3GQZ A;  5KMW A;  3M2J A;  3EQV A;  2ZQ7 A;  4S2L A;  2OSU A;  4MEZ A;  1PWG A;  1ZC2 A;  4OOM A;  2HP6 A;  4M3K A;  5CHM A;  4EV4 A;  4K0W A;  2CC1 A;  5EPH A;  5GL9 A;  1E25 A;  4F94 A;  1E3U D;  4S2J A;  2PBY A;  3ITB A;  3C4P A;  3IH8 A;  5HAR A;  1M6K A;  3HLB A;  3NC8 A;  3D4F A;  3IWI A;  1MKI A;  2Y59 A;  3G35 A;  1M40 A;  1GCE A;  2WYX A;  1ESI A;  5FQ9 A;  4O7D A;  3NDG A;  4PM9 A;  3WRT A;  3QHY A;  1PIO A;  3HVF A;  4N1H A;  2ZM2 A;  4JBF A;  5DTS A;  3S4X A;  3N7W A;  1K56 D;  1IEM A;  5F1G A;  2EXB A;  4R3B A;  1BLS A;  4QB8 A;  3GSG A;  3ZG9 B;  3UPN A;  5TGF A;  4Z9Q A;  1DY6 A;  5KZH A;  1XPB A;  4QY5 A;  2QZ6 A;  1FCO A;  4PM7 A;  3VOY A;  1MWT A;  3V3S A;  1MPL A;  4RX2 A;  5GLB A;  3M2K A;  3N8S A;  4X55 A;  3VOZ A;  2Y2N A;  4KG5 A;  2XR0 A;  1K25 A;  5HAP A;  4LV1 A;  4NK3 A;  4OP8 A;  2Y2I A;  1GHP A;  4R4S A;  1MWS A;  5E2G A;  5E2E A;  1CI8 A;  3HUO A;  1YQS A;  4UA6 A;  1S6R A;  1LL9 A;  3PBT A;  1IYP A;  2JC7 A;  4WEJ A;  1H8Z A;  2H0Y A;  2XDM A;  3BM6 A;  2XFT A;  4MBH A;  5GLC A;  3ZVT A;  4QY6 A;  4X69 A;  3GR2 A;  5HFO A;  3C7U A; 
#chains in the Genus database with same CATH topology
 2GDN A;  4OP5 A;  3HBR A;  1ES4 A;  1XX2 A;  4I3A A;  4D2O A;  1GSV A;  2P9V A;  5CEB A;  3Q7Z A;  4JGQ A;  2Y2L A;  5FAS A;  4X68 A;  4YWZ A;  1BT5 A;  3BYD A;  4NXB A;  3UNW A;  4QJG A;  3C7V A;  1TEM A;  3H82 B;  2QYB A;  1VET A;  3W8K A;  2PAV P;  2XRN A;  2B18 A;  4QWO A;  4CLC A;  1SKO A;  1XFN A;  3BY9 A;  4BWI A;  5BOH A;  1F2K A;  3OLO A;  1HD8 A;  5E43 A;  4Y5F A;  1CQA A;  1RCJ A;  1Y28 A;  4Y13 A;  4E6W A;  3MSH A;  3BY8 A;  3N4I A;  2IWD A;  3IBR A;  4NXF A;  4JXW A;  3U2A A;  5HWT A;  1Y54 A;  1PW8 A;  2OWJ A;  3MQQ A;  3B33 A;  3DWK A;  3PBN A;  2W3H A;  2J80 A;  3GVB A;  4MN5 A;  2K7S A;  5GLD A;  2OAP 1;  4EEU A;  2W3D A;  1N4O A;  3MF0 A;  4EBP A;  1RGY A;  3K3D A;  2FFF B;  2XFS A;  3IX8 A;  3SS5 A;  5FAP A;  3B3X A;  2JHE A;  1K55 A;  3IXB A;  3QP4 A;  5TJJ A;  4OLG A;  4HES A;  4LFU A;  5AQA A;  4OVD A;  5EVL A;  3UB5 P;  3PAG A;  1XP4 A;  4HQA A;  2QPN A;  1V9Z A;  3P98 A;  2V1B A;  3PTE A;  4KZ9 A;  4DE0 A;  4MDZ A;  4L9G A;  4QU3 A;  3E4O A;  5HZH A;  3HUM A;  3F1O B;  5CTN A;  3K3C A;  1PZP A;  2Y8H A;  5FDH A;  3JPU A;  4B88 A;  4OQH A;  4KEN B;  5I5L A;  3GMW A;  1I5Q A;  2J9O A;  5EVI C;  1DJC A;  4EES A;  3W2Z A;  5AQB A;  1ZKJ A;  3LI9 A;  4KQQ A;  1AXB A;  4PM6 A;  2JKT I;  3GV9 A;  4FTX A;  1NLZ A;  5FI6 A;  5MC7 A;  4Z1W A;  4DE2 A;  2HDU A;  2XLN A;  1BTL A;  4FSF A;  2DNS A;  1Z6F A;  1JWZ A;  5CXW A;  5DF7 A;  4ZRR A;  3PYP A;  2ZQC A;  1E3U A;  3GTC A;  4WL9 A;  3T1R A;  1FOF A;  2VGJ A;  3FZC A;  3TE8 A;  4BL2 A;  3FV7 A;  1KGE A;  5HX9 A;  2VK3 A;  3UO9 A;  2Y2P A;  4Y0U A;  1BYW A;  2VLG A;  5HDC A;  3CUE A;  1K0K A;  1YMS A;  3TOI A;  3V5M A;  3F1O A;  3KO6 A;  3O88 A;  1IEL A;  5EVI A;  4R3J A;  3S22 A;  4Y0O A;  1QMF A;  4IJG A;  3IXH A;  4ZAM A;  4GDN A;  2JKG A;  3OCN A;  2Z2M B;  3BEB A;  3OCL A;  4JXV A;  4Y2F A;  1XGI A;  4WZ5 C;  4HNB A;  3PR6 A;  3UDI A;  1PRQ A;  2HP5 A;  2Y2K A;  5FSR A;  1SKO B;  3HLE A;  3QNC A;  3WWX A;  1OJG A;  3M6B A;  2VV8 A;  4WZ4 A;  4CPK A;  2W3F A;  4ETZ A;  4E3O A;  3A3E A;  3F1P B;  5F1F A;  3T4L A;  3H7W A;  3IQA A;  4EUZ A;  4X1M A;  3GEC A;  3VSL A;  2XQZ A;  1OTA A;  5FI2 A;  3NEC A;  3TG9 A;  3G30 A;  1Z09 A;  2A24 A;  4CJN A;  3FYZ A;  4EBN A;  1HVB A;  3W4P A;  5FAO A;  1SKF A;  1GSX A;  2L1M A;  4JXG A;  4XT2 B;  3WS5 A;  1NJ4 A;  5EVI B;  4E3J A;  1CI9 A;  2XSS A;  4PPR A;  4IHQ A;  4PKY A;  2XF3 A;  4GOG A;  3A0S A;  3DAV A;  4P6B A;  4B4X A;  2B02 A;  2BAS A;  2EX6 A;  3IT9 A;  3PBR A;  5DFY A;  5TBM B;  3ZNT A;  4GW9 A;  3KSG A;  3VP1 A;  4I3J A;  5FEG A;  1ES2 A;  1XJ4 A;  2VA0 A;  1G6A A;  3I7J A;  4L0L A;  2GX5 A;  1OT6 A;  3P01 A;  4E3M A;  3LIA A;  4FD8 A;  4NXG A;  1GSW A;  2A3U A;  3C4O A;  1AWI A;  4KZA A;  3SZT A;  4HI4 A;  3ITA A;  5L07 A;  5HPI A;  3UN7 A;  2Y2O A;  4BBT A;  2Y2J A;  2VJW A;  1X0O A;  5DF9 A;  4B93 A;  3EWK A;  3IHB A;  3CPT A;  4S2N A;  3NY4 A;  2WKH A;  2WAE A;  4ZJ1 A;  2JKR I;  1FCN A;  1HLU P;  4Q8I A;  2WGI A;  1XFQ A;  4PHT A;  2H5S A;  2ZQ7 A;  4S2L A;  4MEZ A;  3BWL A;  1ZC2 A;  4HJ4 A;  2HP6 A;  4M3K A;  4K0W A;  3UMD A;  5DFX A;  1M6K A;  3HLB A;  3IWI A;  1MKI A;  3G35 A;  4NXE A;  4HHD A;  1GCE A;  3WRT A;  3QHY A;  1PIO A;  4JBF A;  1IEM A;  2EXB A;  4R3B A;  3E4P A;  3S7P A;  2K31 A;  1P9R A;  2UV0 E;  1ZHH B;  1FCO A;  1MPL A;  4RX2 A;  2OWH A;  2VKS A;  1K25 A;  3FC7 A;  4GHI A;  4LV1 A;  4GS9 B;  2Y2I A;  1TF1 A;  1CI8 A;  4UA6 A;  3LIF A;  1S6R A;  1YPR A;  4WN5 A;  3U4L P;  2H0Y A;  2XFT A;  3ZVT A;  4X69 A;  3GR2 A;  2W27 A;  1YLY A;  4N9K A;  3NOP C;  1PFL A;  1KE3 A;  2C5W B;  5L10 A;  1CEF A;  2EX9 A;  1T1A A;  3QP1 A;  3IF5 A;  3OPR A;  5FQQ A;  2RCX A;  1RGZ A;  3UB9 A;  4RVA A;  2JKT M;  1BZA A;  3DBA A;  3IS2 A;  4S2O A;  3OBF A;  2ZOH A;  4R23 A;  4UA9 A;  3T1X A;  5AVF A;  3NCK A;  3WS2 A;  2ZJ9 A;  4DMZ A;  5CGS A;  5A92 A;  3KYE A;  1KGF A;  3GRJ A;  3A3I A;  2Y2M A;  3W4O A;  3Q1F A;  1CF0 A;  3VP0 A;  1H5X A;  5LBR A;  3O5Y A;  5A93 A;  3BFE A;  5L2F A;  1RP5 A;  2PT7 A;  4KUK A;  1L0G A;  3PXP A;  4KZB A;  3TSG A;  3MZD A;  4F3L A;  1V9Y A;  1PI4 A;  5IHV A;  1NWZ A;  2V9A A;  1VB6 A;  4YOF A;  3OZH A;  1EWZ A;  5JYO A;  3O87 A;  4WF0 A;  5CEC A;  3ZNY A;  2M7U A;  3R7W B;  1D1J A;  4FOF A;  1UWN X;  2EWV A;  1OME A;  2ZBB A;  4MCW A;  1H0M A;  4EU0 A;  3PBQ A;  3Q81 A;  4MLL A;  4WLA A;  3NI9 A;  1LT0 A;  5EE8 A;  4DE1 A;  1XJ6 A;  4GLQ A;  3LIB A;  1ZG6 A;  1J9M A;  2B5R A;  4DXB A;  2XD5 A;  4HH3 A;  4EUV A;  1N9L A;  2OLU A;  4FUW A;  1Q2P A;  1KVM A;  1C3B A;  1EW0 A;  1ZG4 A;  3MMH A;  1P0Z A;  2O0Y A;  3PBO A;  2V20 A;  3NUL A;  3T4J A;  3SH9 A;  3QP8 A;  4NET A;  3MBZ A;  1W7F A;  4OPR A;  3ZYT A;  4RQ9 A;  1BLP A;  2J9P A;  1OJ5 A;  5JYP A;  5U47 A;  4I38 A;  4Y3I A;  3G34 A;  5EM1 A;  2B95 A;  1G28 A;  4O0P A;  2HJ9 C;  1IYO A;  4DRT A;  1N9N A;  1WYB A;  1XGJ A;  2C6W B;  3LIC A;  4X53 A;  1LL5 A;  1PZO A;  3G2Z A;  2YKF A;  1LSX A;  1PYY A;  4BBV A;  3WS4 A;  3SW1 A;  4P0M A;  4NKP A;  3LIE A;  3NHQ A;  3H82 A;  4N92 A;  2WKR A;  4IVK A;  1JNU A;  5J8X A;  4WMC D;  2ZMA A;  1IYS A;  1FR6 A;  1S1Y A;  3O3V A;  1D7E A;  2WGW B;  3A3D A;  4EER A;  3QNB A;  3MXQ A;  4XUX A;  1A0K A;  1ES3 A;  1ODV A;  4R3A A;  4QHC A;  2XEP A;  1TD5 A;  3BLS A;  4E3N A;  5CGX A;  4UQI M;  3ZHH A;  3LCE A;  4H6J B;  4GKU A;  1DP6 A;  1BLC A;  2ZM8 A;  4X1L A;  2EX8 A;  1KVL A;  4CQH A;  4FH2 A;  4EW7 A;  2V0U A;  2VGL M;  1K54 C;  5J3W A;  4XUZ A;  3G31 A;  4OQ0 A;  3MZE A;  1H3Q A;  2QMI A;  2OAQ 1;  4NG2 A;  2PHY A;  2R9W A;  3HRE A;  3L9K A;  5GLA A;  1FSY A;  2EA9 A;  3IH9 A;  3VV4 A;  3OPP A;  3UPO A;  3EOI A;  2A24 B;  3F1P A;  4MNR A;  4LV0 A;  3ZG0 A;  2ZC3 B;  2RL3 A;  1KDW A;  3VMA A;  3V39 A;  4HIA A;  4JF6 A;  4E6X A;  3FPV A;  4ZDX A;  2NUP C;  1JTD A;  1KGG A;  5KSH A;  2KX6 A;  3BRM A;  1IKG A;  1F5M A;  3KSH A;  3C5A A;  1IFQ A;  4S2P A;  1FIL A;  5GHZ A;  1ALQ A;  4PM8 A;  3CPT B;  3FPW A;  3ZG5 A;  5CTM A;  3VP4 A;  4KG6 A;  5DTK A;  4FH4 A;  4RA7 A;  3BFD A;  4OH0 A;  3VOL A;  2Y2H A;  4GS9 A;  4WM9 A;  1K4E A;  2G2U A;  2WZZ A;  3CI6 A;  4C6Y A;  1L0F A;  3IXD A;  2A2L A;  5E2F A;  2VV6 A;  5HWW A;  3BEC A;  3NOU C;  5G18 A;  3ZG8 B;  3HLD A;  1XA1 A;  1VHM A;  2IWB A;  5EVI D;  2X01 A;  4LRX C;  1TS8 A;  4ZJ2 A;  1GHM A;  4JKT A;  4IBX A;  1G68 A;  3HLF A;  3T4K A;  4DN0 A;  3EEH A;  3MKE A;  2Q9M A;  4DF6 A;  3CAX A;  3JVU A;  2EX2 A;  4MBF A;  2ZM0 A;  3UPP A;  1O7E A;  4K91 A;  4NEE D;  2XRO A;  1ZTU A;  2ZLY A;  1MZU A;  5L8M A;  1MC0 A;  1L2S A;  4WBG A;  1FR1 A;  3A3F A;  1ERO A;  3ZGA B;  1JWV A;  3O86 A;  3HCY A;  3PHY A;  5J7E A;  5FA7 A;  3FKW A;  5HDS A;  1DP9 A;  4OPQ A;  4Y7P A;  5IT5 A;  3GQZ A;  3EQV A;  4OOM A;  2ACG A;  5CHM A;  3HJI A;  1E25 A;  4F94 A;  4S2J A;  2PBY A;  3IH8 A;  3D4F A;  3H7W B;  1M40 A;  2V8C A;  2WYX A;  3MQO A;  1ESI A;  4O7D A;  1KOU A;  3MFX A;  3S4X A;  3HVF A;  5IU1 A;  3F1N B;  3CUE C;  3MS6 A;  1XPB A;  2QZ6 A;  4PM7 A;  3VOY A;  3M2K A;  3VOZ A;  4D60 A;  1GHP A;  4R4S A;  5E2G A;  3HUO A;  1YQS A;  2XDM A;  2PYP A;  4MBH A;  4B4Z A;  4HOI A;  1K57 A;  2K2N A;  1PWC A;  4KQR A;  2XGN A;  2DMW A;  2W1T B;  3NJA A;  1MY8 A;  3KYQ A;  4ARZ A;  2W1R A;  2HJE A;  3VSK A;  3AGF A;  3CG5 A;  4X25 A;  2VZW A;  3UE3 A;  3C30 A;  1T1C A;  4HJ3 A;  2BTF P;  1I2W A;  5AQ9 A;  1T18 A;  3T12 B;  2L4R A;  5EEC A;  4B9O A;  3RH8 B;  3CHW P;  5AJG A;  2PDR A;  3HL9 A;  4ETX A;  3FKV A;  4OON A;  1GHI A;  2G2W A;  4RYE A;  4MMN A;  4KZ4 A;  4GD8 A;  4OPY A;  5FDS A;  4IUK A;  1Q2Q A;  3MXS A;  2Y4A A;  4U0X A;  1SCW A;  2QWS A;  1IYQ A;  4U0T A;  2EWW A;  1CJF A;  3QP2 A;  4GNU A;  4Q0I A;  2Q0O A;  3PAE A;  1W8Y A;  1U60 A;  3A0R A;  2VX8 A;  3Q7V B;  4BEN A;  2PR5 A;  2WGW A;  1L0D A;  3UE6 A;  2Y79 A;  3LY4 A;  5G4Z A;  5CGW A;  4LRY C;  1MWU A;  5M1A A;  4L9E A;  4EQ1 A;  3LEZ A;  3RJU A;  4R1G A;  2BLS A;  2P04 A;  3CWF A;  2JN7 A;  4YIN A;  5DKK A;  3TRC A;  2ZQA A;  1LI9 A;  3NOT C;  4Y15 A;  3RFB A;  1TS7 A;  5TBM A;  2HDQ A;  4DKI A;  5DJU A;  5EOO A;  1TS0 A;  1ACF A;  2XA7 M;  4ZTK A;  3MQ0 A;  3LFV A;  3LI8 A;  2ZL1 A;  2HPB A;  4MBK A;  5GHY A;  3N6I A;  2A49 A;  5CRF A;  4JF5 A;  3Q82 A;  4BBU A;  1F9I A;  4PM5 A;  3R4K A;  5EV0 A;  3P7N A;  1H8Y A;  1S1Z A;  4IBR A;  5FI7 A;  3EGX C;  5A90 A;  2J8Y A;  1VEU B;  3B42 A;  2PBD P;  3DTK A;  1LSW A;  1JVJ A;  1XA7 A;  2YKH A;  2PD8 A;  4Q0H A;  2WAD A;  1MWR A;  4R70 A;  1ES5 A;  3LYX A;  3ZG7 B;  1FCM A;  4LEN A;  1YLJ A;  2EXA A;  4KZ7 A;  4UA7 A;  1WA9 A;  2W3E A;  3IS2 B;  4C3Q A;  3HJK A;  2QHK A;  4C75 A;  2FFY A;  3KX0 X;  3HLW A;  2FH5 A;  3E2K A;  1ERQ A;  5J4E A;  1YSP A;  2KDK A;  4GN2 A;  4DDS A;  4KUO A;  2D01 A;  1L3L A;  2ZMF A;  5F69 A;  4EXO A;  5TFQ A;  4LCL A;  3S7N A;  3BQ8 A;  3S7Q A;  2OV5 A;  3BFF A;  3MR0 A;  1BUL A;  5EOE A;  3WS0 A;  5F5Y A;  2OOL A;  2WKE A;  2JBF A;  4H8R A;  5HD5 A;  4GHI B;  3G2Y A;  3LR3 A;  1LHY A;  1NZU A;  2ZL1 B;  1PW1 A;  4GDB A;  3SS3 A;  2Z6D A;  5FQJ A;  3VE4 A;  4WMC A;  3A0V A;  4MN7 A;  3S7O A;  1K55 C;  4KG2 A;  4PAU A;  5HAQ A;  4HBU A;  3T4T A;  3R7W A;  5CER A;  3UME A;  2HF6 A;  3ZVW A;  4EWF A;  3DWZ A;  2PRF A;  2HV1 A;  2ZOI A;  4UEY A;  2PU2 A;  2ZD8 A;  4JLF A;  4P6Z S;  5KIZ A;  4K0X A;  5AQ7 A;  1SDN A;  3MKF A;  5GHX A;  3CLO A;  4OQG A;  4EQI A;  5F82 A;  1QME A;  2PYR A;  4HP9 A;  4JF4 A;  4RX3 A;  4R38 A;  3AGD A;  3LR0 A;  1W63 Q;  2EFX A;  2VEA A;  2I9V A;  3UB8 A;  2E8I A;  2VGL S;  3SS4 A;  1CK3 A;  3T1S A;  4DJ2 A;  1P97 A;  3VP2 A;  4LCM A;  4BD0 A;  4WZ5 A;  1J3W A;  1DJB A;  1OTD A;  2JE5 A;  2GNX A;  4EET B;  2NUT C;  3QP5 A;  4O8G A;  4JGO A;  1LSV A;  3CIT A;  4ME4 A;  5C5K A;  3G6O A;  3EEA A;  3H9W A;  5I94 A;  5DJT A;  5AVE A;  4HH2 A;  1TS6 A;  3IBJ A;  3ICY A;  3D3O A;  3EQU A;  2WKI A;  2ZMV A;  3UDF A;  3C2W A;  4S2N C;  4LRZ E;  5DTT A;  2W1T A;  2XD1 A;  4UQI S;  3JYI A;  2X71 A;  1IKI A;  3TJZ C;  1LL8 A;  2JCH A;  1K4F A;  2M1C A;  1CEG A;  2IWC A;  4OOY A;  3WRZ A;  4CLC B;  3JVV A;  5FQM A;  4S2K A;  4HP4 A;  3DTI A;  2I72 A;  3HUN A;  1S0W A;  3OOV A;  3S1Y A;  3QP6 A;  1YT4 A;  2R9X A;  1LLB A;  5HAI A;  1YSQ A;  3MFD A;  4I3I A;  1STZ A;  2QJ7 A;  4II7 A;  3DTM A;  1OTB A;  1F98 A;  1ERM A;  1G6O A;  4QD4 A;  3ZFZ A;  4WYY A;  5F6A A;  3T1Q B;  3LGO A;  4LLO B;  2HP9 A;  3KYZ A;  4WEL A;  4KQD A;  5HL1 A;  2PR6 A;  1SDE A;  2X02 A;  2H28 A;  1PWG A;  1UGU A;  5GL9 A;  3V67 A;  1E3U D;  1T1B A;  3TW8 A;  2Y59 A;  5FQ9 A;  4PM9 A;  2J3T D;  4N1H A;  2CMN A;  1G5U A;  1SZV A;  1W63 M;  3GSG A;  3ZG9 B;  3UPN A;  5TGF A;  4Z9Q A;  5KZH A;  4HY8 A;  5F68 A;  2J3W A;  3V3S A;  5FL3 A;  3N8S A;  3E98 A;  4KG5 A;  3RTY A;  1S4R A;  4ARZ B;  5HAP A;  4NK3 A;  4OP8 A;  4H6J A;  5E2E A;  1LL9 A;  3PBT A;  2JC7 A;  5EFW A;  1H8Z A;  3BW6 A;  5IS1 A;  4QY6 A;  5FEF A;  3C7U A;  1HZO A;  3ISG A;  3D72 A;  3LID A;  2V2F F;  3N8L A;  4LV3 A;  5FAT A;  2WGV A;  1OTE A;  3UE0 A;  4AFI A;  4GD6 A;  3GDI A;  1NRF A;  1PWD A;  2PU4 A;  3Q7V A;  2O9C A;  3SH8 A;  3RXW A;  3C8C A;  2O9B A;  3G32 A;  5CED A;  1XJ3 A;  2ZQ8 A;  4DDY A;  4OPZ A;  2QKP A;  3SOI A;  1KE4 A;  4ZJ3 A;  5FAQ A;  1ONH A;  2XH9 A;  2WZX A;  1S66 L;  4S2I A;  2ZC6 B;  5L09 A;  3WS1 A;  4E3I A;  5D3O A;  3NIA A;  4GCZ A;  3T4O A;  3T50 A;  4JXS A;  2WKP A;  4O01 A;  3UB7 A;  1TVF A;  1VM1 A;  2V8F A;  1JTG A;  4BMW A;  1VET B;  1VEU A;  1IOU A;  3OPH A;  4HJ6 A;  4ZBE A;  5CHU A;  2Z6C A;  2O99 A;  3LUQ A;  1O07 A;  3IF6 C;  3OC2 A;  1Y4O A;  1PI5 A;  4JPM A;  3IWO A;  3HLC A;  1ONG A;  1W8Q A;  3LO7 A;  1NYY A;  3LR4 A;  2HGV A;  4ESP A;  5DVA A;  4BLM A;  3OPL A;  4JGR A;  1OPX A;  3C38 A;  2EFU A;  2XK1 A;  1BLH A;  4XXR A;  1P9W A;  2J7V A;  4Y0T A;  4IVI A;  1W5D A;  3UE1 A;  2P9V B;  4P87 A;  4GJ4 A;  2OLV A;  2Y2G A;  1KE0 A;  2GJ3 A;  4UHU A;  3VP3 A;  1ESU A;  3E4Q A;  5CHJ A;  4G3K A;  2G7U A;  4R4R A;  3BFC A;  5HWV A;  1K6R A;  5HPF A;  3IF6 B;  1MKM A;  2J3T C;  2XA7 S;  3IHA A;  2ZC4 B;  1NXY A;  4N1X A;  1YLT A;  2MJ6 A;  4OQI A;  4Q0J A;  1K57 C;  4HBT A;  4DE3 A;  3NDE A;  2QJ5 A;  3BQA A;  1YM1 A;  1SHV A;  4R6L A;  2V1Z A;  1NY0 A;  4XT2 A;  3MZF A;  2ZQD A;  3BFG A;  1TDL A;  4DJ3 A;  2R78 A;  3P09 A;  3PBS A;  4U3T A;  2VV7 A;  1YLP A;  2ZC5 B;  3V50 A;  2W3G A;  4I39 A;  1OT9 A;  4Y17 A;  1BSG A;  3VE3 A;  4KZ6 A;  4BD1 A;  2DRW A;  1YLZ A;  2FZ0 A;  4K08 A;  2GZA A;  5HD3 A;  4R0Q A;  1I2S A;  2W0N A;  5EM0 A;  5F83 A;  1FQG A;  1NLY A;  3L7H A;  4JGP A;  1GA9 A;  1BUE A;  1EI5 A;  3Q07 A;  1UWP X;  3IF6 A;  3F1N A;  1MXO A;  3DW0 A;  2JKF A;  1VQQ A;  1WE4 A;  3IX3 A;  3N8R A;  3ULF A;  5EVE A;  3SH7 A;  3E0Y A;  4G3W A;  4WEK A;  4E3K A;  1K54 A;  3D9Y A;  4G3V A;  1FIK A;  2HDS A;  1W79 A;  1YAX A;  1T19 A;  3FWL A;  3UDX A;  4E3L A;  4KZ5 A;  5HSQ A;  4KZ3 A;  5K5B A;  1OTI A;  3ZCZ A;  2Y91 A;  2D02 A;  2O9A A;  3IWQ A;  2KLI A;  3V3R A;  2ZC7 A;  3IXG A;  2Q9N A;  2VGK A;  4FCF A;  4PKY G;  4GZB A;  4F3L B;  3UB6 A;  3CZD A;  3BJN A;  2P08 A;  4HEF A;  4ID4 A;  5FQK A;  3BLM A;  4N9L A;  4BQM A;  5M19 A;  1TDG A;  5CX7 A;  5EUA A;  2ZQ9 A;  3CJM A;  3M6H A;  3ZQ5 A;  3CMZ A;  4X6T A;  1H8M A;  4L9F A;  4KZ8 A;  2E8J A;  4KQO A;  4PMA A;  2INW A;  4X56 A;  2Y2Q A;  3LR5 A;  2JKR M;  2UWX A;  4S2M A;  1XJ2 A;  3ZDJ A;  2BG1 A;  2IA2 A;  4OKP A;  3UY6 A;  1XXM A;  4P85 A;  1MBL A;  2M7V A;  3LY3 A;  3VFH A;  5DF8 A;  2HDR A;  1K38 A;  3MXR A;  1LI0 A;  3LEQ A;  5M18 A;  5FQI A;  4YFM A;  5G4Y A;  3K2N A;  3KSI A;  1K6S A;  1YMX A;  3T4S A;  2H0T A;  2WAF A;  4LV2 A;  2WUQ A;  5KSC A;  2HZ5 A;  4BJP A;  2Y55 A;  1WYC A;  1DJA A;  1N9B A;  1NRJ A;  4GB7 A;  4OLD A;  3RXX A;  4E04 A;  2AVX A;  1KDS A;  3T4Q A;  1YLW A;  4BL3 A;  5E2H A;  1D06 A;  1L0E A;  1N9O A;  4EBL A;  3NBL A;  2P7J A;  4IED A;  1JWP A;  4CLC E;  1S67 L;  3MJQ A;  4OOL A;  4A5R A;  5HDD A;  1XKZ A;  2P74 A;  4WUJ A;  1GA0 A;  3B47 A;  4EEP A;  3AGE A;  5DKL A;  3FG8 A;  1E4D A;  3G4P A;  4QPR A;  1K56 A;  3A3J A;  4M4X A;  1DP8 A;  3W4Q A;  2WK0 A;  2LB9 A;  1HTZ A;  4UAA A;  5HW3 A;  1NZO A;  5TR7 A;  5HL6 A;  3KSF A;  1FSW A;  4YNR A;  4CLC D;  3VFF A;  3E2L A;  3HLG A;  2DCF A;  2Z2L B;  4DXC A;  2H10 A;  3EGD C;  5A91 A;  1NYM A;  5KMW A;  3M2J A;  2OSU A;  4LGW A;  2V1A A;  2V0W A;  4MN6 A;  5A8B A;  4EV4 A;  2CC1 A;  5EPH A;  3IX4 A;  3ITB A;  3C4P A;  5HAR A;  2PD7 A;  3NC8 A;  2WKQ A;  4I5S A;  3NDG A;  2L0W A;  2ZM2 A;  5DTS A;  3N7W A;  1K56 D;  5F1G A;  1PNE A;  4IUH A;  1BLS A;  4P6Z M;  4QB8 A;  2LB5 A;  1DY6 A;  4QY5 A;  1YKD A;  1MWT A;  5GLB A;  4X55 A;  2Y2N A;  2XR0 A;  4CLC C;  1MWS A;  1DRM A;  1S4S A;  3DTE A;  2KOI A;  4LPZ A;  1IYP A;  4WEJ A;  3BM6 A;  5GLC A;  5HFO A; 
#chains in the Genus database with same CATH homology
 1HZO A;  1YLY A;  2GDN A;  3ISG A;  4OP5 A;  1K57 A;  3HBR A;  2V2F F;  4N9K A;  3N8L A;  1ES4 A;  4LV3 A;  5FAT A;  2WGV A;  1XX2 A;  1PWC A;  4KQR A;  2XGN A;  3UE0 A;  4GD6 A;  1KE3 A;  2C5W B;  1NRF A;  4D2O A;  1CEF A;  1PWD A;  2PU4 A;  2P9V A;  3Q7V A;  2EX9 A;  5CEB A;  1MY8 A;  3SH8 A;  3Q7Z A;  3RXW A;  3VSK A;  3AGF A;  2Y2L A;  3IF5 A;  3OPR A;  3CG5 A;  5FQQ A;  2RCX A;  1RGZ A;  3G32 A;  4RVA A;  5CED A;  1BZA A;  2ZQ8 A;  3UE3 A;  5FAS A;  4S2O A;  4X68 A;  4DDY A;  4OPZ A;  1BT5 A;  3BYD A;  1I2W A;  3SOI A;  5AQ9 A;  3UNW A;  4QJG A;  3C7V A;  1KE4 A;  1TEM A;  4ZJ3 A;  5EEC A;  4R23 A;  4UA9 A;  5FAQ A;  1ONH A;  3NCK A;  3W8K A;  3WS2 A;  2ZJ9 A;  3HL9 A;  2XH9 A;  3FKV A;  4OON A;  1GHI A;  2G2W A;  4RYE A;  2WZX A;  5CGS A;  4S2I A;  2ZC6 B;  4GD8 A;  4KZ4 A;  4OPY A;  3WS1 A;  5A92 A;  5BOH A;  4E3I A;  5D3O A;  1HD8 A;  3NIA A;  1Q2Q A;  3MXS A;  5E43 A;  4JXS A;  2Y4A A;  4U0X A;  1SCW A;  1KGF A;  1RCJ A;  3GRJ A;  1TVF A;  1VM1 A;  4E6W A;  1IYQ A;  1JTG A;  3A3I A;  3N4I A;  2IWD A;  4JXW A;  4U0T A;  4GNU A;  2Y2M A;  3W4O A;  3Q1F A;  3VP0 A;  3OPH A;  4ZBE A;  1H5X A;  1Y54 A;  5CHU A;  5A93 A;  3BFE A;  5L2F A;  1RP5 A;  1PW8 A;  1O07 A;  3IF6 C;  3PAE A;  1W8Y A;  1U60 A;  3OC2 A;  1L0G A;  4KZB A;  3DWK A;  3PBN A;  3TSG A;  1PI5 A;  4JPM A;  3MZD A;  3Q7V B;  3IWO A;  4BEN A;  2WGW A;  1PI4 A;  5IHV A;  1L0D A;  3GVB A;  3HLC A;  1ONG A;  1W8Q A;  3LO7 A;  1NYY A;  3OZH A;  1EWZ A;  5DVA A;  5GLD A;  4BLM A;  3LY4 A;  5JYO A;  3OPL A;  3O87 A;  5CGW A;  1N4O A;  1MWU A;  2EFU A;  5M1A A;  4EBP A;  2XK1 A;  5CEC A;  1RGY A;  3ZNY A;  1BLH A;  3LEZ A;  3RJU A;  2FFF B;  4R1G A;  4XXR A;  2BLS A;  2XFS A;  3SS5 A;  4YIN A;  2J7V A;  4Y0T A;  4IVI A;  1W5D A;  5FAP A;  2ZQA A;  3UE1 A;  2P9V B;  4P87 A;  1LI9 A;  2OLV A;  2Y2G A;  1KE0 A;  1OME A;  4UHU A;  3B3X A;  1ESU A;  3VP3 A;  5CHJ A;  2HDQ A;  3PBQ A;  3Q81 A;  1K55 A;  3IXB A;  4MLL A;  3NI9 A;  4OLG A;  4DKI A;  4HES A;  4R4R A;  5AQA A;  5EE8 A;  3BFC A;  4OVD A;  5EOO A;  4DE1 A;  5EVL A;  1K6R A;  3PAG A;  1XP4 A;  3IF6 B;  4ZTK A;  2QPN A;  3IHA A;  1ZG6 A;  1J9M A;  2B5R A;  2ZC4 B;  3P98 A;  1NXY A;  4DXB A;  2HPB A;  2XD5 A;  4MBK A;  4N1X A;  3PTE A;  5GHY A;  1YLT A;  3N6I A;  4KZ9 A;  4DE0 A;  2A49 A;  4OQI A;  2OLU A;  5CRF A;  4JF5 A;  3Q82 A;  4QU3 A;  1Q2P A;  1KVM A;  1K57 C;  4HBT A;  1C3B A;  3HUM A;  4DE3 A;  4PM5 A;  3NDE A;  1ZG4 A;  1YM1 A;  1SHV A;  5CTN A;  2V1Z A;  1NY0 A;  1H8Y A;  4IBR A;  3MZF A;  5FI7 A;  1PZP A;  5A90 A;  2J8Y A;  2ZQD A;  5FDH A;  4B4Z A;  3PBO A;  2V20 A;  3BFG A;  1JVJ A;  1XA7 A;  1TDL A;  4B88 A;  4OQH A;  3SH9 A;  3P09 A;  3PBS A;  4NET A;  4U3T A;  2WAD A;  1MWR A;  1YLP A;  4KEN B;  2ZC5 B;  3GMW A;  1ES5 A;  1I5Q A;  3MBZ A;  3V50 A;  1W7F A;  2J9O A;  5EVI C;  4OPR A;  3ZG7 B;  1DJC A;  1FCM A;  1BLP A;  2J9P A;  5AQB A;  4LEN A;  1BSG A;  5JYP A;  1ZKJ A;  1YLJ A;  4KZ6 A;  4KQQ A;  2EXA A;  4KZ7 A;  1AXB A;  5U47 A;  4BD1 A;  3G34 A;  4UA7 A;  2DRW A;  1YLZ A;  4PM6 A;  4C3Q A;  3GV9 A;  1IYO A;  4DRT A;  4R0Q A;  4C75 A;  1WYB A;  1I2S A;  2FFY A;  5FI6 A;  1XGJ A;  2C6W B;  3HLW A;  5F83 A;  4X53 A;  1LL5 A;  4DE2 A;  3E2K A;  1ERQ A;  1PZO A;  1FQG A;  2HDU A;  2XLN A;  3G2Z A;  1BTL A;  1GA9 A;  4FSF A;  1PYY A;  2DNS A;  3WS4 A;  1BUE A;  1Z6F A;  1EI5 A;  1JWZ A;  4GN2 A;  5CXW A;  5DF7 A;  4DDS A;  4P0M A;  2ZQC A;  1E3U A;  3GTC A;  3Q07 A;  3IF6 A;  5TFQ A;  1FOF A;  4LCL A;  2VGJ A;  3FZC A;  4BL2 A;  4N92 A;  1MXO A;  3FV7 A;  2OV5 A;  1KGE A;  4IVK A;  5HX9 A;  3BFF A;  3UO9 A;  2Y2P A;  1BUL A;  4Y0U A;  3DW0 A;  5EOE A;  3WS0 A;  5J8X A;  4WMC D;  2ZMA A;  1IYS A;  1FR6 A;  1VQQ A;  1WE4 A;  1YMS A;  2WKE A;  3N8R A;  2JBF A;  3O3V A;  4H8R A;  3TOI A;  2WGW B;  3A3D A;  3SH7 A;  3QNB A;  3V5M A;  3G2Y A;  3O88 A;  4XUX A;  1IEL A;  5EVI A;  1LHY A;  4R3J A;  3S22 A;  1NZU A;  4WEK A;  4Y0O A;  1PW1 A;  4E3K A;  1ES3 A;  1K54 A;  4GDB A;  1QMF A;  3SS3 A;  5FQJ A;  4WMC A;  3IXH A;  4QHC A;  4ZAM A;  4GDN A;  2XEP A;  3OCN A;  3BLS A;  4E3N A;  5CGX A;  2HDS A;  3ZHH A;  1W79 A;  2Z2M B;  3LCE A;  3FWL A;  4GKU A;  3UDX A;  1K55 C;  4KG2 A;  3BEB A;  4E3L A;  4KZ5 A;  4KZ3 A;  3OCL A;  4JXV A;  5HAQ A;  1BLC A;  4HBU A;  1XGI A;  2ZM8 A;  2EX8 A;  4WZ5 C;  5CER A;  3ZCZ A;  1KVL A;  4FH2 A;  2Y91 A;  3IWQ A;  1K54 C;  3UDI A;  2HP5 A;  3ZVW A;  4EWF A;  3DWZ A;  4XUZ A;  2Y2K A;  5FSR A;  3G31 A;  4OQ0 A;  3MZE A;  3V3R A;  2QMI A;  2ZC7 A;  3IXG A;  2Q9N A;  3HLE A;  2VGK A;  2PU2 A;  4FCF A;  3QNC A;  2ZD8 A;  4JLF A;  4GZB A;  2R9W A;  3WWX A;  3CZD A;  3HRE A;  4K0X A;  5AQ7 A;  5GLA A;  1FSY A;  3M6B A;  4HEF A;  3IH9 A;  4ID4 A;  4WZ4 A;  1SDN A;  3MKF A;  5GHX A;  3OPP A;  3BLM A;  5FQK A;  4CPK A;  3UPO A;  4N9L A;  4BQM A;  4MNR A;  4OQG A;  1TDG A;  4EQI A;  5M19 A;  5F82 A;  1QME A;  5EUA A;  2ZQ9 A;  3A3E A;  4E3O A;  4LV0 A;  3ZG0 A;  5F1F A;  4JF4 A;  4RX3 A;  3CJM A;  3IQA A;  3M6H A;  2ZC3 B;  2RL3 A;  1KDW A;  3AGD A;  3CMZ A;  3VMA A;  4X6T A;  3V39 A;  2EFX A;  4EUZ A;  4KZ8 A;  3VSL A;  2E8I A;  2XQZ A;  3SS4 A;  4JF6 A;  1CK3 A;  4KQO A;  5FI2 A;  4PMA A;  4E6X A;  4ZDX A;  3VP2 A;  4X56 A;  3TG9 A;  1JTD A;  2Y2Q A;  3G30 A;  1KGG A;  4LCM A;  4BD0 A;  2UWX A;  5KSH A;  4S2M A;  4WZ5 A;  3BRM A;  1DJB A;  3ZDJ A;  1IKG A;  4CJN A;  2BG1 A;  3FYZ A;  4EBN A;  4OKP A;  1HVB A;  3C5A A;  3UY6 A;  2JE5 A;  1XXM A;  3W4P A;  4P85 A;  1MBL A;  4S2P A;  3LY3 A;  5GHZ A;  5FAO A;  1SKF A;  3VFH A;  2HDR A;  1K38 A;  4JXG A;  1ALQ A;  3MXR A;  5DF8 A;  3WS5 A;  4PM8 A;  1LI0 A;  3ZG5 A;  1NJ4 A;  5EVI B;  5CTM A;  3VP4 A;  4E3J A;  4KG6 A;  5DTK A;  5M18 A;  4FH4 A;  1CI9 A;  3BFD A;  4OH0 A;  4RA7 A;  2Y2H A;  5FQI A;  4WM9 A;  4YFM A;  1K4E A;  5I94 A;  4PPR A;  2G2U A;  2WZZ A;  1K6S A;  1YMX A;  4C6Y A;  1L0F A;  3IXD A;  3EQU A;  2H0T A;  2WKI A;  2WAF A;  3UDF A;  5E2F A;  2XF3 A;  4GOG A;  4LV2 A;  3BEC A;  4S2N C;  4P6B A;  4B4X A;  2WUQ A;  5KSC A;  4BJP A;  2Y55 A;  2EX6 A;  5DTT A;  2XD1 A;  1WYC A;  1DJA A;  3IT9 A;  3JYI A;  1N9B A;  2X71 A;  3PBR A;  4GB7 A;  4OLD A;  3RXX A;  5G18 A;  1IKI A;  3ZNT A;  1KDS A;  1YLW A;  3ZG8 B;  3HLD A;  4BL3 A;  1XA1 A;  5E2H A;  1L0E A;  2JCH A;  3VP1 A;  1K4F A;  1CEG A;  2IWC A;  4OOY A;  3WRZ A;  2IWB A;  4EBL A;  3NBL A;  5EVI D;  2X01 A;  4IED A;  1ES2 A;  1JWP A;  5FQM A;  3I7J A;  1G6A A;  4L0L A;  4OOL A;  4A5R A;  4S2K A;  4ZJ2 A;  1GHM A;  1XKZ A;  4JKT A;  2P74 A;  1GA0 A;  4IBX A;  1G68 A;  3HLF A;  4E3M A;  3AGE A;  3MKE A;  2I72 A;  4FD8 A;  3HUN A;  2A3U A;  2Q9M A;  1S0W A;  3S1Y A;  1E4D A;  4DF6 A;  3C4O A;  3G4P A;  4KZA A;  1YT4 A;  1K56 A;  2EX2 A;  2R9X A;  3ITA A;  4MBF A;  2ZM0 A;  3UN7 A;  3UPP A;  1O7E A;  2Y2O A;  2Y2J A;  3A3J A;  1LLB A;  4K91 A;  5HAI A;  3W4Q A;  2WK0 A;  1HTZ A;  3MFD A;  2ZLY A;  5DF9 A;  4UAA A;  1L2S A;  5HW3 A;  1NZO A;  4WBG A;  1FR1 A;  3A3F A;  5TR7 A;  3DTM A;  3IHB A;  1ERM A;  4S2N A;  3NY4 A;  1ERO A;  1FSW A;  4QD4 A;  3ZFZ A;  2WKH A;  3VFF A;  3ZGA B;  4WYY A;  1JWV A;  2WAE A;  3E2L A;  3O86 A;  3HLG A;  2DCF A;  2Z2L B;  4DXC A;  4ZJ1 A;  1FCN A;  2H10 A;  4Q8I A;  2WGI A;  2HP9 A;  5FA7 A;  4WEL A;  5A91 A;  5HL1 A;  1NYM A;  3FKW A;  1SDE A;  2H5S A;  4OPQ A;  2X02 A;  4Y7P A;  3GQZ A;  5KMW A;  3M2J A;  3EQV A;  2ZQ7 A;  4S2L A;  2OSU A;  4MEZ A;  1PWG A;  1ZC2 A;  4OOM A;  2HP6 A;  4M3K A;  5CHM A;  4EV4 A;  4K0W A;  2CC1 A;  5EPH A;  5GL9 A;  1E25 A;  4F94 A;  1E3U D;  4S2J A;  2PBY A;  3ITB A;  3C4P A;  3IH8 A;  5HAR A;  1M6K A;  3HLB A;  3NC8 A;  3D4F A;  3IWI A;  1MKI A;  2Y59 A;  3G35 A;  1M40 A;  1GCE A;  2WYX A;  1ESI A;  5FQ9 A;  4O7D A;  3NDG A;  4PM9 A;  3WRT A;  3QHY A;  1PIO A;  3HVF A;  4N1H A;  2ZM2 A;  4JBF A;  5DTS A;  3S4X A;  3N7W A;  1K56 D;  1IEM A;  5F1G A;  2EXB A;  4R3B A;  1BLS A;  4QB8 A;  3GSG A;  3ZG9 B;  3UPN A;  5TGF A;  4Z9Q A;  1DY6 A;  5KZH A;  1XPB A;  4QY5 A;  2QZ6 A;  1FCO A;  4PM7 A;  3VOY A;  1MWT A;  3V3S A;  1MPL A;  4RX2 A;  5GLB A;  3M2K A;  3N8S A;  4X55 A;  3VOZ A;  2Y2N A;  4KG5 A;  2XR0 A;  1K25 A;  5HAP A;  4LV1 A;  4NK3 A;  4OP8 A;  2Y2I A;  1GHP A;  4R4S A;  1MWS A;  5E2G A;  5E2E A;  1CI8 A;  3HUO A;  1YQS A;  4UA6 A;  1S6R A;  1LL9 A;  3PBT A;  1IYP A;  2JC7 A;  4WEJ A;  1H8Z A;  2H0Y A;  2XDM A;  3BM6 A;  2XFT A;  4MBH A;  5GLC A;  3ZVT A;  4QY6 A;  4X69 A;  3GR2 A;  5HFO A;  3C7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...