2IWCA

Benzylpenicilloyl-acylated mecr1 extracellular antibiotic-sensor domain.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
255
structure length
255
Chain Sequence
GHMSAHVQQDKYETNVSYKKLNQLAPYFKGFDGSFVLYNEREQAYSIYNEPESKQRYSPNSTYKIYLALMAFDQNLLSLNHTEQQWDKHQYPFKEWNQDQNLNSSMKYSVNWYYENLNKHLRQDEVKSYLDLIEYGNEEISGNENYWNESSLKISAIEQVNLLKNMKQHNMHFDNKAIEKVENSMTLKQKDTYKYVGKTGTGIVNHKEANGWFVGYVETKDNTYYFATHLKGEDNANGEKAQQISERILKEMELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords METHICILLIN RESISTANCE MECR1 PROTEIN
publication title Unbound and Acylated Structures of the Mecr1 Extracellular Antibiotic-Sensor Domain Provide Insights Into the Signal-Transduction System that Triggers Methicillin Resistance.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus n315
molecule tags Antibiotic resistance
total genus 91
structure length 255
sequence length 255
ec nomenclature
pdb deposition date 2006-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2iwcA00
5HX9A 3M2KA 1SHVA 3IXGA 3A3IA 3CJMA 5FI7A 2IWBA 3V3RA 4PM5A 3SH8A 4R4SA 3GVBA 1K54C 1FSWA 4EV4A 2XDMA 4BENA 1I2WA 3ZHHA 1FR1A 2ZC5B 3RXWA 3G30A 4PM8A 3HLBA 5TFQA 4FH2A 3N4IA 1K4EA 5G18A 4OONA 2WAEA 1BSGA 1IYPA 3NDEA 3G32A 4S2LA 1NRFA 1YQSA 3OPRA 3WRZA 4Y0UA 1ONGA 2XFTA 1RGZA 1ERQA 1SDNA 2PU4A 1L0FA 1W7FA 4ZAMA 1MY8A 4EBPA 2BLSA 3Q1FA 5KSCA 5KMWA 1TDGA 5GHXA 1BLPA 3BRMA 2HPBA 4OP8A 4BL2A 1YT4A 3MZEA 3E2LA 1IYOA 4R0QA 4OOYA 4BD1A 3NCKA 2VGJA 4C3QA 3G35A 1JWZA 1SDEA 1L0EA 1BLSA 5EOEA 3S1YA 3WS4A 3OCNA 1ES2A 4L0LA 3N8LA 4R23A 1K25A 4FD8A 2Y2KA 3M6BA 1U60A 4ZDXA 1XA1A 4DDYA 1DJAA 2ZQ9A 2ZM2A 4X53A 4Q8IA 1PYYA 4Y0OA 3UPNA 1GHIA 1HTZA 1YMSA 1TEMA 2WGVA 3A3FA 3BM6A 3W4QA 3BEBA 3DW0A 3LY4A 1K57C 4GD6A 3ZNYA 3B3XA 2HDUA 4BL3A 3Q7VA 2HP9A 3Q07A 4E3LA 3C7UA 5CHJA 5DF9A 1PZOA 2GDNA 4WMCA 4JPMA 4BLMA 1FOFA 2QZ6A 1M6KA 1SKFA 5CEBA 5EE8A 3GQZA 1ERMA 3IF5A 1Q2QA 2G2WA 2OLUA 1XX2A 1XPBA 1DJBA 3WS0A 3MZFA 2WZZA 3PBNA 1IEMA 4WMCD 5CGSA 3CZDA 1ES5A 4UAAA 5M1AA 1PWCA 1QMEA 1NYMA 2Y59A 5KSHA 4IBRA 4H8RA 4NETA 4GN2A 4MLLA 4JXGA 3C4PA 5TR7A 3ITBA 4X56A 2HDQA 2DRWA 3Q7ZA 2EX8A 5F1FA 1LHYA 3MKEA 2Y2QA 4PM6A 1ZG6A 2EXBA 3MFDA 4R3JA 4OLDA 3UDXA 1HVBA 1K4FA 3S4XA 2XFSA 5E2GA 4MEZA 5FDHA 3IF6C 3W8KA 5U47A 1I2SA 2OSUA 1XKZA 2JBFA 4KZAA 1CI9A 4KG2A 3ZG9B 1EWZA 3DWKA 2WKHA 3ZGAB 2WKIA 3PBRA 1CEFA 5A90A 2H0TA 4JF6A 4JXWA 4KZ7A 4RA7A 3BFGA 3HLGA 3UPPA 2XD5A 4C75A 3MZDA 3FV7A 4IVIA 4OLGA 4GKUA 3ZVTA 5EVIA 4EBNA 4WEKA 3EQVA 5HARA 3BYDA 4R1GA 4PM9A 3M6HA 1GA0A 3VOZA 3OPHA 3W4PA 1MXOA 4JF4A 2UWXA 3WRTA 4X6TA 1YLZA 1GHPA 3HLEA 2ZQCA 4QHCA 2R9XA 3AGDA 2ZJ9A 4P0MA 4OQIA 5EVID 3SH7A 4IEDA 4OKPA 1ES3A 5CHMA 4U3TA 4PM7A 3A3JA 5FQQA 1WYBA 4P6BA 3ZCZA 3BLMA 4GDBA 4DRTA 5GHZA 3M2JA 4D2OA 5D3OA 2WGIA 4OPZA 5FI2A 4K0XA 5E2HA 2G2UA 4QB8A 3VSKA 2WGWB 5EECA 3VP1A 5A92A 5TGFA 3AGFA 4WZ5A 2Y2IA 2CC1A 5CHUA 4Y7PA 4RVAA 2Y2GA 3HUMA 4N1XA 5CTNA 1ZG4A 2P9VB 5HAPA 5HL1A 1O07A 4N9LA 2Y2JA 2Y91A 3O88A 4NK3A 5HFOA 4E6WA 1QMFA 1BT5A 3HUNA 4P85A 4OVDA 2E8IA 3S22A 2X71A 2ZM8A 1OMEA 2X02A 3O86A 2IWDA 1JTGA 3LY3A 4GNUA 4OQGA 3VFFA 3WS5A 3A3DA 5CECA 4E6XA 4S2IA 1ONHA 1NZUA 4YINA 3BLSA 4ZBEA 1KGEA 3WWXA 3ZDJA 4E3MA 4DKIA 3HLDA 2RL3A 4KENB 2XF3A 4S2NA 5FA7A 5JYPA 1NJ4A 4KZ3A 1CK3A 2V2FF 3GR2A 4FCFA 4GZBA 3VP3A 4QD4A 5F82A 3V5MA 3BFEA 2A3UA 1Y54A 2A49A 4RX3A 4ZTKA 1NYYA 2XQZA 1MKIA 3QNCA 1W8QA 1RCJA 4EWFA 2Y2NA 4QJGA 1KE4A 3OCLA 2R9WA 3QHYA 1S6RA 4BJPA 3Q82A 5J8XA 4DE0A 3UE1A 3IH9A 3UPOA 3ZG5A 5DTTA 5AQBA 3A3EA 3CMZA 4JXSA 1FCOA 3G2YA 4ID4A 3TSGA 3O3VA 4WM9A 1I5QA 1GHMA 1O7EA 1EROA 5CEDA 3V50A 1YLWA 2FFFB 5FQMA 1WYCA 1TDLA 2EX9A 3HUOA 2ZQ8A 3PBQA 1MWUA 5E2FA 1VM1A 4S2OA 5CTMA 2XK1A 5EVIC 1LL5A 4ZJ2A 3G31A 3I7JA 1NXYA 3CG5A 4B88A 2P74A 2WADA 1IKGA 3FZCA 3QNBA 4K0WA 1E4DA 1WE4A 2DCFA 2Z2LB 4KZBA 3IF6B 5AQ7A 1LI9A 4LENA 4BD0A 4ZJ3A 1DJCA 3UDFA 2EXAA 3FYZA 4JF5A 4XXRA 5AQ9A 1KGGA 1KVMA 2H0YA 1LL9A 1Q2PA 4N92A 5E2EA 2JCHA 4DE2A 1ALQA 5F1GA 2ZC6B 3RJUA 2PBYA 3OC2A 1ZKJA 4KZ4A 5CXWA 1J9MA 1K54A 1KGFA 4JKTA 5CERA 4CJNA 2J7VA 4P87A 1FSYA 1CEGA 1Z6FA 4XUZA 4E3IA 1PW1A 1BULA 1BTLA 1XP4A 3G4PA 4WZ5C 2ZQDA 3IHAA 3NBLA 4WYYA 3N8SA 4XUXA 3NDGA 5FQKA 3UE3A 3IXDA 1YLJA 4QY6A 2WYXA 1KE0A 1RP5A 3N7WA 3PBOA 4LV2A 4GDNA 3NI9A 2JE5A 2EX2A 3VMAA 4FH4A 1GCEA 2Y2MA 3IWOA 3WS1A 2ZD8A 3VP2A 1K38A 4EBLA 3PAGA 4ZJ1A 2Y2OA 4LCMA 5FAPA 1XA7A 3PAEA 4WZ4A 5KZHA 3BECA 3D4FA 3VSLA 5GL9A 3MXSA 4LV3A 1ZC2A 1PZPA 4KG5A 5HAQA 1IYQA 2Q9MA 3EQUA 1GA9A 3JYIA 5GLDA 2XD1A 3W4OA 3WS2A 2ZC7A 3LCEA 3N6IA 1PWDA 4OH0A 4C6YA 3HLCA 4E3KA 3ZG8B 4HBTA 5GLAA 1E25A 2HDRA 4A5RA 1FCNA 4YFMA 3FKVA 2H5SA 4F94A 5FQ9A 3ZG0A 1KDWA 2XR0A 1YM1A 5JYOA 2QPNA 3GSGA 5M19A 3ITAA 3GRJA 4DDSA 2X01A 1CI8A 1XXMA 1VQQA 2ZMAA 5L2FA 3HLFA 1KVLA 3VFHA 5EOOA 5EUAA 1MBLA 2H10A 5M18A 3E2KA 5HAIA 5FAQA 1IKIA 1KE3A 2EFUA 1N4OA 2C6WB 3HL9A 3OPLA 3P09A 2Y2HA 3V3SA 4S2PA 4HESA 2XH9A 3IH8A 1E3UA 3SS4A 4DF6A 4Z9QA 3IWQA 3ZFZA 4KZ9A 1BLHA 2DNSA 4IBXA 4HEFA 1PW8A 4WELA 5CGXA 5CGWA 3C7VA 3UY6A 3ZVWA 2EX6A 3UNWA 4DE1A 2EFXA 3O87A 3C5AA 5FASA 4R3BA 4U0XA 1E3UD 4B4ZA 1FQGA 1W79A 3SH9A 5EVIB 4HBUA 2B5RA 4RX2A 4UA6A 2WK0A 4X69A 3AGEA 3HVFA 4WEJA 5FQJA 4QU3A 2I72A 1RGYA 5DF8A 4E3NA 3IF6A 2ZLYA 1AXBA 2HP5A 2Z2MB 3HREA 1H5XA 3P98A 5FSRA 3GMWA 1YLPA 3DTMA 4KZ8A 4JXVA 2J8YA 4KZ6A 2WAFA 3MBZA 5GHYA 1K55A 3ISGA 3MKFA 2ZM0A 5EVLA 3GTCA 1TVFA 1MPLA 1HZOA 2IWCA 3IQAA 2HP6A 3OPPA 1H8YA 1IYSA 1K6RA 3FWLA 4GB7A 4PMAA 2ZC4B 5I94A 5FI6A 4X68A 3IHBA 4K91A 1XGJA 1K6SA 1MWSA 4OPRA 2ZQAA 1JWVA 1N9BA 4IVKA 4OPYA 4B4XA 5FATA 3UO9A 4UA7A 4DXCA 1JVJA 1PIOA 3NIAA 4S2KA 4MBFA 3ZG7B 3HLWA 1ESIA 5DF7A 4RYEA 2OLVA 2J9PA 1H8ZA 1YLTA 2Y4AA 4GD8A 1NZOA 5DVAA 3G34A 4JLFA 1SCWA 4MNRA 3NY4A 3SOIA 4KG6A 3LEZA 1FCMA 4OP5A 2XEPA 5DTSA 2WKEA 1G6AA 2V1ZA 5HW3A 5FQIA 5F83A 3TOIA 2VGKA 3C4OA 1ESUA 5A93A 4QY5A 5EPHA 1S0WA 1ES4A 3GV9A 3IXHA 4JBFA 1PI5A 4KQOA 4OQ0A 2PU2A 1L0DA 4KZ5A 4OOLA 4OPQA 4MBHA 4EQIA 3UE0A 3IWIA 3LO7A 3UDIA 1K56A 1G68A 3MXRA 1YMXA 2C5WB 2HDSA 1W5DA 1BUEA 4U0TA 5CRFA 3SS5A 1BZAA 3Q7VB 3NC8A 4S2NC 3V39A 1XGIA 1JTDA 3ZNTA 1FR6A 3DWZA 5AQAA 2Y2PA 2WGWA 1MWTA 5GLBA 1K56D 2XLNA 4LCLA 1MWRA 2Q9NA 1PWGA 3HBRA 4LV0A 5E43A 1L2SA 2ZQ7A 5GLCA 3BFCA 1W8YA 2P9VA 2XGNA 4S2JA 3RXXA 3FKWA 4OOMA 5A91A 2V20A 1DY6A 2ZC3B 1HD8A 5DTKA 4UHUA 5IHVA 3VP0A 1EI5A 4DE3A 3VOYA 4S2MA 2WUQA 1K55C 5BOHA 3BFFA 1LI0A 4PPRA 3VP4A 1JWPA 4E3JA 1BLCA 1L0GA 1K57A 4O7DA 4UA9A 3G2ZA 4OQHA 2QMIA 3PBTA 3TG9A 4N1HA 3N8RA 1KDSA 4MBKA 4EUZA 1LLBA 4R4RA 4N9KA 1YLYA 4GOGA 4E3OA 4KQRA 2FFYA 5FAOA 4X55A 3BFDA 3OZHA 1M40A 2Y2LA 2Y55A 4FSFA 3Q81A 4LV1A 3UN7A 4BQMA 4Y0TA 2OV5A 1PI4A 3IT9A 1C3BA 4WBGA 4M3KA 3PTEA 3SS3A 2JC7A 4KQQA 3PBSA 2J9OA 3IXBA 1IELA 4CPKA 2WZXA 1NY0A 4DXBA 2BG1A 2RCXA
chains in the Genus database with same CATH superfamily
5HX9A 2OAQ1 2IWBA 1VETA 3V3RA 3SH8A 3U2AA 4BENA 1I2WA 4PHTA 2L0WA 3G30A 4PM8A 3HLBA 4FH2A 5G18A 4OONA 1YQSA 3OPRA 1ONGA 4II7A 1GSVA 2W3HA 3JVUA 2VV7A 4I5SA 1MY8A 2BLSA 1TDGA 5GHXA 1BLPA 3BRMA 2HPBA 4E04A 3E2LA 4BD1A 4CLCB 2HZ5A 5KIZA 5EOEA 4L0LA 3BJNA 4MMNA 1XA1A 2ZQ9A 2ZBBA 2JKGA 1TEMA 4YOFA 1XJ6A 3LY4A 4GD6A 3ZNYA 2GDNA 4JPMA 1FOFA 2QZ6A 4BBUA 2XA7S 1G5UA 1DJBA 3MZFA 4GS9A 1YPRA 3PBNA 4WMCD 3SZTA 2GZAA 1PWCA 1OT9A 4H8RA 5TR7A 4X56A 2DRWA 1WA9A 1CQAA 5F1FA 4Y3IA 3G6OA 3UB5P 1ZG6A 2K2NA 4UEYA 2ACGA 2XFSA 3GECA 3ZG9B 1OTEA 1NLYA 1CEFA 4JF6A 3BFGA 3HLGA 1F98A 3LICA 2XD5A 1MC0A 1OTBA 4IVIA 4QWOA 5HZHA 1MKMA 3ZVTA 4GJ4A 3LI8A 2UWXA 4XT2B 1GHPA 2P04A 2GX5A 4PM7A 2EA9A 3A3JA 5FQQA 2B95A 3ZCZA 3OOVA 4GDBA 4D2OA 4GHIA 4OPZA 5E2HA 2G2UA 3VP1A 5TGFA 2Y2IA 4Y7PA 2Y2GA 5CTNA 4UQIM 1O07A 2A24A 2Y2JA 2E8IA 2X71A 2X02A 4HH3A 4GNUA 4NXFA 3ZDJA 2W1TB 5JYPA 3GR2A 2A2LA 5L10A 2H28A 5F82A 1MKIA 1W8QA 2Y2NA 3OCLA 3QHYA 1TS8A 3IH9A 1FCOA 4ID4A 3TSGA 3RH8B 1S66L 1O7EA 3EGDC 2O9BA 2ZQ8A 5E2FA 1VM1A 5EVIC 5HWTA 3G31A 3I7JA 1NXYA 3CG5A 4B88A 2P74A 1E4DA 1OPXA 1WE4A 1OT6A 3C38A 3UDFA 2CMNA 2KOIA 1KVMA 1LL9A 1Q2PA 3KYEA 3QP8A 5F1GA 3LIDA 4G3VA 4MN7A 1CEGA 1PW1A 4WZ5C 2ZQDA 3IHAA 3NOTC 1OJ5A 4Z1WA 4LGWA 3IXDA 3H82B 4QY6A 4Y5FA 2JE5A 2EX2A 4FH4A 4X25A 1K38A 1XA7A 3PAEA 1T1BA 5GL9A 3MXSA 4KG5A 4HIAA 1Z09A 1GA9A 4CQHA 2XD1A 3WS2A 2ZC7A 4H6JB 4OH0A 4E3KA 4ETZA 4YFMA 4UQIS 4EXOA 4F94A 1S67L 4O0PA 5M19A 2M7VA 2K31A 1VQQA 3F1OB 3VFHA 5EUAA 5FAQA 3ZHHA 2EFUA 3IBJA 3LR3A 5HDCA 4HESA 2FZ0A 4DF6A 3HJIA 3IWQA 4R3AA 4IBXA 4CLCD 1CJFA 1PNEA 3NOPC 5EM1A 5K5BA 2EFXA 2JKTM 5AJGA 1E3UD 4B4ZA 2WKRA 5EVIB 2B5RA 2WK0A 5FQJA 4LRZE 2ZLYA 1H5XA 3P98A 5FSRA 3DTMA 3EGXC 2ZM0A 3UB7A 3OPPA 2Z6CA 3FWLA 4PMAA 5FI6A 3IHBA 3VE3A 1MWSA 2M7UA 1JWVA 4DXCA 5FATA 3UO9A 1T1AA 4S2KA 3HLWA 5FL3A 2PRFA 2D02A 1NZOA 4X1MA 3DTEA 4JLFA 5DKKA 2Q0OA 4KG6A 2V1ZA 4R70A 5IU1A 2Y8HA 1LSWA 2PD7A 3MQQA 4KQOA 1H8MA 4KZ5A 4OPQA 4EQIA 3UE0A 2GNXA 3Q7VB 1DRMA 3LIEA 2Y2PA 2WGWA 2QKPA 5GLBA 1K56D 2XLNA 4LV0A 1L2SA 2ZQ7A 5GLCA 4S2JA 5C5KA 3T4LA 5IHVA 1EI5A 4ESPA 3RFBA 5BOHA 4E3JA 1BLCA 1L0GA 1K57A 4UA9A 2QMIA 4MBKA 2PR6A 4X55A 3Q81A 2OV5A 3PTEA 1IELA 4PKYA 4CPKA 3IXGA 3A3IA 3CJMA 4PM5A 4ARZB 4R4SA 1K54C 1FSWA 1VEUA 3UMEA 1HLUP 3VE4A 3N4IA 1NRFA 3PYPA 1SDNA 3T4QA 3MXQA 4ZAMA 3QP1A 3Q1FA 5KSCA 3DTIA 1GSXA 4OP8A 1YT4A 4ZRRA 1IYOA 4R0QA 4OOYA 4C3QA 3G35A 1L0EA 1BLSA 3S1YA 2W0NA 3OBFA 3WS4A 1N9NA 2ZMFA 5DKLA 2XSSA 4R23A 1PRQA 1S1ZA 4DDYA 1DJAA 2ZM2A 3E0YA 1PYYA 4Y0OA 3UPNA 3BM6A 3BEBA 3E98A 4LLOB 4BL3A 2HP9A 3C7UA 2L1MA 3L7HA 4CLCC 2BASA 3GQZA 1Q2QA 5G4ZA 2G2WA 1XX2A 3OLOA 3IBRA 3CZDA 1ES5A 5M1AA 2Y59A 4NETA 4MLLA 2PBDP 2QJ7A 5AVEA 1SKOA 4R3JA 4OLDA 4HH2A 2LB5A 3TJZC 4JGPA 2OSUA 2JBFA 3LGOA 1CI9A 4IHQA 3T1QB 1EWZA 3DWKA 3S7NA 1V9YA 3UMDA 2WKIA 2VK3A 4RA7A 3UPPA 2VX8A 3FC7A 4C75A 3FV7A 4GKUA 4EBNA 3EQVA 5HARA 3BYDA 4NXBA 3M6HA 1ACFA 3W4PA 1P97A 2OOLA 1OTAA 4X6TA 3HLEA 2ZQCA 4K08A 5A8BA 2VEAA 1TS7A 2P7JA 4P0MA 4OQIA 5EVID 1LL8A 4OKPA 5L09A 3BLMA 5FDSA 2O9AA 5GHZA 5FI2A 3LIAA 3VSKA 1YAXA 5A92A 2CC1A 5CHUA 3B47A 4N1XA 5HL1A 4L9EA 4MN6A 4N9LA 5HFOA 1QMFA 3HUNA 4OVDA 5J3WA 2ZM8A 3VFFA 3WS5A 4OQGA 5HD5A 3NECA 3BLSA 4EQ1A 3ICYA 2RL3A 5FA7A 2XF3A 5L07A 3NULA 1S4SA 3ZYTA 1XFQA 2XQZA 4IUKA 5HSQA 5TBMA 4M4XA 3D3OA 3Q82A 5J8XA 1MZUA 3UE1A 3F1NA 3UPOA 3ZG5A 3CMZA 4JXSA 3KSGA 1TS0A 1VETB 4L9FA 1I5QA 5CEDA 1T18A 4R38A 4E3IA 1P9RA 4I3IA 1TDLA 3HUOA 1MWUA 4S2OA 3TW8A 1LL5A 4ZJ2A 2WADA 3D72A 1IKGA 2XRNA 5G4YA 2DCFA 5AQ7A 4Y17A 1ZHHB 4GCZA 4LENA 5F68A 2OAP1 1DJCA 3JVVA 4JF5A 4XXRA 3QP5A 1KGGA 5AQ9A 2HJ9C 4N92A 4DE2A 1ALQA 3RJUA 3OC2A 1N9OA 2E8JA 5CXWA 3LIBA 3E4QA 4HY8A 4CJNA 2J7VA 4P87A 1FSYA 5AVFA 4HQAA 4XUZA 1VB6A 1XP4A 3T50A 5TJJA 3NBLA 3N8SA 3NDGA 4I3AA 2JKFA 2WYXA 3UB6A 4B9OA 2VGLM 3VMAA 3IWOA 3WS1A 2ZD8A 3VP2A 3PAGA 2Y2OA 4LCMA 2GJ3A 3D4FA 2YKHA 5HAQA 2Q9MA 3EQUA 3MQ0A 3N6IA 5DFYA 4C6YA 3S7QA 4HBTA 2VA0A 3HJKA 4GS9B 5GLAA 1E25A 2HDRA 1W63Q 4NG2A 2H5SA 3ZG0A 1KDWA 5JYOA 4DDSA 1CI8A 1XXMA 2ZMAA 3DAVA 5EOOA 5HAIA 1P9WA 1IKIA 1N4OA 3OPLA 5KMWA 4S2PA 4Z9QA 5EM0A 4EU0A 1PW8A 3DTKA 4P6ZM 4JGQA 3MFXA 5CGWA 3PXPA 3C7VA 1D1JA 3UNWA 5HWVA 5FASA 2Y79A 2HV1A 1W79A 3SH9A 3LIFA 3LYXA 4X69A 4WEJA 2QJ5A 2I72A 1RGYA 4CLCE 2V8FA 1AXBA 2Z2MB 5HPFA 1YLPA 1N9LA 4HP4A 4KZ8A 4JXVA 1K55A 3ISGA 3MKFA 5EVLA 1TVFA 2HP6A 3E4PA 1K6RA 3LR0A 2K7SA 5I94A 2KX6A 4OPRA 2ZQAA 1N9BA 4OPYA 1IFQA 4UA7A 1JVJA 1PIOA 3NIAA 3ZG7B 4MBFA 1KOUA 3K2NA 3LEQA 1ESIA 2ZL1A 4Q0HA 2Y4AA 4G3KA 2DMWA 2WKPA 4GD8A 2VGLS 5DVAA 1SCWA 4MNRA 1F2KA 1FCMA 4OP5A 4EW7A 3IX3A 4H6JA 1G6AA 5HW3A 2VV6A 5FQIA 5L8MA 1ESUA 1S0WA 4OQ0A 2PU2A 2NUPC 3UDIA 3CPTB 3MXRA 1W5DA 2V1BA 5CRFA 4S2NC 3F1OA 3ZNTA 1FR6A 3DWZA 3KYZA 1MWTA 2FH5A 4LCLA 1MWRA 2Q9NA 3F1PA 5E43A 1W8YA 2P9VA 2XGNA 3RXXA 5IT5A 3FKWA 5A91A 3V67A 1DY6A 2V9AA 4UHUA 2WUQA 3BFFA 1LI0A 4PPRA 5HDDA 1PFLA 4P6ZS 4OQHA 5EFWA 4N1HA 3N8RA 1KDSA 4EUZA 2QWSA 2FFYA 5FAOA 4Q0JA 3OZHA 1M40A 4I39A 4LV1A 3UN7A 4BQMA 4YWZA 3BW6A 4M3KA 3SS3A 4DMZA 1NWZA 4KQQA 3BQAA 4DXBA 4Q0IA 2BG1A 2RCXA 3M2KA 3MR0A 3GVBA 4EV4A 1UWPX 2PT7A 3RXWA 5TFQA 1K4EA 2WAEA 3NDEA 3G32A 4S2LA 3WRZA 4IJGA 4Y0UA 1TF1A 2XFTA 1ERQA 1L0FA 4EEUA 3NCKA 2VGJA 2MJ6A 2PDRA 1JWZA 1SDEA 3OCNA 3N8LA 1OJGA 3T4OA 3CUEC 1K25A 1A0KA 3M6BA 4KUKA 1OTIA 2NUTC 5DJTA 4ME4A 3S7OA 1HTZA 1YMSA 3A3FA 3RTYA 3A0SA 3DW0A 1K57C 3H7WA 3Q7VA 3Q07A 5DF9A 4WMCA 2PYPA 1SKFA 5CEBA 1XFNA 4AFIA 1ERMA 5IS1A 3LI9A 1XPBA 4NXGA 3IS2A 4WUJA 2IA2A 3IX8A 4Y2FA 4UAAA 3R7WA 5F5YA 5KSHA 4IBRA 2JHEA 4BBVA 4GN2A 3NHQA 3ITBA 3Q7ZA 1LHYA 3MKEA 3MFDA 4L9GA 3UDXA 1HVBA 4HJ6A 2V0UA 5FDHA 3T4TA 3IF6C 1I2SA 3ULFA 3ZGAB 3PBRA 3VV4A 5A90A 1IOUA 4JXWA 5LBRA 3BY9A 4PM9A 1GA0A 3VOZA 3OPHA 3EEHA 3WRTA 4Y13A 2BTFP 2R9XA 3AGDA 2ZJ9A 3SH7A 4IEDA 5CHMA 4DN0A 4DRTA 2EWWA 4KQDA 5D3OA 3S7PA 3K3CA 4K0XA 4QB8A 1OTDA 2WGWB 5EECA 3MSHA 4RVAA 3HUMA 2Y91A 4E6WA 1BT5A 1OMEA 3O86A 2IWDA 1JTGA 3K3DA 3A3DA 4E6XA 4S2IA 1NZUA 1KGEA 3BY8A 1XJ3A 4Y15A 4DKIA 2AVXA 4KZ3A 4F3LA 3NOUC 4FCFA 4FUWA 3VP3A 3V5MA 2QYBA 2A49A 1Y54A 4RX3A 4ZTKA 3KYQA 1DP6A 4EUVA 1RCJA 2W27A 4QJGA 4BJPA 4HP9A 4DE0A 2O9CA 4FOFA 5DTTA 5AQBA 3G2YA 4MCWA 3O3VA 4I38A 3UE6A 3V50A 5FQMA 3PBQA 1VEUB 2XK1A 3FZCA 4K0WA 2PHYA 1S1YA 2Z2LB 4KZBA 3IF6B 2W3GA 1LI9A 2V0WA 2EXAA 3EWKA 3FYZA 1EW0A 5DJUA 2H0YA 5J4EA 5E2EA 3P01A 1S4RA 2ZC6B 1F9IA 2PBYA 3UB8A 4KZ4A 1K54A 5CERA 1Z6FA 4HHDA 3G4PA 3UE3A 4LRYC 3PBOA 4NXEA 4GDNA 3NI9A 1GCEA 2Y2MA 4ZJ1A 1H0MA 5FAPA 5KZHA 3BECA 2JKRI 3DBAA 4LV3A 4ETXA 1IYQA 3JYIA 5GLDA 3LCEA 3HLCA 3ZG8B 1FCNA 3FKVA 2KDKA 5FQ9A 2XR0A 1YM1A 3PR6A 2HGVA 3GSGA 2J3WA 4DJ2A 5L2FA 1SKOB 3HLFA 4JGRA 3IX4A 4CLCA 1MBLA 3QP4A 2H10A 5M18A 3H9WA 1KE3A 2C6WB 3HL9A 4GW9A 3V3SA 2XH9A 3IH8A 1E3UA 3A0RA 1BLHA 5CGXA 5HPIA 5CX7A 2VJWA 2W3EA 3UY6A 1D06A 4DE1A 3O87A 2HF6A 1XJ2A 1XJ4A 4UA6A 1V9ZA 4QU3A 1ODVA 3BWLA 3HREA 2OWJA 3GTCA 1MPLA 3B42A 4GB7A 2ZC4B 4X68A 4K91A 1LSXA 1XGJA 1K6SA 5EV0A 4IVKA 4B4XA 1CF0A 4NEED 3QP6A 4RYEA 1TD5A 2J9PA 1H8ZA 4D60A 2QHKA 1LT0A 2I9VA 1YSQA 4MN5A 1BYWA 3O5YA 3LEZA 2XEPA 2WKEA 3FPVA 2PR5A 5TBMB 5F69A 1D7EA 2VGKA 3C4OA 3MS6A 4XT2A 5EPHA 2W1RA 3F1NB 3GV9A 1FILA 1L0DA 4OOLA 4MBHA 3LO7A 1K56A 1G68A 3L9KA 1YMXA 2ZOIA 2C5WB 4BMWA 1BUEA 4U0TA 1BZAA 3EEAA 3NC8A 3V39A 1XGIA 2INWA 1STZA 1SZVA 2ZC3B 4EESA 5DTKA 3VP0A 3UB9A 4DE3A 3VOYA 4S2MA 1K55C 2JKRM 3VP4A 2W1TA 3G2ZA 4YNRA 4R4RA 4N9KA 4GOGA 4E3OA 3MF0A 2Y2LA 5DFXA 3IT9A 4WBGA 1C3BA 1H3QA 2JC7A 3PBSA 3IXBA 4WF0A 5FI7A 1SHVA 3QP2A 3T1RA 4I3JA 3CWFA 2XDMA 2JKTI 2PD8A 4PKYG 4X1LA 3VOLA 1FR1A 2ZC5B 1JNUA 3T4JA 1BSGA 1IYPA 3CAXA 4LPZA 2YKFA 1RGZA 2O0YA 2PU4A 1W7FA 3KO6A 3LR5A 4EBPA 3FPWA 4WL9A 1L3LA 4BL2A 2G7UA 3MZEA 4GHIB 2O99A 3T4SA 1ZTUA 1ES2A 3CLOA 4FD8A 2A24B 2Y2KA 1U60A 4ZDXA 1T1CA 3H82A 4Q8IA 4X53A 1GHIA 5J7EA 2WGVA 3CPTA 1X0OA 3W4QA 3KSFA 3B3XA 2HDUA 4E3LA 5CHJA 1PZOA 4HJ4A 4BLMA 1M6KA 4QPRA 3HCYA 2JN7A 2VLGA 5EE8A 3IF5A 1AWIA 2OLUA 3WS0A 2WZZA 1IEMA 4PAUA 5CGSA 1QMEA 1NYMA 2LB9A 3EOIA 3LUQA 3LFVA 4JXGA 3C4PA 5HD3A 1UWNX 2HDQA 2EX8A 1GSWA 3MMHA 2Y2QA 4PM6A 2EXBA 3W2ZA 2V8CA 1K4FA 3S4XA 5E2GA 4MEZA 3W8KA 1G6OA 5U47A 1W63M 1XKZA 4KZAA 4KG2A 2ZL1B 2V1AA 3MQOA 2WKHA 2J3TD 2H0TA 4KZ7A 4O8GA 3MZDA 3CITA 4OLGA 4BBTA 5EVIA 4G3WA 1F5MA 4FTXA 4WEKA 4R1GA 1MXOA 4JF4A 1YLZA 4QHCA 2KLIA 1ES3A 4U3TA 1WYBA 4P6BA 3JPUA 3M2JA 3GDIA 2WGIA 3KSIA 3AGFA 5FEGA 4WZ5A 3F1PB 5HAPA 1ZG4A 2P9VB 3A0VA 3O88A 4NK3A 4P85A 3S22A 1T19A 5CECA 3LY3A 3T12B 1ONHA 4YINA 4ZBEA 3WWXA 3FG8A 4LRXC 4E3MA 3HLDA 4KENB 4S2NA 1NJ4A 1CK3A 2V2FF 4GZBA 1G28A 4QD4A 3BFEA 4B93A 2A3UA 1NYYA 3QNCA 4EWFA 1KE4A 4NKPA 2R9WA 1S6RA 4R6LA 3A3EA 4HNBA 3T1XA 4WM9A 1GHMA 2VV8A 1EROA 1YLWA 4WN5A 2FFFB 1WYCA 2EX9A 1TS6A 2XROA 5CTMA 3QNBA 4DJ3A 4BD0A 4ZJ3A 3E4OA 1Y4OA 2JCHA 1ZKJA 4KUOA 1J9MA 1KGFA 4JKTA 5FEFA 2WKQA 1BULA 1BTLA 2B02A 4WYYA 4XUXA 3TE8A 3T1SA 3MJQA 5FQKA 2B18A 1FIKA 1YLJA 1KE0A 1RP5A 3N7WA 4LFUA 4LV2A 5EVEA 2L4RA 2EWVA 4EBLA 3H7WB 4GLQA 4WZ4A 3VSLA 4JGOA 4ARZA 1ZC2A 1PZPA 3W4OA 3D9YA 1PWDA 5F6AA 3CUEA 3IS2B 3SW1A 2VZWA 4A5RA 2R78A 3R7WB 1UGUA 2QPNA 3ITAA 3GRJA 3NJAA 2X01A 3B33A 1VHMA 1KVLA 3BQ8A 5HWWA 3E2KA 2W3DA 4EEPA 3P09A 2Y2HA 2W3FA 1K0KA 3SS4A 3R4KA 3ZFZA 4KZ9A 2DNSA 4HEFA 4WELA 1LSVA 1YSPA 3ZVWA 2EX6A 3C5AA 4R3BA 4U0XA 1FQGA 3LR4A 4HBUA 1P0ZA 4RX2A 3AGEA 3HVFA 5DF8A 4E3NA 3IF6A 2J3TC 5HDSA 2HP5A 3GMWA 2J8YA 3C30A 4RQ9A 4KZ6A 2WAFA 5I5LA 3MBZA 5GHYA 3TRCA 1HZOA 2IWCA 3IQAA 2ZMVA 1H8YA 1NLZA 3P7NA 1IYSA 2D01A 3CI6A 2UV0E 1DP9A 3CHWP 4EERA 5DF7A 2OLVA 2VKSA 2Z6DA 4EETB 1YLTA 4WLAA 4F3LB 3G34A 3NY4A 3SOIA 5DTSA 3KX0X 5F83A 3TOIA 5A93A 2OWHA 4QY5A 3T4KA 1ES4A 3IXHA 4JBFA 1PI5A 2J80A 1DP8A 2P08A 3KSHA 4HOIA 3IWIA 1YKDA 3C2WA 4BWIA 2HDSA 2ZOHA 5MC7A 3U4LP 3SS5A 2XA7M 1JTDA 5AQAA 3PHYA 1PWGA 3HBRA 3BFCA 4O01A 4OOMA 2V20A 4MDZA 1HD8A 4HI4A 2PAVP 1JWPA 5HL6A 1Y28A 4O7DA 3PBTA 3TG9A 2PYRA 1LLBA 1YLYA 1NRJA 4KQRA 3BFDA 2HJEA 2Y55A 4FSFA 4IUHA 4Y0TA 1PI4A 1J3WA 4HJ3A 2J9OA 3C8CA 3ZQ5A 2WZXA 1NY0A 2M1CA
chains in the Genus database with same CATH topology
5HX9A 3M2KA 1SHVA 3IXGA 3A3IA 3CJMA 5FI7A 2IWBA 3V3RA 4PM5A 3SH8A 4R4SA 3GVBA 1K54C 1FSWA 4EV4A 2XDMA 4BENA 1I2WA 3ZHHA 1FR1A 2ZC5B 3RXWA 3G30A 4PM8A 3HLBA 5TFQA 4FH2A 3N4IA 1K4EA 5G18A 4OONA 2WAEA 1BSGA 1IYPA 3NDEA 3G32A 4S2LA 1NRFA 1YQSA 3OPRA 3WRZA 4Y0UA 1ONGA 2XFTA 1RGZA 1ERQA 1SDNA 2PU4A 1L0FA 1W7FA 4ZAMA 1MY8A 4EBPA 2BLSA 3Q1FA 5KSCA 5KMWA 1TDGA 5GHXA 1BLPA 3BRMA 2HPBA 4OP8A 4BL2A 1YT4A 3MZEA 3E2LA 1IYOA 4R0QA 4OOYA 4BD1A 3NCKA 2VGJA 4C3QA 3G35A 1JWZA 1SDEA 1L0EA 1BLSA 5EOEA 3S1YA 3WS4A 3OCNA 1ES2A 4L0LA 3N8LA 4R23A 1K25A 4FD8A 2Y2KA 3M6BA 1U60A 4ZDXA 1XA1A 4DDYA 1DJAA 2ZQ9A 2ZM2A 4X53A 4Q8IA 1PYYA 4Y0OA 3UPNA 1GHIA 1HTZA 1YMSA 1TEMA 2WGVA 3A3FA 3BM6A 3W4QA 3BEBA 3DW0A 3LY4A 1K57C 4GD6A 3ZNYA 3B3XA 2HDUA 4BL3A 3Q7VA 2HP9A 3Q07A 4E3LA 3C7UA 5CHJA 5DF9A 1PZOA 2GDNA 4WMCA 4JPMA 4BLMA 1FOFA 2QZ6A 1M6KA 1SKFA 5CEBA 5EE8A 3GQZA 1ERMA 3IF5A 1Q2QA 2G2WA 2OLUA 1XX2A 1XPBA 1DJBA 3WS0A 3MZFA 2WZZA 3PBNA 1IEMA 4WMCD 5CGSA 3CZDA 1ES5A 4UAAA 5M1AA 1PWCA 1QMEA 1NYMA 2Y59A 5KSHA 4IBRA 4H8RA 4NETA 4GN2A 4MLLA 4JXGA 3C4PA 5TR7A 3ITBA 4X56A 2HDQA 2DRWA 3Q7ZA 2EX8A 5F1FA 1LHYA 3MKEA 2Y2QA 4PM6A 1ZG6A 2EXBA 3MFDA 4R3JA 4OLDA 3UDXA 1HVBA 1K4FA 3S4XA 2XFSA 5E2GA 4MEZA 5FDHA 3IF6C 3W8KA 5U47A 1I2SA 2OSUA 1XKZA 2JBFA 4KZAA 1CI9A 4KG2A 3ZG9B 1EWZA 3DWKA 2WKHA 3ZGAB 2WKIA 3PBRA 1CEFA 5A90A 2H0TA 4JF6A 4JXWA 4KZ7A 4RA7A 3BFGA 3HLGA 3UPPA 2XD5A 4C75A 3MZDA 3FV7A 4IVIA 4OLGA 4GKUA 3ZVTA 5EVIA 4EBNA 4WEKA 3EQVA 5HARA 3BYDA 4R1GA 4PM9A 3M6HA 1GA0A 3VOZA 3OPHA 3W4PA 1MXOA 4JF4A 2UWXA 3WRTA 4X6TA 1YLZA 1GHPA 3HLEA 2ZQCA 4QHCA 2R9XA 3AGDA 2ZJ9A 4P0MA 4OQIA 5EVID 3SH7A 4IEDA 4OKPA 1ES3A 5CHMA 4U3TA 4PM7A 3A3JA 5FQQA 1WYBA 4P6BA 3ZCZA 3BLMA 4GDBA 4DRTA 5GHZA 3M2JA 4D2OA 5D3OA 2WGIA 4OPZA 5FI2A 4K0XA 5E2HA 2G2UA 4QB8A 3VSKA 2WGWB 5EECA 3VP1A 5A92A 5TGFA 3AGFA 4WZ5A 2Y2IA 2CC1A 5CHUA 4Y7PA 4RVAA 2Y2GA 3HUMA 4N1XA 5CTNA 1ZG4A 2P9VB 5HAPA 5HL1A 1O07A 4N9LA 2Y2JA 2Y91A 3O88A 4NK3A 5HFOA 4E6WA 1QMFA 1BT5A 3HUNA 4P85A 4OVDA 2E8IA 3S22A 2X71A 2ZM8A 1OMEA 2X02A 3O86A 2IWDA 1JTGA 3LY3A 4GNUA 4OQGA 3VFFA 3WS5A 3A3DA 5CECA 4E6XA 4S2IA 1ONHA 1NZUA 4YINA 3BLSA 4ZBEA 1KGEA 3WWXA 3ZDJA 4E3MA 4DKIA 3HLDA 2RL3A 4KENB 2XF3A 4S2NA 5FA7A 5JYPA 1NJ4A 4KZ3A 1CK3A 2V2FF 3GR2A 4FCFA 4GZBA 3VP3A 4QD4A 5F82A 3V5MA 3BFEA 2A3UA 1Y54A 2A49A 4RX3A 4ZTKA 1NYYA 2XQZA 1MKIA 3QNCA 1W8QA 1RCJA 4EWFA 2Y2NA 4QJGA 1KE4A 3OCLA 2R9WA 3QHYA 1S6RA 4BJPA 3Q82A 5J8XA 4DE0A 3UE1A 3IH9A 3UPOA 3ZG5A 5DTTA 5AQBA 3A3EA 3CMZA 4JXSA 1FCOA 3G2YA 4ID4A 3TSGA 3O3VA 4WM9A 1I5QA 1GHMA 1O7EA 1EROA 5CEDA 3V50A 1YLWA 2FFFB 5FQMA 1WYCA 1TDLA 2EX9A 3HUOA 2ZQ8A 3PBQA 1MWUA 5E2FA 1VM1A 4S2OA 5CTMA 2XK1A 5EVIC 1LL5A 4ZJ2A 3G31A 3I7JA 1NXYA 3CG5A 4B88A 2P74A 2WADA 1IKGA 3FZCA 3QNBA 4K0WA 1E4DA 1WE4A 2DCFA 2Z2LB 4KZBA 3IF6B 5AQ7A 1LI9A 4LENA 4BD0A 4ZJ3A 1DJCA 3UDFA 2EXAA 3FYZA 4JF5A 4XXRA 5AQ9A 1KGGA 1KVMA 2H0YA 1LL9A 1Q2PA 4N92A 5E2EA 2JCHA 4DE2A 1ALQA 5F1GA 2ZC6B 3RJUA 2PBYA 3OC2A 1ZKJA 4KZ4A 5CXWA 1J9MA 1K54A 1KGFA 4JKTA 5CERA 4CJNA 2J7VA 4P87A 1FSYA 1CEGA 1Z6FA 4XUZA 4E3IA 1PW1A 1BULA 1BTLA 1XP4A 3G4PA 4WZ5C 2ZQDA 3IHAA 3NBLA 4WYYA 3N8SA 4XUXA 3NDGA 5FQKA 3UE3A 3IXDA 1YLJA 4QY6A 2WYXA 1KE0A 1RP5A 3N7WA 3PBOA 4LV2A 4GDNA 3NI9A 2JE5A 2EX2A 3VMAA 4FH4A 1GCEA 2Y2MA 3IWOA 3WS1A 2ZD8A 3VP2A 1K38A 4EBLA 3PAGA 4ZJ1A 2Y2OA 4LCMA 5FAPA 1XA7A 3PAEA 4WZ4A 5KZHA 3BECA 3D4FA 3VSLA 5GL9A 3MXSA 4LV3A 1ZC2A 1PZPA 4KG5A 5HAQA 1IYQA 2Q9MA 3EQUA 1GA9A 3JYIA 5GLDA 2XD1A 3W4OA 3WS2A 2ZC7A 3LCEA 3N6IA 1PWDA 4OH0A 4C6YA 3HLCA 4E3KA 3ZG8B 4HBTA 5GLAA 1E25A 2HDRA 4A5RA 1FCNA 4YFMA 3FKVA 2H5SA 4F94A 5FQ9A 3ZG0A 1KDWA 2XR0A 1YM1A 5JYOA 2QPNA 3GSGA 5M19A 3ITAA 3GRJA 4DDSA 2X01A 1CI8A 1XXMA 1VQQA 2ZMAA 5L2FA 3HLFA 1KVLA 3VFHA 5EOOA 5EUAA 1MBLA 2H10A 5M18A 3E2KA 5HAIA 5FAQA 1IKIA 1KE3A 2EFUA 1N4OA 2C6WB 3HL9A 3OPLA 3P09A 2Y2HA 3V3SA 4S2PA 4HESA 2XH9A 3IH8A 1E3UA 3SS4A 4DF6A 4Z9QA 3IWQA 3ZFZA 4KZ9A 1BLHA 2DNSA 4IBXA 4HEFA 1PW8A 4WELA 5CGXA 5CGWA 3C7VA 3UY6A 3ZVWA 2EX6A 3UNWA 4DE1A 2EFXA 3O87A 3C5AA 5FASA 4R3BA 4U0XA 1E3UD 4B4ZA 1FQGA 1W79A 3SH9A 5EVIB 4HBUA 2B5RA 4RX2A 4UA6A 2WK0A 4X69A 3AGEA 3HVFA 4WEJA 5FQJA 4QU3A 2I72A 1RGYA 5DF8A 4E3NA 3IF6A 2ZLYA 1AXBA 2HP5A 2Z2MB 3HREA 1H5XA 3P98A 5FSRA 3GMWA 1YLPA 3DTMA 4KZ8A 4JXVA 2J8YA 4KZ6A 2WAFA 3MBZA 5GHYA 1K55A 3ISGA 3MKFA 2ZM0A 5EVLA 3GTCA 1TVFA 1MPLA 1HZOA 2IWCA 3IQAA 2HP6A 3OPPA 1H8YA 1IYSA 1K6RA 3FWLA 4GB7A 4PMAA 2ZC4B 5I94A 5FI6A 4X68A 3IHBA 4K91A 1XGJA 1K6SA 1MWSA 4OPRA 2ZQAA 1JWVA 1N9BA 4IVKA 4OPYA 4B4XA 5FATA 3UO9A 4UA7A 4DXCA 1JVJA 1PIOA 3NIAA 4S2KA 4MBFA 3ZG7B 3HLWA 1ESIA 5DF7A 4RYEA 2OLVA 2J9PA 1H8ZA 1YLTA 2Y4AA 4GD8A 1NZOA 5DVAA 3G34A 4JLFA 1SCWA 4MNRA 3NY4A 3SOIA 4KG6A 3LEZA 1FCMA 4OP5A 2XEPA 5DTSA 2WKEA 1G6AA 2V1ZA 5HW3A 5FQIA 5F83A 3TOIA 2VGKA 3C4OA 1ESUA 5A93A 4QY5A 5EPHA 1S0WA 1ES4A 3GV9A 3IXHA 4JBFA 1PI5A 4KQOA 4OQ0A 2PU2A 1L0DA 4KZ5A 4OOLA 4OPQA 4MBHA 4EQIA 3UE0A 3IWIA 3LO7A 3UDIA 1K56A 1G68A 3MXRA 1YMXA 2C5WB 2HDSA 1W5DA 1BUEA 4U0TA 5CRFA 3SS5A 1BZAA 3Q7VB 3NC8A 4S2NC 3V39A 1XGIA 1JTDA 3ZNTA 1FR6A 3DWZA 5AQAA 2Y2PA 2WGWA 1MWTA 5GLBA 1K56D 2XLNA 4LCLA 1MWRA 2Q9NA 1PWGA 3HBRA 4LV0A 5E43A 1L2SA 2ZQ7A 5GLCA 3BFCA 1W8YA 2P9VA 2XGNA 4S2JA 3RXXA 3FKWA 4OOMA 5A91A 2V20A 1DY6A 2ZC3B 1HD8A 5DTKA 4UHUA 5IHVA 3VP0A 1EI5A 4DE3A 3VOYA 4S2MA 2WUQA 1K55C 5BOHA 3BFFA 1LI0A 4PPRA 3VP4A 1JWPA 4E3JA 1BLCA 1L0GA 1K57A 4O7DA 4UA9A 3G2ZA 4OQHA 2QMIA 3PBTA 3TG9A 4N1HA 3N8RA 1KDSA 4MBKA 4EUZA 1LLBA 4R4RA 4N9KA 1YLYA 4GOGA 4E3OA 4KQRA 2FFYA 5FAOA 4X55A 3BFDA 3OZHA 1M40A 2Y2LA 2Y55A 4FSFA 3Q81A 4LV1A 3UN7A 4BQMA 4Y0TA 2OV5A 1PI4A 3IT9A 1C3BA 4WBGA 4M3KA 3PTEA 3SS3A 2JC7A 4KQQA 3PBSA 2J9OA 3IXBA 1IELA 4CPKA 2WZXA 1NY0A 4DXBA 2BG1A 2RCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HX9 A;  3M2K A;  1SHV A;  3IXG A;  3A3I A;  3CJM A;  5FI7 A;  2IWB A;  3V3R A;  4PM5 A;  3SH8 A;  4R4S A;  3GVB A;  1K54 C;  1FSW A;  4EV4 A;  2XDM A;  4BEN A;  1I2W A;  3ZHH A;  1FR1 A;  2ZC5 B;  3RXW A;  3G30 A;  4PM8 A;  3HLB A;  5TFQ A;  4FH2 A;  3N4I A;  1K4E A;  5G18 A;  4OON A;  2WAE A;  1BSG A;  1IYP A;  3NDE A;  3G32 A;  4S2L A;  1NRF A;  1YQS A;  3OPR A;  3WRZ A;  4Y0U A;  1ONG A;  2XFT A;  1RGZ A;  1ERQ A;  1SDN A;  2PU4 A;  1L0F A;  1W7F A;  4ZAM A;  1MY8 A;  4EBP A;  2BLS A;  3Q1F A;  5KSC A;  5KMW A;  1TDG A;  5GHX A;  1BLP A;  3BRM A;  2HPB A;  4OP8 A;  4BL2 A;  1YT4 A;  3MZE A;  3E2L A;  1IYO A;  4R0Q A;  4OOY A;  4BD1 A;  3NCK A;  2VGJ A;  4C3Q A;  3G35 A;  1JWZ A;  1SDE A;  1L0E A;  1BLS A;  5EOE A;  3S1Y A;  3WS4 A;  3OCN A;  1ES2 A;  4L0L A;  3N8L A;  4R23 A;  1K25 A;  4FD8 A;  2Y2K A;  3M6B A;  1U60 A;  4ZDX A;  1XA1 A;  4DDY A;  1DJA A;  2ZQ9 A;  2ZM2 A;  4X53 A;  4Q8I A;  1PYY A;  4Y0O A;  3UPN A;  1GHI A;  1HTZ A;  1YMS A;  1TEM A;  2WGV A;  3A3F A;  3BM6 A;  3W4Q A;  3BEB A;  3DW0 A;  3LY4 A;  1K57 C;  4GD6 A;  3ZNY A;  3B3X A;  2HDU A;  4BL3 A;  3Q7V A;  2HP9 A;  3Q07 A;  4E3L A;  3C7U A;  5CHJ A;  5DF9 A;  1PZO A;  2GDN A;  4WMC A;  4JPM A;  4BLM A;  1FOF A;  2QZ6 A;  1M6K A;  1SKF A;  5CEB A;  5EE8 A;  3GQZ A;  1ERM A;  3IF5 A;  1Q2Q A;  2G2W A;  2OLU A;  1XX2 A;  1XPB A;  1DJB A;  3WS0 A;  3MZF A;  2WZZ A;  3PBN A;  1IEM A;  4WMC D;  5CGS A;  3CZD A;  1ES5 A;  4UAA A;  5M1A A;  1PWC A;  1QME A;  1NYM A;  2Y59 A;  5KSH A;  4IBR A;  4H8R A;  4NET A;  4GN2 A;  4MLL A;  4JXG A;  3C4P A;  5TR7 A;  3ITB A;  4X56 A;  2HDQ A;  2DRW A;  3Q7Z A;  2EX8 A;  5F1F A;  1LHY A;  3MKE A;  2Y2Q A;  4PM6 A;  1ZG6 A;  2EXB A;  3MFD A;  4R3J A;  4OLD A;  3UDX A;  1HVB A;  1K4F A;  3S4X A;  2XFS A;  5E2G A;  4MEZ A;  5FDH A;  3IF6 C;  3W8K A;  5U47 A;  1I2S A;  2OSU A;  1XKZ A;  2JBF A;  4KZA A;  1CI9 A;  4KG2 A;  3ZG9 B;  1EWZ A;  3DWK A;  2WKH A;  3ZGA B;  2WKI A;  3PBR A;  1CEF A;  5A90 A;  2H0T A;  4JF6 A;  4JXW A;  4KZ7 A;  4RA7 A;  3BFG A;  3HLG A;  3UPP A;  2XD5 A;  4C75 A;  3MZD A;  3FV7 A;  4IVI A;  4OLG A;  4GKU A;  3ZVT A;  5EVI A;  4EBN A;  4WEK A;  3EQV A;  5HAR A;  3BYD A;  4R1G A;  4PM9 A;  3M6H A;  1GA0 A;  3VOZ A;  3OPH A;  3W4P A;  1MXO A;  4JF4 A;  2UWX A;  3WRT A;  4X6T A;  1YLZ A;  1GHP A;  3HLE A;  2ZQC A;  4QHC A;  2R9X A;  3AGD A;  2ZJ9 A;  4P0M A;  4OQI A;  5EVI D;  3SH7 A;  4IED A;  4OKP A;  1ES3 A;  5CHM A;  4U3T A;  4PM7 A;  3A3J A;  5FQQ A;  1WYB A;  4P6B A;  3ZCZ A;  3BLM A;  4GDB A;  4DRT A;  5GHZ A;  3M2J A;  4D2O A;  5D3O A;  2WGI A;  4OPZ A;  5FI2 A;  4K0X A;  5E2H A;  2G2U A;  4QB8 A;  3VSK A;  2WGW B;  5EEC A;  3VP1 A;  5A92 A;  5TGF A;  3AGF A;  4WZ5 A;  2Y2I A;  2CC1 A;  5CHU A;  4Y7P A;  4RVA A;  2Y2G A;  3HUM A;  4N1X A;  5CTN A;  1ZG4 A;  2P9V B;  5HAP A;  5HL1 A;  1O07 A;  4N9L A;  2Y2J A;  2Y91 A;  3O88 A;  4NK3 A;  5HFO A;  4E6W A;  1QMF A;  1BT5 A;  3HUN A;  4P85 A;  4OVD A;  2E8I A;  3S22 A;  2X71 A;  2ZM8 A;  1OME A;  2X02 A;  3O86 A;  2IWD A;  1JTG A;  3LY3 A;  4GNU A;  4OQG A;  3VFF A;  3WS5 A;  3A3D A;  5CEC A;  4E6X A;  4S2I A;  1ONH A;  1NZU A;  4YIN A;  3BLS A;  4ZBE A;  1KGE A;  3WWX A;  3ZDJ A;  4E3M A;  4DKI A;  3HLD A;  2RL3 A;  4KEN B;  2XF3 A;  4S2N A;  5FA7 A;  5JYP A;  1NJ4 A;  4KZ3 A;  1CK3 A;  2V2F F;  3GR2 A;  4FCF A;  4GZB A;  3VP3 A;  4QD4 A;  5F82 A;  3V5M A;  3BFE A;  2A3U A;  1Y54 A;  2A49 A;  4RX3 A;  4ZTK A;  1NYY A;  2XQZ A;  1MKI A;  3QNC A;  1W8Q A;  1RCJ A;  4EWF A;  2Y2N A;  4QJG A;  1KE4 A;  3OCL A;  2R9W A;  3QHY A;  1S6R A;  4BJP A;  3Q82 A;  5J8X A;  4DE0 A;  3UE1 A;  3IH9 A;  3UPO A;  3ZG5 A;  5DTT A;  5AQB A;  3A3E A;  3CMZ A;  4JXS A;  1FCO A;  3G2Y A;  4ID4 A;  3TSG A;  3O3V A;  4WM9 A;  1I5Q A;  1GHM A;  1O7E A;  1ERO A;  5CED A;  3V50 A;  1YLW A;  2FFF B;  5FQM A;  1WYC A;  1TDL A;  2EX9 A;  3HUO A;  2ZQ8 A;  3PBQ A;  1MWU A;  5E2F A;  1VM1 A;  4S2O A;  5CTM A;  2XK1 A;  5EVI C;  1LL5 A;  4ZJ2 A;  3G31 A;  3I7J A;  1NXY A;  3CG5 A;  4B88 A;  2P74 A;  2WAD A;  1IKG A;  3FZC A;  3QNB A;  4K0W A;  1E4D A;  1WE4 A;  2DCF A;  2Z2L B;  4KZB A;  3IF6 B;  5AQ7 A;  1LI9 A;  4LEN A;  4BD0 A;  4ZJ3 A;  1DJC A;  3UDF A;  2EXA A;  3FYZ A;  4JF5 A;  4XXR A;  5AQ9 A;  1KGG A;  1KVM A;  2H0Y A;  1LL9 A;  1Q2P A;  4N92 A;  5E2E A;  2JCH A;  4DE2 A;  1ALQ A;  5F1G A;  2ZC6 B;  3RJU A;  2PBY A;  3OC2 A;  1ZKJ A;  4KZ4 A;  5CXW A;  1J9M A;  1K54 A;  1KGF A;  4JKT A;  5CER A;  4CJN A;  2J7V A;  4P87 A;  1FSY A;  1CEG A;  1Z6F A;  4XUZ A;  4E3I A;  1PW1 A;  1BUL A;  1BTL A;  1XP4 A;  3G4P A;  4WZ5 C;  2ZQD A;  3IHA A;  3NBL A;  4WYY A;  3N8S A;  4XUX A;  3NDG A;  5FQK A;  3UE3 A;  3IXD A;  1YLJ A;  4QY6 A;  2WYX A;  1KE0 A;  1RP5 A;  3N7W A;  3PBO A;  4LV2 A;  4GDN A;  3NI9 A;  2JE5 A;  2EX2 A;  3VMA A;  4FH4 A;  1GCE A;  2Y2M A;  3IWO A;  3WS1 A;  2ZD8 A;  3VP2 A;  1K38 A;  4EBL A;  3PAG A;  4ZJ1 A;  2Y2O A;  4LCM A;  5FAP A;  1XA7 A;  3PAE A;  4WZ4 A;  5KZH A;  3BEC A;  3D4F A;  3VSL A;  5GL9 A;  3MXS A;  4LV3 A;  1ZC2 A;  1PZP A;  4KG5 A;  5HAQ A;  1IYQ A;  2Q9M A;  3EQU A;  1GA9 A;  3JYI A;  5GLD A;  2XD1 A;  3W4O A;  3WS2 A;  2ZC7 A;  3LCE A;  3N6I A;  1PWD A;  4OH0 A;  4C6Y A;  3HLC A;  4E3K A;  3ZG8 B;  4HBT A;  5GLA A;  1E25 A;  2HDR A;  4A5R A;  1FCN A;  4YFM A;  3FKV A;  2H5S A;  4F94 A;  5FQ9 A;  3ZG0 A;  1KDW A;  2XR0 A;  1YM1 A;  5JYO A;  2QPN A;  3GSG A;  5M19 A;  3ITA A;  3GRJ A;  4DDS A;  2X01 A;  1CI8 A;  1XXM A;  1VQQ A;  2ZMA A;  5L2F A;  3HLF A;  1KVL A;  3VFH A;  5EOO A;  5EUA A;  1MBL A;  2H10 A;  5M18 A;  3E2K A;  5HAI A;  5FAQ A;  1IKI A;  1KE3 A;  2EFU A;  1N4O A;  2C6W B;  3HL9 A;  3OPL A;  3P09 A;  2Y2H A;  3V3S A;  4S2P A;  4HES A;  2XH9 A;  3IH8 A;  1E3U A;  3SS4 A;  4DF6 A;  4Z9Q A;  3IWQ A;  3ZFZ A;  4KZ9 A;  1BLH A;  2DNS A;  4IBX A;  4HEF A;  1PW8 A;  4WEL A;  5CGX A;  5CGW A;  3C7V A;  3UY6 A;  3ZVW A;  2EX6 A;  3UNW A;  4DE1 A;  2EFX A;  3O87 A;  3C5A A;  5FAS A;  4R3B A;  4U0X A;  1E3U D;  4B4Z A;  1FQG A;  1W79 A;  3SH9 A;  5EVI B;  4HBU A;  2B5R A;  4RX2 A;  4UA6 A;  2WK0 A;  4X69 A;  3AGE A;  3HVF A;  4WEJ A;  5FQJ A;  4QU3 A;  2I72 A;  1RGY A;  5DF8 A;  4E3N A;  3IF6 A;  2ZLY A;  1AXB A;  2HP5 A;  2Z2M B;  3HRE A;  1H5X A;  3P98 A;  5FSR A;  3GMW A;  1YLP A;  3DTM A;  4KZ8 A;  4JXV A;  2J8Y A;  4KZ6 A;  2WAF A;  3MBZ A;  5GHY A;  1K55 A;  3ISG A;  3MKF A;  2ZM0 A;  5EVL A;  3GTC A;  1TVF A;  1MPL A;  1HZO A;  2IWC A;  3IQA A;  2HP6 A;  3OPP A;  1H8Y A;  1IYS A;  1K6R A;  3FWL A;  4GB7 A;  4PMA A;  2ZC4 B;  5I94 A;  5FI6 A;  4X68 A;  3IHB A;  4K91 A;  1XGJ A;  1K6S A;  1MWS A;  4OPR A;  2ZQA A;  1JWV A;  1N9B A;  4IVK A;  4OPY A;  4B4X A;  5FAT A;  3UO9 A;  4UA7 A;  4DXC A;  1JVJ A;  1PIO A;  3NIA A;  4S2K A;  4MBF A;  3ZG7 B;  3HLW A;  1ESI A;  5DF7 A;  4RYE A;  2OLV A;  2J9P A;  1H8Z A;  1YLT A;  2Y4A A;  4GD8 A;  1NZO A;  5DVA A;  3G34 A;  4JLF A;  1SCW A;  4MNR A;  3NY4 A;  3SOI A;  4KG6 A;  3LEZ A;  1FCM A;  4OP5 A;  2XEP A;  5DTS A;  2WKE A;  1G6A A;  2V1Z A;  5HW3 A;  5FQI A;  5F83 A;  3TOI A;  2VGK A;  3C4O A;  1ESU A;  5A93 A;  4QY5 A;  5EPH A;  1S0W A;  1ES4 A;  3GV9 A;  3IXH A;  4JBF A;  1PI5 A;  4KQO A;  4OQ0 A;  2PU2 A;  1L0D A;  4KZ5 A;  4OOL A;  4OPQ A;  4MBH A;  4EQI A;  3UE0 A;  3IWI A;  3LO7 A;  3UDI A;  1K56 A;  1G68 A;  3MXR A;  1YMX A;  2C5W B;  2HDS A;  1W5D A;  1BUE A;  4U0T A;  5CRF A;  3SS5 A;  1BZA A;  3Q7V B;  3NC8 A;  4S2N C;  3V39 A;  1XGI A;  1JTD A;  3ZNT A;  1FR6 A;  3DWZ A;  5AQA A;  2Y2P A;  2WGW A;  1MWT A;  5GLB A;  1K56 D;  2XLN A;  4LCL A;  1MWR A;  2Q9N A;  1PWG A;  3HBR A;  4LV0 A;  5E43 A;  1L2S A;  2ZQ7 A;  5GLC A;  3BFC A;  1W8Y A;  2P9V A;  2XGN A;  4S2J A;  3RXX A;  3FKW A;  4OOM A;  5A91 A;  2V20 A;  1DY6 A;  2ZC3 B;  1HD8 A;  5DTK A;  4UHU A;  5IHV A;  3VP0 A;  1EI5 A;  4DE3 A;  3VOY A;  4S2M A;  2WUQ A;  1K55 C;  5BOH A;  3BFF A;  1LI0 A;  4PPR A;  3VP4 A;  1JWP A;  4E3J A;  1BLC A;  1L0G A;  1K57 A;  4O7D A;  4UA9 A;  3G2Z A;  4OQH A;  2QMI A;  3PBT A;  3TG9 A;  4N1H A;  3N8R A;  1KDS A;  4MBK A;  4EUZ A;  1LLB A;  4R4R A;  4N9K A;  1YLY A;  4GOG A;  4E3O A;  4KQR A;  2FFY A;  5FAO A;  4X55 A;  3BFD A;  3OZH A;  1M40 A;  2Y2L A;  2Y55 A;  4FSF A;  3Q81 A;  4LV1 A;  3UN7 A;  4BQM A;  4Y0T A;  2OV5 A;  1PI4 A;  3IT9 A;  1C3B A;  4WBG A;  4M3K A;  3PTE A;  3SS3 A;  2JC7 A;  4KQQ A;  3PBS A;  2J9O A;  3IXB A;  1IEL A;  4CPK A;  2WZX A;  1NY0 A;  4DXB A;  2BG1 A;  2RCX A; 
#chains in the Genus database with same CATH topology
 5HX9 A;  2OAQ 1;  2IWB A;  1VET A;  3V3R A;  3SH8 A;  3U2A A;  4BEN A;  1I2W A;  4PHT A;  2L0W A;  3G30 A;  4PM8 A;  3HLB A;  4FH2 A;  5G18 A;  4OON A;  1YQS A;  3OPR A;  1ONG A;  4II7 A;  1GSV A;  2W3H A;  3JVU A;  2VV7 A;  4I5S A;  1MY8 A;  2BLS A;  1TDG A;  5GHX A;  1BLP A;  3BRM A;  2HPB A;  4E04 A;  3E2L A;  4BD1 A;  4CLC B;  2HZ5 A;  5KIZ A;  5EOE A;  4L0L A;  3BJN A;  4MMN A;  1XA1 A;  2ZQ9 A;  2ZBB A;  2JKG A;  1TEM A;  4YOF A;  1XJ6 A;  3LY4 A;  4GD6 A;  3ZNY A;  2GDN A;  4JPM A;  1FOF A;  2QZ6 A;  4BBU A;  2XA7 S;  1G5U A;  1DJB A;  3MZF A;  4GS9 A;  1YPR A;  3PBN A;  4WMC D;  3SZT A;  2GZA A;  1PWC A;  1OT9 A;  4H8R A;  5TR7 A;  4X56 A;  2DRW A;  1WA9 A;  1CQA A;  5F1F A;  4Y3I A;  3G6O A;  3UB5 P;  1ZG6 A;  2K2N A;  4UEY A;  2ACG A;  2XFS A;  3GEC A;  3ZG9 B;  1OTE A;  1NLY A;  1CEF A;  4JF6 A;  3BFG A;  3HLG A;  1F98 A;  3LIC A;  2XD5 A;  1MC0 A;  1OTB A;  4IVI A;  4QWO A;  5HZH A;  1MKM A;  3ZVT A;  4GJ4 A;  3LI8 A;  2UWX A;  4XT2 B;  1GHP A;  2P04 A;  2GX5 A;  4PM7 A;  2EA9 A;  3A3J A;  5FQQ A;  2B95 A;  3ZCZ A;  3OOV A;  4GDB A;  4D2O A;  4GHI A;  4OPZ A;  5E2H A;  2G2U A;  3VP1 A;  5TGF A;  2Y2I A;  4Y7P A;  2Y2G A;  5CTN A;  4UQI M;  1O07 A;  2A24 A;  2Y2J A;  2E8I A;  2X71 A;  2X02 A;  4HH3 A;  4GNU A;  4NXF A;  3ZDJ A;  2W1T B;  5JYP A;  3GR2 A;  2A2L A;  5L10 A;  2H28 A;  5F82 A;  1MKI A;  1W8Q A;  2Y2N A;  3OCL A;  3QHY A;  1TS8 A;  3IH9 A;  1FCO A;  4ID4 A;  3TSG A;  3RH8 B;  1S66 L;  1O7E A;  3EGD C;  2O9B A;  2ZQ8 A;  5E2F A;  1VM1 A;  5EVI C;  5HWT A;  3G31 A;  3I7J A;  1NXY A;  3CG5 A;  4B88 A;  2P74 A;  1E4D A;  1OPX A;  1WE4 A;  1OT6 A;  3C38 A;  3UDF A;  2CMN A;  2KOI A;  1KVM A;  1LL9 A;  1Q2P A;  3KYE A;  3QP8 A;  5F1G A;  3LID A;  4G3V A;  4MN7 A;  1CEG A;  1PW1 A;  4WZ5 C;  2ZQD A;  3IHA A;  3NOT C;  1OJ5 A;  4Z1W A;  4LGW A;  3IXD A;  3H82 B;  4QY6 A;  4Y5F A;  2JE5 A;  2EX2 A;  4FH4 A;  4X25 A;  1K38 A;  1XA7 A;  3PAE A;  1T1B A;  5GL9 A;  3MXS A;  4KG5 A;  4HIA A;  1Z09 A;  1GA9 A;  4CQH A;  2XD1 A;  3WS2 A;  2ZC7 A;  4H6J B;  4OH0 A;  4E3K A;  4ETZ A;  4YFM A;  4UQI S;  4EXO A;  4F94 A;  1S67 L;  4O0P A;  5M19 A;  2M7V A;  2K31 A;  1VQQ A;  3F1O B;  3VFH A;  5EUA A;  5FAQ A;  3ZHH A;  2EFU A;  3IBJ A;  3LR3 A;  5HDC A;  4HES A;  2FZ0 A;  4DF6 A;  3HJI A;  3IWQ A;  4R3A A;  4IBX A;  4CLC D;  1CJF A;  1PNE A;  3NOP C;  5EM1 A;  5K5B A;  2EFX A;  2JKT M;  5AJG A;  1E3U D;  4B4Z A;  2WKR A;  5EVI B;  2B5R A;  2WK0 A;  5FQJ A;  4LRZ E;  2ZLY A;  1H5X A;  3P98 A;  5FSR A;  3DTM A;  3EGX C;  2ZM0 A;  3UB7 A;  3OPP A;  2Z6C A;  3FWL A;  4PMA A;  5FI6 A;  3IHB A;  3VE3 A;  1MWS A;  2M7U A;  1JWV A;  4DXC A;  5FAT A;  3UO9 A;  1T1A A;  4S2K A;  3HLW A;  5FL3 A;  2PRF A;  2D02 A;  1NZO A;  4X1M A;  3DTE A;  4JLF A;  5DKK A;  2Q0O A;  4KG6 A;  2V1Z A;  4R70 A;  5IU1 A;  2Y8H A;  1LSW A;  2PD7 A;  3MQQ A;  4KQO A;  1H8M A;  4KZ5 A;  4OPQ A;  4EQI A;  3UE0 A;  2GNX A;  3Q7V B;  1DRM A;  3LIE A;  2Y2P A;  2WGW A;  2QKP A;  5GLB A;  1K56 D;  2XLN A;  4LV0 A;  1L2S A;  2ZQ7 A;  5GLC A;  4S2J A;  5C5K A;  3T4L A;  5IHV A;  1EI5 A;  4ESP A;  3RFB A;  5BOH A;  4E3J A;  1BLC A;  1L0G A;  1K57 A;  4UA9 A;  2QMI A;  4MBK A;  2PR6 A;  4X55 A;  3Q81 A;  2OV5 A;  3PTE A;  1IEL A;  4PKY A;  4CPK A;  3IXG A;  3A3I A;  3CJM A;  4PM5 A;  4ARZ B;  4R4S A;  1K54 C;  1FSW A;  1VEU A;  3UME A;  1HLU P;  3VE4 A;  3N4I A;  1NRF A;  3PYP A;  1SDN A;  3T4Q A;  3MXQ A;  4ZAM A;  3QP1 A;  3Q1F A;  5KSC A;  3DTI A;  1GSX A;  4OP8 A;  1YT4 A;  4ZRR A;  1IYO A;  4R0Q A;  4OOY A;  4C3Q A;  3G35 A;  1L0E A;  1BLS A;  3S1Y A;  2W0N A;  3OBF A;  3WS4 A;  1N9N A;  2ZMF A;  5DKL A;  2XSS A;  4R23 A;  1PRQ A;  1S1Z A;  4DDY A;  1DJA A;  2ZM2 A;  3E0Y A;  1PYY A;  4Y0O A;  3UPN A;  3BM6 A;  3BEB A;  3E98 A;  4LLO B;  4BL3 A;  2HP9 A;  3C7U A;  2L1M A;  3L7H A;  4CLC C;  2BAS A;  3GQZ A;  1Q2Q A;  5G4Z A;  2G2W A;  1XX2 A;  3OLO A;  3IBR A;  3CZD A;  1ES5 A;  5M1A A;  2Y59 A;  4NET A;  4MLL A;  2PBD P;  2QJ7 A;  5AVE A;  1SKO A;  4R3J A;  4OLD A;  4HH2 A;  2LB5 A;  3TJZ C;  4JGP A;  2OSU A;  2JBF A;  3LGO A;  1CI9 A;  4IHQ A;  3T1Q B;  1EWZ A;  3DWK A;  3S7N A;  1V9Y A;  3UMD A;  2WKI A;  2VK3 A;  4RA7 A;  3UPP A;  2VX8 A;  3FC7 A;  4C75 A;  3FV7 A;  4GKU A;  4EBN A;  3EQV A;  5HAR A;  3BYD A;  4NXB A;  3M6H A;  1ACF A;  3W4P A;  1P97 A;  2OOL A;  1OTA A;  4X6T A;  3HLE A;  2ZQC A;  4K08 A;  5A8B A;  2VEA A;  1TS7 A;  2P7J A;  4P0M A;  4OQI A;  5EVI D;  1LL8 A;  4OKP A;  5L09 A;  3BLM A;  5FDS A;  2O9A A;  5GHZ A;  5FI2 A;  3LIA A;  3VSK A;  1YAX A;  5A92 A;  2CC1 A;  5CHU A;  3B47 A;  4N1X A;  5HL1 A;  4L9E A;  4MN6 A;  4N9L A;  5HFO A;  1QMF A;  3HUN A;  4OVD A;  5J3W A;  2ZM8 A;  3VFF A;  3WS5 A;  4OQG A;  5HD5 A;  3NEC A;  3BLS A;  4EQ1 A;  3ICY A;  2RL3 A;  5FA7 A;  2XF3 A;  5L07 A;  3NUL A;  1S4S A;  3ZYT A;  1XFQ A;  2XQZ A;  4IUK A;  5HSQ A;  5TBM A;  4M4X A;  3D3O A;  3Q82 A;  5J8X A;  1MZU A;  3UE1 A;  3F1N A;  3UPO A;  3ZG5 A;  3CMZ A;  4JXS A;  3KSG A;  1TS0 A;  1VET B;  4L9F A;  1I5Q A;  5CED A;  1T18 A;  4R38 A;  4E3I A;  1P9R A;  4I3I A;  1TDL A;  3HUO A;  1MWU A;  4S2O A;  3TW8 A;  1LL5 A;  4ZJ2 A;  2WAD A;  3D72 A;  1IKG A;  2XRN A;  5G4Y A;  2DCF A;  5AQ7 A;  4Y17 A;  1ZHH B;  4GCZ A;  4LEN A;  5F68 A;  2OAP 1;  1DJC A;  3JVV A;  4JF5 A;  4XXR A;  3QP5 A;  1KGG A;  5AQ9 A;  2HJ9 C;  4N92 A;  4DE2 A;  1ALQ A;  3RJU A;  3OC2 A;  1N9O A;  2E8J A;  5CXW A;  3LIB A;  3E4Q A;  4HY8 A;  4CJN A;  2J7V A;  4P87 A;  1FSY A;  5AVF A;  4HQA A;  4XUZ A;  1VB6 A;  1XP4 A;  3T50 A;  5TJJ A;  3NBL A;  3N8S A;  3NDG A;  4I3A A;  2JKF A;  2WYX A;  3UB6 A;  4B9O A;  2VGL M;  3VMA A;  3IWO A;  3WS1 A;  2ZD8 A;  3VP2 A;  3PAG A;  2Y2O A;  4LCM A;  2GJ3 A;  3D4F A;  2YKH A;  5HAQ A;  2Q9M A;  3EQU A;  3MQ0 A;  3N6I A;  5DFY A;  4C6Y A;  3S7Q A;  4HBT A;  2VA0 A;  3HJK A;  4GS9 B;  5GLA A;  1E25 A;  2HDR A;  1W63 Q;  4NG2 A;  2H5S A;  3ZG0 A;  1KDW A;  5JYO A;  4DDS A;  1CI8 A;  1XXM A;  2ZMA A;  3DAV A;  5EOO A;  5HAI A;  1P9W A;  1IKI A;  1N4O A;  3OPL A;  5KMW A;  4S2P A;  4Z9Q A;  5EM0 A;  4EU0 A;  1PW8 A;  3DTK A;  4P6Z M;  4JGQ A;  3MFX A;  5CGW A;  3PXP A;  3C7V A;  1D1J A;  3UNW A;  5HWV A;  5FAS A;  2Y79 A;  2HV1 A;  1W79 A;  3SH9 A;  3LIF A;  3LYX A;  4X69 A;  4WEJ A;  2QJ5 A;  2I72 A;  1RGY A;  4CLC E;  2V8F A;  1AXB A;  2Z2M B;  5HPF A;  1YLP A;  1N9L A;  4HP4 A;  4KZ8 A;  4JXV A;  1K55 A;  3ISG A;  3MKF A;  5EVL A;  1TVF A;  2HP6 A;  3E4P A;  1K6R A;  3LR0 A;  2K7S A;  5I94 A;  2KX6 A;  4OPR A;  2ZQA A;  1N9B A;  4OPY A;  1IFQ A;  4UA7 A;  1JVJ A;  1PIO A;  3NIA A;  3ZG7 B;  4MBF A;  1KOU A;  3K2N A;  3LEQ A;  1ESI A;  2ZL1 A;  4Q0H A;  2Y4A A;  4G3K A;  2DMW A;  2WKP A;  4GD8 A;  2VGL S;  5DVA A;  1SCW A;  4MNR A;  1F2K A;  1FCM A;  4OP5 A;  4EW7 A;  3IX3 A;  4H6J A;  1G6A A;  5HW3 A;  2VV6 A;  5FQI A;  5L8M A;  1ESU A;  1S0W A;  4OQ0 A;  2PU2 A;  2NUP C;  3UDI A;  3CPT B;  3MXR A;  1W5D A;  2V1B A;  5CRF A;  4S2N C;  3F1O A;  3ZNT A;  1FR6 A;  3DWZ A;  3KYZ A;  1MWT A;  2FH5 A;  4LCL A;  1MWR A;  2Q9N A;  3F1P A;  5E43 A;  1W8Y A;  2P9V A;  2XGN A;  3RXX A;  5IT5 A;  3FKW A;  5A91 A;  3V67 A;  1DY6 A;  2V9A A;  4UHU A;  2WUQ A;  3BFF A;  1LI0 A;  4PPR A;  5HDD A;  1PFL A;  4P6Z S;  4OQH A;  5EFW A;  4N1H A;  3N8R A;  1KDS A;  4EUZ A;  2QWS A;  2FFY A;  5FAO A;  4Q0J A;  3OZH A;  1M40 A;  4I39 A;  4LV1 A;  3UN7 A;  4BQM A;  4YWZ A;  3BW6 A;  4M3K A;  3SS3 A;  4DMZ A;  1NWZ A;  4KQQ A;  3BQA A;  4DXB A;  4Q0I A;  2BG1 A;  2RCX A;  3M2K A;  3MR0 A;  3GVB A;  4EV4 A;  1UWP X;  2PT7 A;  3RXW A;  5TFQ A;  1K4E A;  2WAE A;  3NDE A;  3G32 A;  4S2L A;  3WRZ A;  4IJG A;  4Y0U A;  1TF1 A;  2XFT A;  1ERQ A;  1L0F A;  4EEU A;  3NCK A;  2VGJ A;  2MJ6 A;  2PDR A;  1JWZ A;  1SDE A;  3OCN A;  3N8L A;  1OJG A;  3T4O A;  3CUE C;  1K25 A;  1A0K A;  3M6B A;  4KUK A;  1OTI A;  2NUT C;  5DJT A;  4ME4 A;  3S7O A;  1HTZ A;  1YMS A;  3A3F A;  3RTY A;  3A0S A;  3DW0 A;  1K57 C;  3H7W A;  3Q7V A;  3Q07 A;  5DF9 A;  4WMC A;  2PYP A;  1SKF A;  5CEB A;  1XFN A;  4AFI A;  1ERM A;  5IS1 A;  3LI9 A;  1XPB A;  4NXG A;  3IS2 A;  4WUJ A;  2IA2 A;  3IX8 A;  4Y2F A;  4UAA A;  3R7W A;  5F5Y A;  5KSH A;  4IBR A;  2JHE A;  4BBV A;  4GN2 A;  3NHQ A;  3ITB A;  3Q7Z A;  1LHY A;  3MKE A;  3MFD A;  4L9G A;  3UDX A;  1HVB A;  4HJ6 A;  2V0U A;  5FDH A;  3T4T A;  3IF6 C;  1I2S A;  3ULF A;  3ZGA B;  3PBR A;  3VV4 A;  5A90 A;  1IOU A;  4JXW A;  5LBR A;  3BY9 A;  4PM9 A;  1GA0 A;  3VOZ A;  3OPH A;  3EEH A;  3WRT A;  4Y13 A;  2BTF P;  2R9X A;  3AGD A;  2ZJ9 A;  3SH7 A;  4IED A;  5CHM A;  4DN0 A;  4DRT A;  2EWW A;  4KQD A;  5D3O A;  3S7P A;  3K3C A;  4K0X A;  4QB8 A;  1OTD A;  2WGW B;  5EEC A;  3MSH A;  4RVA A;  3HUM A;  2Y91 A;  4E6W A;  1BT5 A;  1OME A;  3O86 A;  2IWD A;  1JTG A;  3K3D A;  3A3D A;  4E6X A;  4S2I A;  1NZU A;  1KGE A;  3BY8 A;  1XJ3 A;  4Y15 A;  4DKI A;  2AVX A;  4KZ3 A;  4F3L A;  3NOU C;  4FCF A;  4FUW A;  3VP3 A;  3V5M A;  2QYB A;  2A49 A;  1Y54 A;  4RX3 A;  4ZTK A;  3KYQ A;  1DP6 A;  4EUV A;  1RCJ A;  2W27 A;  4QJG A;  4BJP A;  4HP9 A;  4DE0 A;  2O9C A;  4FOF A;  5DTT A;  5AQB A;  3G2Y A;  4MCW A;  3O3V A;  4I38 A;  3UE6 A;  3V50 A;  5FQM A;  3PBQ A;  1VEU B;  2XK1 A;  3FZC A;  4K0W A;  2PHY A;  1S1Y A;  2Z2L B;  4KZB A;  3IF6 B;  2W3G A;  1LI9 A;  2V0W A;  2EXA A;  3EWK A;  3FYZ A;  1EW0 A;  5DJU A;  2H0Y A;  5J4E A;  5E2E A;  3P01 A;  1S4R A;  2ZC6 B;  1F9I A;  2PBY A;  3UB8 A;  4KZ4 A;  1K54 A;  5CER A;  1Z6F A;  4HHD A;  3G4P A;  3UE3 A;  4LRY C;  3PBO A;  4NXE A;  4GDN A;  3NI9 A;  1GCE A;  2Y2M A;  4ZJ1 A;  1H0M A;  5FAP A;  5KZH A;  3BEC A;  2JKR I;  3DBA A;  4LV3 A;  4ETX A;  1IYQ A;  3JYI A;  5GLD A;  3LCE A;  3HLC A;  3ZG8 B;  1FCN A;  3FKV A;  2KDK A;  5FQ9 A;  2XR0 A;  1YM1 A;  3PR6 A;  2HGV A;  3GSG A;  2J3W A;  4DJ2 A;  5L2F A;  1SKO B;  3HLF A;  4JGR A;  3IX4 A;  4CLC A;  1MBL A;  3QP4 A;  2H10 A;  5M18 A;  3H9W A;  1KE3 A;  2C6W B;  3HL9 A;  4GW9 A;  3V3S A;  2XH9 A;  3IH8 A;  1E3U A;  3A0R A;  1BLH A;  5CGX A;  5HPI A;  5CX7 A;  2VJW A;  2W3E A;  3UY6 A;  1D06 A;  4DE1 A;  3O87 A;  2HF6 A;  1XJ2 A;  1XJ4 A;  4UA6 A;  1V9Z A;  4QU3 A;  1ODV A;  3BWL A;  3HRE A;  2OWJ A;  3GTC A;  1MPL A;  3B42 A;  4GB7 A;  2ZC4 B;  4X68 A;  4K91 A;  1LSX A;  1XGJ A;  1K6S A;  5EV0 A;  4IVK A;  4B4X A;  1CF0 A;  4NEE D;  3QP6 A;  4RYE A;  1TD5 A;  2J9P A;  1H8Z A;  4D60 A;  2QHK A;  1LT0 A;  2I9V A;  1YSQ A;  4MN5 A;  1BYW A;  3O5Y A;  3LEZ A;  2XEP A;  2WKE A;  3FPV A;  2PR5 A;  5TBM B;  5F69 A;  1D7E A;  2VGK A;  3C4O A;  3MS6 A;  4XT2 A;  5EPH A;  2W1R A;  3F1N B;  3GV9 A;  1FIL A;  1L0D A;  4OOL A;  4MBH A;  3LO7 A;  1K56 A;  1G68 A;  3L9K A;  1YMX A;  2ZOI A;  2C5W B;  4BMW A;  1BUE A;  4U0T A;  1BZA A;  3EEA A;  3NC8 A;  3V39 A;  1XGI A;  2INW A;  1STZ A;  1SZV A;  2ZC3 B;  4EES A;  5DTK A;  3VP0 A;  3UB9 A;  4DE3 A;  3VOY A;  4S2M A;  1K55 C;  2JKR M;  3VP4 A;  2W1T A;  3G2Z A;  4YNR A;  4R4R A;  4N9K A;  4GOG A;  4E3O A;  3MF0 A;  2Y2L A;  5DFX A;  3IT9 A;  4WBG A;  1C3B A;  1H3Q A;  2JC7 A;  3PBS A;  3IXB A;  4WF0 A;  5FI7 A;  1SHV A;  3QP2 A;  3T1R A;  4I3J A;  3CWF A;  2XDM A;  2JKT I;  2PD8 A;  4PKY G;  4X1L A;  3VOL A;  1FR1 A;  2ZC5 B;  1JNU A;  3T4J A;  1BSG A;  1IYP A;  3CAX A;  4LPZ A;  2YKF A;  1RGZ A;  2O0Y A;  2PU4 A;  1W7F A;  3KO6 A;  3LR5 A;  4EBP A;  3FPW A;  4WL9 A;  1L3L A;  4BL2 A;  2G7U A;  3MZE A;  4GHI B;  2O99 A;  3T4S A;  1ZTU A;  1ES2 A;  3CLO A;  4FD8 A;  2A24 B;  2Y2K A;  1U60 A;  4ZDX A;  1T1C A;  3H82 A;  4Q8I A;  4X53 A;  1GHI A;  5J7E A;  2WGV A;  3CPT A;  1X0O A;  3W4Q A;  3KSF A;  3B3X A;  2HDU A;  4E3L A;  5CHJ A;  1PZO A;  4HJ4 A;  4BLM A;  1M6K A;  4QPR A;  3HCY A;  2JN7 A;  2VLG A;  5EE8 A;  3IF5 A;  1AWI A;  2OLU A;  3WS0 A;  2WZZ A;  1IEM A;  4PAU A;  5CGS A;  1QME A;  1NYM A;  2LB9 A;  3EOI A;  3LUQ A;  3LFV A;  4JXG A;  3C4P A;  5HD3 A;  1UWN X;  2HDQ A;  2EX8 A;  1GSW A;  3MMH A;  2Y2Q A;  4PM6 A;  2EXB A;  3W2Z A;  2V8C A;  1K4F A;  3S4X A;  5E2G A;  4MEZ A;  3W8K A;  1G6O A;  5U47 A;  1W63 M;  1XKZ A;  4KZA A;  4KG2 A;  2ZL1 B;  2V1A A;  3MQO A;  2WKH A;  2J3T D;  2H0T A;  4KZ7 A;  4O8G A;  3MZD A;  3CIT A;  4OLG A;  4BBT A;  5EVI A;  4G3W A;  1F5M A;  4FTX A;  4WEK A;  4R1G A;  1MXO A;  4JF4 A;  1YLZ A;  4QHC A;  2KLI A;  1ES3 A;  4U3T A;  1WYB A;  4P6B A;  3JPU A;  3M2J A;  3GDI A;  2WGI A;  3KSI A;  3AGF A;  5FEG A;  4WZ5 A;  3F1P B;  5HAP A;  1ZG4 A;  2P9V B;  3A0V A;  3O88 A;  4NK3 A;  4P85 A;  3S22 A;  1T19 A;  5CEC A;  3LY3 A;  3T12 B;  1ONH A;  4YIN A;  4ZBE A;  3WWX A;  3FG8 A;  4LRX C;  4E3M A;  3HLD A;  4KEN B;  4S2N A;  1NJ4 A;  1CK3 A;  2V2F F;  4GZB A;  1G28 A;  4QD4 A;  3BFE A;  4B93 A;  2A3U A;  1NYY A;  3QNC A;  4EWF A;  1KE4 A;  4NKP A;  2R9W A;  1S6R A;  4R6L A;  3A3E A;  4HNB A;  3T1X A;  4WM9 A;  1GHM A;  2VV8 A;  1ERO A;  1YLW A;  4WN5 A;  2FFF B;  1WYC A;  2EX9 A;  1TS6 A;  2XRO A;  5CTM A;  3QNB A;  4DJ3 A;  4BD0 A;  4ZJ3 A;  3E4O A;  1Y4O A;  2JCH A;  1ZKJ A;  4KUO A;  1J9M A;  1KGF A;  4JKT A;  5FEF A;  2WKQ A;  1BUL A;  1BTL A;  2B02 A;  4WYY A;  4XUX A;  3TE8 A;  3T1S A;  3MJQ A;  5FQK A;  2B18 A;  1FIK A;  1YLJ A;  1KE0 A;  1RP5 A;  3N7W A;  4LFU A;  4LV2 A;  5EVE A;  2L4R A;  2EWV A;  4EBL A;  3H7W B;  4GLQ A;  4WZ4 A;  3VSL A;  4JGO A;  4ARZ A;  1ZC2 A;  1PZP A;  3W4O A;  3D9Y A;  1PWD A;  5F6A A;  3CUE A;  3IS2 B;  3SW1 A;  2VZW A;  4A5R A;  2R78 A;  3R7W B;  1UGU A;  2QPN A;  3ITA A;  3GRJ A;  3NJA A;  2X01 A;  3B33 A;  1VHM A;  1KVL A;  3BQ8 A;  5HWW A;  3E2K A;  2W3D A;  4EEP A;  3P09 A;  2Y2H A;  2W3F A;  1K0K A;  3SS4 A;  3R4K A;  3ZFZ A;  4KZ9 A;  2DNS A;  4HEF A;  4WEL A;  1LSV A;  1YSP A;  3ZVW A;  2EX6 A;  3C5A A;  4R3B A;  4U0X A;  1FQG A;  3LR4 A;  4HBU A;  1P0Z A;  4RX2 A;  3AGE A;  3HVF A;  5DF8 A;  4E3N A;  3IF6 A;  2J3T C;  5HDS A;  2HP5 A;  3GMW A;  2J8Y A;  3C30 A;  4RQ9 A;  4KZ6 A;  2WAF A;  5I5L A;  3MBZ A;  5GHY A;  3TRC A;  1HZO A;  2IWC A;  3IQA A;  2ZMV A;  1H8Y A;  1NLZ A;  3P7N A;  1IYS A;  2D01 A;  3CI6 A;  2UV0 E;  1DP9 A;  3CHW P;  4EER A;  5DF7 A;  2OLV A;  2VKS A;  2Z6D A;  4EET B;  1YLT A;  4WLA A;  4F3L B;  3G34 A;  3NY4 A;  3SOI A;  5DTS A;  3KX0 X;  5F83 A;  3TOI A;  5A93 A;  2OWH A;  4QY5 A;  3T4K A;  1ES4 A;  3IXH A;  4JBF A;  1PI5 A;  2J80 A;  1DP8 A;  2P08 A;  3KSH A;  4HOI A;  3IWI A;  1YKD A;  3C2W A;  4BWI A;  2HDS A;  2ZOH A;  5MC7 A;  3U4L P;  3SS5 A;  2XA7 M;  1JTD A;  5AQA A;  3PHY A;  1PWG A;  3HBR A;  3BFC A;  4O01 A;  4OOM A;  2V20 A;  4MDZ A;  1HD8 A;  4HI4 A;  2PAV P;  1JWP A;  5HL6 A;  1Y28 A;  4O7D A;  3PBT A;  3TG9 A;  2PYR A;  1LLB A;  1YLY A;  1NRJ A;  4KQR A;  3BFD A;  2HJE A;  2Y55 A;  4FSF A;  4IUH A;  4Y0T A;  1PI4 A;  1J3W A;  4HJ3 A;  2J9O A;  3C8C A;  3ZQ5 A;  2WZX A;  1NY0 A;  2M1C A; 
#chains in the Genus database with same CATH homology
 5HX9 A;  3M2K A;  1SHV A;  3IXG A;  3A3I A;  3CJM A;  5FI7 A;  2IWB A;  3V3R A;  4PM5 A;  3SH8 A;  4R4S A;  3GVB A;  1K54 C;  1FSW A;  4EV4 A;  2XDM A;  4BEN A;  1I2W A;  3ZHH A;  1FR1 A;  2ZC5 B;  3RXW A;  3G30 A;  4PM8 A;  3HLB A;  5TFQ A;  4FH2 A;  3N4I A;  1K4E A;  5G18 A;  4OON A;  2WAE A;  1BSG A;  1IYP A;  3NDE A;  3G32 A;  4S2L A;  1NRF A;  1YQS A;  3OPR A;  3WRZ A;  4Y0U A;  1ONG A;  2XFT A;  1RGZ A;  1ERQ A;  1SDN A;  2PU4 A;  1L0F A;  1W7F A;  4ZAM A;  1MY8 A;  4EBP A;  2BLS A;  3Q1F A;  5KSC A;  5KMW A;  1TDG A;  5GHX A;  1BLP A;  3BRM A;  2HPB A;  4OP8 A;  4BL2 A;  1YT4 A;  3MZE A;  3E2L A;  1IYO A;  4R0Q A;  4OOY A;  4BD1 A;  3NCK A;  2VGJ A;  4C3Q A;  3G35 A;  1JWZ A;  1SDE A;  1L0E A;  1BLS A;  5EOE A;  3S1Y A;  3WS4 A;  3OCN A;  1ES2 A;  4L0L A;  3N8L A;  4R23 A;  1K25 A;  4FD8 A;  2Y2K A;  3M6B A;  1U60 A;  4ZDX A;  1XA1 A;  4DDY A;  1DJA A;  2ZQ9 A;  2ZM2 A;  4X53 A;  4Q8I A;  1PYY A;  4Y0O A;  3UPN A;  1GHI A;  1HTZ A;  1YMS A;  1TEM A;  2WGV A;  3A3F A;  3BM6 A;  3W4Q A;  3BEB A;  3DW0 A;  3LY4 A;  1K57 C;  4GD6 A;  3ZNY A;  3B3X A;  2HDU A;  4BL3 A;  3Q7V A;  2HP9 A;  3Q07 A;  4E3L A;  3C7U A;  5CHJ A;  5DF9 A;  1PZO A;  2GDN A;  4WMC A;  4JPM A;  4BLM A;  1FOF A;  2QZ6 A;  1M6K A;  1SKF A;  5CEB A;  5EE8 A;  3GQZ A;  1ERM A;  3IF5 A;  1Q2Q A;  2G2W A;  2OLU A;  1XX2 A;  1XPB A;  1DJB A;  3WS0 A;  3MZF A;  2WZZ A;  3PBN A;  1IEM A;  4WMC D;  5CGS A;  3CZD A;  1ES5 A;  4UAA A;  5M1A A;  1PWC A;  1QME A;  1NYM A;  2Y59 A;  5KSH A;  4IBR A;  4H8R A;  4NET A;  4GN2 A;  4MLL A;  4JXG A;  3C4P A;  5TR7 A;  3ITB A;  4X56 A;  2HDQ A;  2DRW A;  3Q7Z A;  2EX8 A;  5F1F A;  1LHY A;  3MKE A;  2Y2Q A;  4PM6 A;  1ZG6 A;  2EXB A;  3MFD A;  4R3J A;  4OLD A;  3UDX A;  1HVB A;  1K4F A;  3S4X A;  2XFS A;  5E2G A;  4MEZ A;  5FDH A;  3IF6 C;  3W8K A;  5U47 A;  1I2S A;  2OSU A;  1XKZ A;  2JBF A;  4KZA A;  1CI9 A;  4KG2 A;  3ZG9 B;  1EWZ A;  3DWK A;  2WKH A;  3ZGA B;  2WKI A;  3PBR A;  1CEF A;  5A90 A;  2H0T A;  4JF6 A;  4JXW A;  4KZ7 A;  4RA7 A;  3BFG A;  3HLG A;  3UPP A;  2XD5 A;  4C75 A;  3MZD A;  3FV7 A;  4IVI A;  4OLG A;  4GKU A;  3ZVT A;  5EVI A;  4EBN A;  4WEK A;  3EQV A;  5HAR A;  3BYD A;  4R1G A;  4PM9 A;  3M6H A;  1GA0 A;  3VOZ A;  3OPH A;  3W4P A;  1MXO A;  4JF4 A;  2UWX A;  3WRT A;  4X6T A;  1YLZ A;  1GHP A;  3HLE A;  2ZQC A;  4QHC A;  2R9X A;  3AGD A;  2ZJ9 A;  4P0M A;  4OQI A;  5EVI D;  3SH7 A;  4IED A;  4OKP A;  1ES3 A;  5CHM A;  4U3T A;  4PM7 A;  3A3J A;  5FQQ A;  1WYB A;  4P6B A;  3ZCZ A;  3BLM A;  4GDB A;  4DRT A;  5GHZ A;  3M2J A;  4D2O A;  5D3O A;  2WGI A;  4OPZ A;  5FI2 A;  4K0X A;  5E2H A;  2G2U A;  4QB8 A;  3VSK A;  2WGW B;  5EEC A;  3VP1 A;  5A92 A;  5TGF A;  3AGF A;  4WZ5 A;  2Y2I A;  2CC1 A;  5CHU A;  4Y7P A;  4RVA A;  2Y2G A;  3HUM A;  4N1X A;  5CTN A;  1ZG4 A;  2P9V B;  5HAP A;  5HL1 A;  1O07 A;  4N9L A;  2Y2J A;  2Y91 A;  3O88 A;  4NK3 A;  5HFO A;  4E6W A;  1QMF A;  1BT5 A;  3HUN A;  4P85 A;  4OVD A;  2E8I A;  3S22 A;  2X71 A;  2ZM8 A;  1OME A;  2X02 A;  3O86 A;  2IWD A;  1JTG A;  3LY3 A;  4GNU A;  4OQG A;  3VFF A;  3WS5 A;  3A3D A;  5CEC A;  4E6X A;  4S2I A;  1ONH A;  1NZU A;  4YIN A;  3BLS A;  4ZBE A;  1KGE A;  3WWX A;  3ZDJ A;  4E3M A;  4DKI A;  3HLD A;  2RL3 A;  4KEN B;  2XF3 A;  4S2N A;  5FA7 A;  5JYP A;  1NJ4 A;  4KZ3 A;  1CK3 A;  2V2F F;  3GR2 A;  4FCF A;  4GZB A;  3VP3 A;  4QD4 A;  5F82 A;  3V5M A;  3BFE A;  2A3U A;  1Y54 A;  2A49 A;  4RX3 A;  4ZTK A;  1NYY A;  2XQZ A;  1MKI A;  3QNC A;  1W8Q A;  1RCJ A;  4EWF A;  2Y2N A;  4QJG A;  1KE4 A;  3OCL A;  2R9W A;  3QHY A;  1S6R A;  4BJP A;  3Q82 A;  5J8X A;  4DE0 A;  3UE1 A;  3IH9 A;  3UPO A;  3ZG5 A;  5DTT A;  5AQB A;  3A3E A;  3CMZ A;  4JXS A;  1FCO A;  3G2Y A;  4ID4 A;  3TSG A;  3O3V A;  4WM9 A;  1I5Q A;  1GHM A;  1O7E A;  1ERO A;  5CED A;  3V50 A;  1YLW A;  2FFF B;  5FQM A;  1WYC A;  1TDL A;  2EX9 A;  3HUO A;  2ZQ8 A;  3PBQ A;  1MWU A;  5E2F A;  1VM1 A;  4S2O A;  5CTM A;  2XK1 A;  5EVI C;  1LL5 A;  4ZJ2 A;  3G31 A;  3I7J A;  1NXY A;  3CG5 A;  4B88 A;  2P74 A;  2WAD A;  1IKG A;  3FZC A;  3QNB A;  4K0W A;  1E4D A;  1WE4 A;  2DCF A;  2Z2L B;  4KZB A;  3IF6 B;  5AQ7 A;  1LI9 A;  4LEN A;  4BD0 A;  4ZJ3 A;  1DJC A;  3UDF A;  2EXA A;  3FYZ A;  4JF5 A;  4XXR A;  5AQ9 A;  1KGG A;  1KVM A;  2H0Y A;  1LL9 A;  1Q2P A;  4N92 A;  5E2E A;  2JCH A;  4DE2 A;  1ALQ A;  5F1G A;  2ZC6 B;  3RJU A;  2PBY A;  3OC2 A;  1ZKJ A;  4KZ4 A;  5CXW A;  1J9M A;  1K54 A;  1KGF A;  4JKT A;  5CER A;  4CJN A;  2J7V A;  4P87 A;  1FSY A;  1CEG A;  1Z6F A;  4XUZ A;  4E3I A;  1PW1 A;  1BUL A;  1BTL A;  1XP4 A;  3G4P A;  4WZ5 C;  2ZQD A;  3IHA A;  3NBL A;  4WYY A;  3N8S A;  4XUX A;  3NDG A;  5FQK A;  3UE3 A;  3IXD A;  1YLJ A;  4QY6 A;  2WYX A;  1KE0 A;  1RP5 A;  3N7W A;  3PBO A;  4LV2 A;  4GDN A;  3NI9 A;  2JE5 A;  2EX2 A;  3VMA A;  4FH4 A;  1GCE A;  2Y2M A;  3IWO A;  3WS1 A;  2ZD8 A;  3VP2 A;  1K38 A;  4EBL A;  3PAG A;  4ZJ1 A;  2Y2O A;  4LCM A;  5FAP A;  1XA7 A;  3PAE A;  4WZ4 A;  5KZH A;  3BEC A;  3D4F A;  3VSL A;  5GL9 A;  3MXS A;  4LV3 A;  1ZC2 A;  1PZP A;  4KG5 A;  5HAQ A;  1IYQ A;  2Q9M A;  3EQU A;  1GA9 A;  3JYI A;  5GLD A;  2XD1 A;  3W4O A;  3WS2 A;  2ZC7 A;  3LCE A;  3N6I A;  1PWD A;  4OH0 A;  4C6Y A;  3HLC A;  4E3K A;  3ZG8 B;  4HBT A;  5GLA A;  1E25 A;  2HDR A;  4A5R A;  1FCN A;  4YFM A;  3FKV A;  2H5S A;  4F94 A;  5FQ9 A;  3ZG0 A;  1KDW A;  2XR0 A;  1YM1 A;  5JYO A;  2QPN A;  3GSG A;  5M19 A;  3ITA A;  3GRJ A;  4DDS A;  2X01 A;  1CI8 A;  1XXM A;  1VQQ A;  2ZMA A;  5L2F A;  3HLF A;  1KVL A;  3VFH A;  5EOO A;  5EUA A;  1MBL A;  2H10 A;  5M18 A;  3E2K A;  5HAI A;  5FAQ A;  1IKI A;  1KE3 A;  2EFU A;  1N4O A;  2C6W B;  3HL9 A;  3OPL A;  3P09 A;  2Y2H A;  3V3S A;  4S2P A;  4HES A;  2XH9 A;  3IH8 A;  1E3U A;  3SS4 A;  4DF6 A;  4Z9Q A;  3IWQ A;  3ZFZ A;  4KZ9 A;  1BLH A;  2DNS A;  4IBX A;  4HEF A;  1PW8 A;  4WEL A;  5CGX A;  5CGW A;  3C7V A;  3UY6 A;  3ZVW A;  2EX6 A;  3UNW A;  4DE1 A;  2EFX A;  3O87 A;  3C5A A;  5FAS A;  4R3B A;  4U0X A;  1E3U D;  4B4Z A;  1FQG A;  1W79 A;  3SH9 A;  5EVI B;  4HBU A;  2B5R A;  4RX2 A;  4UA6 A;  2WK0 A;  4X69 A;  3AGE A;  3HVF A;  4WEJ A;  5FQJ A;  4QU3 A;  2I72 A;  1RGY A;  5DF8 A;  4E3N A;  3IF6 A;  2ZLY A;  1AXB A;  2HP5 A;  2Z2M B;  3HRE A;  1H5X A;  3P98 A;  5FSR A;  3GMW A;  1YLP A;  3DTM A;  4KZ8 A;  4JXV A;  2J8Y A;  4KZ6 A;  2WAF A;  3MBZ A;  5GHY A;  1K55 A;  3ISG A;  3MKF A;  2ZM0 A;  5EVL A;  3GTC A;  1TVF A;  1MPL A;  1HZO A;  2IWC A;  3IQA A;  2HP6 A;  3OPP A;  1H8Y A;  1IYS A;  1K6R A;  3FWL A;  4GB7 A;  4PMA A;  2ZC4 B;  5I94 A;  5FI6 A;  4X68 A;  3IHB A;  4K91 A;  1XGJ A;  1K6S A;  1MWS A;  4OPR A;  2ZQA A;  1JWV A;  1N9B A;  4IVK A;  4OPY A;  4B4X A;  5FAT A;  3UO9 A;  4UA7 A;  4DXC A;  1JVJ A;  1PIO A;  3NIA A;  4S2K A;  4MBF A;  3ZG7 B;  3HLW A;  1ESI A;  5DF7 A;  4RYE A;  2OLV A;  2J9P A;  1H8Z A;  1YLT A;  2Y4A A;  4GD8 A;  1NZO A;  5DVA A;  3G34 A;  4JLF A;  1SCW A;  4MNR A;  3NY4 A;  3SOI A;  4KG6 A;  3LEZ A;  1FCM A;  4OP5 A;  2XEP A;  5DTS A;  2WKE A;  1G6A A;  2V1Z A;  5HW3 A;  5FQI A;  5F83 A;  3TOI A;  2VGK A;  3C4O A;  1ESU A;  5A93 A;  4QY5 A;  5EPH A;  1S0W A;  1ES4 A;  3GV9 A;  3IXH A;  4JBF A;  1PI5 A;  4KQO A;  4OQ0 A;  2PU2 A;  1L0D A;  4KZ5 A;  4OOL A;  4OPQ A;  4MBH A;  4EQI A;  3UE0 A;  3IWI A;  3LO7 A;  3UDI A;  1K56 A;  1G68 A;  3MXR A;  1YMX A;  2C5W B;  2HDS A;  1W5D A;  1BUE A;  4U0T A;  5CRF A;  3SS5 A;  1BZA A;  3Q7V B;  3NC8 A;  4S2N C;  3V39 A;  1XGI A;  1JTD A;  3ZNT A;  1FR6 A;  3DWZ A;  5AQA A;  2Y2P A;  2WGW A;  1MWT A;  5GLB A;  1K56 D;  2XLN A;  4LCL A;  1MWR A;  2Q9N A;  1PWG A;  3HBR A;  4LV0 A;  5E43 A;  1L2S A;  2ZQ7 A;  5GLC A;  3BFC A;  1W8Y A;  2P9V A;  2XGN A;  4S2J A;  3RXX A;  3FKW A;  4OOM A;  5A91 A;  2V20 A;  1DY6 A;  2ZC3 B;  1HD8 A;  5DTK A;  4UHU A;  5IHV A;  3VP0 A;  1EI5 A;  4DE3 A;  3VOY A;  4S2M A;  2WUQ A;  1K55 C;  5BOH A;  3BFF A;  1LI0 A;  4PPR A;  3VP4 A;  1JWP A;  4E3J A;  1BLC A;  1L0G A;  1K57 A;  4O7D A;  4UA9 A;  3G2Z A;  4OQH A;  2QMI A;  3PBT A;  3TG9 A;  4N1H A;  3N8R A;  1KDS A;  4MBK A;  4EUZ A;  1LLB A;  4R4R A;  4N9K A;  1YLY A;  4GOG A;  4E3O A;  4KQR A;  2FFY A;  5FAO A;  4X55 A;  3BFD A;  3OZH A;  1M40 A;  2Y2L A;  2Y55 A;  4FSF A;  3Q81 A;  4LV1 A;  3UN7 A;  4BQM A;  4Y0T A;  2OV5 A;  1PI4 A;  3IT9 A;  1C3B A;  4WBG A;  4M3K A;  3PTE A;  3SS3 A;  2JC7 A;  4KQQ A;  3PBS A;  2J9O A;  3IXB A;  1IEL A;  4CPK A;  2WZX A;  1NY0 A;  4DXB A;  2BG1 A;  2RCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...