2IWDA

Oxacilloyl-acylated mecr1 extracellular antibiotic-sensor domain.
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
246
structure length
246
Chain Sequence
b'DKYETNVSYKKLNQLAPYFKGFDGSFVLYNEREQAYSIYNEPESKQRYSPNSTYKIYLALMAFDQNLLSLNHTEQQWDKHQYPFKEWNQDQNLNSSMKYSVNWYYENLNKHLRQDEVKSYLDLIEYGNEEISGNENYWNESSLKISAIEQVNLLKNMKQHNMHFDNKAIEKVENSMTLKQKDTYKYVGKTGTGIVNHKEANGWFVGYVETKDNTYYFATHLKGEDNANGEKAQQISERILKEMELI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Methicillin resistance mecR1 protein
publication title Unbound and Acylated Structures of the Mecr1 Extracellular Antibiotic-Sensor Domain Provide Insights Into the Signal-Transduction System that Triggers Methicillin Resistance.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Antibiotic resistance
total genus 87
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2006-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2iwdA00
3LY3A 1W5DA 3FWLA 3G31A 3MZDA 5HW3A 4IEDA 4U3TA 3BFDA 2Y2MA 1MWSA 1PW1A 1WYBA 3V3RA 3N4IA 1NZUA 3UNWA 5M19A 2ZC4B 4E3LA 1K6SA 4MBFA 3O88A 4KZAA 4KZ7A 2PBYA 3DWKA 3IF6A 4WYYA 3MXSA 1GHPA 4JXWA 3HLWA 3M2KA 4OQGA 4P85A 4WM9A 4Y0UA 1SDEA 4DKIA 4IVKA 4GDNA 3W4PA 4K0WA 4JXGA 1JWZA 3MZFA 5GLBA 3UDIA 1NRFA 2X02A 5FQQA 5CHUA 4ZJ3A 3SH7A 4PM9A 4QD4A 1KDWA 4JLFA 4NK3A 1PWDA 2PU4A 4S2PA 1MWTA 5HFOA 1BLHA 1DJAA 4BL3A 5AQ9A 1PWCA 3I7JA 4KZ4A 2Y2OA 3IWOA 5CXWA 1Y54A 2BLSA 2Y2LA 3ZVTA 1I2WA 3RXWA 2WADA 3V5MA 1MXOA 2RL3A 3OC2A 3SS3A 3OPHA 3WS2A 1YM1A 3UDFA 3DWZA 1Q2QA 3N7WA 3GMWA 3HUOA 3BRMA 4OH0A 2Y4AA 4KZBA 4MLLA 3PTEA 1LLBA 5E2HA 4F94A 2H0TA 4EBPA 3RJUA 3ZCZA 3QNCA 2OV5A 2VGJA 3MFDA 3ITBA 4BLMA 1K56A 2Q9MA 1O07A 1MWRA 4EV4A 3BECA 1YLPA 4FCFA 2Y2QA 4M3KA 4PM5A 1W8QA 1WE4A 2A49A 2C6WB 4WELA 4JF6A 1L0EA 2WKIA 1FSWA 1LHYA 4R1GA 5GHYA 3UY6A 4EQIA 3OCLA 3G30A 4X55A 3IHBA 2FFFB 3G2YA 2EX6A 4R23A 4OPYA 4BD0A 4OONA 4CJNA 5JYPA 3D4FA 5M18A 3CMZA 1Q2PA 1IEMA 1S0WA 2G2WA 2XFTA 4S2IA 5I94A 1QMEA 5DTTA 5HAQA 4WEJA 1IKGA 3O86A 5HARA 2Y2IA 1ALQA 1ERQA 5A90A 5EVIB 1TVFA 5EVLA 4N1XA 5F1GA 4DF6A 5CGSA 4JBFA 3LO7A 3HBRA 4OVDA 4S2JA 1FR1A 4YFMA 1MBLA 4ZBEA 3BLMA 3PBTA 3V50A 1YT4A 4LV3A 1XGIA 4LV1A 2ZC3B 4GN2A 3ZDJA 2ZMAA 2WGIA 4S2MA 1TEMA 1BULA 2ZM8A 1ZC2A 1U60A 5FI2A 2DCFA 2J9OA 2BG1A 5CRFA 3W4OA 3VP0A 3N8SA 5FI7A 1CEGA 3SS4A 4R4RA 3WS4A 3MKEA 2ZJ9A 2V2FF 5A93A 3GQZA 2XLNA 2XH9A 2FFYA 4U0TA 1ESIA 5FDHA 3GSGA 3G34A 4PM8A 3VOYA 5J8XA 4C75A 1FCMA 1WYCA 2XGNA 1MY8A 4GD6A 2ZC5B 3AGFA 3WRTA 1LL5A 2JC7A 5AQ7A 3HREA 3IXBA 4EBNA 4Z9QA 1PIOA 4GZBA 3ZHHA 5CHJA 1YLWA 3ZVWA 1JVJA 1ES4A 3HLGA 4H8RA 4ZJ2A 3IH8A 5A91A 1TDGA 1YLZA 3MZEA 2ZQ8A 1XP4A 1JTGA 1L0DA 5CERA 3ZFZA 4Q8IA 3BFEA 2WK0A 3G4PA 1GHIA 5DTSA 1PI4A 1J9MA 4JXSA 2EXAA 3VP4A 3HLCA 3Q1FA 1H8ZA 3VP1A 3IF6B 1PZPA 1XXMA 1PWGA 1IYSA 3FYZA 3HUMA 4OPRA 4QHCA 4FH2A 4OOMA 1O7EA 1K55C 4JPMA 3NDEA 4JF5A 5IHVA 2ZQCA 4X69A 1S6RA 2ZQ9A 5F1FA 1FSYA 4HBTA 1K4EA 4KG6A 3PAEA 5HAIA 2I72A 4DE3A 5FSRA 3OPLA 1SHVA 2HPBA 4ID4A 5CEDA 1ES3A 3WRZA 3EQUA 4HEFA 2RCXA 5KZHA 4U0XA 2XD5A 3Q7VA 1K55A 4GDBA 3QHYA 4N92A 2HP6A 2Y2GA 2WKHA 2Y2HA 1K6RA 5DTKA 2WZZA 5E2GA 4UA7A 5BOHA 4BQMA 3V3SA 1YLJA 4FSFA 3E2KA 4FD8A 3A3JA 4OP8A 5M1AA 3NIAA 1G6AA 1FOFA 1DY6A 3HLDA 5E2FA 5GHXA 3PBQA 3MXRA 1XX2A 4WMCD 1EI5A 2EX2A 2V20A 4OOLA 4KZ6A 4N9KA 4RX2A 3ZG8B 4P6BA 2HDSA 2Y91A 5DF8A 3G32A 4DE1A 4B4ZA 2H0YA 4DE2A 1BLCA 2R9WA 4KZ5A 4DXCA 2Q9NA 5GLCA 2DRWA 1XA1A 3UDXA 3IWIA 1N9BA 3S1YA 4KQQA 2Y2NA 1SDNA 2ZC7A 4S2NC 3V39A 2ZQAA 3ZG7B 4DDYA 3B3XA 1TDLA 4P0MA 3DW0A 1KE3A 5DVAA 4GNUA 5EVID 4PMAA 2QMIA 1AXBA 3C5AA 3OZHA 2WAFA 1K25A 4P87A 4OQHA 4HBUA 3N8RA 5EE8A 3ISGA 4R3BA 3S22A 1L2SA 4KZ3A 5E43A 5F82A 3ZNYA 2ZQDA 4NETA 5G18A 1KDSA 4R3JA 3FZCA 1K4FA 4E3NA 1CI8A 5FASA 4S2NA 5TFQA 1C3BA 4EWFA 1ES2A 3WS0A 1PI5A 4Y0TA 3VFHA 5FAPA 2X71A 4E3JA 1YLYA 2A3UA 4OQ0A 2GDNA 5GHZA 5JYOA 5FQMA 1IYPA 1NXYA 1IELA 2ZD8A 3E2LA 4JXVA 5AQBA 5FI6A 3G2ZA 3PAGA 2QPNA 3VOZA 2Y2JA 3SS5A 1NYYA 4RX3A 4R4SA 2EX9A 3BFGA 4QY6A 1ZG6A 3Q82A 4OLDA 3VP3A 3NC8A 1W79A 4IVIA 1RP5A 1I2SA 3UE1A 1XGJA 3A3DA 2EX8A 3QNBA 1YQSA 5HL1A 4WZ4A 5D3OA 3NCKA 4C3QA 2P9VA 5CEBA 5KSHA 3IH9A 1HVBA 1NY0A 5CHMA 2UWXA 3Q07A 1CI9A 1LI0A 1XKZA 4GD8A 5F83A 3VMAA 2XR0A 2OLVA 2WYXA 4GOGA 3M6HA 3ITAA 2HP5A 2WGWA 3ZG0A 4BENA 1BTLA 4OQIA 4XXRA 2CC1A 4EUZA 5FA7A 3MKFA 2ZQ7A 3S4XA 2WZXA 1FCOA 1JWVA 4OP5A 3PBSA 3WWXA 3ZNTA 2R9XA 3IWQA 1RGZA 3A3FA 4UA9A 4Y0OA 1VM1A 3FKVA 1HTZA 1M40A 3UO9A 2C5WB 1QMFA 1BZAA 1HZOA 1GA0A 4XUXA 1BUEA 5CGWA 2H10A 5EECA 3C7VA 4EBLA 2ZM0A 3BLSA 3VSLA 1M6KA 2WUQA 3GR2A 2OSUA 4Y7PA 1EROA 1PZOA 1E3UA 1CK3A 1KGFA 4BL2A 1E25A 1XA7A 3O87A 3P09A 4KQOA 2Z2LB 3UPOA 3GRJA 4HESA 4E6XA 2WAEA 4DE0A 3HLEA 1E4DA 2HDQA 3IT9A 3CJMA 3GTCA 3Q7VB 1GHMA 2H5SA 4A5RA 1LI9A 3NI9A 3VP2A 1K56D 3BFCA 1ONGA 3G35A 3NDGA 3GVBA 2IWCA 3C7UA 3AGDA 4WZ5C 5AQAA 4OOYA 5L2FA 2XFSA 5CECA 1NJ4A 2VGKA 2JBFA 3PBNA 1YMSA 4KENB 1YLTA 3UE0A 3DTMA 2HP9A 3NBLA 1I5QA 1ONHA 4E3MA 5CTNA 4OPZA 5U47A 1IYOA 4YINA 4RYEA 2EFXA 2WGVA 2OLUA 2Y55A 4WZ5A 2V1ZA 3AGEA 5FATA 3UPNA 1KGEA 2IWBA 1K57C 5FQ9A 1EWZA 1NYMA 3LY4A 3TOIA 1H8YA 1H5XA 1HD8A 1XPBA 4E3OA 3BM6A 4ZJ1A 4E3IA 1KE4A 3LEZA 1RGYA 4N9LA 2ZLYA 4R0QA 4B88A 5KMWA 1FR6A 1SCWA 4N1HA 3SH8A 1G68A 4CPKA 3HUNA 1VQQA 4QJGA 2P74A 3CG5A 4UHUA 2PU2A 1BSGA 1KE0A 1FQGA 4K0XA 3O3VA 3MBZA 4QB8A 4L0LA 3A3EA 3CZDA 1Z6FA 4QU3A 4X6TA 1K57A 4LCLA 4X68A 2JE5A 4BJPA 4DXBA 5DF7A 4E3KA 2XK1A 5TR7A 4FH4A 3LCEA 4RA7A 4MBKA 1IYQA 3ZGAB 3FV7A 1BLPA 2J9PA 4WBGA 4PPRA 3UPPA 1ES5A 1DJBA 5EUAA 1IKIA 3VFFA 5FQIA 1L0GA 3TG9A 5EOEA 1K54C 2E8IA 4XUZA 1W7FA 5FQJA 3C4PA 2WKEA 3JYIA 2XDMA 1NZOA 1JWPA 3UN7A 3ZG5A 3BEBA 4MBHA 5HAPA 1OMEA 3P98A 3HLBA 4DDSA 5CTMA 1KVLA 5EOOA 3W8KA 4KG5A 1DJCA 1FCNA 1L0FA 1MPLA 1SKFA 3OPPA 4JF4A 4RVAA 4OKPA 5FAQA 5GL9A 1ZG4A 2XQZA 3TSGA 2P9VB 1PW8A 4OLGA 2Y2PA 1KGGA 4LENA 4IBRA 1KVMA 5GLAA 3IXDA 2EXBA 1K54A 1ESUA 2EFUA 4KZ8A 4GB7A 5FAOA 4QY5A 3SOIA 2JCHA 5GLDA 1BLSA 1BT5A 2XEPA 4KG2A 3ZG9B 4WMCA 1RCJA 2WGWB 5EVIC 5KSCA 5CGXA 1ERMA 3IHAA 4S2KA 4ZDXA 1E3UD 2HDUA 3IXHA 4X53A 3NY4A 1YMXA 2Y59A 4PM7A 3Q7ZA 2XF3A 2QZ6A 4KZ9A 2J8YA 3Q81A 4WEKA 3IF5A 4UAAA 4ZAMA 4LV0A 1CEFA 3BFFA 5EVIA 3IQAA 3OCNA 1W8YA 5TGFA 2ZC6B 5HX9A 2B5RA 4JKTA 4UA6A 3FKWA 3C4OA 3A3IA 2DNSA 1GCEA 3UE3A 2HDRA 4LV2A 1MWUA 4K91A 3HL9A 5DF9A 4E6WA 4ZTKA 1LL9A 3M6BA 2Z2MB 2ZM2A 3WS1A 3PBRA 3VSKA 3HVFA 2XD1A 5E2EA 2IWDA 2X01A 2Y2KA 3N6IA 4PM6A 2J7VA 4D2OA 1K38A 1N4OA 3W4QA 4MEZA 3BYDA 3WS5A 4BD1A 5EPHA 3SH9A 4X56A 5FQKA 1PYYA 1ZKJA 3EQVA 3M2JA 1JTDA 3HLFA 3PBOA 3RXXA 5A92A 2G2UA 4O7DA 4B4XA 4S2OA 3N8LA 4IBXA 4LCMA 4MNRA 1GA9A 4C6YA 3IF6C 4KQRA 4S2LA 1MKIA 4DRTA 4GKUA 3GV9A 3IXGA 3OPRA 4OPQA
chains in the Genus database with same CATH superfamily
2D02A 3G31A 5HW3A 2KDKA 3BFDA 3LR4A 2ZC4B 1K6SA 4WM9A 1GHPA 4P85A 4Y0UA 1SDEA 4DKIA 4GDNA 1NRFA 5FQQA 3U2AA 4HI4A 1KDWA 2A24A 1MWTA 5HFOA 1DJAA 1PWCA 3IWOA 2Y2LA 3ZVTA 1I2WA 4R70A 3RXWA 5LBRA 2MJ6A 2QJ7A 2Y4AA 2XRNA 1ACFA 4F94A 4WN5A 1OTBA 3KYZA 1K56A 1YLPA 3MQOA 1WE4A 4EERA 1L0EA 3VV4A 1NWZA 2OOLA 4EQIA 3G30A 2W0NA 2FFFB 3G2YA 5M18A 2G2WA 5I94A 3G6OA 5DTTA 5HDCA 4WEJA 4NG2A 2Y2IA 5AJGA 4EETB 4R3AA 4IUKA 3LI8A 4OVDA 4O8GA 3V50A 4XT2B 3ZDJA 2ZMAA 3MXQA 1SKOA 3UB9A 4ETXA 2J9OA 3LI9A 3W4OA 3LIFA 3WS4A 2V2FF 1XFQA 1T19A 2FFYA 3G34A 3MF0A 4C75A 4HH2A 1LL5A 3D72A 1TD5A 5AQ7A 5FEGA 3IXBA 2QHKA 3MSHA 3JVUA 4H8RA 1YLZA 2ZQ8A 1JTGA 3H82B 4L9EA 5I5LA 4Q8IA 3BFEA 2WK0A 1PI4A 1S4SA 2EXAA 1P9WA 1H8ZA 1XXMA 4OPRA 4FH2A 3NDEA 3LFVA 2ZQCA 3JPUA 4PKYA 2KOIA 4Y13A 3OPLA 1S66L 3EQUA 5L07A 2RCXA 2HF6A 1S1YA 4H6JB 2WKHA 2WZZA 3T12B 2V8FA 3FC7A 3A3JA 1FOFA 5DJTA 2L0WA 3IS2B 2M1CA 2EX2A 4IJGA 4OOLA 4P6BA 2EWWA 4DXCA 1XA1A 4KQQA 2Y2NA 2ZC7A 2ZQAA 3DW0A 5DVAA 4GNUA 4PMAA 2QMIA 2WAFA 1K25A 4P87A 4OQHA 5E43A 1NLZA 2E8JA 1KDSA 1PRQA 4R3JA 5FASA 1K4FA 4EWFA 2XSSA 3VFHA 1YLYA 1KOUA 5FQMA 1NXYA 4JXVA 5AQBA 5L8MA 3G2ZA 3PAGA 3VOZA 1OT6A 4R4SA 1FILA 4QY6A 3Q82A 3EEAA 3CAXA 3UE1A 1RP5A 5HWTA 1XGJA 1F5MA 2EX8A 5HL1A 4WZ4A 2Y79A 2P9VA 4HJ4A 1HVBA 2W3FA 4GD8A 3A0SA 5J3WA 4GOGA 2ZOHA 3ITAA 3ZG0A 4BENA 2PBDP 4OQIA 3MKFA 2ZQ7A 4MCWA 3PBSA 3WWXA 2R9XA 1RGZA 4UA9A 4Y0OA 3UO9A 4DMZA 1HZOA 2GNXA 5CGWA 5EECA 4EBLA 2ZM0A 3P7NA 3R4KA 3GR2A 2P7JA 1PZOA 1CK3A 1KGFA 3LYXA 2P04A 2K2NA 3C2WA 4LRXC 4KQOA 3EEHA 4X1MA 3HLEA 1E4DA 2HDQA 3Q7VB 1GHMA 4WUJA 4B93A 1K56D 4Y17A 3A0RA 4NXEA 3BY8A 2VGKA 2JBFA 3PBNA 4GS9B 2PDRA 1H3QA 3KYEA 4DJ2A 2EFXA 2WGVA 3LEQA 2V1ZA 5FATA 3UPNA 2IWBA 1NYMA 4ARZB 3TOIA 2NUPC 1HD8A 4E3OA 3BM6A 4ZJ1A 3T1SA 4E3IA 2ZLYA 4YWZA 1FR6A 1CF0A 3CITA 4HQAA 4QJGA 2P74A 3CG5A 4BMWA 3O3VA 3A3EA 3OLOA 4X6TA 4X68A 1VEUB 4FH4A 1IYQA 3P01A 1PNEA 3C30A 5FQIA 1L0GA 3TG9A 1K54C 1OPXA 3C4PA 1NZOA 5HAPA 4KUOA 3LR0A 5EOOA 1L0FA 4JF4A 5FAQA 4UEYA 1V9YA 3T50A 1KGGA 1K54A 4KZ8A 2JCHA 1BLSA 4KG2A 4WMCA 4I38A 2WGWB 5EVIC 5CGXA 2GX5A 5HSQA 1P9RA 2QZ6A 2J8YA 2VX8A 3Q81A 3BWLA 4LV0A 3BFFA 3QP6A 5EVIA 4I39A 3EWKA 3T4TA 1CQAA 4I5SA 4UA6A 3FKWA 3C4OA 4EQ1A 2DNSA 2HDRA 4NXFA 4EEPA 1XJ4A 3M6BA 1JNUA 4JGOA 4K08A 5E2EA 2IWDA 2X01A 2Y2KA 3N6IA 2W1RA 4HJ3A 3EGDC 5G4YA 1PFLA 4UQIM 5FQKA 1FIKA 4Q0JA 3EQVA 3M2JA 3HLFA 4B4XA 4S2OA 3N8LA 4C6YA 2VA0A 4KQRA 4S2LA 4DRTA 4QPRA 3IXGA 3OPRA 3MZDA 4IEDA 4GHIB 4U3TA 1MWSA 1WYBA 3V3RA 3QP5A 2ACGA 5M19A 4BBVA 4E3LA 4MBFA 3DWKA 4WYYA 3MXSA 2W1TA 2W3DA 3F1OB 3HJIA 5F5YA 4PM9A 1MC0A 4QD4A 4NK3A 1PWDA 2J3WA 2PU4A 4S2PA 4BL3A 5CXWA 1OTEA 2K31A 2WADA 3F1NB 4CLCE 3OC2A 3SS3A 3UDFA 3DWZA 3MMHA 3S7QA 3HUOA 4OH0A 4KZBA 2VV8A 3PTEA 1P0ZA 4PKYG 4EBPA 3ZCZA 4DN0A 3B47A 1VHMA 3E4QA 4HIAA 4BLMA 2B18A 1MWRA 3CLOA 3D9YA 5DKKA 1W8QA 2A49A 2LB5A 2W3GA 2WKIA 1FSWA 4R1GA 5GHYA 3IHBA 3VE3A 1LSXA 4CJNA 3D4FA 3CMZA 4P6ZS 5HPIA 3GECA 1QMEA 3H7WB 5HAQA 2KX6A 2HZ5A 5HZHA 3ZYTA 2BTFP 5EVLA 5EV0A 1SKOB 5F1GA 4DF6A 1CJFA 3HBRA 4ZBEA 4CLCC 1XGIA 4GN2A 1OTAA 1AWIA 1Y28A 4Q0HA 2JKGA 2ZM8A 1ZC2A 5FI2A 2DCFA 2BG1A 5HPFA 3VP0A 1W63Q 1CEGA 3KSFA 4R4RA 3MKEA 2VLGA 3NHQA 2L4RA 4CLCA 5C5KA 3T4JA 1N9OA 1NRJA 1WYCA 1MY8A 2ZC5B 1LT0A 2OAP1 3HREA 4F3LB 1YLWA 3E4OA 1ES4A 3HLGA 2EWVA 5FL3A 3MZEA 1L0DA 3G4PA 5DTSA 2XA7M 3VP4A 4JGQA 2OWHA 2ZOIA 3IF6B 1YPRA 3FYZA 4OOMA 1O7EA 4YOFA 4JPMA 2FZ0A 4JF5A 4HP9A 5IHVA 3E4PA 4X69A 2PD7A 2O9AA 1K4EA 2ZL1A 2I72A 4DE3A 5FSRA 1SHVA 2HPBA 4ID4A 5CEDA 1ES3A 3DTEA 3WRZA 1OTDA 4HEFA 3V67A 4YNRA 3VE4A 4GDBA 2ZMVA 4N92A 2HJ9C 1K6RA 5E2GA 4UA7A 5BOHA 3V3SA 1X0OA 1YLJA 3B33A 4FD8A 5HWWA 2Q0OA 3PBQA 4WMCD 3TJZC 4LRZE 3ZG8B 4BBUA 2HDSA 3E98A 4B4ZA 4DE2A 3CI6A 2DRWA 3UDXA 3IWIA 1N9BA 4DDYA 4S2NC 3UB6A 3V39A 3ZG7B 3B3XA 4P0MA 1KE3A 5EVID 3C5AA 3OZHA 3S22A 4ETZA 4KZ3A 5F82A 4NETA 3FZCA 4E3NA 4S2NA 5TFQA 1ES2A 3WS0A 5FAPA 2X71A 2A3UA 2GDNA 3L7HA 4R38A 5GHZA 5JYOA 1IELA 2ZD8A 2Y2JA 2DMWA 1EW0A 4JGRA 4IVIA 1OJ5A 1YQSA 5CX7A 5KSHA 4HP4A 2XR0A 2OLVA 4XXRA 2CC1A 4EUZA 3S4XA 2WZXA 1FCOA 1JWVA 3ZNTA 1XJ6A 3IWQA 1VM1A 1HTZA 1M40A 2C5WB 2GJ3A 3LR3A 3IBRA 1GA0A 3QP2A 4XUXA 1BUEA 3C7VA 3PYPA 3BLSA 3VSLA 2PHYA 2WUQA 1TS0A 4O0PA 3B42A 1XA7A 4QWOA 3NECA 3O87A 3UPOA 2WAEA 3S7OA 5J4EA 2PT7A 1ZHHB 2H5SA 2VV7A 4A5RA 3BFCA 3G35A 3GVBA 2IWCA 3T1QB 4CQHA 2XFSA 5CECA 1NJ4A 1W63M 3HCYA 4KUKA 1I5QA 1ONHA 4OPZA 2VKSA 2QYBA 2Y55A 3K2NA 2R78A 1H0MA 1WA9A 4ESPA 1K57C 3T4LA 1H5XA 4N9LA 4NEED 4B88A 5KMWA 3SH8A 2YKHA 1J3WA 4O01A 3CPTB 3MBZA 4L0LA 1Z6FA 4QU3A 1K57A 3IX4A 1L3LA 2M7UA 3ZGAB 3H9WA 5K5BA 3UPPA 3VFFA 4CLCD 4WL9A 2E8IA 2WKEA 3JYIA 4MBHA 5CTMA 1KVLA 4LPZA 4KG5A 1DJCA 1FCNA 3ICYA 4RVAA 4OKPA 1ZG4A 4EEUA 3TSGA 4LENA 3E0YA 2UV0E 4QY5A 3SOIA 5GLDA 1BT5A 3O5YA 4II7A 3ZG9B 4I3JA 2K7SA 1ERMA 4ZDXA 4X53A 1YMXA 4PM7A 3IBJA 3Q7ZA 4KZ9A 3QP8A 4WEKA 3IF5A 4UAAA 4ZAMA 1CEFA 4B9OA 3IQAA 1VETB 1W8YA 2ZC6B 5HX9A 3FPWA 2EA9A 3A3IA 3UE3A 4XT2A 4PAUA 4EU0A 1MWUA 4MN7A 4ZTKA 1HLUP 2NUTC 2ZM2A 4ME4A 2V1BA 3W4QA 3BYDA 1T18A 2VGLM 4X56A 1PYYA 4HOIA 1JTDA 3UMDA 3CWFA 3RXXA 2G2UA 4O7DA 4IBXA 1GA9A 1MKIA 2VK3A 4GKUA 1N9LA 4OPQA 1VB6A 3H82A 3UB8A 1PW1A 1F2KA 3N4IA 2W1TB 3UNWA 3O88A 4KZ7A 2Y8HA 3HLWA 3M2KA 4IVKA 3W4PA 3KSHA 4JXGA 1JWZA 3MZFA 2X02A 5CHUA 4ZJ3A 4JLFA 4G3KA 4HHDA 3I7JA 4KZ4A 2Y2OA 1Z09A 1S67L 1Y54A 2BLSA 3KX0X 4H6JA 3OPHA 5HL6A 3F1PB 3C38A 5E2HA 2H0TA 5L10A 3RJUA 3QNCA 2OV5A 2VGJA 3RH8B 3KSGA 2Q9MA 4EV4A 3BECA 2Y2QA 2WKPA 3TRCA 4JF6A 3R7WB 1LHYA 3D3OA 3UMEA 3C8CA 4X55A 3PR6A 4BD0A 1G5UA 4OONA 1S0WA 5F69A 1IKGA 3O86A 5TBMB 1TS7A 1NLYA 1ALQA 1ERQA 2QJ5A 4S2JA 4YFMA 1MBLA 3BLMA 3PBTA 1YT4A 4LV3A 2ZC3B 3QP1A 2WGIA 4S2MA 4P6ZM 5FI7A 3SS4A 1T1CA 3MQ0A 5A93A 3GQZA 2XLNA 5FDHA 4U0TA 5FEFA 5J8XA 5HWVA 1FCMA 2XGNA 4GD6A 3AGFA 1LL8A 3WRTA 2JC7A 2JKTI 4EBNA 4Z9QA 5A8BA 3CHWP 5CHJA 2VZWA 4ZJ2A 1YAXA 5TJJA 5A91A 1D06A 1XP4A 4LRYC 5CERA 3ZFZA 3LGOA 3QP4A 3Q1FA 4EESA 3MJQA 1PWGA 1IYSA 3T4KA 4QHCA 1K55C 3NOPC 1S6RA 5F1FA 1FSYA 5HAIA 3HJKA 2A24B 1LSWA 2W3HA 3LIEA 4M4XA 4FOFA 5KZHA 3Q7VA 4I3AA 1K55A 4EW7A 2HP6A 2Y2HA 2VJWA 4GCZA 4GS9A 4NKPA 1DY6A 5E2FA 5GHXA 2V20A 4RX2A 4N9KA 2Y91A 5DF8A 2R9WA 3K3CA 5GLCA 4ARZA 1H8MA 3S1YA 1SDNA 5JYPA 1K0KA 4Z1WA 3SW1A 4HBUA 5EE8A 3ISGA 4R3BA 1L2SA 1VEUA 2ZQDA 5G18A 2CMNA 1CI8A 1XJ2A 2I9VA 4Y2FA 5FI6A 2KLIA 2PAVP 3BFGA 2J3TC 1T1BA 3NCKA 3IH9A 5HD5A 4X25A 5F83A 1CI9A 3PHYA 2B95A 3MFXA 3VMAA 2WYXA 3M6HA 2HP5A 3BQAA 3GDIA 3EOIA 2WGWA 1DRMA 3U4LP 4OP5A 4RQ9A 4JGPA 2JKFA 4UQIS 4ZRRA 5F6AA 2B02A 3UB5P 3W2ZA 1TS6A 2WKQA 4BL2A 3NJAA 3BJNA 4E6XA 2Z6DA 3CJMA 3GTCA 5F68A 1LI9A 3BQ8A 3NI9A 4WZ5C 4OOYA 5L2FA 5KIZA 4GW9A 2L1MA 3DAVA 3BW6A 3UE0A 2HP9A 3NBLA 5U47A 1IYOA 4GHIA 4RYEA 1Y4OA 4WZ5A 2OLUA 3JVVA 1KGEA 5EM1A 1EWZA 3LY4A 3F1OA 1XPBA 1KE4A 1RGYA 1SCWA 4N1HA 3LUQA 4CPKA 5G4ZA 2PU2A 2JKRI 1KE0A 1FQGA 5FDSA 1DP9A 3CZDA 4LCLA 3UB7A 2JE5A 5DF7A 3F1NA 2XK1A 5TR7A 4RA7A 1BLPA 2J9PA 4WBGA 1UWPX 4PPRA 1ES5A 1DJBA 4G3WA 1UGUA 1F98A 5EOEA 4XUZA 3NOTC 1GSWA 2XDMA 3UN7A 4BBTA 3BEBA 2M7VA 1OMEA 3P98A 1SKFA 1V9ZA 2XQZA 2P9VB 2Y2PA 3IX3A 4IBRA 2PR5A 2EXBA 1ESUA 1BYWA 2V1AA 1F9IA 3CUEC 4HY8A 1E3UD 3IXHA 3NY4A 2Y59A 1ODVA 3LR5A 3H7WA 1S4RA 3CUEA 3OCNA 5TGFA 1SZVA 2JKTM 3FPVA 4L9FA 1GCEA 4WF0A 2FH5A 2VEAA 3DBAA 4Y3IA 3K3DA 3T1RA 4E6WA 5MC7A 1LL9A 3WS1A 3PBRA 3HVFA 2XD1A 3NOUC 2J7VA 4D2OA 2OWJA 2XA7S 4MEZA 5DJUA 2INWA 4BD1A 5EPHA 3SH9A 2V9AA 1ZKJA 5IU1A 4F3LA 5A92A 4Y15A 3IF6C 2BASA 3LY3A 1W5DA 3FWLA 2Y2MA 1NZUA 3PXPA 5HD3A 2XROA 4KZAA 3LICA 2PBYA 3IF6A 3LIAA 4JXWA 4OQGA 4K0WA 5GLBA 3UDIA 2J80A 3SH7A 1BLHA 5AQ9A 1OTIA 4FUWA 2OAQ1 2HGVA 4HNBA 3V5MA 1MXOA 2RL3A 3WS2A 1YM1A 4G3VA 1Q2QA 3N7WA 3GMWA 3BRMA 4MLLA 1LLBA 2A2LA 1T1AA 2J3TD 5DFYA 3MFDA 3ITBA 1O07A 4FCFA 4M3KA 4PM5A 3T4QA 2C6WB 4WELA 1YKDA 1G28A 4E04A 4GLQA 3UY6A 3OCLA 3MQQA 2O9BA 2EX6A 4R23A 4OPYA 1Q2PA 1IEMA 4BWIA 2XFTA 4S2IA 3ULFA 1UWNX 5HARA 5A90A 4NXBA 5EVIB 1TVFA 4N1XA 1XJ3A 5CGSA 4JBFA 3LO7A 1FR1A 1TF1A 4LV1A 4HJ6A 1TEMA 1BULA 5EVEA 1U60A 5CRFA 2PYRA 3N8SA 3BY9A 2ZJ9A 1OT9A 3EGXC 2XH9A 1ESIA 2V0UA 3GSGA 4PM8A 3VOYA 4IUHA 2WKRA 4EUVA 3NULA 1PIOA 4GZBA 3RTYA 3ZHHA 3L9KA 3ZVWA 1JVJA 3IH8A 1TDGA 2ZMFA 2HJEA 1GHIA 1J9MA 4JXSA 3SZTA 1ZTUA 3HLCA 3VP1A 1PZPA 3HUMA 2QWSA 2YKFA 1IOUA 2ZQ9A 4HBTA 4KG6A 3PAEA 2IA2A 2PD8A 4U0XA 2PYPA 2XD5A 3QHYA 2Y2GA 3MR0A 5DTKA 1YSPA 4BQMA 4FSFA 3E2KA 5M1AA 4OP8A 4MMNA 3NIAA 1G6AA 3RFBA 3HLDA 3MXRA 1XX2A 2JKRM 4WLAA 1N9NA 1EI5A 4KZ6A 4Y5FA 5EFWA 3IS2A 3G32A 4DE1A 2H0YA 1BLCA 4KZ5A 4R6LA 2Q9NA 3A0VA 2JHEA 1TDLA 4L9GA 1AXBA 3KYQA 3N8RA 3CPTA 3ZNYA 3MS6A 1MKMA 1C3BA 3T4OA 1OJGA 1PI5A 4Y0TA 4E3JA 4OQ0A 4Q0IA 2JN7A 1IYPA 2W3EA 2O0YA 3E2LA 2QPNA 3SS5A 1NYYA 4RX3A 2EX9A 2HV1A 1ZG6A 3VP3A 4OLDA 3NC8A 1W79A 1P97A 1I2SA 4MN5A 3A3DA 3QNBA 5D3OA 5DFXA 4C3QA 5DKLA 5CEBA 1NY0A 5CHMA 1MZUA 2UWXA 3Q07A 4CLCB 1LI0A 1XKZA 4LLOB 5IT5A 2D01A 1BTLA 5FA7A 1TS8A 2G7UA 3OBFA 4KQDA 5AVFA 3A3FA 2PR6A 3FKVA 1IFQA 2VGLS 2V8CA 3IX8A 3KO6A 1QMFA 1BZAA 1VETA 1LSVA 2H10A 4NXGA 2AVXA 3LIBA 1M6KA 2VV6A 3LIDA 2OSUA 4Y7PA 4IHQA 1EROA 4DJ3A 1E3UA 1E25A 2ZL1B 3P09A 2Z2LB 3GRJA 4HESA 4LFUA 4DE0A 5J7EA 1YSQA 3IT9A 1G6OA 2QKPA 4LGWA 3VP2A 1ONGA 3NDGA 3C7UA 3AGDA 5AQAA 5HDSA 1YMSA 4KENB 1YLTA 4X1LA 3DTMA 4E3MA 5CTNA 2O9CA 4YINA 5AVEA 4AFIA 3S7NA 3AGEA 4EXOA 4GJ4A 5FQ9A 1H8YA 3LEZA 4R0QA 1A0KA 2P08A 1G68A 3HUNA 1VQQA 4UHUA 1BSGA 5IS1A 4K0XA 1DP6A 1D7EA 4QB8A 1XFNA 4DXBA 3S7PA 4BJPA 4E3KA 4D60A 3LCEA 4MBKA 1GSXA 3KSIA 3FV7A 5EM0A 3F1PA 2ZBBA 5EUAA 1IKIA 2V0WA 1W7FA 5FQJA 3FG8A 1JWPA 3ZG5A 3ZQ5A 4PHTA 3T1XA 3HLBA 4DDSA 3W8KA 1MPLA 3OPPA 5GL9A 3OOVA 4OLGA 1PW8A 3VOLA 3T4SA 5GLAA 1KVMA 3IXDA 2EFUA 1GSVA 2GZAA 4GB7A 5FAOA 3TE8A 2LB9A 2XEPA 2O99A 3R7WA 1RCJA 5KSCA 3IHAA 4I3IA 4S2KA 2HDUA 1STZA 2XF3A 5L09A 1DP8A 5TBMA 1S1ZA 4HH3A 2B5RA 4JKTA 3DTIA 4FTXA 5HDDA 4LV2A 4K91A 3HL9A 5DF9A 2H28A 2PRFA 2Z2MB 3VSKA 3TW8A 4PM6A 1K38A 1N4OA 4MDZA 3UE6A 3WS5A 1D1JA 2Z6CA 3DTKA 3PBOA 4MN6A 4LCMA 2W27A 4MNRA 3GV9A
chains in the Genus database with same CATH topology
3LY3A 1W5DA 3FWLA 3G31A 3MZDA 5HW3A 4IEDA 4U3TA 3BFDA 2Y2MA 1MWSA 1PW1A 1WYBA 3V3RA 3N4IA 1NZUA 3UNWA 5M19A 2ZC4B 4E3LA 1K6SA 4MBFA 3O88A 4KZAA 4KZ7A 2PBYA 3DWKA 3IF6A 4WYYA 3MXSA 1GHPA 4JXWA 3HLWA 3M2KA 4OQGA 4P85A 4WM9A 4Y0UA 1SDEA 4DKIA 4IVKA 4GDNA 3W4PA 4K0WA 4JXGA 1JWZA 3MZFA 5GLBA 3UDIA 1NRFA 2X02A 5FQQA 5CHUA 4ZJ3A 3SH7A 4PM9A 4QD4A 1KDWA 4JLFA 4NK3A 1PWDA 2PU4A 4S2PA 1MWTA 5HFOA 1BLHA 1DJAA 4BL3A 5AQ9A 1PWCA 3I7JA 4KZ4A 2Y2OA 3IWOA 5CXWA 1Y54A 2BLSA 2Y2LA 3ZVTA 1I2WA 3RXWA 2WADA 3V5MA 1MXOA 2RL3A 3OC2A 3SS3A 3OPHA 3WS2A 1YM1A 3UDFA 3DWZA 1Q2QA 3N7WA 3GMWA 3HUOA 3BRMA 4OH0A 2Y4AA 4KZBA 4MLLA 3PTEA 1LLBA 5E2HA 4F94A 2H0TA 4EBPA 3RJUA 3ZCZA 3QNCA 2OV5A 2VGJA 3MFDA 3ITBA 4BLMA 1K56A 2Q9MA 1O07A 1MWRA 4EV4A 3BECA 1YLPA 4FCFA 2Y2QA 4M3KA 4PM5A 1W8QA 1WE4A 2A49A 2C6WB 4WELA 4JF6A 1L0EA 2WKIA 1FSWA 1LHYA 4R1GA 5GHYA 3UY6A 4EQIA 3OCLA 3G30A 4X55A 3IHBA 2FFFB 3G2YA 2EX6A 4R23A 4OPYA 4BD0A 4OONA 4CJNA 5JYPA 3D4FA 5M18A 3CMZA 1Q2PA 1IEMA 1S0WA 2G2WA 2XFTA 4S2IA 5I94A 1QMEA 5DTTA 5HAQA 4WEJA 1IKGA 3O86A 5HARA 2Y2IA 1ALQA 1ERQA 5A90A 5EVIB 1TVFA 5EVLA 4N1XA 5F1GA 4DF6A 5CGSA 4JBFA 3LO7A 3HBRA 4OVDA 4S2JA 1FR1A 4YFMA 1MBLA 4ZBEA 3BLMA 3PBTA 3V50A 1YT4A 4LV3A 1XGIA 4LV1A 2ZC3B 4GN2A 3ZDJA 2ZMAA 2WGIA 4S2MA 1TEMA 1BULA 2ZM8A 1ZC2A 1U60A 5FI2A 2DCFA 2J9OA 2BG1A 5CRFA 3W4OA 3VP0A 3N8SA 5FI7A 1CEGA 3SS4A 4R4RA 3WS4A 3MKEA 2ZJ9A 2V2FF 5A93A 3GQZA 2XLNA 2XH9A 2FFYA 4U0TA 1ESIA 5FDHA 3GSGA 3G34A 4PM8A 3VOYA 5J8XA 4C75A 1FCMA 1WYCA 2XGNA 1MY8A 4GD6A 2ZC5B 3AGFA 3WRTA 1LL5A 2JC7A 5AQ7A 3HREA 3IXBA 4EBNA 4Z9QA 1PIOA 4GZBA 3ZHHA 5CHJA 1YLWA 3ZVWA 1JVJA 1ES4A 3HLGA 4H8RA 4ZJ2A 3IH8A 5A91A 1TDGA 1YLZA 3MZEA 2ZQ8A 1XP4A 1JTGA 1L0DA 5CERA 3ZFZA 4Q8IA 3BFEA 2WK0A 3G4PA 1GHIA 5DTSA 1PI4A 1J9MA 4JXSA 2EXAA 3VP4A 3HLCA 3Q1FA 1H8ZA 3VP1A 3IF6B 1PZPA 1XXMA 1PWGA 1IYSA 3FYZA 3HUMA 4OPRA 4QHCA 4FH2A 4OOMA 1O7EA 1K55C 4JPMA 3NDEA 4JF5A 5IHVA 2ZQCA 4X69A 1S6RA 2ZQ9A 5F1FA 1FSYA 4HBTA 1K4EA 4KG6A 3PAEA 5HAIA 2I72A 4DE3A 5FSRA 3OPLA 1SHVA 2HPBA 4ID4A 5CEDA 1ES3A 3WRZA 3EQUA 4HEFA 2RCXA 5KZHA 4U0XA 2XD5A 3Q7VA 1K55A 4GDBA 3QHYA 4N92A 2HP6A 2Y2GA 2WKHA 2Y2HA 1K6RA 5DTKA 2WZZA 5E2GA 4UA7A 5BOHA 4BQMA 3V3SA 1YLJA 4FSFA 3E2KA 4FD8A 3A3JA 4OP8A 5M1AA 3NIAA 1G6AA 1FOFA 1DY6A 3HLDA 5E2FA 5GHXA 3PBQA 3MXRA 1XX2A 4WMCD 1EI5A 2EX2A 2V20A 4OOLA 4KZ6A 4N9KA 4RX2A 3ZG8B 4P6BA 2HDSA 2Y91A 5DF8A 3G32A 4DE1A 4B4ZA 2H0YA 4DE2A 1BLCA 2R9WA 4KZ5A 4DXCA 2Q9NA 5GLCA 2DRWA 1XA1A 3UDXA 3IWIA 1N9BA 3S1YA 4KQQA 2Y2NA 1SDNA 2ZC7A 4S2NC 3V39A 2ZQAA 3ZG7B 4DDYA 3B3XA 1TDLA 4P0MA 3DW0A 1KE3A 5DVAA 4GNUA 5EVID 4PMAA 2QMIA 1AXBA 3C5AA 3OZHA 2WAFA 1K25A 4P87A 4OQHA 4HBUA 3N8RA 5EE8A 3ISGA 4R3BA 3S22A 1L2SA 4KZ3A 5E43A 5F82A 3ZNYA 2ZQDA 4NETA 5G18A 1KDSA 4R3JA 3FZCA 1K4FA 4E3NA 1CI8A 5FASA 4S2NA 5TFQA 1C3BA 4EWFA 1ES2A 3WS0A 1PI5A 4Y0TA 3VFHA 5FAPA 2X71A 4E3JA 1YLYA 2A3UA 4OQ0A 2GDNA 5GHZA 5JYOA 5FQMA 1IYPA 1NXYA 1IELA 2ZD8A 3E2LA 4JXVA 5AQBA 5FI6A 3G2ZA 3PAGA 2QPNA 3VOZA 2Y2JA 3SS5A 1NYYA 4RX3A 4R4SA 2EX9A 3BFGA 4QY6A 1ZG6A 3Q82A 4OLDA 3VP3A 3NC8A 1W79A 4IVIA 1RP5A 1I2SA 3UE1A 1XGJA 3A3DA 2EX8A 3QNBA 1YQSA 5HL1A 4WZ4A 5D3OA 3NCKA 4C3QA 2P9VA 5CEBA 5KSHA 3IH9A 1HVBA 1NY0A 5CHMA 2UWXA 3Q07A 1CI9A 1LI0A 1XKZA 4GD8A 5F83A 3VMAA 2XR0A 2OLVA 2WYXA 4GOGA 3M6HA 3ITAA 2HP5A 2WGWA 3ZG0A 4BENA 1BTLA 4OQIA 4XXRA 2CC1A 4EUZA 5FA7A 3MKFA 2ZQ7A 3S4XA 2WZXA 1FCOA 1JWVA 4OP5A 3PBSA 3WWXA 3ZNTA 2R9XA 3IWQA 1RGZA 3A3FA 4UA9A 4Y0OA 1VM1A 3FKVA 1HTZA 1M40A 3UO9A 2C5WB 1QMFA 1BZAA 1HZOA 1GA0A 4XUXA 1BUEA 5CGWA 2H10A 5EECA 3C7VA 4EBLA 2ZM0A 3BLSA 3VSLA 1M6KA 2WUQA 3GR2A 2OSUA 4Y7PA 1EROA 1PZOA 1E3UA 1CK3A 1KGFA 4BL2A 1E25A 1XA7A 3O87A 3P09A 4KQOA 2Z2LB 3UPOA 3GRJA 4HESA 4E6XA 2WAEA 4DE0A 3HLEA 1E4DA 2HDQA 3IT9A 3CJMA 3GTCA 3Q7VB 1GHMA 2H5SA 4A5RA 1LI9A 3NI9A 3VP2A 1K56D 3BFCA 1ONGA 3G35A 3NDGA 3GVBA 2IWCA 3C7UA 3AGDA 4WZ5C 5AQAA 4OOYA 5L2FA 2XFSA 5CECA 1NJ4A 2VGKA 2JBFA 3PBNA 1YMSA 4KENB 1YLTA 3UE0A 3DTMA 2HP9A 3NBLA 1I5QA 1ONHA 4E3MA 5CTNA 4OPZA 5U47A 1IYOA 4YINA 4RYEA 2EFXA 2WGVA 2OLUA 2Y55A 4WZ5A 2V1ZA 3AGEA 5FATA 3UPNA 1KGEA 2IWBA 1K57C 5FQ9A 1EWZA 1NYMA 3LY4A 3TOIA 1H8YA 1H5XA 1HD8A 1XPBA 4E3OA 3BM6A 4ZJ1A 4E3IA 1KE4A 3LEZA 1RGYA 4N9LA 2ZLYA 4R0QA 4B88A 5KMWA 1FR6A 1SCWA 4N1HA 3SH8A 1G68A 4CPKA 3HUNA 1VQQA 4QJGA 2P74A 3CG5A 4UHUA 2PU2A 1BSGA 1KE0A 1FQGA 4K0XA 3O3VA 3MBZA 4QB8A 4L0LA 3A3EA 3CZDA 1Z6FA 4QU3A 4X6TA 1K57A 4LCLA 4X68A 2JE5A 4BJPA 4DXBA 5DF7A 4E3KA 2XK1A 5TR7A 4FH4A 3LCEA 4RA7A 4MBKA 1IYQA 3ZGAB 3FV7A 1BLPA 2J9PA 4WBGA 4PPRA 3UPPA 1ES5A 1DJBA 5EUAA 1IKIA 3VFFA 5FQIA 1L0GA 3TG9A 5EOEA 1K54C 2E8IA 4XUZA 1W7FA 5FQJA 3C4PA 2WKEA 3JYIA 2XDMA 1NZOA 1JWPA 3UN7A 3ZG5A 3BEBA 4MBHA 5HAPA 1OMEA 3P98A 3HLBA 4DDSA 5CTMA 1KVLA 5EOOA 3W8KA 4KG5A 1DJCA 1FCNA 1L0FA 1MPLA 1SKFA 3OPPA 4JF4A 4RVAA 4OKPA 5FAQA 5GL9A 1ZG4A 2XQZA 3TSGA 2P9VB 1PW8A 4OLGA 2Y2PA 1KGGA 4LENA 4IBRA 1KVMA 5GLAA 3IXDA 2EXBA 1K54A 1ESUA 2EFUA 4KZ8A 4GB7A 5FAOA 4QY5A 3SOIA 2JCHA 5GLDA 1BLSA 1BT5A 2XEPA 4KG2A 3ZG9B 4WMCA 1RCJA 2WGWB 5EVIC 5KSCA 5CGXA 1ERMA 3IHAA 4S2KA 4ZDXA 1E3UD 2HDUA 3IXHA 4X53A 3NY4A 1YMXA 2Y59A 4PM7A 3Q7ZA 2XF3A 2QZ6A 4KZ9A 2J8YA 3Q81A 4WEKA 3IF5A 4UAAA 4ZAMA 4LV0A 1CEFA 3BFFA 5EVIA 3IQAA 3OCNA 1W8YA 5TGFA 2ZC6B 5HX9A 2B5RA 4JKTA 4UA6A 3FKWA 3C4OA 3A3IA 2DNSA 1GCEA 3UE3A 2HDRA 4LV2A 1MWUA 4K91A 3HL9A 5DF9A 4E6WA 4ZTKA 1LL9A 3M6BA 2Z2MB 2ZM2A 3WS1A 3PBRA 3VSKA 3HVFA 2XD1A 5E2EA 2IWDA 2X01A 2Y2KA 3N6IA 4PM6A 2J7VA 4D2OA 1K38A 1N4OA 3W4QA 4MEZA 3BYDA 3WS5A 4BD1A 5EPHA 3SH9A 4X56A 5FQKA 1PYYA 1ZKJA 3EQVA 3M2JA 1JTDA 3HLFA 3PBOA 3RXXA 5A92A 2G2UA 4O7DA 4B4XA 4S2OA 3N8LA 4IBXA 4LCMA 4MNRA 1GA9A 4C6YA 3IF6C 4KQRA 4S2LA 1MKIA 4DRTA 4GKUA 3GV9A 3IXGA 3OPRA 4OPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LY3 A;  1W5D A;  3FWL A;  3G31 A;  3MZD A;  5HW3 A;  4IED A;  4U3T A;  3BFD A;  2Y2M A;  1MWS A;  1PW1 A;  1WYB A;  3V3R A;  3N4I A;  1NZU A;  3UNW A;  5M19 A;  2ZC4 B;  4E3L A;  1K6S A;  4MBF A;  3O88 A;  4KZA A;  4KZ7 A;  2PBY A;  3DWK A;  3IF6 A;  4WYY A;  3MXS A;  1GHP A;  4JXW A;  3HLW A;  3M2K A;  4OQG A;  4P85 A;  4WM9 A;  4Y0U A;  1SDE A;  4DKI A;  4IVK A;  4GDN A;  3W4P A;  4K0W A;  4JXG A;  1JWZ A;  3MZF A;  5GLB A;  3UDI A;  1NRF A;  2X02 A;  5FQQ A;  5CHU A;  4ZJ3 A;  3SH7 A;  4PM9 A;  4QD4 A;  1KDW A;  4JLF A;  4NK3 A;  1PWD A;  2PU4 A;  4S2P A;  1MWT A;  5HFO A;  1BLH A;  1DJA A;  4BL3 A;  5AQ9 A;  1PWC A;  3I7J A;  4KZ4 A;  2Y2O A;  3IWO A;  5CXW A;  1Y54 A;  2BLS A;  2Y2L A;  3ZVT A;  1I2W A;  3RXW A;  2WAD A;  3V5M A;  1MXO A;  2RL3 A;  3OC2 A;  3SS3 A;  3OPH A;  3WS2 A;  1YM1 A;  3UDF A;  3DWZ A;  1Q2Q A;  3N7W A;  3GMW A;  3HUO A;  3BRM A;  4OH0 A;  2Y4A A;  4KZB A;  4MLL A;  3PTE A;  1LLB A;  5E2H A;  4F94 A;  2H0T A;  4EBP A;  3RJU A;  3ZCZ A;  3QNC A;  2OV5 A;  2VGJ A;  3MFD A;  3ITB A;  4BLM A;  1K56 A;  2Q9M A;  1O07 A;  1MWR A;  4EV4 A;  3BEC A;  1YLP A;  4FCF A;  2Y2Q A;  4M3K A;  4PM5 A;  1W8Q A;  1WE4 A;  2A49 A;  2C6W B;  4WEL A;  4JF6 A;  1L0E A;  2WKI A;  1FSW A;  1LHY A;  4R1G A;  5GHY A;  3UY6 A;  4EQI A;  3OCL A;  3G30 A;  4X55 A;  3IHB A;  2FFF B;  3G2Y A;  2EX6 A;  4R23 A;  4OPY A;  4BD0 A;  4OON A;  4CJN A;  5JYP A;  3D4F A;  5M18 A;  3CMZ A;  1Q2P A;  1IEM A;  1S0W A;  2G2W A;  2XFT A;  4S2I A;  5I94 A;  1QME A;  5DTT A;  5HAQ A;  4WEJ A;  1IKG A;  3O86 A;  5HAR A;  2Y2I A;  1ALQ A;  1ERQ A;  5A90 A;  5EVI B;  1TVF A;  5EVL A;  4N1X A;  5F1G A;  4DF6 A;  5CGS A;  4JBF A;  3LO7 A;  3HBR A;  4OVD A;  4S2J A;  1FR1 A;  4YFM A;  1MBL A;  4ZBE A;  3BLM A;  3PBT A;  3V50 A;  1YT4 A;  4LV3 A;  1XGI A;  4LV1 A;  2ZC3 B;  4GN2 A;  3ZDJ A;  2ZMA A;  2WGI A;  4S2M A;  1TEM A;  1BUL A;  2ZM8 A;  1ZC2 A;  1U60 A;  5FI2 A;  2DCF A;  2J9O A;  2BG1 A;  5CRF A;  3W4O A;  3VP0 A;  3N8S A;  5FI7 A;  1CEG A;  3SS4 A;  4R4R A;  3WS4 A;  3MKE A;  2ZJ9 A;  2V2F F;  5A93 A;  3GQZ A;  2XLN A;  2XH9 A;  2FFY A;  4U0T A;  1ESI A;  5FDH A;  3GSG A;  3G34 A;  4PM8 A;  3VOY A;  5J8X A;  4C75 A;  1FCM A;  1WYC A;  2XGN A;  1MY8 A;  4GD6 A;  2ZC5 B;  3AGF A;  3WRT A;  1LL5 A;  2JC7 A;  5AQ7 A;  3HRE A;  3IXB A;  4EBN A;  4Z9Q A;  1PIO A;  4GZB A;  3ZHH A;  5CHJ A;  1YLW A;  3ZVW A;  1JVJ A;  1ES4 A;  3HLG A;  4H8R A;  4ZJ2 A;  3IH8 A;  5A91 A;  1TDG A;  1YLZ A;  3MZE A;  2ZQ8 A;  1XP4 A;  1JTG A;  1L0D A;  5CER A;  3ZFZ A;  4Q8I A;  3BFE A;  2WK0 A;  3G4P A;  1GHI A;  5DTS A;  1PI4 A;  1J9M A;  4JXS A;  2EXA A;  3VP4 A;  3HLC A;  3Q1F A;  1H8Z A;  3VP1 A;  3IF6 B;  1PZP A;  1XXM A;  1PWG A;  1IYS A;  3FYZ A;  3HUM A;  4OPR A;  4QHC A;  4FH2 A;  4OOM A;  1O7E A;  1K55 C;  4JPM A;  3NDE A;  4JF5 A;  5IHV A;  2ZQC A;  4X69 A;  1S6R A;  2ZQ9 A;  5F1F A;  1FSY A;  4HBT A;  1K4E A;  4KG6 A;  3PAE A;  5HAI A;  2I72 A;  4DE3 A;  5FSR A;  3OPL A;  1SHV A;  2HPB A;  4ID4 A;  5CED A;  1ES3 A;  3WRZ A;  3EQU A;  4HEF A;  2RCX A;  5KZH A;  4U0X A;  2XD5 A;  3Q7V A;  1K55 A;  4GDB A;  3QHY A;  4N92 A;  2HP6 A;  2Y2G A;  2WKH A;  2Y2H A;  1K6R A;  5DTK A;  2WZZ A;  5E2G A;  4UA7 A;  5BOH A;  4BQM A;  3V3S A;  1YLJ A;  4FSF A;  3E2K A;  4FD8 A;  3A3J A;  4OP8 A;  5M1A A;  3NIA A;  1G6A A;  1FOF A;  1DY6 A;  3HLD A;  5E2F A;  5GHX A;  3PBQ A;  3MXR A;  1XX2 A;  4WMC D;  1EI5 A;  2EX2 A;  2V20 A;  4OOL A;  4KZ6 A;  4N9K A;  4RX2 A;  3ZG8 B;  4P6B A;  2HDS A;  2Y91 A;  5DF8 A;  3G32 A;  4DE1 A;  4B4Z A;  2H0Y A;  4DE2 A;  1BLC A;  2R9W A;  4KZ5 A;  4DXC A;  2Q9N A;  5GLC A;  2DRW A;  1XA1 A;  3UDX A;  3IWI A;  1N9B A;  3S1Y A;  4KQQ A;  2Y2N A;  1SDN A;  2ZC7 A;  4S2N C;  3V39 A;  2ZQA A;  3ZG7 B;  4DDY A;  3B3X A;  1TDL A;  4P0M A;  3DW0 A;  1KE3 A;  5DVA A;  4GNU A;  5EVI D;  4PMA A;  2QMI A;  1AXB A;  3C5A A;  3OZH A;  2WAF A;  1K25 A;  4P87 A;  4OQH A;  4HBU A;  3N8R A;  5EE8 A;  3ISG A;  4R3B A;  3S22 A;  1L2S A;  4KZ3 A;  5E43 A;  5F82 A;  3ZNY A;  2ZQD A;  4NET A;  5G18 A;  1KDS A;  4R3J A;  3FZC A;  1K4F A;  4E3N A;  1CI8 A;  5FAS A;  4S2N A;  5TFQ A;  1C3B A;  4EWF A;  1ES2 A;  3WS0 A;  1PI5 A;  4Y0T A;  3VFH A;  5FAP A;  2X71 A;  4E3J A;  1YLY A;  2A3U A;  4OQ0 A;  2GDN A;  5GHZ A;  5JYO A;  5FQM A;  1IYP A;  1NXY A;  1IEL A;  2ZD8 A;  3E2L A;  4JXV A;  5AQB A;  5FI6 A;  3G2Z A;  3PAG A;  2QPN A;  3VOZ A;  2Y2J A;  3SS5 A;  1NYY A;  4RX3 A;  4R4S A;  2EX9 A;  3BFG A;  4QY6 A;  1ZG6 A;  3Q82 A;  4OLD A;  3VP3 A;  3NC8 A;  1W79 A;  4IVI A;  1RP5 A;  1I2S A;  3UE1 A;  1XGJ A;  3A3D A;  2EX8 A;  3QNB A;  1YQS A;  5HL1 A;  4WZ4 A;  5D3O A;  3NCK A;  4C3Q A;  2P9V A;  5CEB A;  5KSH A;  3IH9 A;  1HVB A;  1NY0 A;  5CHM A;  2UWX A;  3Q07 A;  1CI9 A;  1LI0 A;  1XKZ A;  4GD8 A;  5F83 A;  3VMA A;  2XR0 A;  2OLV A;  2WYX A;  4GOG A;  3M6H A;  3ITA A;  2HP5 A;  2WGW A;  3ZG0 A;  4BEN A;  1BTL A;  4OQI A;  4XXR A;  2CC1 A;  4EUZ A;  5FA7 A;  3MKF A;  2ZQ7 A;  3S4X A;  2WZX A;  1FCO A;  1JWV A;  4OP5 A;  3PBS A;  3WWX A;  3ZNT A;  2R9X A;  3IWQ A;  1RGZ A;  3A3F A;  4UA9 A;  4Y0O A;  1VM1 A;  3FKV A;  1HTZ A;  1M40 A;  3UO9 A;  2C5W B;  1QMF A;  1BZA A;  1HZO A;  1GA0 A;  4XUX A;  1BUE A;  5CGW A;  2H10 A;  5EEC A;  3C7V A;  4EBL A;  2ZM0 A;  3BLS A;  3VSL A;  1M6K A;  2WUQ A;  3GR2 A;  2OSU A;  4Y7P A;  1ERO A;  1PZO A;  1E3U A;  1CK3 A;  1KGF A;  4BL2 A;  1E25 A;  1XA7 A;  3O87 A;  3P09 A;  4KQO A;  2Z2L B;  3UPO A;  3GRJ A;  4HES A;  4E6X A;  2WAE A;  4DE0 A;  3HLE A;  1E4D A;  2HDQ A;  3IT9 A;  3CJM A;  3GTC A;  3Q7V B;  1GHM A;  2H5S A;  4A5R A;  1LI9 A;  3NI9 A;  3VP2 A;  1K56 D;  3BFC A;  1ONG A;  3G35 A;  3NDG A;  3GVB A;  2IWC A;  3C7U A;  3AGD A;  4WZ5 C;  5AQA A;  4OOY A;  5L2F A;  2XFS A;  5CEC A;  1NJ4 A;  2VGK A;  2JBF A;  3PBN A;  1YMS A;  4KEN B;  1YLT A;  3UE0 A;  3DTM A;  2HP9 A;  3NBL A;  1I5Q A;  1ONH A;  4E3M A;  5CTN A;  4OPZ A;  5U47 A;  1IYO A;  4YIN A;  4RYE A;  2EFX A;  2WGV A;  2OLU A;  2Y55 A;  4WZ5 A;  2V1Z A;  3AGE A;  5FAT A;  3UPN A;  1KGE A;  2IWB A;  1K57 C;  5FQ9 A;  1EWZ A;  1NYM A;  3LY4 A;  3TOI A;  1H8Y A;  1H5X A;  1HD8 A;  1XPB A;  4E3O A;  3BM6 A;  4ZJ1 A;  4E3I A;  1KE4 A;  3LEZ A;  1RGY A;  4N9L A;  2ZLY A;  4R0Q A;  4B88 A;  5KMW A;  1FR6 A;  1SCW A;  4N1H A;  3SH8 A;  1G68 A;  4CPK A;  3HUN A;  1VQQ A;  4QJG A;  2P74 A;  3CG5 A;  4UHU A;  2PU2 A;  1BSG A;  1KE0 A;  1FQG A;  4K0X A;  3O3V A;  3MBZ A;  4QB8 A;  4L0L A;  3A3E A;  3CZD A;  1Z6F A;  4QU3 A;  4X6T A;  1K57 A;  4LCL A;  4X68 A;  2JE5 A;  4BJP A;  4DXB A;  5DF7 A;  4E3K A;  2XK1 A;  5TR7 A;  4FH4 A;  3LCE A;  4RA7 A;  4MBK A;  1IYQ A;  3ZGA B;  3FV7 A;  1BLP A;  2J9P A;  4WBG A;  4PPR A;  3UPP A;  1ES5 A;  1DJB A;  5EUA A;  1IKI A;  3VFF A;  5FQI A;  1L0G A;  3TG9 A;  5EOE A;  1K54 C;  2E8I A;  4XUZ A;  1W7F A;  5FQJ A;  3C4P A;  2WKE A;  3JYI A;  2XDM A;  1NZO A;  1JWP A;  3UN7 A;  3ZG5 A;  3BEB A;  4MBH A;  5HAP A;  1OME A;  3P98 A;  3HLB A;  4DDS A;  5CTM A;  1KVL A;  5EOO A;  3W8K A;  4KG5 A;  1DJC A;  1FCN A;  1L0F A;  1MPL A;  1SKF A;  3OPP A;  4JF4 A;  4RVA A;  4OKP A;  5FAQ A;  5GL9 A;  1ZG4 A;  2XQZ A;  3TSG A;  2P9V B;  1PW8 A;  4OLG A;  2Y2P A;  1KGG A;  4LEN A;  4IBR A;  1KVM A;  5GLA A;  3IXD A;  2EXB A;  1K54 A;  1ESU A;  2EFU A;  4KZ8 A;  4GB7 A;  5FAO A;  4QY5 A;  3SOI A;  2JCH A;  5GLD A;  1BLS A;  1BT5 A;  2XEP A;  4KG2 A;  3ZG9 B;  4WMC A;  1RCJ A;  2WGW B;  5EVI C;  5KSC A;  5CGX A;  1ERM A;  3IHA A;  4S2K A;  4ZDX A;  1E3U D;  2HDU A;  3IXH A;  4X53 A;  3NY4 A;  1YMX A;  2Y59 A;  4PM7 A;  3Q7Z A;  2XF3 A;  2QZ6 A;  4KZ9 A;  2J8Y A;  3Q81 A;  4WEK A;  3IF5 A;  4UAA A;  4ZAM A;  4LV0 A;  1CEF A;  3BFF A;  5EVI A;  3IQA A;  3OCN A;  1W8Y A;  5TGF A;  2ZC6 B;  5HX9 A;  2B5R A;  4JKT A;  4UA6 A;  3FKW A;  3C4O A;  3A3I A;  2DNS A;  1GCE A;  3UE3 A;  2HDR A;  4LV2 A;  1MWU A;  4K91 A;  3HL9 A;  5DF9 A;  4E6W A;  4ZTK A;  1LL9 A;  3M6B A;  2Z2M B;  2ZM2 A;  3WS1 A;  3PBR A;  3VSK A;  3HVF A;  2XD1 A;  5E2E A;  2IWD A;  2X01 A;  2Y2K A;  3N6I A;  4PM6 A;  2J7V A;  4D2O A;  1K38 A;  1N4O A;  3W4Q A;  4MEZ A;  3BYD A;  3WS5 A;  4BD1 A;  5EPH A;  3SH9 A;  4X56 A;  5FQK A;  1PYY A;  1ZKJ A;  3EQV A;  3M2J A;  1JTD A;  3HLF A;  3PBO A;  3RXX A;  5A92 A;  2G2U A;  4O7D A;  4B4X A;  4S2O A;  3N8L A;  4IBX A;  4LCM A;  4MNR A;  1GA9 A;  4C6Y A;  3IF6 C;  4KQR A;  4S2L A;  1MKI A;  4DRT A;  4GKU A;  3GV9 A;  3IXG A;  3OPR A;  4OPQ A; 
#chains in the Genus database with same CATH topology
 2D02 A;  3G31 A;  5HW3 A;  2KDK A;  3BFD A;  3LR4 A;  2ZC4 B;  1K6S A;  4WM9 A;  1GHP A;  4P85 A;  4Y0U A;  1SDE A;  4DKI A;  4GDN A;  1NRF A;  5FQQ A;  3U2A A;  4HI4 A;  1KDW A;  2A24 A;  1MWT A;  5HFO A;  1DJA A;  1PWC A;  3IWO A;  2Y2L A;  3ZVT A;  1I2W A;  4R70 A;  3RXW A;  5LBR A;  2MJ6 A;  2QJ7 A;  2Y4A A;  2XRN A;  1ACF A;  4F94 A;  4WN5 A;  1OTB A;  3KYZ A;  1K56 A;  1YLP A;  3MQO A;  1WE4 A;  4EER A;  1L0E A;  3VV4 A;  1NWZ A;  2OOL A;  4EQI A;  3G30 A;  2W0N A;  2FFF B;  3G2Y A;  5M18 A;  2G2W A;  5I94 A;  3G6O A;  5DTT A;  5HDC A;  4WEJ A;  4NG2 A;  2Y2I A;  5AJG A;  4EET B;  4R3A A;  4IUK A;  3LI8 A;  4OVD A;  4O8G A;  3V50 A;  4XT2 B;  3ZDJ A;  2ZMA A;  3MXQ A;  1SKO A;  3UB9 A;  4ETX A;  2J9O A;  3LI9 A;  3W4O A;  3LIF A;  3WS4 A;  2V2F F;  1XFQ A;  1T19 A;  2FFY A;  3G34 A;  3MF0 A;  4C75 A;  4HH2 A;  1LL5 A;  3D72 A;  1TD5 A;  5AQ7 A;  5FEG A;  3IXB A;  2QHK A;  3MSH A;  3JVU A;  4H8R A;  1YLZ A;  2ZQ8 A;  1JTG A;  3H82 B;  4L9E A;  5I5L A;  4Q8I A;  3BFE A;  2WK0 A;  1PI4 A;  1S4S A;  2EXA A;  1P9W A;  1H8Z A;  1XXM A;  4OPR A;  4FH2 A;  3NDE A;  3LFV A;  2ZQC A;  3JPU A;  4PKY A;  2KOI A;  4Y13 A;  3OPL A;  1S66 L;  3EQU A;  5L07 A;  2RCX A;  2HF6 A;  1S1Y A;  4H6J B;  2WKH A;  2WZZ A;  3T12 B;  2V8F A;  3FC7 A;  3A3J A;  1FOF A;  5DJT A;  2L0W A;  3IS2 B;  2M1C A;  2EX2 A;  4IJG A;  4OOL A;  4P6B A;  2EWW A;  4DXC A;  1XA1 A;  4KQQ A;  2Y2N A;  2ZC7 A;  2ZQA A;  3DW0 A;  5DVA A;  4GNU A;  4PMA A;  2QMI A;  2WAF A;  1K25 A;  4P87 A;  4OQH A;  5E43 A;  1NLZ A;  2E8J A;  1KDS A;  1PRQ A;  4R3J A;  5FAS A;  1K4F A;  4EWF A;  2XSS A;  3VFH A;  1YLY A;  1KOU A;  5FQM A;  1NXY A;  4JXV A;  5AQB A;  5L8M A;  3G2Z A;  3PAG A;  3VOZ A;  1OT6 A;  4R4S A;  1FIL A;  4QY6 A;  3Q82 A;  3EEA A;  3CAX A;  3UE1 A;  1RP5 A;  5HWT A;  1XGJ A;  1F5M A;  2EX8 A;  5HL1 A;  4WZ4 A;  2Y79 A;  2P9V A;  4HJ4 A;  1HVB A;  2W3F A;  4GD8 A;  3A0S A;  5J3W A;  4GOG A;  2ZOH A;  3ITA A;  3ZG0 A;  4BEN A;  2PBD P;  4OQI A;  3MKF A;  2ZQ7 A;  4MCW A;  3PBS A;  3WWX A;  2R9X A;  1RGZ A;  4UA9 A;  4Y0O A;  3UO9 A;  4DMZ A;  1HZO A;  2GNX A;  5CGW A;  5EEC A;  4EBL A;  2ZM0 A;  3P7N A;  3R4K A;  3GR2 A;  2P7J A;  1PZO A;  1CK3 A;  1KGF A;  3LYX A;  2P04 A;  2K2N A;  3C2W A;  4LRX C;  4KQO A;  3EEH A;  4X1M A;  3HLE A;  1E4D A;  2HDQ A;  3Q7V B;  1GHM A;  4WUJ A;  4B93 A;  1K56 D;  4Y17 A;  3A0R A;  4NXE A;  3BY8 A;  2VGK A;  2JBF A;  3PBN A;  4GS9 B;  2PDR A;  1H3Q A;  3KYE A;  4DJ2 A;  2EFX A;  2WGV A;  3LEQ A;  2V1Z A;  5FAT A;  3UPN A;  2IWB A;  1NYM A;  4ARZ B;  3TOI A;  2NUP C;  1HD8 A;  4E3O A;  3BM6 A;  4ZJ1 A;  3T1S A;  4E3I A;  2ZLY A;  4YWZ A;  1FR6 A;  1CF0 A;  3CIT A;  4HQA A;  4QJG A;  2P74 A;  3CG5 A;  4BMW A;  3O3V A;  3A3E A;  3OLO A;  4X6T A;  4X68 A;  1VEU B;  4FH4 A;  1IYQ A;  3P01 A;  1PNE A;  3C30 A;  5FQI A;  1L0G A;  3TG9 A;  1K54 C;  1OPX A;  3C4P A;  1NZO A;  5HAP A;  4KUO A;  3LR0 A;  5EOO A;  1L0F A;  4JF4 A;  5FAQ A;  4UEY A;  1V9Y A;  3T50 A;  1KGG A;  1K54 A;  4KZ8 A;  2JCH A;  1BLS A;  4KG2 A;  4WMC A;  4I38 A;  2WGW B;  5EVI C;  5CGX A;  2GX5 A;  5HSQ A;  1P9R A;  2QZ6 A;  2J8Y A;  2VX8 A;  3Q81 A;  3BWL A;  4LV0 A;  3BFF A;  3QP6 A;  5EVI A;  4I39 A;  3EWK A;  3T4T A;  1CQA A;  4I5S A;  4UA6 A;  3FKW A;  3C4O A;  4EQ1 A;  2DNS A;  2HDR A;  4NXF A;  4EEP A;  1XJ4 A;  3M6B A;  1JNU A;  4JGO A;  4K08 A;  5E2E A;  2IWD A;  2X01 A;  2Y2K A;  3N6I A;  2W1R A;  4HJ3 A;  3EGD C;  5G4Y A;  1PFL A;  4UQI M;  5FQK A;  1FIK A;  4Q0J A;  3EQV A;  3M2J A;  3HLF A;  4B4X A;  4S2O A;  3N8L A;  4C6Y A;  2VA0 A;  4KQR A;  4S2L A;  4DRT A;  4QPR A;  3IXG A;  3OPR A;  3MZD A;  4IED A;  4GHI B;  4U3T A;  1MWS A;  1WYB A;  3V3R A;  3QP5 A;  2ACG A;  5M19 A;  4BBV A;  4E3L A;  4MBF A;  3DWK A;  4WYY A;  3MXS A;  2W1T A;  2W3D A;  3F1O B;  3HJI A;  5F5Y A;  4PM9 A;  1MC0 A;  4QD4 A;  4NK3 A;  1PWD A;  2J3W A;  2PU4 A;  4S2P A;  4BL3 A;  5CXW A;  1OTE A;  2K31 A;  2WAD A;  3F1N B;  4CLC E;  3OC2 A;  3SS3 A;  3UDF A;  3DWZ A;  3MMH A;  3S7Q A;  3HUO A;  4OH0 A;  4KZB A;  2VV8 A;  3PTE A;  1P0Z A;  4PKY G;  4EBP A;  3ZCZ A;  4DN0 A;  3B47 A;  1VHM A;  3E4Q A;  4HIA A;  4BLM A;  2B18 A;  1MWR A;  3CLO A;  3D9Y A;  5DKK A;  1W8Q A;  2A49 A;  2LB5 A;  2W3G A;  2WKI A;  1FSW A;  4R1G A;  5GHY A;  3IHB A;  3VE3 A;  1LSX A;  4CJN A;  3D4F A;  3CMZ A;  4P6Z S;  5HPI A;  3GEC A;  1QME A;  3H7W B;  5HAQ A;  2KX6 A;  2HZ5 A;  5HZH A;  3ZYT A;  2BTF P;  5EVL A;  5EV0 A;  1SKO B;  5F1G A;  4DF6 A;  1CJF A;  3HBR A;  4ZBE A;  4CLC C;  1XGI A;  4GN2 A;  1OTA A;  1AWI A;  1Y28 A;  4Q0H A;  2JKG A;  2ZM8 A;  1ZC2 A;  5FI2 A;  2DCF A;  2BG1 A;  5HPF A;  3VP0 A;  1W63 Q;  1CEG A;  3KSF A;  4R4R A;  3MKE A;  2VLG A;  3NHQ A;  2L4R A;  4CLC A;  5C5K A;  3T4J A;  1N9O A;  1NRJ A;  1WYC A;  1MY8 A;  2ZC5 B;  1LT0 A;  2OAP 1;  3HRE A;  4F3L B;  1YLW A;  3E4O A;  1ES4 A;  3HLG A;  2EWV A;  5FL3 A;  3MZE A;  1L0D A;  3G4P A;  5DTS A;  2XA7 M;  3VP4 A;  4JGQ A;  2OWH A;  2ZOI A;  3IF6 B;  1YPR A;  3FYZ A;  4OOM A;  1O7E A;  4YOF A;  4JPM A;  2FZ0 A;  4JF5 A;  4HP9 A;  5IHV A;  3E4P A;  4X69 A;  2PD7 A;  2O9A A;  1K4E A;  2ZL1 A;  2I72 A;  4DE3 A;  5FSR A;  1SHV A;  2HPB A;  4ID4 A;  5CED A;  1ES3 A;  3DTE A;  3WRZ A;  1OTD A;  4HEF A;  3V67 A;  4YNR A;  3VE4 A;  4GDB A;  2ZMV A;  4N92 A;  2HJ9 C;  1K6R A;  5E2G A;  4UA7 A;  5BOH A;  3V3S A;  1X0O A;  1YLJ A;  3B33 A;  4FD8 A;  5HWW A;  2Q0O A;  3PBQ A;  4WMC D;  3TJZ C;  4LRZ E;  3ZG8 B;  4BBU A;  2HDS A;  3E98 A;  4B4Z A;  4DE2 A;  3CI6 A;  2DRW A;  3UDX A;  3IWI A;  1N9B A;  4DDY A;  4S2N C;  3UB6 A;  3V39 A;  3ZG7 B;  3B3X A;  4P0M A;  1KE3 A;  5EVI D;  3C5A A;  3OZH A;  3S22 A;  4ETZ A;  4KZ3 A;  5F82 A;  4NET A;  3FZC A;  4E3N A;  4S2N A;  5TFQ A;  1ES2 A;  3WS0 A;  5FAP A;  2X71 A;  2A3U A;  2GDN A;  3L7H A;  4R38 A;  5GHZ A;  5JYO A;  1IEL A;  2ZD8 A;  2Y2J A;  2DMW A;  1EW0 A;  4JGR A;  4IVI A;  1OJ5 A;  1YQS A;  5CX7 A;  5KSH A;  4HP4 A;  2XR0 A;  2OLV A;  4XXR A;  2CC1 A;  4EUZ A;  3S4X A;  2WZX A;  1FCO A;  1JWV A;  3ZNT A;  1XJ6 A;  3IWQ A;  1VM1 A;  1HTZ A;  1M40 A;  2C5W B;  2GJ3 A;  3LR3 A;  3IBR A;  1GA0 A;  3QP2 A;  4XUX A;  1BUE A;  3C7V A;  3PYP A;  3BLS A;  3VSL A;  2PHY A;  2WUQ A;  1TS0 A;  4O0P A;  3B42 A;  1XA7 A;  4QWO A;  3NEC A;  3O87 A;  3UPO A;  2WAE A;  3S7O A;  5J4E A;  2PT7 A;  1ZHH B;  2H5S A;  2VV7 A;  4A5R A;  3BFC A;  3G35 A;  3GVB A;  2IWC A;  3T1Q B;  4CQH A;  2XFS A;  5CEC A;  1NJ4 A;  1W63 M;  3HCY A;  4KUK A;  1I5Q A;  1ONH A;  4OPZ A;  2VKS A;  2QYB A;  2Y55 A;  3K2N A;  2R78 A;  1H0M A;  1WA9 A;  4ESP A;  1K57 C;  3T4L A;  1H5X A;  4N9L A;  4NEE D;  4B88 A;  5KMW A;  3SH8 A;  2YKH A;  1J3W A;  4O01 A;  3CPT B;  3MBZ A;  4L0L A;  1Z6F A;  4QU3 A;  1K57 A;  3IX4 A;  1L3L A;  2M7U A;  3ZGA B;  3H9W A;  5K5B A;  3UPP A;  3VFF A;  4CLC D;  4WL9 A;  2E8I A;  2WKE A;  3JYI A;  4MBH A;  5CTM A;  1KVL A;  4LPZ A;  4KG5 A;  1DJC A;  1FCN A;  3ICY A;  4RVA A;  4OKP A;  1ZG4 A;  4EEU A;  3TSG A;  4LEN A;  3E0Y A;  2UV0 E;  4QY5 A;  3SOI A;  5GLD A;  1BT5 A;  3O5Y A;  4II7 A;  3ZG9 B;  4I3J A;  2K7S A;  1ERM A;  4ZDX A;  4X53 A;  1YMX A;  4PM7 A;  3IBJ A;  3Q7Z A;  4KZ9 A;  3QP8 A;  4WEK A;  3IF5 A;  4UAA A;  4ZAM A;  1CEF A;  4B9O A;  3IQA A;  1VET B;  1W8Y A;  2ZC6 B;  5HX9 A;  3FPW A;  2EA9 A;  3A3I A;  3UE3 A;  4XT2 A;  4PAU A;  4EU0 A;  1MWU A;  4MN7 A;  4ZTK A;  1HLU P;  2NUT C;  2ZM2 A;  4ME4 A;  2V1B A;  3W4Q A;  3BYD A;  1T18 A;  2VGL M;  4X56 A;  1PYY A;  4HOI A;  1JTD A;  3UMD A;  3CWF A;  3RXX A;  2G2U A;  4O7D A;  4IBX A;  1GA9 A;  1MKI A;  2VK3 A;  4GKU A;  1N9L A;  4OPQ A;  1VB6 A;  3H82 A;  3UB8 A;  1PW1 A;  1F2K A;  3N4I A;  2W1T B;  3UNW A;  3O88 A;  4KZ7 A;  2Y8H A;  3HLW A;  3M2K A;  4IVK A;  3W4P A;  3KSH A;  4JXG A;  1JWZ A;  3MZF A;  2X02 A;  5CHU A;  4ZJ3 A;  4JLF A;  4G3K A;  4HHD A;  3I7J A;  4KZ4 A;  2Y2O A;  1Z09 A;  1S67 L;  1Y54 A;  2BLS A;  3KX0 X;  4H6J A;  3OPH A;  5HL6 A;  3F1P B;  3C38 A;  5E2H A;  2H0T A;  5L10 A;  3RJU A;  3QNC A;  2OV5 A;  2VGJ A;  3RH8 B;  3KSG A;  2Q9M A;  4EV4 A;  3BEC A;  2Y2Q A;  2WKP A;  3TRC A;  4JF6 A;  3R7W B;  1LHY A;  3D3O A;  3UME A;  3C8C A;  4X55 A;  3PR6 A;  4BD0 A;  1G5U A;  4OON A;  1S0W A;  5F69 A;  1IKG A;  3O86 A;  5TBM B;  1TS7 A;  1NLY A;  1ALQ A;  1ERQ A;  2QJ5 A;  4S2J A;  4YFM A;  1MBL A;  3BLM A;  3PBT A;  1YT4 A;  4LV3 A;  2ZC3 B;  3QP1 A;  2WGI A;  4S2M A;  4P6Z M;  5FI7 A;  3SS4 A;  1T1C A;  3MQ0 A;  5A93 A;  3GQZ A;  2XLN A;  5FDH A;  4U0T A;  5FEF A;  5J8X A;  5HWV A;  1FCM A;  2XGN A;  4GD6 A;  3AGF A;  1LL8 A;  3WRT A;  2JC7 A;  2JKT I;  4EBN A;  4Z9Q A;  5A8B A;  3CHW P;  5CHJ A;  2VZW A;  4ZJ2 A;  1YAX A;  5TJJ A;  5A91 A;  1D06 A;  1XP4 A;  4LRY C;  5CER A;  3ZFZ A;  3LGO A;  3QP4 A;  3Q1F A;  4EES A;  3MJQ A;  1PWG A;  1IYS A;  3T4K A;  4QHC A;  1K55 C;  3NOP C;  1S6R A;  5F1F A;  1FSY A;  5HAI A;  3HJK A;  2A24 B;  1LSW A;  2W3H A;  3LIE A;  4M4X A;  4FOF A;  5KZH A;  3Q7V A;  4I3A A;  1K55 A;  4EW7 A;  2HP6 A;  2Y2H A;  2VJW A;  4GCZ A;  4GS9 A;  4NKP A;  1DY6 A;  5E2F A;  5GHX A;  2V20 A;  4RX2 A;  4N9K A;  2Y91 A;  5DF8 A;  2R9W A;  3K3C A;  5GLC A;  4ARZ A;  1H8M A;  3S1Y A;  1SDN A;  5JYP A;  1K0K A;  4Z1W A;  3SW1 A;  4HBU A;  5EE8 A;  3ISG A;  4R3B A;  1L2S A;  1VEU A;  2ZQD A;  5G18 A;  2CMN A;  1CI8 A;  1XJ2 A;  2I9V A;  4Y2F A;  5FI6 A;  2KLI A;  2PAV P;  3BFG A;  2J3T C;  1T1B A;  3NCK A;  3IH9 A;  5HD5 A;  4X25 A;  5F83 A;  1CI9 A;  3PHY A;  2B95 A;  3MFX A;  3VMA A;  2WYX A;  3M6H A;  2HP5 A;  3BQA A;  3GDI A;  3EOI A;  2WGW A;  1DRM A;  3U4L P;  4OP5 A;  4RQ9 A;  4JGP A;  2JKF A;  4UQI S;  4ZRR A;  5F6A A;  2B02 A;  3UB5 P;  3W2Z A;  1TS6 A;  2WKQ A;  4BL2 A;  3NJA A;  3BJN A;  4E6X A;  2Z6D A;  3CJM A;  3GTC A;  5F68 A;  1LI9 A;  3BQ8 A;  3NI9 A;  4WZ5 C;  4OOY A;  5L2F A;  5KIZ A;  4GW9 A;  2L1M A;  3DAV A;  3BW6 A;  3UE0 A;  2HP9 A;  3NBL A;  5U47 A;  1IYO A;  4GHI A;  4RYE A;  1Y4O A;  4WZ5 A;  2OLU A;  3JVV A;  1KGE A;  5EM1 A;  1EWZ A;  3LY4 A;  3F1O A;  1XPB A;  1KE4 A;  1RGY A;  1SCW A;  4N1H A;  3LUQ A;  4CPK A;  5G4Z A;  2PU2 A;  2JKR I;  1KE0 A;  1FQG A;  5FDS A;  1DP9 A;  3CZD A;  4LCL A;  3UB7 A;  2JE5 A;  5DF7 A;  3F1N A;  2XK1 A;  5TR7 A;  4RA7 A;  1BLP A;  2J9P A;  4WBG A;  1UWP X;  4PPR A;  1ES5 A;  1DJB A;  4G3W A;  1UGU A;  1F98 A;  5EOE A;  4XUZ A;  3NOT C;  1GSW A;  2XDM A;  3UN7 A;  4BBT A;  3BEB A;  2M7V A;  1OME A;  3P98 A;  1SKF A;  1V9Z A;  2XQZ A;  2P9V B;  2Y2P A;  3IX3 A;  4IBR A;  2PR5 A;  2EXB A;  1ESU A;  1BYW A;  2V1A A;  1F9I A;  3CUE C;  4HY8 A;  1E3U D;  3IXH A;  3NY4 A;  2Y59 A;  1ODV A;  3LR5 A;  3H7W A;  1S4R A;  3CUE A;  3OCN A;  5TGF A;  1SZV A;  2JKT M;  3FPV A;  4L9F A;  1GCE A;  4WF0 A;  2FH5 A;  2VEA A;  3DBA A;  4Y3I A;  3K3D A;  3T1R A;  4E6W A;  5MC7 A;  1LL9 A;  3WS1 A;  3PBR A;  3HVF A;  2XD1 A;  3NOU C;  2J7V A;  4D2O A;  2OWJ A;  2XA7 S;  4MEZ A;  5DJU A;  2INW A;  4BD1 A;  5EPH A;  3SH9 A;  2V9A A;  1ZKJ A;  5IU1 A;  4F3L A;  5A92 A;  4Y15 A;  3IF6 C;  2BAS A;  3LY3 A;  1W5D A;  3FWL A;  2Y2M A;  1NZU A;  3PXP A;  5HD3 A;  2XRO A;  4KZA A;  3LIC A;  2PBY A;  3IF6 A;  3LIA A;  4JXW A;  4OQG A;  4K0W A;  5GLB A;  3UDI A;  2J80 A;  3SH7 A;  1BLH A;  5AQ9 A;  1OTI A;  4FUW A;  2OAQ 1;  2HGV A;  4HNB A;  3V5M A;  1MXO A;  2RL3 A;  3WS2 A;  1YM1 A;  4G3V A;  1Q2Q A;  3N7W A;  3GMW A;  3BRM A;  4MLL A;  1LLB A;  2A2L A;  1T1A A;  2J3T D;  5DFY A;  3MFD A;  3ITB A;  1O07 A;  4FCF A;  4M3K A;  4PM5 A;  3T4Q A;  2C6W B;  4WEL A;  1YKD A;  1G28 A;  4E04 A;  4GLQ A;  3UY6 A;  3OCL A;  3MQQ A;  2O9B A;  2EX6 A;  4R23 A;  4OPY A;  1Q2P A;  1IEM A;  4BWI A;  2XFT A;  4S2I A;  3ULF A;  1UWN X;  5HAR A;  5A90 A;  4NXB A;  5EVI B;  1TVF A;  4N1X A;  1XJ3 A;  5CGS A;  4JBF A;  3LO7 A;  1FR1 A;  1TF1 A;  4LV1 A;  4HJ6 A;  1TEM A;  1BUL A;  5EVE A;  1U60 A;  5CRF A;  2PYR A;  3N8S A;  3BY9 A;  2ZJ9 A;  1OT9 A;  3EGX C;  2XH9 A;  1ESI A;  2V0U A;  3GSG A;  4PM8 A;  3VOY A;  4IUH A;  2WKR A;  4EUV A;  3NUL A;  1PIO A;  4GZB A;  3RTY A;  3ZHH A;  3L9K A;  3ZVW A;  1JVJ A;  3IH8 A;  1TDG A;  2ZMF A;  2HJE A;  1GHI A;  1J9M A;  4JXS A;  3SZT A;  1ZTU A;  3HLC A;  3VP1 A;  1PZP A;  3HUM A;  2QWS A;  2YKF A;  1IOU A;  2ZQ9 A;  4HBT A;  4KG6 A;  3PAE A;  2IA2 A;  2PD8 A;  4U0X A;  2PYP A;  2XD5 A;  3QHY A;  2Y2G A;  3MR0 A;  5DTK A;  1YSP A;  4BQM A;  4FSF A;  3E2K A;  5M1A A;  4OP8 A;  4MMN A;  3NIA A;  1G6A A;  3RFB A;  3HLD A;  3MXR A;  1XX2 A;  2JKR M;  4WLA A;  1N9N A;  1EI5 A;  4KZ6 A;  4Y5F A;  5EFW A;  3IS2 A;  3G32 A;  4DE1 A;  2H0Y A;  1BLC A;  4KZ5 A;  4R6L A;  2Q9N A;  3A0V A;  2JHE A;  1TDL A;  4L9G A;  1AXB A;  3KYQ A;  3N8R A;  3CPT A;  3ZNY A;  3MS6 A;  1MKM A;  1C3B A;  3T4O A;  1OJG A;  1PI5 A;  4Y0T A;  4E3J A;  4OQ0 A;  4Q0I A;  2JN7 A;  1IYP A;  2W3E A;  2O0Y A;  3E2L A;  2QPN A;  3SS5 A;  1NYY A;  4RX3 A;  2EX9 A;  2HV1 A;  1ZG6 A;  3VP3 A;  4OLD A;  3NC8 A;  1W79 A;  1P97 A;  1I2S A;  4MN5 A;  3A3D A;  3QNB A;  5D3O A;  5DFX A;  4C3Q A;  5DKL A;  5CEB A;  1NY0 A;  5CHM A;  1MZU A;  2UWX A;  3Q07 A;  4CLC B;  1LI0 A;  1XKZ A;  4LLO B;  5IT5 A;  2D01 A;  1BTL A;  5FA7 A;  1TS8 A;  2G7U A;  3OBF A;  4KQD A;  5AVF A;  3A3F A;  2PR6 A;  3FKV A;  1IFQ A;  2VGL S;  2V8C A;  3IX8 A;  3KO6 A;  1QMF A;  1BZA A;  1VET A;  1LSV A;  2H10 A;  4NXG A;  2AVX A;  3LIB A;  1M6K A;  2VV6 A;  3LID A;  2OSU A;  4Y7P A;  4IHQ A;  1ERO A;  4DJ3 A;  1E3U A;  1E25 A;  2ZL1 B;  3P09 A;  2Z2L B;  3GRJ A;  4HES A;  4LFU A;  4DE0 A;  5J7E A;  1YSQ A;  3IT9 A;  1G6O A;  2QKP A;  4LGW A;  3VP2 A;  1ONG A;  3NDG A;  3C7U A;  3AGD A;  5AQA A;  5HDS A;  1YMS A;  4KEN B;  1YLT A;  4X1L A;  3DTM A;  4E3M A;  5CTN A;  2O9C A;  4YIN A;  5AVE A;  4AFI A;  3S7N A;  3AGE A;  4EXO A;  4GJ4 A;  5FQ9 A;  1H8Y A;  3LEZ A;  4R0Q A;  1A0K A;  2P08 A;  1G68 A;  3HUN A;  1VQQ A;  4UHU A;  1BSG A;  5IS1 A;  4K0X A;  1DP6 A;  1D7E A;  4QB8 A;  1XFN A;  4DXB A;  3S7P A;  4BJP A;  4E3K A;  4D60 A;  3LCE A;  4MBK A;  1GSX A;  3KSI A;  3FV7 A;  5EM0 A;  3F1P A;  2ZBB A;  5EUA A;  1IKI A;  2V0W A;  1W7F A;  5FQJ A;  3FG8 A;  1JWP A;  3ZG5 A;  3ZQ5 A;  4PHT A;  3T1X A;  3HLB A;  4DDS A;  3W8K A;  1MPL A;  3OPP A;  5GL9 A;  3OOV A;  4OLG A;  1PW8 A;  3VOL A;  3T4S A;  5GLA A;  1KVM A;  3IXD A;  2EFU A;  1GSV A;  2GZA A;  4GB7 A;  5FAO A;  3TE8 A;  2LB9 A;  2XEP A;  2O99 A;  3R7W A;  1RCJ A;  5KSC A;  3IHA A;  4I3I A;  4S2K A;  2HDU A;  1STZ A;  2XF3 A;  5L09 A;  1DP8 A;  5TBM A;  1S1Z A;  4HH3 A;  2B5R A;  4JKT A;  3DTI A;  4FTX A;  5HDD A;  4LV2 A;  4K91 A;  3HL9 A;  5DF9 A;  2H28 A;  2PRF A;  2Z2M B;  3VSK A;  3TW8 A;  4PM6 A;  1K38 A;  1N4O A;  4MDZ A;  3UE6 A;  3WS5 A;  1D1J A;  2Z6C A;  3DTK A;  3PBO A;  4MN6 A;  4LCM A;  2W27 A;  4MNR A;  3GV9 A; 
#chains in the Genus database with same CATH homology
 3LY3 A;  1W5D A;  3FWL A;  3G31 A;  3MZD A;  5HW3 A;  4IED A;  4U3T A;  3BFD A;  2Y2M A;  1MWS A;  1PW1 A;  1WYB A;  3V3R A;  3N4I A;  1NZU A;  3UNW A;  5M19 A;  2ZC4 B;  4E3L A;  1K6S A;  4MBF A;  3O88 A;  4KZA A;  4KZ7 A;  2PBY A;  3DWK A;  3IF6 A;  4WYY A;  3MXS A;  1GHP A;  4JXW A;  3HLW A;  3M2K A;  4OQG A;  4P85 A;  4WM9 A;  4Y0U A;  1SDE A;  4DKI A;  4IVK A;  4GDN A;  3W4P A;  4K0W A;  4JXG A;  1JWZ A;  3MZF A;  5GLB A;  3UDI A;  1NRF A;  2X02 A;  5FQQ A;  5CHU A;  4ZJ3 A;  3SH7 A;  4PM9 A;  4QD4 A;  1KDW A;  4JLF A;  4NK3 A;  1PWD A;  2PU4 A;  4S2P A;  1MWT A;  5HFO A;  1BLH A;  1DJA A;  4BL3 A;  5AQ9 A;  1PWC A;  3I7J A;  4KZ4 A;  2Y2O A;  3IWO A;  5CXW A;  1Y54 A;  2BLS A;  2Y2L A;  3ZVT A;  1I2W A;  3RXW A;  2WAD A;  3V5M A;  1MXO A;  2RL3 A;  3OC2 A;  3SS3 A;  3OPH A;  3WS2 A;  1YM1 A;  3UDF A;  3DWZ A;  1Q2Q A;  3N7W A;  3GMW A;  3HUO A;  3BRM A;  4OH0 A;  2Y4A A;  4KZB A;  4MLL A;  3PTE A;  1LLB A;  5E2H A;  4F94 A;  2H0T A;  4EBP A;  3RJU A;  3ZCZ A;  3QNC A;  2OV5 A;  2VGJ A;  3MFD A;  3ITB A;  4BLM A;  1K56 A;  2Q9M A;  1O07 A;  1MWR A;  4EV4 A;  3BEC A;  1YLP A;  4FCF A;  2Y2Q A;  4M3K A;  4PM5 A;  1W8Q A;  1WE4 A;  2A49 A;  2C6W B;  4WEL A;  4JF6 A;  1L0E A;  2WKI A;  1FSW A;  1LHY A;  4R1G A;  5GHY A;  3UY6 A;  4EQI A;  3OCL A;  3G30 A;  4X55 A;  3IHB A;  2FFF B;  3G2Y A;  2EX6 A;  4R23 A;  4OPY A;  4BD0 A;  4OON A;  4CJN A;  5JYP A;  3D4F A;  5M18 A;  3CMZ A;  1Q2P A;  1IEM A;  1S0W A;  2G2W A;  2XFT A;  4S2I A;  5I94 A;  1QME A;  5DTT A;  5HAQ A;  4WEJ A;  1IKG A;  3O86 A;  5HAR A;  2Y2I A;  1ALQ A;  1ERQ A;  5A90 A;  5EVI B;  1TVF A;  5EVL A;  4N1X A;  5F1G A;  4DF6 A;  5CGS A;  4JBF A;  3LO7 A;  3HBR A;  4OVD A;  4S2J A;  1FR1 A;  4YFM A;  1MBL A;  4ZBE A;  3BLM A;  3PBT A;  3V50 A;  1YT4 A;  4LV3 A;  1XGI A;  4LV1 A;  2ZC3 B;  4GN2 A;  3ZDJ A;  2ZMA A;  2WGI A;  4S2M A;  1TEM A;  1BUL A;  2ZM8 A;  1ZC2 A;  1U60 A;  5FI2 A;  2DCF A;  2J9O A;  2BG1 A;  5CRF A;  3W4O A;  3VP0 A;  3N8S A;  5FI7 A;  1CEG A;  3SS4 A;  4R4R A;  3WS4 A;  3MKE A;  2ZJ9 A;  2V2F F;  5A93 A;  3GQZ A;  2XLN A;  2XH9 A;  2FFY A;  4U0T A;  1ESI A;  5FDH A;  3GSG A;  3G34 A;  4PM8 A;  3VOY A;  5J8X A;  4C75 A;  1FCM A;  1WYC A;  2XGN A;  1MY8 A;  4GD6 A;  2ZC5 B;  3AGF A;  3WRT A;  1LL5 A;  2JC7 A;  5AQ7 A;  3HRE A;  3IXB A;  4EBN A;  4Z9Q A;  1PIO A;  4GZB A;  3ZHH A;  5CHJ A;  1YLW A;  3ZVW A;  1JVJ A;  1ES4 A;  3HLG A;  4H8R A;  4ZJ2 A;  3IH8 A;  5A91 A;  1TDG A;  1YLZ A;  3MZE A;  2ZQ8 A;  1XP4 A;  1JTG A;  1L0D A;  5CER A;  3ZFZ A;  4Q8I A;  3BFE A;  2WK0 A;  3G4P A;  1GHI A;  5DTS A;  1PI4 A;  1J9M A;  4JXS A;  2EXA A;  3VP4 A;  3HLC A;  3Q1F A;  1H8Z A;  3VP1 A;  3IF6 B;  1PZP A;  1XXM A;  1PWG A;  1IYS A;  3FYZ A;  3HUM A;  4OPR A;  4QHC A;  4FH2 A;  4OOM A;  1O7E A;  1K55 C;  4JPM A;  3NDE A;  4JF5 A;  5IHV A;  2ZQC A;  4X69 A;  1S6R A;  2ZQ9 A;  5F1F A;  1FSY A;  4HBT A;  1K4E A;  4KG6 A;  3PAE A;  5HAI A;  2I72 A;  4DE3 A;  5FSR A;  3OPL A;  1SHV A;  2HPB A;  4ID4 A;  5CED A;  1ES3 A;  3WRZ A;  3EQU A;  4HEF A;  2RCX A;  5KZH A;  4U0X A;  2XD5 A;  3Q7V A;  1K55 A;  4GDB A;  3QHY A;  4N92 A;  2HP6 A;  2Y2G A;  2WKH A;  2Y2H A;  1K6R A;  5DTK A;  2WZZ A;  5E2G A;  4UA7 A;  5BOH A;  4BQM A;  3V3S A;  1YLJ A;  4FSF A;  3E2K A;  4FD8 A;  3A3J A;  4OP8 A;  5M1A A;  3NIA A;  1G6A A;  1FOF A;  1DY6 A;  3HLD A;  5E2F A;  5GHX A;  3PBQ A;  3MXR A;  1XX2 A;  4WMC D;  1EI5 A;  2EX2 A;  2V20 A;  4OOL A;  4KZ6 A;  4N9K A;  4RX2 A;  3ZG8 B;  4P6B A;  2HDS A;  2Y91 A;  5DF8 A;  3G32 A;  4DE1 A;  4B4Z A;  2H0Y A;  4DE2 A;  1BLC A;  2R9W A;  4KZ5 A;  4DXC A;  2Q9N A;  5GLC A;  2DRW A;  1XA1 A;  3UDX A;  3IWI A;  1N9B A;  3S1Y A;  4KQQ A;  2Y2N A;  1SDN A;  2ZC7 A;  4S2N C;  3V39 A;  2ZQA A;  3ZG7 B;  4DDY A;  3B3X A;  1TDL A;  4P0M A;  3DW0 A;  1KE3 A;  5DVA A;  4GNU A;  5EVI D;  4PMA A;  2QMI A;  1AXB A;  3C5A A;  3OZH A;  2WAF A;  1K25 A;  4P87 A;  4OQH A;  4HBU A;  3N8R A;  5EE8 A;  3ISG A;  4R3B A;  3S22 A;  1L2S A;  4KZ3 A;  5E43 A;  5F82 A;  3ZNY A;  2ZQD A;  4NET A;  5G18 A;  1KDS A;  4R3J A;  3FZC A;  1K4F A;  4E3N A;  1CI8 A;  5FAS A;  4S2N A;  5TFQ A;  1C3B A;  4EWF A;  1ES2 A;  3WS0 A;  1PI5 A;  4Y0T A;  3VFH A;  5FAP A;  2X71 A;  4E3J A;  1YLY A;  2A3U A;  4OQ0 A;  2GDN A;  5GHZ A;  5JYO A;  5FQM A;  1IYP A;  1NXY A;  1IEL A;  2ZD8 A;  3E2L A;  4JXV A;  5AQB A;  5FI6 A;  3G2Z A;  3PAG A;  2QPN A;  3VOZ A;  2Y2J A;  3SS5 A;  1NYY A;  4RX3 A;  4R4S A;  2EX9 A;  3BFG A;  4QY6 A;  1ZG6 A;  3Q82 A;  4OLD A;  3VP3 A;  3NC8 A;  1W79 A;  4IVI A;  1RP5 A;  1I2S A;  3UE1 A;  1XGJ A;  3A3D A;  2EX8 A;  3QNB A;  1YQS A;  5HL1 A;  4WZ4 A;  5D3O A;  3NCK A;  4C3Q A;  2P9V A;  5CEB A;  5KSH A;  3IH9 A;  1HVB A;  1NY0 A;  5CHM A;  2UWX A;  3Q07 A;  1CI9 A;  1LI0 A;  1XKZ A;  4GD8 A;  5F83 A;  3VMA A;  2XR0 A;  2OLV A;  2WYX A;  4GOG A;  3M6H A;  3ITA A;  2HP5 A;  2WGW A;  3ZG0 A;  4BEN A;  1BTL A;  4OQI A;  4XXR A;  2CC1 A;  4EUZ A;  5FA7 A;  3MKF A;  2ZQ7 A;  3S4X A;  2WZX A;  1FCO A;  1JWV A;  4OP5 A;  3PBS A;  3WWX A;  3ZNT A;  2R9X A;  3IWQ A;  1RGZ A;  3A3F A;  4UA9 A;  4Y0O A;  1VM1 A;  3FKV A;  1HTZ A;  1M40 A;  3UO9 A;  2C5W B;  1QMF A;  1BZA A;  1HZO A;  1GA0 A;  4XUX A;  1BUE A;  5CGW A;  2H10 A;  5EEC A;  3C7V A;  4EBL A;  2ZM0 A;  3BLS A;  3VSL A;  1M6K A;  2WUQ A;  3GR2 A;  2OSU A;  4Y7P A;  1ERO A;  1PZO A;  1E3U A;  1CK3 A;  1KGF A;  4BL2 A;  1E25 A;  1XA7 A;  3O87 A;  3P09 A;  4KQO A;  2Z2L B;  3UPO A;  3GRJ A;  4HES A;  4E6X A;  2WAE A;  4DE0 A;  3HLE A;  1E4D A;  2HDQ A;  3IT9 A;  3CJM A;  3GTC A;  3Q7V B;  1GHM A;  2H5S A;  4A5R A;  1LI9 A;  3NI9 A;  3VP2 A;  1K56 D;  3BFC A;  1ONG A;  3G35 A;  3NDG A;  3GVB A;  2IWC A;  3C7U A;  3AGD A;  4WZ5 C;  5AQA A;  4OOY A;  5L2F A;  2XFS A;  5CEC A;  1NJ4 A;  2VGK A;  2JBF A;  3PBN A;  1YMS A;  4KEN B;  1YLT A;  3UE0 A;  3DTM A;  2HP9 A;  3NBL A;  1I5Q A;  1ONH A;  4E3M A;  5CTN A;  4OPZ A;  5U47 A;  1IYO A;  4YIN A;  4RYE A;  2EFX A;  2WGV A;  2OLU A;  2Y55 A;  4WZ5 A;  2V1Z A;  3AGE A;  5FAT A;  3UPN A;  1KGE A;  2IWB A;  1K57 C;  5FQ9 A;  1EWZ A;  1NYM A;  3LY4 A;  3TOI A;  1H8Y A;  1H5X A;  1HD8 A;  1XPB A;  4E3O A;  3BM6 A;  4ZJ1 A;  4E3I A;  1KE4 A;  3LEZ A;  1RGY A;  4N9L A;  2ZLY A;  4R0Q A;  4B88 A;  5KMW A;  1FR6 A;  1SCW A;  4N1H A;  3SH8 A;  1G68 A;  4CPK A;  3HUN A;  1VQQ A;  4QJG A;  2P74 A;  3CG5 A;  4UHU A;  2PU2 A;  1BSG A;  1KE0 A;  1FQG A;  4K0X A;  3O3V A;  3MBZ A;  4QB8 A;  4L0L A;  3A3E A;  3CZD A;  1Z6F A;  4QU3 A;  4X6T A;  1K57 A;  4LCL A;  4X68 A;  2JE5 A;  4BJP A;  4DXB A;  5DF7 A;  4E3K A;  2XK1 A;  5TR7 A;  4FH4 A;  3LCE A;  4RA7 A;  4MBK A;  1IYQ A;  3ZGA B;  3FV7 A;  1BLP A;  2J9P A;  4WBG A;  4PPR A;  3UPP A;  1ES5 A;  1DJB A;  5EUA A;  1IKI A;  3VFF A;  5FQI A;  1L0G A;  3TG9 A;  5EOE A;  1K54 C;  2E8I A;  4XUZ A;  1W7F A;  5FQJ A;  3C4P A;  2WKE A;  3JYI A;  2XDM A;  1NZO A;  1JWP A;  3UN7 A;  3ZG5 A;  3BEB A;  4MBH A;  5HAP A;  1OME A;  3P98 A;  3HLB A;  4DDS A;  5CTM A;  1KVL A;  5EOO A;  3W8K A;  4KG5 A;  1DJC A;  1FCN A;  1L0F A;  1MPL A;  1SKF A;  3OPP A;  4JF4 A;  4RVA A;  4OKP A;  5FAQ A;  5GL9 A;  1ZG4 A;  2XQZ A;  3TSG A;  2P9V B;  1PW8 A;  4OLG A;  2Y2P A;  1KGG A;  4LEN A;  4IBR A;  1KVM A;  5GLA A;  3IXD A;  2EXB A;  1K54 A;  1ESU A;  2EFU A;  4KZ8 A;  4GB7 A;  5FAO A;  4QY5 A;  3SOI A;  2JCH A;  5GLD A;  1BLS A;  1BT5 A;  2XEP A;  4KG2 A;  3ZG9 B;  4WMC A;  1RCJ A;  2WGW B;  5EVI C;  5KSC A;  5CGX A;  1ERM A;  3IHA A;  4S2K A;  4ZDX A;  1E3U D;  2HDU A;  3IXH A;  4X53 A;  3NY4 A;  1YMX A;  2Y59 A;  4PM7 A;  3Q7Z A;  2XF3 A;  2QZ6 A;  4KZ9 A;  2J8Y A;  3Q81 A;  4WEK A;  3IF5 A;  4UAA A;  4ZAM A;  4LV0 A;  1CEF A;  3BFF A;  5EVI A;  3IQA A;  3OCN A;  1W8Y A;  5TGF A;  2ZC6 B;  5HX9 A;  2B5R A;  4JKT A;  4UA6 A;  3FKW A;  3C4O A;  3A3I A;  2DNS A;  1GCE A;  3UE3 A;  2HDR A;  4LV2 A;  1MWU A;  4K91 A;  3HL9 A;  5DF9 A;  4E6W A;  4ZTK A;  1LL9 A;  3M6B A;  2Z2M B;  2ZM2 A;  3WS1 A;  3PBR A;  3VSK A;  3HVF A;  2XD1 A;  5E2E A;  2IWD A;  2X01 A;  2Y2K A;  3N6I A;  4PM6 A;  2J7V A;  4D2O A;  1K38 A;  1N4O A;  3W4Q A;  4MEZ A;  3BYD A;  3WS5 A;  4BD1 A;  5EPH A;  3SH9 A;  4X56 A;  5FQK A;  1PYY A;  1ZKJ A;  3EQV A;  3M2J A;  1JTD A;  3HLF A;  3PBO A;  3RXX A;  5A92 A;  2G2U A;  4O7D A;  4B4X A;  4S2O A;  3N8L A;  4IBX A;  4LCM A;  4MNR A;  1GA9 A;  4C6Y A;  3IF6 C;  4KQR A;  4S2L A;  1MKI A;  4DRT A;  4GKU A;  3GV9 A;  3IXG A;  3OPR A;  4OPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...