2IWEA

Structure of a cavity mutant (h117g) of pseudomonas aeruginosa azurin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGGSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Click-Chemistry with an Active Site Variant of Azurin
doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 29
structure length 128
sequence length 128
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2006-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2iweA00
2UXTA 1A4BA 1E65A 4YSTA 2DWSA 3KW7A 5FC9A 4BWTA 4HZ1A 1CUOA 3X2QB 2YAPA 2WO2B 3IN0A 2BW5A 2N0MA 1AG0A 4KOBA 2GIMA 1MG3C 2J5WA 1JVOA 4KNUA 1ADWA 2BP8A 1NIFA 4HCFA 3QJRB 1TU2A 4DPCX 3HB3B 2CJ3A 3N55A 1L9OA 4A66A 4A2FA 1HFUA 1F56A 1ZDSA 2FTAA 1GR7A 3AZUA 2HRHA 3QJUB 1PLBA 4CSZA 2AZAA 1L9QA 2GI0A 2OV0A 6PCYA 1MZZA 1WS7A 4E9TA 3S8GB 1KBWA 1ASPA 5B1JC 5B7MA 3NSCA 1AAJA 3FQ1A 2BWDA 1JZJA 2X87A 2VSMB 3GDCA 2BZCA 5D4IA 4NB7A 1OV8A 2CBPA 4WTQA 2DWTA 3NJGA 4A2DA 3FU7B 3HEIB 4JHUA 1BYOA 1OOWA 3OMAB 4AKPA 2RACA 4KO5A 3CZUB 4GP8B 1ZV2A 1NPNA 3EH3B 2I7SA 1KDJA 4E9QA 1OE3A 3OMIB 2QPDB 4NERA 3IEAA 1A3ZA 2J55A 2YAHA 3JT2A 3ZBMA 1PZAA 3CDZB 1KCWA 2CUAA 3AY2A 4DPAX 1CC3A 2IDQA 2XX1A 1M57B 2YARA 2I85A 2XV2A 4E9RA 1PLAA 3FPYA 3T6ZA 3SBRA 1WA1X 3IE9A 8PAZA 2XU9A 1WA2X 3AG2B 2E86A 1L9SA 1HAUA 1MG2C 2DYSB 2XWZA 4UANA 1TEGA 3ASOB 4YSOA 1N68A 2VM3A 4G71B 2GB2A 5I26A 3SQRA 1GS7A 2IWEA 4A2EA 1J9RA 1SDDA 2FQDA 6PAZA 2XVBA 2P80D 2YAFA 5IY5B 4GYBA 1GS6X 1JZIA 4FAAB 2DY2A 3H4HA 3H56A 4JKNA 2CCWA 2YQBA 1PAZA 2BP0B 1ASOA 3FT0A 9PCYA 3UADA 4AZUA 3PXLA 3NJHA 3UGEA 1AIZA 3X1FA 1E30A 5I28A 1EHKB 3OQRA 3UABA 1M9WA 2XXFA 2WO3B 3AG1B 2XXGA 5PCYA 4DP0X 1ZIBA 5PAZA 1A4CA 3NJLA 1XB3A 2CAKA 2EIJB 4BXVA 1NWOA 4PAZA 4RH4A 2HX9A 3FU8A 1PZBA 4E9VA 3FSVA 1J9TA 1I53A 4BK5C 3G5WA 1VLXA 1J5CA 2YXVA 3TBCA 1MDAA 1URIA 1ETJA 2IWKA 5TK4A 2IH8A 3TU6A 4AI7A 1OE1A 4KNTA 1AACA 4E9SA 3DTUB 4BDVB 1ET8A 1MZYA 1W6WA 4KOCA 4YVUA 5LDUA 5EHFA 1AANA 1J9SA 5B7EA 3PAUA 2GSMB 4GP5B 3C75A 4DP8X 1BXAA 2DYRB 1NIDA 4YL4A 2TSAA 1KDIA 3NSDA 2FQGA 2VW4A 3EHBB 7PAZA 2IDUA 3CVCA 3H4FA 1IBZA 2OJ1A 3ASNB 4Q89A 1ZIAA 3AW5A 2H5UA 1B3IA 2ZXWB 2IWFA 3MX0B 2PCFA 1W6LA 5F7AA 4L0PB 4W1TA 1PF3A 3WNIA 3FS9A 2EINB 2VSKB 4Q8BA 2PCYA 1JXFA 2PPDA 3FQYA 3NP4A 1OF0A 1WAEA 3CVBA 2PP8A 2BW4A 1IUZA 3FYIB 1PNDA 3L45A 4NAJA 5B7FA 1L9TA 4BWWA 5I6OA 1GSKA 4YSRA 4YSUA 3UACA 4ENZA 4QLWA 5A7EA 1JZHA 2ZOOA 4GXFA 3FU7A 5B3SB 4HAKA 4HCGA 3ZDWA 2JKWA 1BXUA 1AS8A 1JOIA 4A2HA 2UX7A 2I7OA 1GS8A 4YSQA 1E5ZA 2UXFA 3OD3A 4GP4B 3S3CB 5I6NA 2A3TA 4UF7C 3WKQA 3SBPA 3FYEB 4A68A 2MTAA 1R1CA 2PPCA 3T6XA 3FSWA 2R7EB 1HAWA 3T71A 3OMNB 4KO9A 3ABGA 3NYKA 3FSAA 1CYXA 1KCBA 3CDZA 1XB6A 1PZCA 4BXSV 2OCCB 1AQ8A 4F2EA 2B3IA 2UXGA 2GBAA 2WSDA 2EIKB 5AZUA 1AG6A 4DP5X 4YSSA 2R7EA 1V55B 4MFHA 4TXVB 5E9NA 4YSDA 5AKRA 1L9RA 1CYWA 1YLBB 1UATA 1L9PA 3RYMA 1SF5A 3WIAA 4UAHA 1AS6A 3D12B 3EH5B 4X4KA 4DP9X 3GXUB 4AKQA 4DP2X 1A4AA 1SF3A 4HHGA 2YAMA 5D4JA 2PLTA 1JXDA 1ET7A 3FPXA 3NJFA 2VW7A 2BWIA 1J9QA 2ZONA 1DZ0A 4N8UA 3WKPA 3UAAA 3ZX1A 3T9WA 1AR1B 3IN2A 1J5DA 4BWUA 4DP6X 4G7QB 2VMJA 4EF3A 1ID2A 1NDTA 2BP0A 2FQEA 4N4YB 1JZGA 2AFNA 2GC4C 2ZWNA 2IAAC 1N70A 3EF4A 3ABLB 3NJIA 1X9RA 5B1JA 2UXVA 2J56A 4CSPA 4KO6A 3EH4B 1W8EA 1PCSA 2AVFA 2Q5BA 4HIPA 3QPKA 1M56B 1NPJA 1OCCB 2HRGA 3NJNA 4M4RB 1WA0X 2BHFA 1AZBA 1GYCA 3FU9A 2P80A 3CVDA 1AZUA 1NTDA 1V10A 3X1BA 2BO0A 2HLEB 2HZHA 1E5YA 1SJMA 1EZLA 4DPBX 5I6LA 2XYBA 3QJVB 1IKOP 3S3BB 4GY4A 3S3DB 1V54B 4P5RA 1WS8A 4BDVA 1AZNA 3QJTB 4G70B 4G72B 2AANA 2BP8B 2Y69B 4E9YA 1QHQA 2H3XC 2IDSA 1GY1A 3T6VA 2FT8A 1JZEA 1SHWA 4K9JA 2Y1AA 3AG4B 1NICA 3NJKA 1DYZA 4HHWA 1NIEA 4YSAA 1ASQA 2HX7A 1ET5A 1AZCA 1ILUA 2PPAA 3JTBA 5TK2A 2LLNA 3WNJA 4A67A 1OCZB 3NSFA 3FQ2A 3S8FB 2QT6A 3FSZA 3SBQA 3DIVA 1AS7A 1XB8A 2BZ7A 2PP7A 3NP3A 4P5SA 2FWLB 2IH9A 2XV3A 1BXVA 2IDFA 1JZFA 4E9WA 3GYRA 2QPEB 4DP1X 2VN3A 1X9UA 4KO7A 2W88A 4AX3A 2VW6A 2W8CA 1BAWA 1A65A 2GC7C 3PCYA 2JFCA 1NIBA 4WKXA 4ZK8A 4YVNA 5B1BB 3PLYA 1KV7A 2DV6A 3KW8A 2FJSA 2UX6A 2XV0A 4DP4X 3QJQB 2EIMB 2VM4A 4G7SB 1JXGA 2YAQA 1FA4A 1QNIA 3NSYA 1PMYA 1BQRA 1SFDA 1FFTB 2GHZA 1TKWA 3U25A 3DKHA 1XMEB 2H47C 2JXMA 2YAOA 3MBWB 5B1AB 3TASA 1GW0A 1KGYE 1PY0A 4A2GA 4M3HA 2XX0A 2PP9A 3TBBA 1KBVA 1OE2A 1QLEB 3WI9A 4F2FA 2FT7A 1TEFA 2PPEA 1SNRA 4KNSA 3IBOA 4HALA 1AOZA 2AZUA 1BYPA 4YSPA 4QKTA 3V9EA 7PCYA 2XUWA 2HX8A 1ILSA 1PLCA 2QDVA 2YAEA 3ABMB 5I5JA 3NJMA 4HCIA 3N2JA 1SDDB 2HXAA 3WG7B 1AZRA 2PPFA 2QDWA 2X88A 4YSCA 1BEXA 4JHVA 1BQ5A 2EILB 1RZPA 1JVLA 4FA7B 1OCRB 2XLLA 1JERA 1IC0A 4F7KA 1T5KA 3T6WA 4YSEA 1E67A 1KYAA 1SHXA 3BVDB 2FNWA 3TA4D 3V9CA 5I6MA 2MRYA 3ABKB 3X1GA 4DP7X 5I6KA 4W9ZA 1A8ZA 2IDTA 3NJJA 1ZDQA 4E9XA 3X1NA 3PAZA 3PAVA 3NT0A 2YXWA 5I5MA 1NZRA 2CALA 1GY2A 2NRDA 1PNCA 5I6PA 1NINA 4G7RB 3ZIYA 1RZQA 2TSBA 3PPSA 1SFHA 3ERXA 3AG3B 1ZPUA 5I5IA 3QQXA 1OCOB 3OM3B 5D4HA 1NWPA 3X1EA 5AFAA 1RCYA 1NIAA 2FT6A 1BQKA 3CG8A 1IBYA 5F7BA 2FQFA 5ANHA 4PCYA 3UAEA 1CURA 1RKRA 4AKOA 3QJSB 2J57A 2Q9OA 2B08A 3BQVA 5B1KA 1FWXA
chains in the Genus database with same CATH superfamily
4Q58C 1OTTD 2EDDA 3HG3A 4MS8C 4F91B 3KW7A 5IEHA 3RVWC 5GXBB 2ICWI 3WFDL 4ZS6C 1SBSL 3AREC 1S9YB 2R2HB 3BZEB 5C08E 3SGJA 4LSTH 4FC3E 1ROWA 3LRGA 3WO4C 4WJ5A 2R29A 3HI1A 4DZ8B 5C70A 1A6AA 1JF5A 4IRJB 1WBXB 2WXJA 3ILEA 3TBWA 4JPWL 3KBEA 4HPOL 1GGUA 2X2JA 3RWGB 3VD4A 3MNZA 3OMZA 4XO8A 2RA1A 3MLPA 3G5VA 5IKCB 1VGEH 4BFJA 1K72A 2VDRL 5D2NC 4FFYH 1XIWB 5F89A 1NDMA 1PZ5B 3QBTB 2FYYA 3RVVD 5IQOA 3PQYD 4OGAD 4IYKA 3ZTDC 5C6TH 4NKDA 5EOTB 1FHNA 1UJTA 3K4ZA 2TRHA 3NTCH 4JHUA 1M7IA 3D39D 3O6FD 2R69L 5EZOL 2P8MB 3OMAB 4TRPL 4YBHA 3H8NA 3MRBB 3AS1A 4HT1L 4NC1C 1BZ8A 4MMXA 3S2AA 4GFXA 4F15B 1NEUA 3FTGB 3VFWB 5E4AA 3QQ4A 3IFPA 4E9QA 1VF5C 5HGBB 4C56B 5E9AA 1BFTA 1RSYA 2ENJA 3BOVA 5K59E 1Q1PA 3VD1A 4PS8A 2BOBB 4PR5B 4PRDB 3DVIA 1KCWA 1W16A 1DLFL 2XIIA 4RZCB 5E9DB 2YFOA 4RA0C 5F6HI 4GSUA 4E68A 2B1OA 3W2DH 1ZTXH 3FPYA 5CU9A 2P5ED 3CFUA 4M6OH 3GJFB 4HIJA 2OMVA 3MCYA 1ULVA 1XAKA 4XNYH 3QI9A 4ZQTA 3Q9QA 1A6VL 2AQTA 4ZT1A 4AM0A 4ZO8A 1XR9A 2WVVA 3L3OB 3LV3A 1OTTC 1UZ8B 4UANA 3ZE0F 2VXTL 4GO6B 5FK9B 4HWZA 5FYKL 3IF1B 2JK5B 3OKEA 1HCZA 1YQ2A 2WLIA 1XZ0B 3EUUA 4KMTL 4XAWH 5K39A 3SDDB 5C0RH 1P4LA 5E1IA 2OX5B 3SKMA 3ZTJG 2FQDA 5MEPA 1MFCH 4HS8H 1DJWA 2YOAA 2BMKB 2DQHL 3DJSA 2J44A 2Z0BA 2PABA 5EIIB 3BH8B 4FQ1L 3QZMA 2AJUH 2X4RA 4GAYB 5EN2A 4QRSA 1T2XA 4X83A 3RB7A 5KSVA 3ARFC 3K6SB 3QZWG 4OCYH 3NJHA 3SYCA 5MHSD 4JCLA 1EDQA 3GIZL 5HHOA 1JPST 4JCMA 5CEZE 1DHKA 2WLKA 3QZWA 4XZUA 3ISRA 3P73B 4E5XB 3UH8A 3MUUA 5K69A 2XA8L 2GCYA 2V6HA 1E6OL 4YLBA 2LAGB 1Q94A 4C4BA 5D7KD 5DEJA 4ZRGA 3TA3C 3NFNB 1JGLL 4G80A 1T1ZA 3CIQA 5FS5A 4B95C 3AC0A 4JFEA 1QA9B 4R4FL 2Q86B 3K4DA 2YK1L 1GTFA 1PYWA 5C8JB 3O4LD 3BAIA 3ARXA 4UIMA 3S88L 1RIUL 4ZFOA 4JMXA 3QWRA 4M7ZC 3I02A 3Q2VA 3QR0A 4LKCB 1LMKA 4ODVL 2FEEI 4RSVA 5F8RC 3TWCH 1TVHA 3IDXH 1E9PA 5KS9B 2N7BA 3OJVC 2NDFA 1BXAA 2QQKH 4MX7B 3VI3F 4UTAH 3GNML 3SO3C 3SDYL 5MERA 1I9RH 2ZJSH 3FMGH 5AVZB 4V2CB 2YBGA 4K8RH 5EOCH 4LCUA 3TCLA 1DVTA 3RWCA 1L7TL 2F19L 1KXQA 3SPCA 4NM8H 1J9CT 1T83A 3MV8B 1OB0A 3CCHB 3M17B 2H5UA 3NIDF 1NC2B 3MLSH 2WBJC 3MJ6A 1G9HA 4GKZB 4Y7OC 1B0IA 3BWSA 5F7AA 1XGTB 5E03A 1A0QH 2NUTA 3HG2A 3RWDB 5CLYA 4XMTA 2YD4A 4QRPA 4LEBA 3FCGA 4WI2A 1OSPH 2F58H 1UOVA 4V1DA 1RJYA 3CVBA 3MGTA 2YGPA 3QDMA 2DQDL 1U3YA 2BW4A 4NENA 2IH1B 4XXCA 1DR9A 2GW5A 1L5GB 5KAQF 5L88L 4M1CD 5DQ9A 4Q9QL 4K3JH 4UI2A 1U8QA 4UQDA 4ONFH 5DO8A 3GT6A 2WC7A 5IHZB 2JKNA 2K70A 3CLFL 3CU7A 1DVQA 1WAPA 3CFBB 2JKWA 4JFFB 1P5UA 1AS8A 3SKOA 3U7YL 5JIPA 2UX7A 1UZGA 5F7MC 5ADOH 5LGKA 1T6VN 1ZGLP 5DC2A 4LOUD 5BW7A 4XVSH 4PRIE 3D3VB 4UF7C 3U1QA 3UPRB 3W0WA 1TKWB 1KPRA 1VFBB 3RX7A 4M02A 1R3JB 3S8WA 4N0CC 3DX9A 1CDBA 1ZA6B 1WIOA 4QXWA 2J8OA 2A73B 1AD0A 1MW1A 1O9ZA 1T0NA 3FTXA 3IMVA 3QEUA 4NXKA 5GZNC 3C5ZD 5C7ZA 2VLJA 2GI7A 4HKBA 4OZGE 4AH2B 1I7ZB 4BM7A 3B1UA 3UZVB 3X3GL 2BNRD 1HZHH 2Z1KA 1QTSA 3T77B 1RZJC 1OF2B 5DTFA 1YEEL 4FMFA 1YPZE 5EF0A 3EYVA 3GHPA 4F7TA 3PJSB 4TQEH 5A2JH 3DX4A 3QORB 3N3EA 2JI2A 1A7RH 1X44A 3RYMA 2AXHA 2AI0H 2F53E 2XWRA 1VACB 3JTSB 1DE4A 2F54D 4G6AD 4Z7QE 2VDNH 5JIIA 2G5BB 1JF1A 2YA0A 3MRPB 5FIEA 2Q8AH 4WV1C 2E6JA 1J9QA 3QDJD 2EIEA 5DJAA 5HYSA 4KY1L 4KPHH 3BXNB 4EI5C 4BELD 1LO0L 2FX8H 3DJZA 2DI7A 1B4TA 3FHAA 2NY1B 4DKFH 1LM8V 2GSIB 1E0OB 4UZUA 2E9JA 4BHUA 2APXA 2Z65C 2O6CA 2Z92B 1UXSB 1VGKA 4XP6H 3PP4L 3VXNA 2DLHA 1I8KB 1MHEB 2D2OA 5B1JA 5IJCC 3ULUL 4G9FD 2MJWA 1BJ8A 4J4PD 4MA8L 3KLAA 3THML 1MY7A 2CA4A 3I9AA 5IQ7H 1HXMB 3Q48A 3KJ6L 4M1CC 3L9RA 4JO3L 4LPCA 2XN9E 3KPNB 3NJNA 4OCNC 5AZEL 4YQXL 2EUWA 1MIEH 3L5XL 1F5WA 3T65B 5IIEA 5GJSL 1FZMB 1R17A 3X1BA 4ODSH 2KMWA 3LQAH 4NO0D 4ZW6A 1MI5E 3AB0B 3PS6A 3MUGB 4N2AA 1UZ6F 5GRJL 2YPLB 3QPQC 4YLQT 1N4XH 2HUHA 1V54B 2VQUA 4PRHE 1XCXA 4Y8DC 3ILPA 1THCA 4QF1B 3GBLA 3VB9A 2Z8VC 2UVEA 4EPSA 3V5HB 4E9YA 3LKOB 2IIJA 3L4YA 1PCXA 3OZ9H 1OVZA 2FL5B 2OZ4H 1MJUH 1YYCA 3GHBH 1EVTC 4PBWD 1JZEA 3GMMB 2HPOA 5JW3H 1ECYA 1UA3A 5JHDD 3VFVA 4JFYA 1F11B 1T6WA 3SPVB 4C4UA 3QQDA 4L37B 4HV8A 2AKRA 2CKBL 4U6YB 5EBMB 1LO4L 3GTNA 3GSUA 2OMZB 3CD4A 4NC0B 4KRLB 4OTXH 5CM1A 2WM0A 5F3BB 4TVUA 1IEBA 3N91A 4O02B 4V33A 3NP3A 2LVCA 1RIHH 1H6UA 1U3HD 3E6HB 4RBPK 3MV7A 2ZOLB 3T2LA 5G5DB 4ZW8A 1MFBL 5FAAA 1F2QA 3N1QC 3TO4D 4BINA 3U0PA 3WO3B 1V3JA 2MCAA 4AGNA 4YBLB 3QUMH 3BKJL 4W70A 4EIGB 2ROYA 4WFHD 3VGGA 2PXYD 35C8L 4ORGB 1NCCL 3RWJA 1HOCA 1PG7W 3WTVA 3VW3L 2XQYG 5K1NA 3TEUA 4JZOB 3K72B 4PJIF 3E8VA 1UWYA 2NX5D 2R23A 3GRBA 1MCPL 3VXRB 4UT9A 3UTTD 4G7SB 1WD8A 3MCG1 3VX1A 2Y2WA 5I9QC 1ADQL 2H26A 4M3KB 3BDYL 2ZWZA 3SBWA 4AIXA 4CADB 1JPTL 5KSBA 1XMEB 1GHFH 2KZ1B 1PY0A 3MREA 4H0LC 4J1UB 1QLEB 4JG0H 1EGJL 1CXIA 3O3AB 4OLWH 3ZKND 4I9WD 3QIWA 1QPPA 1UM5H 5CS7A 1TMQA 4PJEF 1KFAH 2GAZA 1MH5B 5KYXB 4PV9B 5J56B 5SX5H 3WOVA 1T2QL 4DKDC 2VDQL 4AQZA 1IC7L 2YGQA 4AL8H 1BOGB 3TJHD 4YFDB 1OCRB 3QQ3B 4P3CH 4EN3C 2A5UA 3VFPB 3E1F1 4MNHA 2BSRB 4KVNH 1P69B 2XN1A 3OLGA 1KTLB 3IAPA 3LAFA 4M1DH 2FIKA 4NT6A 3ARQA 3LRMA 1GZPB 2BS71 1T1XB 5SWSB 3QNYA 4KRPD 4E9XA 5F9JB 4ACTA 4QTIL 2CSPA 4I7ZC 3PV6B 2R0KH 1KB5A 2CALA 3HE7B 3RNQA 5BO1L 1IIKA 3VGHA 1FORL 4FJYA 1HQ4B 1RK1A 3VWKA 4DO6A 1PNCA 1BQLH 2I69A 5FCUH 3EYOB 1T89A 2TSBA 3F6LA 3FO0H 3PPSA 3PWVB 5E2WH 1R0AL 1V3LA 2AJXL 3H9HA 4JE0A 3AG3B 4DOHE 5DJDB 4OZFA 3G5YB 2VJ0A 1EZSA 2QPSA 1NWPA 3OHMB 5FYJL 2ADJA 4IRJD 1BZQK 3SGEI 3IDJA 5TJWK 1NFIB 3VFMA 3VYOA 1NIAA 4Z77A 3WFBL 5BPPA 3TYFB 2NW3B 3QQ9D 4G5AA 4Z95L 3HRPA 2VQ4A 1FWXA 5AZ2H 3AMKA 3PHAA 5A2IH 1XIWD 1CU4L 1C7SA 2VOTA 4PW4A 3WS3A 1YN7B 4OI9A 2YAPA 4N9GB 4C55A 5F7DB 5FO9A 4OVUA 5LBSA 2MOQA 1M1XB 3LX9A 1FFRA 1KF9B 1WAAA 2ARJA 4F8TA 4P23B 1H3PH 3ZT5A 5E4IA 4W9GC 5BXFA 2J43A 2HG5B 3BVNA 4XAKD 4AT6B 2DWXA 4QRFA 2YPVA 1UA6H 3KHQA 1VZHA 3GMQA 2IBGA 2QSCH 1I75A 4C56D 1IV8A 4MJIB 3QG7L 3U6XA 2WKOA 3VTAA 4XX1G 2VR7A 5HDBB 4N2OA 4OD1L 1SEQL 4TVPE 3B2PA 4N26A 2NDGA 1C16A 2KQMA 4AVHA 5FCSH 4LLAA 4WJKB 4NRYB 1DQJB 2XACC 3KYMB 4JPSA 1TJHL 3RDJA 3LZQA 3EFFB 1A21A 2AXJA 3VFGL 4Q9RH 2AJYL 5K59F 2XQBL 3KGUA 3BE1L 4B96A 4DUWA 4HUVB 1U8PA 5AAMC 3D33A 4I1NB 1A4KA 4M9PA 3QCTL 1GGCH 3SDCD 3U82B 3QUXB 3S36H 5SWZD 1CS6A 3WEBA 4Q7DA 1E4XI 4KRPC 3BLPX 3QNZA 3QJZA 4G3YH 4HUWB 1RZ7L 2WXOA 3MLYL 4IJ3B 4O51A 4ZMNA 2BVPB 2Z31B 3N9GH 1DUYB 3QRLA 2F1BA 1I1YA 2OTUB 3H2PA 3PHQA 5F9OL 1SDYA 4PH8A 3SDDD 1QZ1A 3ARGC 2R0LL 3P69A 3GXIA 4IOFD 2HKFL 3WS6C 3RIFF 4KQ4H 5HD8D 4PLOB 1WK0A 4H44C 5KBPA 5C6PB 3NSXA 3P4NA 1GYVA 4R83A 3PU7A 3D05A 5IQLA 5DS8B 5IESH 1DDHA 1A7OL 3DA0A 1MREH 3BFQG 4G43A 2CDFB 2V7NB 1FFPA 4MZRA 3K71A 3R1GL 4JQIH 4WCYH 4B7IA 3PREA 2JTYA 3UTQA 3N40F 2YD5A 2K4WA 1FNGA 3ECBA 3L4XA 1NMCC 1QMUA 4FABL 3T0EE 3I9GH 4CN6A 3V0WH 1QR1A 3WNOA 3KEDA 3O9WB 2IGTA 1VERA 2GK0B 3ZL1A 5HJDA 3WMQA 4YDIL 4FAAB 3LRSA 2Y5TB 3BUQA 3LKSA 4JR9H 3ULSB 1TCMA 4H1LH 4OUUB 2UY7A 4I0PA 2IO5A 1BBDH 2XRAH 2V3DA 4L3EE 4I9XA 4CN4A 2JQMA 3T0WA 3LD8C 4HIIA 1FDLL 4I5BB 2YA1A 4JRWA 3RJQB 3TF4A 5I15H 3PWUB 2EDHA 3QR2A 3WDHA 3GUFA 3AU1A 2AVGA 2UZIL 4XR8C 4GMSL 4PJDB 1I9IL 3AG1B 2K7QA 3HBPA 1Z7JA 5J4MA 3KPOB 4NI3A 5PAZA 1NEZA 2GPZA 4HWBL 2Q76B 1SY6L 1DL7H 5EZJB 3QC5X 5HHPB 4Y19A 4EZJA 4H5SA 3ZDXE 1MCCA 1ETJA 3SJVE 1X5YA 2BC4B 1ZT1B 4XPAH 4E9SA 4Z7WB 1Z9PA 4OGXL 1E28B 2JB6A 4W81A 4P2QE 1TYRA 2VM9A 3AXIA 3CLEL 1JMZA 1W6WA 5AOMA 5GGSY 4LL1A 4F9LC 1TTCA 4R26H 3SCMC 1P6AB 2KQNA 1MJ8L 5E0FA 3ZHKA 5A2FA 1EA9C 3T8MA 2TAAA 4LCIH 4ECNA 2ADIA 4J28A 3R0NA 2F15A 2LABA 4YL4A 2FQGA 2VW4A 2IV9A 1AYRA 3EHBB 3NAAL 2IDUA 1ACCA 4BE5A 3APFA 5HVHB 4WWNA 2W9LA 3LEVH 2W0FA 4NN7C 1K5NB 4MVBD 4K55A 1JZ8A 2BM3A 4XCNB 5EH1A 2OM5A 3BQUA 5TGBA 2NCEA 4J6RL 4PJ7A 1P4IH 1A64A 1QWNA 2ADFH 3FU5A 1QFPA 2EINB 3C6LC 4ATTA 2VSKB 2PCYA 1VPOL 5DD1H 4F93B 4MQSB 5BV7B 5E5MB 5IBTH 4A63A 5FYLE 2X9WA 2R15A 5TDNB 5L4MA 3GSVA 3HW7A 5C6WH 2HLFD 2PP8A 2YHGA 1IJ9A 3UJJL 2X4TA 4XMXA 2WAQA 3V0GA 5H37G 2DQEH 5I6OA 4I18A 1GSKA 1IKFH 1R3KB 3ZYZA 3IJHA 3CLWA 4FQHB 2OKMA 4C4KO 5BZWA 4YK4C 4LSPH 4TUUA 3GSQB 5H37A 1TR7A 5LDSA 4PGEB 4HETA 1BF8A 4OZGF 2X4UA 1EEYA 3GSNH 3LXUX 3NFPA 2DIEA 2C26A 5CINL 1XL4A 4GOSA 1AQKL 3PIQB 4PREB 5DFWH 3TBYB 4A68A 4U3XA 1KT2B 1OHQA 1YPZF 3H3PL 5C92A 3SGJC 4OB5L 1HAWA 5HJGA 1E8YA 3U4BL 3KDMA 3U9WA 2V17H 4YIQA 4PM1A 1SLVA 5IB2B 1XGQB 4N8CL 4X7CC 3FT4B 4DZBA 4HKJA 4CKQA 1WZ1L 2X10A 1RUPH 5CCKH 3MJ9A 1YO4A 2D4DA 3M07A 4ZUWA 2PETA 4UNUA 3NCJL 2NY1D 4N3TA 5ALCH 4ORZC 4FFZA 4X6DE 4S2SB 4Z7QF 1SYVA 5GSRB 1HU8A 4X6CE 5HHOD 4I48A 3UG4A 4L2LA 1K9TA 2J8HA 3WO4B 2P1YA 4GRLC 2Y7LA 1WITA 3IGKA 2QKIA 4PG2A 3N41B 4WUUB 1D6EB 3LPFA 3D12B 1FV1B 3S98A 5E2UL 1MRCL 5DC4B 1SF3A 3GJEB 4I13B 4FLOA 3UYPA 3UXFA 1UACH 5KW9L 3A3YB 4FZEH 4MKMA 1DQVA 1G6RH 5D2NB 3WFEL 4F9PA 1CD1A 3RI5F 2WTRB 2AV7A 4FFWD 1VEPA 2YEZB 4FA8A 5BVPH 3L3GB 2H0FA 2FGWH 4OCWH 3MRKA 4NQVB 4AGQA 1IAIM 2EDQA 2JH2A 2OZNA 1YMHA 3SEPA 4WW2A 1IGIH 2PW2B 4S0HA 1ZJAA 3B3IA 5IB4A 3EW3B 2C3VB 5I8EB 1W72H 2DICA 1X7QA 4IHOB 1LWJA 5ESQA 4E41E 1ZE3C 1W8EA 5FB8A 1A1MB 2CGRL 3QPKA 5AVVB 3FQXA 2FJFA 5K9JL 3QI9C 1HCFX 3VQMA 2VZ3A 3JWDC 3MRDA 1JGDA 1YMME 2VTFA 1AZUA 4I8DA 4NWTL 3QIBD 1UYWH 2F2HA 4CU6A 5JHLA 1EZLA 2XY2A 2YRPA 1A2YB 1CFSB 2YD0A 4L4TE 4XCFH 1JZ6A 4L1LA 3PHSA 4EZKA 2CLRB 4DHLA 1KJMB 2NLJA 3P3TA 4WI8A 5I8KL 3TV3H 4CVUA 2YLHA 4HJ0C 5DJ8A 3KWWB 4KKRA 4MMZB 2VJ8A 1GY1A 4JFOB 4PUBL 4XCEB 5E8PB 4ENEC 3K3QA 2CUIA 1C5CL 1L9MA 2BX5A 5EPMB 2R29H 1BFVH 2HLAA 4LNRB 4GKNB 2VITB 1DYZA 1MIMH 4P9HL 3K4AA 3CVHA 3VH8B 1TT6A 1YJDC 3WNPA 2HH0H 4RISH 2PPAA 2CHWA 3QUKB 3VXRD 3W0WD 5LG6A 3SBQA 1N6VA 1DEEB 1F58L 1KXTA 1SN5A 1TQUA 2IH9A 3SY0A 2MCPH 2ADGB 4R6UA 4EDWH 1K8DB 2IDFA 3BAWA 2ZSWA 5F1NB 5I0DA 3VXSB 3BPNC 1RUKL 1U93A 2VLJD 4NNXB 2QPEB 1CB4A 3DNKA 3FUKA 3BAJA 1F3RB 1OT4A 4TUOB 3EYUH 4BSJA 1JK8B 3X13A 1BAWA 3GBEA 2EVHA 2VIRA 1JYWA 1YDPA 3VMNA 5JZ7C 2WWKO 3MXWH 3PCYA 1QSFA 1N0LA 5CF3A 1RFDL 2JFCA 4Q6IA 1UH2A 2DD8H 3QEQA 2X9ZA 3QUYB 2DJMA 4HJ1A 1UH4A 3QCVL 4WW1B 3MNVA 4WKZB 2A6JA 4B3VA 1I31A 2DI9A 3TA3B 1CVSC 4TQ8A 3NOIA 4JFQA 1M42A 4P4RA 3R7QA 3S37H 1FH5H 1H8NA 2W07B 4O2CB 3GMLB 4U1HB 1Q0XH 4AGLA 5JPMB 1JGEA 2JXMA 3G6DL 1G7JB 4G8GA 3G9AB 1KGUA 1KBVA 1ZE3H 3WI9A 3SKJL 3UJTH 3ZDYB 1T83C 3SGKA 4M7ZB 3U1SH 4OFYA 1MAMH 3IJEB 1D5BA 5SWSD 1HHHA 4LDEB 5T3ZL 3WIHA 4QGYA 3JWDH 5J6HA 5ADPL 2YRLA 2XUWA 3GIVB 4H8QA 1KSRA 4KRMB 2YWZA 3L5JA 1JGUH 3SO3B 5I5JA 1PLGL 1OO2A 2EIBA 2XG5A 3P9LA 4OFVA 3QJOA 5K9KA 3Q5YA 4D0DB 1QRNA 1JP5A 1D5XA 1YEWA 2Z6FA 4OCSH 4FA7B 4XXCC 2WQRA 1WGOA 4U3CA 1AP2A 5D7JA 2WBJB 2E56A 1EBPA 2Z64C 3KGTA 4U1IA 2G2RB 3OZKA 3RGVA 4ESKA 4KHXH 2VQ1B 1NGYA 1P5UC 1EEQA 4JZNB 4N0RA 4JJ5A 3ZTJH 3BKCL 3ATDA 3KGSA 1QUNA 4WI7A 2IDTA 4WTZA 1ZDQA 1JHKL 3VXQB 1S5HB 1F0LA 4PJ8B 4NPYB 1ZHKB 1NGWA 1YJDH 4NNYB 3MRRA 5GGTL 3BH9B 1NZRA 2XNAA 4R7VA 3HZVB 2G0LA 2P8PA 1XXFC 2WQWA 4EJ1C 1FGVH 1C8QA 1JGVH 1NCWH 3US1A 2N0KA 2OFQA 4YHLL 1JZ2A 3ERXA 4GRWB 1AGDA 3EYSH 2R9HC 3OG4B 4QYAA 4P2OB 5H35A 1IAII 4RBPH 3TVMA 1KYUA 4WU5B 5B3NA 3X1EA 1Y18B 2VXUH 2WVSA 4RFEA 1CTNA 3NIGE 5ANHA 3BHBA 2A83A 1RVFH 3ATBA 3REVB 2EUXA 4JW3A 4WFFE 4M4RA 4MJID 3SKNB 4WTXA 5F3FA 4BFBD 2X6AA 3KYKH 4LQFL 2NY6D 2VRKA 1PTZA 1B4JL 5KS9E 4TLUA 3MV7D 1AGBB 1U3NA 3HC2A 1JS4A 1O7DE 2Q3AA 1QKZH 3WAJA 4JE4B 4J2XA 3OJDB 4GW1A 4R0LB 1DBKL 1AJ7L 3BPOC 1GMIA 4UAOB 1IFGA 3MJ7B 5JTWA 2X3BA 1U41A 5KANI 2E7MA 3S48A 2ZOTA 4U05A 3JYBA 3MV8E 3WHE1 1AXTH 3HPJB 4WSJA 1GPOH 2XKUA 3ENEA 1H9DA 1NJ9B 1NAKL 3OX8B 3HBGA 2VCOA 1E43A 1UOLA 2NNRA 3IGAA 4MAUH 7TAAA 1ZRUA 2Z31D 4X5PA 4BCYA 2E6QA 5EIVA 4N6QA 4A37A 5DR5H 1BVNP 2NPLX 3KD4A 4ODXA 4G9DB 3T8XB 3HVNA 5B1JC 1JHTB 4FTVA 4AYGA 2O5YL 1LXMA 4WV1B 3VXUA 4Y9CA 4EI5B 3QWOA 3NJGA 1LEKA 3FU7B 4GB9A 3TN0A 4ALAH 1BSIA 3D85B 5JIDA 3EYFB 4YPGB 3F7RA 4ILDA 1OOWA 1U95B 5DMKA 1KCVL 2V37A 1EX0A 1N2RB 1M2VB 4ZUSA 2G2NA 2Y1VA 3UAFA 4UTBH 1Z5LA 3K8KA 4JPVL 2IWGA 4G42A 1YY8A 2AJ3B 5I30L 1J87A 1EMTH 3RPBA 1DANU 2DYPB 3FRPB 4N6RB 1IE5A 1A9BA 1KCSH 1Q9LA 1S7RA 3QP3A 1CLCA 2XWCA 3VRLE 4WDIA 5TE4L 3EFOA 4R96B 4XTRC 3V52L 5E94A 1S46A 2A1WH 1NC4D 3A47A 3B5GA 3O9WD 3DO7B 5LBVA 5LQBH 3RFZC 1YNTB 2VDMH 3AY2A 1VHPA 3JV5A 3APDA 4HUXA 5FPIA 2L0DA 2X7LB 4HLZH 1XH0A 3NCWA 3K2KA 3KEHA 3TIDA 3ALWA 4NAQA 1T22A 4I3SH 1FBIH 3AS0A 4CN1A 3UZQB 2F5AL 2I5YL 5DXWA 1WA2X 4XCCH 5BUGA 5KN5A 3QXDB 1HAUA 3GK8H 5GS0D 1YEDA 5JQ6L 2WNKA 4AIZB 3QZBA 2UZYB 4OSUH 4AOFA 4QHKI 4G71B 4EBQL 1LNUA 5GGVL 4HU8A 4OZIE 3PABB 4F80A 3V55A 2FR4A 4LSSH 3RX8A 4XC1L 2IWEA 1UUSA 2VR5A 3IJ8A 3GRGA 4EQ3A 1FUNA 1SYSA 4ONGH 1QASA 1KUMA 2R39A 3FW6A 4QHUA 4WAFA 3BWAB 1IQDA 2VGLM 1EJOH 1MW2A 1W0WA 2C5DC 1I3RA 2R1XA 2VUYA 3EJTA 3K0YA 1KGXA 3ZDXF 3EO0A 4D8OA 4FJZA 3HUJE 4UQEA 5E2VH 4B9IA 4CMMB 3NRFA 3QQNA 1T0PB 3SBWC 1ZV5A 1IAIL 2ZZUT 4AMKH 4XBMA 4NQCB 4Z76B 4PSPA 2OXHB 2YBRA 4BXVA 4HULB 5MP6L 4G8EA 1R24B 4KMLB 4E9VA 4PJHA 5CAYB 2HB0A 1O6VA 4OGYL 5F6IC 5C3LD 3MRNB 3QIWC 4IRSA 4HC1L 1KIPA 2IWKA 4IBTA 1CLVA 4A7GA 3D0LA 1PG7H 4Y5XA 2VLLA 4X99B 1UUNA 2YPLE 2W80C 4E0RA 2H1LM 2CXKA 4RAUA 3RDTB 1TJIL 2D31B 3L17A 3DC0A 5IFAL 1WEJL 2BRRL 3C2AH 3GSXA 4FQQB 1YNKH 4JFWA 1T5XB 4M1GL 4GP5B 1M6UA 2JELH 4LBEA 1AGCA 3TH3T 1KDIA 3JWNE 3L48A 3VXMD 4M48L 4YMPA 4RGMC 1BQHB 4U3HA 1F4XL 4LP5A 3QDHA 2DEWX 3NCXA 5EZLB 5JW5B 1HH6B 3F85A 2COVD 4XH2A 1WBZB 1ZK9A 1CT8A 5CMAA 1KV3A 4XN2A 5H2BB 2Q8BL 1G4MA 4MB3A 3V5DB 3GI9H 4Y2DA 1ES0B 3ZE2E 1NANH 2EYTA 5DHEA 2B39A 4NUMA 4IIQB 4UDTB 4XBGA 3CSTA 3RTQB 4X5XA 3WNIA 3VWKC 5DLML 1OLZA 2OXGA 4LLUA 3H54A 5J3HC 1T89C 5HYFA 4XI5D 2CLZA 2X70B 4JAMA 4NJAL 4CJ1A 3BP5B 1H8SA 1U8IA 4OT1H 3NH7H 1HILA 1K3ZA 4UILH 1ANUA 1JTTA 2WNGA 5E0QA 4FD0A 4YSUA 1OAZL 1T2JA 3T4YA 1JZHA 2XV6B 3W57A 3S4SB 1WZAA 3FH7A 1RUML 2ZOWA 5FA3B 1J1PH 1PZDA 3OKOB 3HBZA 4U2YA 3CPLA 4A2HA 4S1QL 5AVUB 3TF7C 4G83A 1YZZA 3CH1A 2BVUA 4YSQA 3GS0A 4TTDC 2QV2A 1G94A 5LCVL 1BGXH 3TYGL 1E5UI 4HD9A 1DQML 2PPCA 4UT9H 2OSXA 4X6DF 2CM5A 2GBVA 1R4XA 3OMNB 1V3MA 4LLMA 4X6CF 5D93C 3UTPD 3NYKA 2VAJA 4IDJL 3QZOA 4X8XA 1Z3GH 5KTEH 5IROD 1KCBA 2UY6A 2YSTA 1FPTH 4DW2H 4I0PD 4JM2D 3A67H 3IDYC 4X5LA 5F7KC 1KJVB 1XF4B 4IBWA 1OSZB 5F0MB 4RMQA 3QR1A 4J3OG 1S3RA 3HB3C 1N9PA 3QAZC 4FP8H 3CHOA 1NSNL 2P24A 4XB7A 3GXUB 2VKXA 3C08L 1ITBB 3NK4A 4XHJC 4O9HH 5IBUB 1TEYA 3NPZB 1MLCB 3WAKA 2YAMA 5HVWA 4Y19D 2WZAA 5I19L 3RY6C 3G08B 1IGYA 1SBBA 1N8ZB 2DI8A 4U31A 3FB5B 3FPXA 4K5MA 3NCBB 2WQUA 4MLSA 1TJGL 3VU1A 2OMYB 2C3WA 1DZ0A 4PRPA 4ZXBD 3UAAA 3WKPA 2WCPA 4DN3H 4F8LA 1BBJB 2JKJA 3KPQA 5DUBA 2VAAA 2J73A 2B9BA 3P3YA 3Q2WA 4HCRL 3UTZA 4FRWA 5IMKB 1MCFA 4RFNC 3ZE1B 3ARSA 3REWB 5L7XL 3QG6A 4KVPA 1KB5H 2V0AA 3V8CA 1FVEA 1KEML 5GS0H 2WUCL 2GJZB 5GGSB 3ZRCC 4B0MM 1JD9A 3KLLA 3VVWA 3CSYA 2FWOA 4YXHL 3CHPA 1DQQB 1C1EL 5CEZL 2GEQA 4B9GA 4OZFH 3LZFH 4GG6E 1H5BB 3WKYA 2X89A 4LOVA 4Z0XB 4OU3A 1DBJH 3FFCB 4KKAD 5DVOA 5IWLA 3GBMH 3RVTD 3I85A 5A3IC 1J8HA 4LCCB 5FKAB 2AEQH 3ARGB 4GI6A 4X80H 5IG7B 2QGEA 5CLTA 4MZ3A 3HNSL 1IAMA 3QJVB 3QXAA 4AYMC 2ICWA 3S3DB 1A7NH 1FZOB 3DOSB 1F1DA 4U7MA 1XCTB 3NRPA 4KI5D 3RNKA 1HDMA 1TNMA 1BG1A 1MUJB 4OD2B 5KSUA 3WEMA 4MJHA 2XVGA 2WLLA 4X8JA 5CIPH 1KBBA 4H20H 4OBRA 2FT8A 4TSCH 1SHWA 2E27L 3ESOA 3L4CA 3OXRB 4I0PC 5EU4B 5ID0B 1CQYA 4FHKA 7CGTA 3GBNH 3QUYD 1NMCB 4ZJ9A 4TOYL 3WLWD 1D5IH 3DTXB 1MWAL 3WEXA 4LEXL 3WKNA 3E3QE 5LHDA 3B7SA 4XNUL 2FECI 1JPSL 3E9UA 2H6UA 1SQ2N 4YNYB 5KVDH 3VDBA 3VD0A 2XZQH 5IB1B 1HH9A 1S9KC 3TZVB 3BDBA 4XMKL 1A25A 4JM4L 1EO8L 1A1NA 4KKZA 4J2QA 1B6UA 5JYMA 2DQJH 3W3BA 3LD8B 2C7UB 4XWGL 4MNGB 2EJ1A 2PO6B 2E76C 4G7YL 4WNJA 4CA4A 1MVYA 2BCKB 4HBQA 4QOKA 3WD5H 3G6AA 3FT2A 3CWGA 4LHUG 4X9HA 3GC3A 3QJQB 1OLLA 4E2OA 1NUNB 1KC5H 5IB5A 4ZMOA 4XO3A 4D2NA 4L5FE 3S34H 2AAAA 4GS7C 3CFKA 3UIYA 2WTPA 1QVOA 3O0LA 3R06A 3M1OA 4HX1A 4POZC 2PP9A 2H2SD 4HJUA 1HZKA 1OGAE 4KKAC 3IDGA 2KS0A 3HLAB 3RVTC 3SCMB 1H3GA 5T5NF 2NY2B 1JN6B 2NQDA 4N2GA 2CDGB 4M7JH 4K15A 3BQUC 1E4JA 1CI3M 4CC4A 1G6RB 5E1AA 2BFVL 3DYMA 2YPKB 3FUDA 4B9CA 1OWWA 1OT2A 4HPYH 3N2JA 5E2TH 2HXAA 1CFBA 4R7NA 5KVFE 3GPSA 1WQVT 2J5LB 3G5ZA 2GFBB 5F44A 4Z3JA 4W9FC 4MA7L 2Y7MA 3LZLA 5C0CD 1BQ5A 4P2OD 5IV2B 3O2VL 1BIIB 4I18C 2P43B 2OYPA 1JERA 3GS4A 3SQBB 5CCHE 32C2B 3ROLB 4JHWL 2XOTA 3BP4A 1WHOA 3AFLA 5LGHH 1OAJA 2P48B 5DI8B 2E0PA 3LZOA 4ZPTA 1KJ2A 3N40P 3AQXA 5AD0A 4PJFB 3D07A 3IKCB 1CE6B 5EF1A 3KR3H 3UERA 3MRIA 5AYTA 3ME0A 3NIGF 4PJDE 5KYYA 2FATL 1E4WH 4Q74A 2DKUA 2CR6A 1E7VA 1YN6A 2GT9B 5DFVD 3ISWA 1NGZA 1QLRA 4NKMA 3UGUA 5EUKB 3PXHA 3DBSA 4H26B 4MCZB 4YK4B 3TL5A 1OARH 3DYOA 4XXWA 5L2JB 3CN1A 3RUGB 1MRDH 3OM3B 3HMXL 3QQXA 4G1EA 4K71C 4KDTA 3KWTA 2AEWA 2B59A 3O45A 1MFNA 4N5UA 3CG8A 3NK3A 4Z7WE 3PYCA 3WFCH 3CFCL 2IPUG 2DPKA 1PY9A 5BOJA 3QJSB 3T2PA 1G6VK 3QRGL 4UT7H 1UOKA 2UXTA 1NCDH 4PIRF 4WJ5B 2CIKA 3LIUA 3HI1B 3MYZA 2QKIC 4PG2C 4XXDB 1A6AB 4MSWB 5IHLB 1JWSA 4OR1A 2D8KA 4PJ5A 1U91B 1LLAA 5ISZB 2ZX5A 3HRZA 3MLUL 4WY7H 3KJ4C 1E8ZA 1ZLWK 5GRYA 1P1ZA 2NZ9D 4GUCA 1Q9WB 3L1GA 4PI0A 2ICWJ 2BP8A 1NIFA 4HCFA 5F89B 3LOWA 5AW5B 2O30A 3ZKMD 3OXSB 1BAFL 1KELH 2NY4B 3B7RL 3QJFA 2HUEA 4GRLB 5BS0A 5EU5B 4J8RA 1J1OH 4A2FA 4OV5A 1BM3H 1HFUA 4QY8B 1ZDSA 1NBCA 2R2BA 4JY4A 3WUZA 4KTGA 4K07A 4XPBL 4A7UA 3KWVA 2VC2B 2AZAA 3KLSA 1L9QA 2FECL 4WW2C 2D7PA 5A16A 3WU1A 3MV01 1M7IB 2RIKA 5IMMB 2HCZX 3KPSE 3KXFA 3X17A 3BW9A 3FC8A 4BQ6A 2OMXB 2QHRL 1NBYB 2QSTA 1EFXA 4FI7A 5DD6A 1HHJB 1I8MB 1OV8A 1UM6L 4LPWA 3B7YA 4G8GD 1B2WH 4I3GA 2EACA 3MRCA 4F1SA 3F58L 3Q1SL 3POHA 1X5IA 4JKKA 4HIHB 2CO1A 5BRQA 2G0KA 5D7LD 5LUMA 1HXYB 1EV2E 2WN3A 4KZEL 1M3IA 3CZUB 1ZTXE 3P11H 1IBFA 5DZJA 4KZCA 1T04B 2V5YA 3UBHA 4BZ2L 2DLEA 3PWJB 3BD3A 5H37H 1AE6L 5JW4Q 3X11A 3POCA 2NT1A 1UCBH 3BX7C 4U6HA 1XDTT 1HKLL 1OCWL 1NAML 4QNPF 2WP3O 3BSZL 1CLYL 1ERNA 2R2EB 5I1EH 1MCHA 4K9EH 1JNHA 2EE0A 1KCRL 5DFVC 1OSYA 3UTSA 4OQTL 5D7JD 1XR9B 3B7TA 4LHUB 1CC3A 4PJ9A 5BRZE 2ZUUA 5CBEB 2IDQA 2YARA 4NQED 2VYRE 1PLAA 3A6BH 3ESMA 1TDQA 5C0BD 4OZIF 3WBDA 3N42F 5F6HJ 1K8IA 4KTDL 3RGBA 2XU9A 3MJ9H 4LLWB 5K39B 1P4LB 4HBCH 4IDLA 4TLKA 3SKMB 4DUVA 5MEPB 3D18A 2X1PA 3DUSB 3H53A 4FFZH 4ZO9A 3ZZ1A 4WUUE 3PGCA 5ESAA 2J2ZA 4A7VA 3ASOB 1BCIA 2JV6A 3QIUA 5B39G 3GFUA 1A14L 2Y07H 4DIXA 1U8CA 4QRSB 4AITA 5C0DA 1WZKA 6TAAA 3L3DA 4NQCD 1LE5A 3BKML 5IGXL 5IHBA 3EGDB 3CZGA 2EKSA 2ZF9A 3KPRA 3LEYH 4YDJA 1SLWA 3RIKA 3TVMD 2Y06L 1WWBX 4PGZA 1GC1L 5D2NE 1HVXA 1MY5A 3HUJF 3I3BA 3H4HA 1KULA 3L3HA 1AKJA 5AW3B 3K81A 5HHMD 4ODHL 1IGMH 1B9ZA 4Q6IC 4MD0A 1MHPH 2FO1A 2BP0B 2GCYB 3DXAD 1EAQA 3ES6A 3O0RL 3H6JA 3K1KC 4BGLA 3RDTD 3BPNB 3OR6A 1A7BA 4RMWA 4JHZA 1OAYL 3KE0A 4RIRA 4QJ3B 3DURA 4Q0XH 4NC1E 3V0HA 4MBOA 2XZCL 3ZJAA 3ZPDA 5IB3B 3U48A 4P04A 4FG6C 1PYWB 3ZTNH 4AEHL 4ZFFA 3EUDA 3DHMA 1YEIH 3WIFB 2PMZA 3QPXH 3KNBB 4ZO7A 3RVUC 3SGKC 1NOAA 4PRBB 2CMRL 4IEFA 1J5CA 3GMPA 3JBG7 3UROR 5D1ZI 1OE1A 3LQZA 5ILTL 5DCCA 2UWEB 3LS4H 4MLIA 1QSEA 4XB8A 5BZXA 2ITDA 2VLKD 3IPFA 5JHLH 1O75A 3UAJC 1KLGB 1TETL 2P44B 2M1KA 3VXUD 2QFRA 2ARJQ 2C1OA 1ETB1 3CJJA 3MRQB 4GIOA 5B7EA 3LVTA 4FL4C 4LE8A 3O3BA 4PS4H 3ZE2F 3LN9A 4YEFA 5E23A 1HEZA 3WE6B 4OAWA 1MFDL 5T1KA 1IX2A 3RGVC 1WE5A 4OCRH 2NUTB 1EIBA 2HJFA 4QRPB 2RH0A 3GGWB 4P2RE 3AW5A 2L7QA 4OJFH 1Q1JL 4V1DB 1CDIA 1YVLA 3CVHH 4XPGH 5F7FA 2DQIH 5C0AD 1PX4A 2PCFA 4NENB 3QYNA 5DQDL 3MMEB 1N6QL 1GXEA 2E6PA 3ABZA 2H8PB 3WXWL 3K2IA 1FC2D 5DLLA 3ZL2A 4APXB 2XSKA 3VXSE 1RU9L 5DD3H 2MCMA 1KLUA 4JRFA 1OF0A 3L9BA 3WNLA 3FAXA 2JKXA 4XNAA 4KZDL 3UFIA 4HUNB 4FG2A 2DQFB 2HG0A 5DS2A 4N9OB 5C0FB 4TVPL 1CICB 1GOHA 5IUSA 2X0WA 2Q3XA 4DKTA 4G6KL 3PQYE 4JRYA 4XNQA 3CUPA 2WQVA 2XJLA 1YY9D 1BXUA 2QV4A 1X5KA 1KN4L 4O4YH 1AD0B 1T0NB 1LD9A 3UZEA 3DETC 4LL4A 3DX8B 2MFNA 3S2CA 2ATKB 3FUFA 1FYHB 1HYRC 4APQB 1E5ZA 2UXFA 3JVGC 1ZHNA 4M8RA 2X1QA 1U21A 1VFAA 3LNHA 3T6XA 5ACZB 2E59A 4L8DA 3W5NA 4Z78B 3FCUB 2ZKWA 4F7TB 3EYQD 3R8QA 3ZDYE 2XTJD 4ELME 5GS1A 1OWRM 2DIJA 3OB0K 4TS6A 4XBEH 3ROOB 1IEAB 3NJXA 5AB9A 5D6CA 4KKBD 4JG1L 4FHBD 3DPBA 3KAAA 1CFNA 3GDBA 3MJ8A 5L9DL 1WF5A 3LNGA 2CR3A 4Y16A 3V4VA 2J1KA 3BPOB 4UM8A 1SRDA 1UATA 5AVTB 1EANA 1KTDA 2BNQD 3A6CH 2ZNWA 1S7SB 4H2AA 4KFZC 4U1GC 3P1VA 1FO0A 2ZKXA 3C87A 2WYHA 4HIXL 1AS6A 3AAZB 2PCPB 3HNVL 3OPUA 3B56A 3TN0C 2VDOB 4GRMB 2VXVL 2VDKH 5F7HA 4N0UE 5B39B 4HJGB 4RWYL 3S6CA 4IRSD 2MOGA 4RGOH 3NJFA 3F05A 3EBAA 5DGQA 5FOBA 5I76B 2SEBA 1A4JA 5C07B 1MDTA 4JN1L 3VQLA 5E08H 4I4WB 1T1WB 1BOYA 2HFFA 3CZEA 1GVIA 4UZGA 4EZLA 5C0EA 2VMJA 4Z7UA 5FHBL 4GG6F 4D7BA 1U8MB 2XWTA 1D3CA 1YSOA 3L9RB 5DJ0A 5GGVY 1I3VA 2FRGP 3GLDA 2R56H 4YE4H 5IIEB 3VTTA 2CNYA 2LHAA 1M7UA 1T0MB 4PJAA 1MFMA 5AKVA 3TURA 5F1OB 1K5WA 2Z7WA 4MQ7A 1J0IA 1AY1L 1ND0B 5FUOL 1OM3H 2BHFA 2ZSVA 4Y1TA 1XF3B 5D7KE 5KJRH 1K6QL 2V2XA 1PIGA 5JORA 2O93L 3UIZA 3RAJL 3RFZB 3KL5A 4MAYC 3D69A 4DPBX 5FM8A 5FW7A 4OJEH 3IDMB 4BQBA 1GKOA 3TZVD 3HC0B 4BV1A 1XGPA 4QCIB 2W9DL 5ID1B 3O4LE 2AKRB 4PMEA 4IGBB 3FDWA 4AQ8A 2EIZB 5T5FL 5D72H 3T3PE 2XTJC 5CJ8A 3V10A 3SQOL 2PO6D 1IEBB 1R3IL 3OKKA 4OFKA 4ZUUB 4Z0BH 4KKBC 3E0GA 3CDGA 5I1JH 2X9XA 4DO4A 2HVBA 3TO2A 2ESVE 2Z4QA 2VLME 3D4ZA 1Y6NR 3Q01A 4NHCL 4WSKA 4NQSA 5EOQH 3EAKA 2BY0A 3F83A 3U0PB 2JCCE 3QHTC 4JHBA 4O00A 5TK2A 1AGFB 1NMAL 4BK4A 1OCZB 3QULA 3IMUA 1T1YA 1RH8A 3SO5A 3HBQA 4FYSA 5EEZA 3VFRA 4WLCA 1T7WA 1CWVA 3Q1EA 3WELA 5DHYA 4YR6A 5FF6A 1XH2A 4KO7A 3I84A 4OLVH 4ZTPH 4JG5A 1TTUA 2A6DA 3CFJB 5FYLL 3QFJA 4X2UA 1E3FA 2NY2D 4WK0B 4U0RC 1H0DB 4Y5XC 4NFBA 2H26B 4TUJA 4UUJA 5DJCA 3BESR 1QFHA 1L0PA 3DJ9A 1RZKC 1GGBL 4N2IA 43CAB 1RJLA 4ZMXA 2MPVA 5F6IB 1L7IL 3QIWB 1FL6A 2XKNA 5FYKD 5HI5C 4IRZH 3KPLA 3NSYA 4J3OD 4H88L 4QO1A 3OLDA 3O3UN 15C8L 1FFTB 2GAZB 3Q6FA 4U1NA 5I0ZA 4Z7AA 3WTSA 1CN4A 1GW0A 1DO6A 2OW7A 3QHFH 5D9SB 2OMUB 1PJ9A 1VEMA 4FQCH 4PRPD 1P1VA 2FD6L 4LSUL 5MI0B 3MV9A 3TV8A 1SNRA 4KNSA 5DHDA 4QXTB 4Y2DC 4UTCA 1N3NA 4GLRI 1A47A 1OP4A 2AK4B 3IRPX 5DEFB 5BVJA 1YNLH 3O41A 1PLCA 3FTWA 1WICA 4MNHB 2YAEA 4Y5VA 4Y4FB 1V7ML 3I6SA 4RGMB 4LEEA 1ITCA 1N12A 4KK5D 2BDNL 4QRRB 3RIAK 2FYVA 4NT6B 4KU1A 2G75B 2YQGA 1OTUC 1QPXA 3BP7A 5EO0A 4YSCA 2D03H 2Y22A 4JHVA 5CP7B 3QNYB 2Z34A 1UFGA 1J1XL 4Q2ZB 3UO1H 1XMWA 4JKPH 1RIVL 4HFWA 1KBPA 4N2HA 4HGKC 3STZA 1T66C 3US0A 4HJIA 1T5KA 1VRSA 3C8DA 3VWKB 5CKAA 3I50L 1YEGL 3FZUD 3WMPA 3GS7A 1MJ7H 4YL9A 2VLRB 1EDYA 9CGTA 2F54E 3D87B 1A8ZA 1GGIH 5E7BA 2Y1ZA 2ZWSA 4DGVH 1CD9B 3TJEL 1MFEH 3L3JB 1LE9A 2O61A 1NH6A 3VFMB 2P5PA 1UHVA 3BVTA 3VFTB 4P46D 3LMJL 3KCPA 1MAKA 5DMGC 5CJ5A 4HOWA 1U8NB 4Y1AE 5ALBL 3I6LD 1G0DA 4J7RA 3ECWA 4CC0A 5I24A 3GO1L 5D4HA 1RCYA 3OF6D 2R2CA 2B16A 4L4VD 1FCGA 5F7BA 1P5VB 1BQKA 2JJSA 4UM9D 2EC9T 3MJGX 4QXGH 1ETZB 2N3JA 1DVSA 1HYSC 1GIGL 3UBXB 1U8OA 1JZ5A 3OHXB 5GZOD 4Y4HB 3FUJA 4LSQH 4WIQA 2IH3B 4JRXB 4LARL 3VSUA 3WUWG 3LN5A 3P9MA 3RA7L 4M7KH 3PV7A 4X4XB 1A4BA 1E65A 4PI2A 3GRWA 4HZ1A 3ULVC 4NPKA 2FSEA 4MWFB 5BXFB 2A74C 3BVNB 2DDQL 4JDZB 4DTGL 1BZ9A 3IDYB 4I89A 4O5LL 3BEWA 2WXFA 1PX3A 2VH5L 3KYAA 2E7BA 3PWPD 1SBSH 3EDKA 1I3GH 2HRLA 4IOIB 5J1AB 4PV8B 3J8F7 2EEFA 4UQBA 3RBSA 2GBTA 3HB3B 3K0WA 2FX7H 1NBVH 2R4RH 4NWUH 1E3XA 2GEEA 3QAZB 4N2KA 1SVZA 1SHMA 1GR7A 1N10A 2X05A 1LK3H 4DVRL 4JPWH 3HHSA 3HI5H 4QOKD 1J5OL 4HPOH 4X4YB 2Q7YA 2BNUB 4N2MA 3I6GB 3UYRH 3R0MA 2ZTBA 1FNEA 1M05A 2FCBA 5D1QA 3O3DA 4D9QE 3WTXA 3QEHA 3FQ1A 2BWDA 4W9KC 1I8IA 4XN5A 4MGXA 1AO7A 4F7MA 4LHUD 4OLZL 4OZ4A 4IMLA 1EAPA 2EXSA 4JHAL 4F58H 4Y9EA 1BP3B 3J7HA 3RB5A 2JQAA 3BWUC 5IP4A 1MJJA 5H4YA 3ZRSA 4ETQA 5D2LE 1C5DB 4GKLA 3G3LA 4RFNB 2CPCA 1D5ZA 1FE8H 5IWLC 4X98B 4AKPA 3VWJB 4PRAA 5EZOH 2V5TA 4D3CL 2I7SA 5I1HL 4LOFA 4ZQKA 5LGJB 5MENA 1HZLA 3H7BA 3OMIB 3P4NB 4QHMA 2BS9A 4KH9A 3TIEA 5IFHH 3QA3A 1ACZA 2I07A 1RJZA 3NN8A 5KAQG 4EUPG 1DDHB 4K3GA 1CLOL 2QPFA 4PVLA 5EV7A 1L0YA 1D5MA 5L8JB 5LXGL 1FJ1A 1SXCA 5C0ND 3HR5A 3KPPB 3UTQB 1FZJA 3A22A 4EUPA 1C12A 5F7NC 3T6ZA 2FJGA 1T4WA 3H9ZA 5E51A 1HWWA 4I0KA 1WA1X 4XNMA 4G6ML 4XVJL 3RFRA 1O6TA 2DQCH 4FEMA 3QCUL 2B1AH 5EA0H 3VXPA 4HPHA 1KPVB 2CO2A 3QEGL 4HF5H 5I6XC 1A7QH 4M61B 1YEFL 4JFXA 1MG2C 1NDGB 4WO0A 2H3NA 3LRSB 2ALWA 2LVEA 1N68A 5J6GA 3MCKB 4GXVH 1SDAB 4PCSA 2VXTH 1YYML 3ULUD 3ULVH 5I26A 2IXQB 3MN8A 4KK8D 2C4FU 2QGBA 5KVEH 5IY5B 4JANA 3PGDA 3VI4A 2KZBA 3MTRA 4FN0A 3L16A 1ZLWH 3W81A 1F4WL 1FFQA 2LU4A 3DO4A 4Y0GA 5HYJA 2G5RA 4AENB 3HFML 4CU8A 4KROC 3STLA 4FQ1H 4DQOL 3V5KA 3CZSA 3CZJA 1NEZB 4UQ9A 4ANUA 1IBHA 3FL7A 2OS7A 4K7PL 2C9AA 4LMQE 4G1MB 3ZE0B 4A38A 3Q6GL 2GUOB 4KKCD 4NFCA 1VA9A 2ZCLL 4QTHB 4QHNA 5HSFA 2XXGA 3MLXL 4HH9B 4XP4L 3MLWL 3ARBA 3L3IA 2OSWA 4YX2H 1CO1A 5IBLD 1P7QB 5AENA 3SDXF 3LDBB 5D70L 1E6OH 1J9TA 4LBAA 3V4PL 2B8OT 3G5WA 5BS0D 3AQDA 3GUTB 1JGLH 5T1JA 4JN2B 4ODUA 1ZLUK 3IVKA 5CN1A 2X0VA 2ETWA 1U2YA 2HVKB 5GPRA 2ADIB 3B9KA 2QBWA 3HS0A 1R3LB 4JLRA 4CC4C 3V0AC 3RJOA 3DV4B 1PS3A 3WV0A 3OWEA 6CGTA 1JFQH 1AANA 3CHXA 4L1HA 4TMPA 1RIUH 4H8WL 2KH2B 5DYOB 5CEYA 1FAIL 4N24A 3WUWB 1JVKA 4NIYE 3NACL 2J1XA 4GKOA 3ARDB 3BQUB 4XN9A 1TZGL 1JNNH 3VGDA 1KNOB 4OLXH 5ETUA 3HAEG 1AD9A 3VYNA 3SOTA 5IJDC 1FZKB 2UVFA 1MXGA 2ZXAA 3AM8A 4XPHH 1QO3B 3KBHE 4MNQA 2ZXWB 4MJ6B 4HK3J 1QQDA 1AFVL 3QH3A 4APQD 1E9QA 4L8BB 2EYRA 5I0VA 4J23A 2LLGA 4N1HB 5F97E 4IKNA 3VFNB 2WLZA 1TTAA 3L7EA 4L8SC 4UQ3A 2XWBA 4NNPH 4PJ9D 2CJTA 4XXWC 5DJXB 5EUOE 4KDTC 2LFGA 3VI3B 1EEYB 5A6MA 4PRNB 1PSKH 2VDPB 1IM3D 2JJVA 2D2CC 5EIQA 2OL3B 2ZYRA 5E6IA 2HMID 4DK5A 1LEGA 1UB5B 3QDGA 4LCWA 2D3LA 5TF1H 1JOIA 4RFOL 3D2TA 3NIDB 1FYTE 4ELMF 2DZEA 5KJ4A 3U7YH 1I1AD 2MH4A 1G7PA 1KTRL 1IILE 3TT1L 3BRGC 1IC5L 1Q8MA 3KH4A 3HRZC 4X7SH 1DQTA 5SWZE 4OZHA 1QFWM 2CO6A 1HE8A 2F0CA 5IBLC 5JA9A 4TNFA 3SIKA 1TQCC 2PYEB 3MRMB 4TYUA 4HKXA 2PW1B 1RL1A 2LLLA 3ZR5A 2YC1B 2WSDA 2ZCKH 1TTBA 1Q72L 1R5IB 1SN2A 3HJ0A 4U1JA 1H15B 3SE4A 2BSTA 4LASH 4NKQB 3DARA 3QXTA 5A6LA 2FZ3A 2WYIA 4YSDA 3UYPB 2K9FB 3ZUCA 3LS5L 5GGUB 3NSJA 1RZGB 2RB8A 1CD1B 1FFOB 3DSFL 3DROA 4GH7B 2AV7B 4XPFL 4U1LB 4N5ED 2NY5C 3L6FA 1EH9A 4DP9X 3JV0A 2X6BA 2IALB 1A4AA 5HYQB 3MRKB 3DUUA 3BCFA 1JXDA 3CE1A 5FYJD 4G6JH 4FQJL 3C6SA 5JXAL 3B3IB 4PVNA 3U2IA 3WJJC 1A7PL 1S7UB 1E42A 4OM0H 2NTFA 4ANVA 1QLFA 3JVFC 4PTUA 2IBZY 3F12A 3GEFA 3IBEA 4KY1H 4AUYA 4BWUA 1KJ2H 3EJPA 1XBDA 3FN0H 2G9HB 4XP9H 1IIIA 2AXFB 5KZCB 2OTWA 2FJFB 1FSKC 4EE2A 12E8L 1A6WL 2ZYSA 5AVRB 3PP4H 5FFOA 2XZZA 1RP8A 2V9TA 2G2PA 4PJ9C 4KO6A 4XO4A 5IW6A 5T1KD 3EGSA 3ULUH 2F68X 5BJTA 4D0BB 3FUIA 4MA8H 4G5ZL 2Q5BA 4HIPA 3HG1A 3OPZL 4JREB 3K1DA 3MZTA 5TFSL 1A6UL 1BLNA 1M56B 3BD5A 2P5WA 1OCCB 4XOBA 5C9JB 1AZBA 1RPKA 4HS3A 5D7IA 3KJ6H 2XWJA 2X9YA 1ZAGA 5DJ8B 2LTQC 3T3PF 5CLWA 1GJIA 1BFOA 2HZHA 4Q4IA 3MCLL 3S5YA 2FEDD 3DX7A 4IBVA 3QIUC 2ZCHL 3L3KA 3ZYIA 5KANG 3B2VL 3L95B 5JDSB 2LT9A 3VG0H 2H6PB 2CZNA 1A9EA 2EXTA 3FONA 4AQEA 3V7MA 2IANB 2C7FA 1HKFA 2XN0A 2JCCF 3N1GC 5CZVL 1MQKL 1K3IA 2I9TA 3LH9A 3JV4B 1CXFA 1FQ9C 2WIIA 1EUTA 3HA0A 4NQXA 4WNSA 5DVKA 3P0VL 4DK6A 5DK2A 4MA3A 2AMUA 2Z7YA 5DK0A 3HPLB 1KXTB 4WI0A 3OB0H 4HJTA 4PGCA 4PG9B 2ZSWB 3L1OL 4AYFB 2ICEB 3S3SA 2O5NA 3HAEB 3UX9B 2F6AA 5I16A 3WJMA 1N7MH 3ELAT 1LO4H 3ZO0A 4L8CA 5IM7B 3IFNL 2VIRB 3FF8A 4HEME 5EU6A 4ZUVB 5DRNA 4Y2NA 1QSFB 2OP4H 4O02L 3SOBL 1Q38A 1ODAA 3BT0A 4A6YA 3NQKA 4BUHA 1XR8B 1DVFB 4LXFA 2E8YA 2NY5H 5CGYD 1BECA 4ZYKA 4N8VG 4TVSa 2Y1YA 4ABUA 2DJUA 1MFBH 1KBKA 1EBAA 4Y16D 2WINA 2WJ7A 4LEOA 3DVGA 5C09B 2AK4D 1K4CA 1KJ3H 2VUOA 3BKJH 4CW1B 4UNIA 2JXMB 2OK0L 3WY4A 2CHNA 35C8H 2EVFA 1NCCH 4Y4FD 5HY9A 3DMMA 4QRRD 3MJWA 3VW3H 4F27A 4LDLB 3DSNA 3OZLA 3U6RA 4HXAL 5KJ7E 1H3VA 4TLSA 1HHHB 2DM2A 4LRIA 5AOZA 5J6HB 2CRZA 3QUZA 3QARA 4HMEA 1IBGH 4BH8A 2WXIA 3RZCA 4OF5A 4WWKA 4P4KA 1JPTH 1BDYA 4K0OA 2N01B 3MUZ1 5I1AA 4W4OA 1FIGH 5BRPA 1CGVA 3U7WH 4ELKA 4YDNA 3SYQA 5K9KB 1QRNB 1EEZB 1QFWI 2CK0H 1J18A 4M6ML 1HT6A 4YWGL 3B2UD 4TNGA 1BPVA 4PJIB 2AXGA 3ULAB 4BFFA 4PWEA 3LPPA 3Q2NA 1NGXA 4F20A 3QUGA 1TJXA 4QIRA 5E4OA 1AGEA 3C9NA 1T2QH 1YYLH 2VDQH 1ZPLA 1LP9F 1RZPA 2YGOA 5HHOE 5T8IA 4FYRA 5F72S 3A21A 1LVEA 5D1XB 3MRRB 1FRGL 1SM3H 1X5MA 3BIBX 1IC0A 4WNQB 5BMFL 5G4MA 2Q6WA 2F18A 3LZNA 2EEDA 1OAXL 3S96A 3DDFA 5J9PB 4BIKA 2BVQA 3UZEC 3NESA 3O2WH 3GKWH 4ZFGL 4LLVA 3NJJA 3UP6A 5F96H 3H9SA 1WSST 2AJSH 4JFEE 5BUPA 4QRAA 1Y1UA 4HCRA 4OV6F 4KVCL 2NSXA 4RFEB 4NQDD 3HZYA 2WQAA 1OD9A 1DSFL 4WGWB 3ZIYA 4HJEA 3IRZA 4M03A 1IM9B 3MLTB 5GS1C 5F9DC 2WKLA 5CGYC 1R0AH 4R4ND 5CJOL 4A7QA 1IAKA 4AXWB 4QRUB 2Z1PA 3FUEA 2P8LA 5DRZA 2D3VA 3JXAA 4Y16C 1S3KL 5I1DB 3QDAA 5FKPA 1FFNB 1B0RB 1BIHA 5ICYB 1A3LL 2PWDA 4YHZH 4NUJA 3U9PL 2IQAA 2B4CC 5CWSB 1KXQE 1SXBA 2I9LB 4WF7A 1CUOA 4HWUA 1ZY9A 5T1LB 3CXDH 4XVTH 4JL1A 1DBML 5E00A 2BXYA 4DN4L 3LIZL 2A0LD 3IGAB 2H41A 1SJHB 1X5GA 2J5WA 4F7EB 1I4FA 3N0AA 1CGWA 3WXVL 1EAJA 4AEEA 5J13C 2CCVA 4QRPE 1AR2A 5AYQA 1I7RB 4DO5A 4EVNA 1TU2A 3CHRA 4V1DE 4F33A 3VWJD 4FTVB 1CDYA 1L9OA 4CDGC 3QDME 3HZMA 5C08B 1RZ8B 1GGTA 4M9OA 4FJ6A 1LEKB 1X5ZA 5D2LF 1QNZH 4HSCX 3O6LH 4PP1D 1AIFB 4LVNC 3VD3A 3SY6A 1CGSL 1PEZA 2ZKMX 4FI6A 3QG7H 5ANMA 4PEEA 2ZWKA 3GDCA 1DJSA 4ONOA 4XP5L 1J88A 2OJZH 2PKDA 1IFRA 1SEQH 3AWEA 3W0WE 4HZAA 1CBVL 4AZ8A 4OJCA 2B0SL 1BYOA 5C0JB 3II3A 3L5WB 1LO2L 2PR4H 3L9EA 4FXKA 1DTUA 2AJYH 5F1IA 1GCYA 3GMRA 4X5RA 3WY3A 1HHKA 4HUXB 4TNWK 4QLRA 2O5ZL 1KMGA 3CFDB 4PJCA 2FIRT 3TIDB 3OAZK 3IEAA 3TWYA 3MLYH 1G1CA 5J11C 4Y5YB 1J0JA 2IAMB 4DCQB 3AWFA 3JT2A 4WO4A 4AQ8C 3MRHB 5F9OH 3VDAA 5T1MB 1T21A 2QADC 4QKXB 3DK0A 3CFEA 3BGMA 1YEDB 4MAYB 2DWDA 4LF3A 2HT4D 1QFWL 4L5FL 5EZPA 2WVUA 1W80A 3OR7A 2GJ6A 3MBWA 3ZRFC 3B9VA 3CMOL 4IJTA 3V0DA 1S7QA 2CM6A 1ZANH 3W9DA 2NXZB 2Y6SD 3V4VH 2BXZA 3DHJA 1VENA 2AV1B 2GTZB 3FH5A 2HT2C 3P4OB 1SYSB 3BUPA 5ICXB 4QEGA 1TEGA 3L7FA 2PYFB 2B4CH 1F4YH 1GZHA 1FO0H 3V6FB 3WL9A 3IU3A 4QHUB 5C0IA 1TVDA 5DJ6A 3SQRA 2A0LC 3V6BR 2WLNA 1E6JH 4ZX3A 1W0WB 2V8LA 2I27N 1KCUH 1WC7B 1G9NC 2J1WA 2WXQA 2HFEB 4LVOC 4AQ1C 5KVFL 2R1XB 1IO4C 2DY2A 1RMFH 1RZIA 2CRIA 4LU5L 5CGTA 5JXED 1D7FA 4YDIH 1EZVY 2ZKHL 2OMWB 3VB8A 1DFXA 4GBXD 1MEXL 1A1OB 5LNGA 4AZUA 3PXLA 4ZMTA 2Q1EA 3W9EA 3I6KB 3NABH 4PP1C 2EH7L 3WHE0 3CN4A 1R9FA 3DVNB 1K2DB 1FDLH 3ML9A 4L1BA 5CHNA 4F7PB 5HHVH 5T1DL 1KIPB 3EDEA 4HYTB 4U0RB 5L6YL 2Y72A 3ARDD 5EFIB 1MOEA 2VLLB 2NY0D 4GW4A 4X7TB 4GMSH 2OYKA 2X4NA 3V0JA 1I9IH 1S9XA 2ZF8A 4R90L 3OKLB 2DW5A 1I53A 4YHZL 5FWQA 3SGEH 2WLJA 3BI9X 3HMXA 4JFDD 3L5IA 2A9MH 1T03H 3ZKXC 2FHCA 2NY7H 4E42B 1KIRA 1BF5A 4QHLA 1I8AA 1U4FA 3HZ3A 4AI7A 4ZNCD 1P2CA 2GKIA 4LSTL 5HJ3A 4Y5VC 5IVXF 3NDZE 3N43F 3TBTB 3BN3B 3BUYA 2EE2A 5G4OA 4GSXA 5D1QD 5FDWA 2MTPA 4X42A 1H3XA 2N7AA 4KKLC 3R7RA 3FB7A 4XH2B 3ETTA 4YC2C 3KH3A 4PWFA 3AJ7A 4Y2DB 2XVLA 1UB6A 2EYTB 4S1RH 3FTVA 2AQ3A 4TPRL 2ZUSA 5DC0A 2ZXBA 1VGEL 2NOYA 3ZMNA 1WP6A 1DCEA 4NM4L 4U0QB 5IHWA 4JFPB 5EBWA 3BN9C 5EUOF 1CG9B 1ZVHA 5KVMC 2WGXA 3DOIA 4BYHA 1MWAB 1NL0H 1PZSA 3D6GA 3BLKA 3NTCL 3A24A 1WZLA 2B2XH 4J6RH 2WMPA 4U3SB 5C7XL 5LAXA 2PYED 2ZPKL 3CPLB 3ATFA 2W5PA 4JPKH 3OQ3B 4MMYB 3ZU8A 1OEZW 2HFTA 3LKQA 5IVZB 2JJSC 3JQOB 1G9NH 1WWCA 3TCXA 5A7EA 1VFOA 5KSBE 2Q2LA 4HCGA 3FTSA 4NO5B 5T3ZD 4D8PA 2DJSA 1MVUA 4KAQH 1E4XH 4P05A 3IS1X 4BZ2A 1DJHA 4R4BA 1TCRA 4WZ9A 5I6NA 2X53A 5HGAA 1ZTXL 2ZWYA 1Q0EA 4LRNH 4MXVE 3BSZA 3TONA 1BZ7B 2WNXA 1AQKH 3CAFA 3U0WL 4FCAA 4DAGL 4FA6A 2E7CA 4OB5H 4ZX5A 4NZTL 3U4BH 4PRIB 4KJQD 3L08A 2DL9A 2O4EA 2J4WH 5ESVA 4NYLB 5JA8B 1NM9A 3QO0B 5FDYA 4CU7A 1PVHA 4NRXA 2GBAA 3EG9B 2A74B 4YSSA 1OT1A 5IMOB 3APNA 2J8UA 4Y89A 4XAWL 2ZUQC 4LLQA 3D39A 3L4TA 3O6FA 5AKRA 4OZGB 1CYWA 4TNVK 4UOJA 1ZLUH 1MFCL 4LP4A 1USZA 3L4WA 2F8VA 5CD3B 2AXWA 4BE6A 2VWEC 1YPZB 4JVPA 2AJUL 3FCTB 3IXTA 5DUBB 1HS6A 5A2AA 1XXDC 4KK6D 1Z9MA 3VMOA 4FZ8H 1Q4NX 1MRCH 2ERJC 2R1WA 2F53B 1S7VA 4GI9A 3WLBB 1TQBC 5KW9H 4H0GA 1JV5B 4XNBA 3T9WA 3S5LA 1AR1B 4L2YA 1L0QA 3RZWA 4Z7QB 2P5EA 2WTOA 1XF5A 2XZAL 1RLWA 3CC1A 4PGBA 1JXKA 2F08A 4TL4A 2IAND 3PNWA 4K5LA 4R9HA 5HPMA 1X5XA 3DTDA 2YD9A 2DQTH 2VO5A 3EH4B 1O7SA 2J25A 4HGWB 5AUMA 4PWKA 4MAZA 3FCSA 2NW2B 1WAAE 4MNQD 4B9YA 5J8OA 3GMOA 1NCJA 3FK3A 4LGRB 2VE6B 2WLLB 2QQKL 3AXLA 1X4YA 2PF6A 2BIQA 4H2CA 4K7PY 3H0TB 4UTAL 4ZZKA 1GZQB 4Z7VF 1G0XA 1XSIA 2ZJSL 1G1KA 3FMGL 3DBXB 5DD5L 1M3JA 5JLZB 5EOCL 2FHBA 3F5WA 1HL9A 1ZHBB 5D96B 2AANA 4AK1A 4P9MH 1DVFD 3WEXB 1ZHLB 2RQEA 2JJWA 1MI5B 3MLSL 4RGND 1O9VA 3MACH 3C5SA 1NFDA 4KJQC 5E6ID 2V7HA 4PUBH 4PRHB 5AB1A 3X14B 4BRJA 4M43L 1A0QL 1KLFA 1G9MC 5C09D 2X4OA 1NICA 3C60D 2IQ9H 4LCWD 2UYLB 5CUSL 1ONQB 1NIEA 2A4CA 4P9HH 1OSPL 3JTBA 5CFAA 5CLXA 1D9KB 3L54A 3TT3H 4ZMYA 2DOCA 4CVZB 1DVZA 3OBAA 1H19A 4K3JL 3ARBC 2W38A 2XV3A 1O5PA 1DQKA 1WDAA 5C0GA 4Q97A 2YKLH 4KJWC 3L4VA 4KROB 4E9WA 1F6LL 3GYRA 4N1CA 3MODH 3TNMB 5ADOL 5C9KA 1N64L 5EWIH 4XVSL 1HK6A 3QYCA 4MDJA 3KBPA 2P3YA 2VISB 3ZSTA 3LEXA 3B9KC 3HS0C 2VRQA 5B1BB 3R4DA 1UXLA 2R59A 2FJSA 3DIFA 2E9IA 2YD6A 2UX6A 1OK8A 2F9BT 2ZNXA 2CLVA 2NR6D 1NAMB 3IMBA 1HZHL 3OTTA 1OP9A 1INEL 1LGVA 3D2UB 1TTRA 5D1XD 5LDUA 1N5AB 5HYEA 2ZX9A 4TQEL 2EVJA 3CN3A 3TBBA 3U0TB 4WU7A 4WFGD 2IPTH 1A7RL 1GH7A 3OKDB 4X6BA 4JDEB 4EUPH 2PPEA 3RL2B 3MFFB 1TSRA 4HSAC 3SKJH 1WTLA 3EH1A 3V4LA 3QS2A 4NP9A 2BOCA 1OAUL 5D5MA 3TX4A 2A77H 2EUVA 1F90H 4LKXA 1FAKT 1QHPA 1YQVH 4HUUB 4KI1A 1GGYA 1QEWA 1UD6A 4BZ1A 5ADPH 5I73C 5KYWA 5E4EB 1UQSB 3E2HB 2VDNL 4UOQA 4LPXA 4LHQB 1B0GA 2LOEA 2Q8AL 4RQQB 2FO4A 3BP4B 1IM9D 3AGVA 5FUCC 1BEXA 4L1SA 4ZPTB 1S5IL 1WT5A 3JWNC 4KPHL 5FW8A 1ECZA 5JO5B 2FX8L 1N26A 3HG1D 1FG9C 2HA1A 2AQNA 4DKFL 3MRIB 2P5WD 5E6IC 3X12B 3MLVL 3ME0B 4PJGA 1T4KA 4XP6L 4L8SB 3P77B 2QR0A 1NGZB 3VRJA 1G9MH 3C5ZA 4R2GC 5E2JA 1EHLH 4AG4H 2BVOA 4P5TD 1S7XA 3ZE0E 2D7MA 2OPCA 4Y19E 3VNZA 1SMAA 5T3XE 2BNRA 3O45B 5T1LD 5FFGA 3X3FH 4QHPA 2NRDA 3F7VA 1MIEL 3DV6B 1E9OB 1BVNT 4ZMAT 4ODSL 2NZIA 1WV7T 3CVIH 1OCOB 3SHSA 1I7TA 3SE3A 2FT6A 4HOMA 1N4XL 5C08D 4PJ5B 1EAOA 3D25A 4DVBA 3HRZB 3ATAA 3VFOB 1DFBH 5D1ZA 2X0UA 2PUQT 4DOHB 3WN5C 4I1RA 3LN4A 3SDAB 5F7UA 4N87A 2YQ2A 3FQTA 2Z35A 3HG4A 3OZ9L 4XP1H 4YSTA 3QDJA 2OZ4L 5EU6D 1MJUL 3GHBL 5JOPD 2EO1A 5DJYB 5JW3L 1PIFA 2CJUH 2ZX8A 2WSPA 5SWQB 2EDKA 3MBEB 3NFSH 4PJ7E 2YN5A 3GZQA 1RZJL 3MNWA 4FGMA 4KNUA 4QWWC 2CPUA 4YAQA 1ADWA 1AJ7H 2RFXA 3C5JA 4P07A 5IK3A 4WTWA 4OTXL 3KXFB 3IETB 4G9FA 3F64A 4J4PA 5GRWA 4WHCA 3BW9B 1RIHL 1CLZH 1EFXB 5CSZB 3GXDA 4D94A 4PY7A 2HRHA 4O2EA 2E4TA 3FFDB 2TRYA 3RL1A 2D3NA 3NEXA 1JAEA 5I1KH 3NZHH 2DLFH 5B1CA 4AMXA 2ZX7A 1NCGA 4Z9KB 4MCYA 4ZUTA 4QRQB 2IAMD 1KBWA 2H32H 5I0YA 1WISA 3FRUA 3QUML 2VJXA 2X87A 3RWFA 4I3RH 1IT9H 3T0VA 1MHCA 4PVBA 1CZ8L 1T20A 2AQPA 4GSDH 1ZVSA 4A2DA 3KDPB 3X11B 1JNJA 4F2MA 1L0XA 1Z9SA 4GQ9H 3BUDA 3LPGA 3C5XA 3ZZLA 1OTSD 1B4RA 4YHIA 1UADC 3O2DL 5FLUA 5IMLA 5KOMC 4KO5A 1QBAA 5GJTH 5KBNC 3JWOC 2AGJL 1KDJA 2AQ1A 4HA1A 2HTLD 2W9EL 3C8HA 4MXQC 1GHFL 4GUPA 3GI8L 1AHKA 5JHDA 5TH2B 2Q10A 3V6ZA 2JKRM 2FBOJ 4JG0L 4OLWL 1NCBL 1NKRA 4OFQA 1UM5L 3CDZB 3OKMA 4AC2A 5EC1B 2CO3A 2HSIA 3IU4H 1RHHB 4DPAX 3VCLA 4LIQE 5L2KA 1KWGA 2X4QA 5AW1B 1KGCE 1U3HA 3CQFA 4U1MB 3QIUB 1R33A 1UEMA 3IDUA 3BFOA 1DUZA 2V2WB 2HPTA 1LE5B 5JMOC 4JY5L 1TSHA 2L8AA 2EKSB 4YDJB 1F41A 1N6UA 3GINA 3TFKD 5FO7A 1Z66A 4AUUA 4P3CL 1T6BX 4N2CA 3EXLA 4U1SB 3ZT6A 3CFQA 1AKJB 2PXYA 4KVNL 4H8VA 4NOBA 4PTTA 4FADA 2DQUH 2IVFC 4ZG1A 3CZLA 4M1DL 5GIRA 4KQ3H 2ADYA 3ES6B 3VFSB 1U8HA 2NX5A 6PAZA 1JCVA 1T3FB 3NZSA 4F8PA 2C1PB 3EDJA 3UTTA 1TVBA 4Z7OE 5B4MD 1TZIA 2R0KL 4JKNA 2V5MA 3T0EB 2YQBA 1DN0B 1BQLL 1F6FB 2EYSA 3C12A 4AJWA 3K5SA 1OD7A 3MA9L 5FECB 3VRIB 1JWUB 1T5WB 1W0YT 5E2WL 1DQIA 5I17B 1G1YA 3DMMC 3KYOA 1HJCA 4QUOA 4PYGA 3QAQA 3QUHA 4IEFB 3GMPB 4LRIC 4KTEH 2MOVA 4L3EB 5TQ0H 1OM9A 3QUZC 1TQSA 4H40A 3LQZB 4ZMZA 3RZCC 2ZUWA 1XB3A 4CNIB 4WWKC 4P4KC 3G6JF 1QSEB 5CJXA 4RH4A 1IAIH 2XWDA 2PTUA 4LMQI 5AZ2L 5HI3D 2FWUA 5MP6H 2DQGL 1VFUA 2M2DA 3DRTB 4GAGL 4GEJA 4G8FB 4OGYH 3GB7A 2XFXA 1BVLA 2IGLA 4MTMA 3NPSB 5C2BL 4YXKH 4HG4J 2YSSA 2VL5A 5EO1A 3CN2A 4AW4A 3T4AA 2X2YA 2JB5H 4KOCA 2E4FA 4IKJA 2BRQA 1U8JA 3ZDXB 1JYXA 2HJFB 1FL3B 1IZJA 1TJIH 3PAUA 3N50A 1COBA 4P2QB 1CK0H 3OAZH 1CFMA 1UA6L 3M88A 2D4FA