2IWEA

Structure of a cavity mutant (h117g) of pseudomonas aeruginosa azurin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGGSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
molecule tags Electron transport
source organism Pseudomonas aeruginosa
publication title Click-Chemistry with an Active Site Variant of Azurin
doi rcsb
total genus 29
structure length 128
sequence length 128
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2006-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2iweA00
1L9QA 1SF5A 3FSVA 2GBAA 1W6LA 1N70A 1BQRA 1PMYA 4G7SB 3SBQA 1GYCA 2YAMA 3WNJA 1SNRA 4YSDA 2X88A 5B1AB 1GY1A 4NB7A 3TA4D 1V54B 4A2DA 3ZX1A 1CURA 3FT0A 4DP9X 2VW4A 3FQYA 4KOCA 2GC7C 1IUZA 2VM4A 2Y69B 5I6MA 1J9RA 1OE2A 2YQBA 2XX0A 3ABGA 2FTAA 1PF3A 1ILUA 1SHWA 3ASNB 3NSYA 5AKRA 3PAUA 1X9UA 3UGEA 1PLBA 4DP6X 3FYEB 1NDTA 1SFDA 2W88A 5PCYA 1SFHA 4MFHA 4DP4X 3QJVB 4DP5X 2BWIA 2OV0A 1JOIA 3GDCA 2FQFA 1GS8A 3IN2A 1X9RA 3QJTB 3T6VA 3FSAA 2I85A 4GY4A 2FQEA 3AZUA 1AR1B 1WS7A 3C75A 3DKHA 4NERA 4YSAA 2YAFA 3ZIYA 3WKPA 4E9TA 4F7KA 2LLNA 4BXSV 5F7AA 7PAZA 3N2JA 1KBVA 2YAPA 1AZUA 3UAAA 2DV6A 4DPBX 1J9TA 3IBOA 4YSSA 1ZIBA 2XWZA 2EIKB 1L9PA 4HHWA 1IBZA 1IKOP 4DP1X 2P80A 1JVOA 4GP5B 3ZDWA 3NJFA 3S3BB 4A2HA 2PP7A 4P5SA 1J9SA 2IWKA 3TASA 4K9JA 5EHFA 3PAVA 3FSZA 2HRHA 1PCSA 5B7FA 4KNUA 1M56B 4E9YA 4BXVA 1J9QA 2ZONA 2XUWA 3AG3B 1QNIA 5A7EA 4E9WA 4UAHA 4BK5C 1AZRA 2NRDA 3IN0A 4JHUA 4W1TA 3T71A 1WS8A 3NJMA 2Y1AA 5B3SB 5I6LA 2I7OA 1JZFA 1JZJA 1OE3A 2CAKA 3X1EA 1I53A 3AG2B 3L45A 2FT8A 4G72B 3H4FA 1BQKA 3V9CA 1AAJA 4AKQA 4EF3A 2GIMA 1NPJA 3MBWB 1YLBB 3OQRA 3AG4B 3NJKA 3NJHA 1AZCA 1ADWA 3NJLA 4FA7B 3TBBA 3FPXA 1PZBA 4UANA 1FA4A 1BQ5A 2IDSA 2RACA 4DP7X 3MX0B 4BWTA 3FU8A 2UXFA 2VM3A 3HEIB 4M3HA 2AZAA 1BYOA 1BXVA 1QHQA 1SDDA 2QDVA 2FQGA 2Q5BA 3BQVA 2VMJA 3S3DB 3JT2A 3X1FA 1AG0A 4PCYA 1KBWA 3X1NA 2J5WA 2XVBA 1AIZA 2OCCB 4E9QA 4YSRA 3UADA 4E9RA 1VLXA 2FJSA 2IDQA 1NIDA 2BO0A 1KDJA 2YXWA 2PP8A 3X1GA 4DP8X 2BW4A 2TSAA 2VSKB 3PLYA 1E65A 2W8CA 3GYRA 4YSTA 2IAAC 5I5JA 3WNIA 2AFNA 2BW5A 3CVCA 1V55B 2YAQA 1KDIA 9PCYA 1AANA 3S3CB 1M9WA 3OMIB 1XB3A 4GP8B 2PPCA 1JVLA 2GB2A 4HHGA 1RCYA 4TXVB 2IDTA 2PPDA 2FQDA 2A3TA 4HIPA 1CUOA 3WI9A 1MG2C 1ZPUA 2AZUA 4G71B 3RYMA 2YAHA 2B3IA 2UX6A 2ZOOA 5TK2A 2DWTA 1SJMA 4A2EA 1OE1A 2PPAA 1SHXA 1URIA 4L0PB 3SBPA 1F56A 4HZ1A 5IY5B 3X2QB 4HCGA 3H4HA 5I5MA 2DY2A 1HFUA 4G7QB 3IEAA 3NJJA 3WG7B 1ET7A 2ZWNA 5FC9A 3NSFA 4YSUA 4WKXA 5I5IA 1E5YA 1PZCA 1MG3C 5AFAA 3UABA 1NIBA 1GSKA 4A66A 2HX9A 3S8FB 3QQXA 4UF7C 1BXUA 2E86A 3FS9A 1A4BA 5I6OA 1L9OA 2J57A 3NP4A 4YVUA 4G70B 3SBRA 4QKTA 1E67A 3FSWA 2DYRB 3NJIA 3T6WA 2H3XC 2FWLB 3EH5B 1BYPA 2UXTA 4KNSA 1TKWA 1GW0A 1AACA 3QJSB 1OCZB 3OM3B 2FT7A 2CALA 1AOZA 2R7EA 4QLWA 1E30A 5B1BB 3PCYA 2X87A 2P80D 1GR7A 3PXLA 1ZDSA 2PCYA 3AW5A 4N4YB 3PAZA 5D4JA 4YVNA 2CBPA 1J5CA 5PAZA 1JXGA 2XLLA 2EIMB 2IWEA 3FU7A 1XMEB 4YL4A 1BAWA 2B08A 1EHKB 3FQ1A 2XV2A 3EHBB 4Q89A 2XXFA 7PCYA 3S8GB 1T5KA 2QT6A 5I28A 4BWUA 4DP0X 3OD3A 1ASQA 2R7EB 1EZLA 2MTAA 1BXAA 2PP9A 1SF3A 4RH4A 8PAZA 2PPFA 1DZ0A 2JKWA 1NIEA 1ASPA 1NZRA 2AVFA 3FYIB 4E9XA 1NIAA 1WA2X 3H56A 4G7RB 4ZK8A 3QJRB 4A2GA 1A8ZA 5B1KA 4GXFA 3JTBA 4F2EA 1L9SA 2PCFA 1A3ZA 2HRGA 2XV3A 6PAZA 2J55A 1AQ8A 1W6WA 2IWFA 5E9NA 4KO6A 1BEXA 4KO9A 3IE9A 3ABLB 5B7EA 3TBCA 1AS8A 1IC0A 1W8EA 2YARA 2YXVA 1ZIAA 2H47C 2UXGA 1AZBA 4FAAB 3KW8A 1L9TA 2GSMB 4P5RA 3D12B 3NP3A 3PPSA 5B7MA 4YSEA 2XV0A 5F7BA 4DPCX 1OF0A 4Q8BA 2TSBA 1GS7A 4AX3A 2JXMA 3HB3B 1PLCA 2MRYA 1TEGA 4X4KA 5I6PA 5TK4A 1PLAA 4JHVA 1FWXA 3FPYA 3CDZA 4AI7A 3WKQA 3X1BA 2GC4C 1WA0X 1PZAA 4N8UA 5D4HA 3NSCA 2ZXWB 4KO7A 1RZPA 2PPEA 4KNTA 2J56A 2DYSB 3FU9A 1B3IA 2EIJB 2VN3A 1ZDQA 5I26A 4HCIA 3QPKA 1MZZA 1ID2A 4KOBA 1JERA 1WAEA 3ABMB 3UAEA 4GYBA 4HAKA 1MDAA 4ENZA 2WSDA 2HZHA 3WIAA 1QLEB 5I6KA 3CDZB 2BP8B 4YSPA 2H5UA 3ABKB 2GHZA 1ET5A 2WO3B 4HCFA 3SQRA 1OCRB 2QDWA 1JXDA 1KV7A 1WA1X 1J5DA 2XYBA 3QJQB 5B1JA 3AG1B 3DIVA 2I7SA 1ETJA 4BWWA 3NJNA 2EILB 2BP8A 2IDUA 2WO2B 3DTUB 3NJGA 5D4IA 1RKRA 4AZUA 1OCCB 2BZCA 3NSDA 1IBYA 2FNWA 2XX1A 5B1JC 1KGYE 2XXGA 3KW7A 4DP2X 3N55A 3BVDB 4YSOA 2BZ7A 3NYKA 3EH3B 4BDVB 1AS7A 1CYWA 3ASOB 3FU7B 1PNDA 1AS6A 2EINB 1KCBA 4YSQA 3AY2A 2IH9A 1N68A 4DPAX 2CJ3A 5ANHA 3U25A 1A4AA 2UX7A 2CCWA 1JZIA 2GI0A 2UXVA 1MZYA 1NWPA 2QPEB 2IDFA 3CVBA 2XU9A 2Q9OA 3GXUB 1CYXA 3NT0A 4AKOA 1AZNA 4A67A 1PY0A 2HX7A 4AKPA 4W9ZA 4WTQA 1JXFA 1NPNA 1XB8A 1GY2A 1ZV2A 1JZGA 1OV8A 1AG6A 4YSCA 1GS6X 1OCOB 1A4CA 1ET8A 2PLTA 1RZQA 4CSPA 2VW7A 3CZUB 1OOWA 4A68A 3T6ZA 1HAWA 1NIFA 2BWDA 3G5WA 1JZHA 2BHFA 1FFTB 1M57B 2DWSA 1JZEA 3ZBMA 4NAJA 4GP4B 2YAEA 4CSZA 3T6XA 1PAZA 1ILSA 1TEFA 1PNCA 1NTDA 3CG8A 1NINA 3T9WA 1NWOA 1UATA 4KO5A 1HAUA 2BP0B 2FT6A 5AZUA 1TU2A 2AANA 4E9VA 1A65A 4A2FA 3FQ2A 1NICA 5LDUA 4F2FA 1E5ZA 3EH4B 1KCWA 4M4RB 1XB6A 3CVDA 1CC3A 2HXAA 3V9EA 2HX8A 1DYZA 3ERXA 1KYAA 5I6NA 2IH8A 2VW6A 3EF4A 4PAZA 2VSMB 2CUAA 1L9RA 3UACA 6PCYA 2JFCA 3QJUB 2HLEB 3OMAB 2BP0A 2QPDB 4JKNA 1SDDB 1R1CA 1V10A 1ASOA 3TU6A 4E9SA 4BDVA 3OMNB 2YAOA 2OJ1A 4HALA 2N0MA
chains in the Genus database with same CATH superfamily
1YMMB 1UB6A 5DMYA 2FX9H 2ZX7A 1QFOA 4QIRA 1D5BB 3QSKB 4QHMA 1XEUA 4OSUH 4PS3A 1A7BA 1KT2B 2DIAA 2ITFA 4P3DA 4PRID 1WAAF 2CDGB 1MCLA 2W9LA 1HIMH 3VW3H 1FYTD 4ODHH 4JANB 1WF5A 3EFDH 1E6OH 4QWWD 4S1DD 1PS3A 3P2BA 4HMDA 2WTOA 5E4EC 4X9BA 3NEEA 1X6LA 1ILUA 3BH8B 1KN4H 4Y5YA 3UGEA 1UB6B 2PYEE 3HC4H 4X8XA 4W93A 5DUBA 3FYEB 3MJGX 4LEXH 4IOFC 2DKMA 4QXWA 2X9ZA 3M8OH 2WOYA 2BWIA 2W94A 3K1KC 5J7CC 5B8CC 3KXFB 2D8KA 2Y2TA 4K71C 4NGHH 3NCEB 3OR6B 4FQCL 1ODUA 4GAFB 4WVRA 5HI5D 4DGWC 1QBML 3SOBH 1KBPA 5KJ4A 4QCIB 1FCGA 3A3YB 1JI2A 3OZ9L 3P4OA 3QXDB 1MVUB 4MNHA 4R3SA 3ETBF 1XAKA 2UUDH 4JM2C 4QT5B 3SGDI 3W5NA 4I85A 1VFMA 3VD0A 4UU9A 1MH5A 1KBVA 1JP5A 2VXQH 1BJ1H 1QRNE 3FO2A 3FHEA 1KXTA 1FZKB 4QTIH 2OXHA 5FIEA 4N22A 3L5IA 5LCVA 4YDVA 2EIKB 4K8RD 3VGDA 8FABB 1PBYA 1ZS8B 2O6DA 4JG9A 5E5LA 2HVJB 3MUUA 2L4OA 4JPKH 5T5NF 1BIIA 4OFKA 5GS3A 5I1LA 3RKPA 1F90L 2N1TE 2XHNA 4KH2A 4R3SB 4ZUVA 3UZEC 1AO7E 3ZUNC 5HHQB 2VUKA 4LPXA 1MI5D 3U82B 2NYKA 2H4EA 3DX7A 3APNA 2EICA 4O02H 4DAGH 2OMUA 1M56B 2HCZX 1FIEA 3KYNB 4CVXB 1L4IA 2EYRB 4U3HA 3JZYA 2ALAA 1S9YB 2F58H 2LR4A 1KGIA 2Y1AA 2OTWB 4MLIA 3BP6A 2DQGL 4X6CE 1G5AA 3U2JA 3X1EA 3TLRA 5I73B 1ZWIB 1ODAA 3PQYE 5EU4A 4ANXA 4JG1H 4NI3A 1O0VA 1Z9NA 2OSLA 1BQKA 4XH2A 1GVIA 2LHAA 2C9QA 4KVNL 2H0FA 4EN3B 3OQRA 4P23B 3VFWA 4U33A 4JQVA 3ZKXB 3NJLA 4FA7B 1KPUA 3CFDB 4P2RA 3OV6A 4DP7X 2ARJB 3WUWB 3KVQA 3FRPA 3L7EA 5L6YL 2J1ZA 1KB5A 3MLVL 1F6AA 1NOAA 2HWZH 3ISYA 2OP4L 3AJ7A 5BZDA 2QDVA 4JEGB 2YN5A 4HUWA 5CR8A 4BFJA 4L9LB 4LLYB 5FDWB 3RWDB 4V2BA 1WZKA 1ZSDA 3JT2A 5LBGA 1CICC 1E7VA 1ACXA 5CSZB 4XT1C 4MBOA 3QH3A 4YSRA 3V5KA 1GA2A 4FMFA 3QNYB 2IQAA 4JB9L 3QCUL 1JS4A 1SXBA 4NQED 1NA8A 1L6ZA 2VDRB 2TSAA 3I50L 1PSKL 3SDXE 4AYFB 2F54E 1PZUB 5KSVB 5C7XL 1FLTX 2AW2A 4W70A 3D5OF 1XB3A 4RBPH 5CHNB 2UZPA 2AGJL 3OF6A 1DTUA 4LCCA 2Z7UA 1CIDA 3T0EE 4K15A 5DHYB 5IGXL 2YUVA 1E4WH 2Y5TA 1FN4B 3RPKA 3VYNA 4YZFF 1UT1A 5D8JL 4QRTB 4FQJH 3MLWL 4JKMA 4RGNE 2B3IA 4NUJB 5CF3A 2DWTA 5CD3B 5EFIA 4Y2OA 5J06A 2X3CA 1CS6A 2VLLB 1EVTC 4RETB 3UEQA 1P1ZA 3VFSB 3DVNA 3ESOA 3ULVE 1I8UA 1GGBL 2DZEA 2EYSA 4U1IB 3IDGB 4BJLA 5C0JB 3GO1L 4KHXH 4RQQB 3ZE1E 2J8UA 4MJIE 4DKDC 1FLRL 1O7DE 3UJIL 4AQ8C 5GRUH 3S37X 5D2NA 3EBHA 1AO7B 4PCKA 4K73A 1HOCA 1RXLA 4XP5H 4XN5A 4Z76B 1HEZB 3UBGA 2V17L 3UBXI 2GJPA 4JZOA 4OLEA 3LSOA 1NUGA 1BPVA 4P2OB 1D9KD 1BXUA 3ATDA 3AAZB 2DQIH 2X89D 3ZDZF 3V6ZA 4ZI8A 2J8UB 1IAOB 3DPBA 1KTJA 3JV5A 1L3WA 4N8PA 2XN2A 1E67A 1GPOL 4CILA 3T6WA 3B2DC 4CAGA 2HVKB 1P5UB 3VFUA 1S7TA 3CVHH 1HQ4B 2WUCL 3SKUD 5LG6A 1OCZB 1NDMA 1RZ7H 1V05A 4MD4A 1J11A 3FTUA 1M53A 3EH1A 1NLBL 3T2PA 2BNQA 4XMZA 5BUAA 1L6PA 4UTCA 5GJSL 5DD1L 4LMQE 4OLUH 1E8ZA 1DCLA 1B90A 1SOKA 3MJ8B 4XCNA 4UB0H 1RULL 3QFDB 3GI8H 2XLLA 4OGAC 1SOSA 4PY7B 2WJ7A 5T5FH 3UX9B 2C9XA 2Z34A 2PR4H 3S8GB 3MLXH 4LK4A 1S5HA 3ESPA 3GLZA 5DVPA 2G5BA 4MXQD 5B39A 3PWLB 4AXWB 4RH4A 8PAZA 2W07B 3EJYC 3ZYZA 1CFQB 2ADIA 2X44D 1H8NA 4MRCA 5HHMD 4HUMB 3FYIB 4OFVA 2GFBB 2A6JA 5CO1A 4ZMAT 5I8KH 3S96A 4AYDC 3SDDC 2ENJA 1NGXA 1R0AL 3KLAA 3DYPA 2WWKO 4PCTA 2CGZA 3AADB 2P24A 5GJTH 1L9SA 4V33A 1QSFB 3GHBH 2IO5A 4HAGA 5M95B 5E8EA 5FV1L 3WEOA 3E8UH 3QFJB 2NW2B 2WLMA 3KDMA 4M62H 1YEIH 2J2ZB 5IW3A 4F33B 1UWFA 1RZKH 1AS8A 4O02A 3LQMA 5HHMB 5IBUG 2V2TA 4HHAA 3F6IA 1SUHA 4OGQC 5EZOL 5ACMA 2LAAA 4O2CA 2A0LC 3LN4A 2OMXB 5JZ7D 4NAMA 4ANVA 2WVUA 1MWAH 4LLQA 4PJ9A 2X1XR 3RKDD 4WIQA 2C9RA 4FFYA 2R56L 3MNMA 3B9DA 4OF8A 4PYGA 1DDHB 1OF0A 5KVFE 3O2DH 5L4JA 2R29L 4L0ZA 1QI3A 1U92B 4FJYA 1JGUL 2RAMA 1EK3A 2PW1B 3ARZA 3N91A 1U3YA 3FN0L 2OKMA 2ZCLH 2PETA 1PLAA 2OR8A 1X5YA 3PFUA 3S34L 3L1GA 3MNWA 1TVBB 1FFOA 3V4VA 5FKPA 4OZIF 3H9SA 3RVUD 1DBMH 1WBYB 1DVZA 3T3PE 4K7PX 5DC2A 4HCRH 5K1NA 3MRCB 4QXGH 2AJSL 1IKFL 2XVGA 4JE0A 5DEFA 5E2UL 3TT1L 3CMOL 1WH0A 4JFYB 1W0WB 3QI9C 5CKGA 2RTTA 5FFOA 4R8WH 2H6PB 3TL5A 2JV6A 3TESA 2OMWA 2PW1A 1ECYA 4KOBA 5IJKA 1EJFA 2WPGA 2ZICA 2WSDA 3FCUB 5E9DB 3QWQB 5IF0B 2AMGA 5JO5B 5SV4A 1K6QL 4W4OA 4YQXL 2XWXA 1XF3A 1ET5A 4E5XA 5KANG 2OMTA 1QR1B 2OMBA 4LBEB 2QDWA 4XNQA 2JJVA 5DEFB 5MEOA 4PVLA 3AG1B 3IWVA 2QFRA 1IE4A 3UTPE 2XZQH 2IDUA 4TUJB 2B3RA 1VEPA 1WUNT 3OG4B 4WNSA 1P7BA 3WJLA 3QG6A 1UXSB 3GSUA 4MXVE 4D9QE 3F7YB 3OSVA 4PJ5B 3CZLA 1IBYA 1D5ZB 4M7JL 5JO5A 3KW7A 3N55A 3T3ME 2WAQA 1NBYB 4XO8A 1K3ZA 4AW7A 4UTAH 1AQDA 2V6HA 1JFQL 4JFZL 3S37L 3DK0A 4RRPG 4UOZA 1UQSB 5T1KB 2WLIB 4IIQB 4D0BB 4LDOB 4OZIA 2CJ3A 3FTSA 4BZ1H 3UTSE 3ARGC 4PRBB 4X7DC 2R2BA 3WFCH 3ZTNL 1WVZA 3PGCB 5HYJD 3HG1A 4Y1AA 1AKPA 3B43A 3B34A 2BVOA 3GXUB 4WSKA 5KVGE 1FLRH 4RGMB 3QFJE 2WYHA 1SXNA 2YMXL 1HE8A 5CZXC 4H8WL 1BGXL 3GIZH 4G42A 3GO1H 4KHXL 2LAGB 5SX4I 3ZDYE 1XGPB 4ZO7A 5GZNA 1S7QA 2A9NL 4FFYL 4DSYA 1N6VA 4J1UA 3HCVA 4OV5B 2JQZA 4K3JH 1FO0H 5CD5D 4KJYA 1M3JA 3ZZLA 4MVBC 3NJXA 1EFQA 1EJOL 4HV8A 1CF8H 4LHQB 4P0DA 4G6KL 1N18A 2YA0A 4ZQKB 2OYPA 1FJ1B 4J6IA 1OOWA 3PGCA 4YXKL 1CTOA 4UIKH 4LOVA 3ILQC 3RWCA 1KYUA 3RWGB 3HNSL 1S7VA 1A7PL 1Q9LB 3FT3A 3NIDB 5DQDL 4WGVB 4HPHA 4RVBA 5DUPL 3VFGH 3ZBMA 1NMBL 2GT9A 2YAEA 3HRZA 5ESVB 1WFNA 3WFHA 2LGNA 1F1GA 1NTDA 4EDXB 1RQ5A 3BO8A 3DMMC 4OLVL 2WZPA 3EYSL 4M5TA 4R7DA 4QYOA 5IVXA 3UXFA 3G5YB 4M7KH 2RQEA 1T66D 4KC3B 4MX7A 2XQYA 1MAJA 3D06A 2WINA 3FUMA 3CCHB 3LXBA 4G8FB 4OCXL 4X7FC 3J8F7 4PGDA 4MJ6B 5FOBB 3MRRB 4NRYA 2OZ4H 4J8QA 1NAMA 1KYAA 5I6NA 4PRIB 4AC2A 3FT3B 3VD7A 5DJ8B 2DJUA 4PJBE 4NUMA 4N3UA 3OGCA 3UACA 5CJBA 1D5MA 1LQSR 1SVCP 3VFNB 4N6RB 3VWJD 4HJSA 3OMAB 4L9DA 4YE0A 4A38A 5LNGA 4OIBA 3QZOA 1FGVH 1G7LA 3REVA 3X12B 4PSRA 3C60B 1VZGA 3BGMB 2DWDB 3MLUL 3N50A 4AIOA 1L9QA 4NRYB 3ZTJH 2X5PA 1N70A 2RQ8A 1PMYA 2XJKA 3H3BC 3WTVA 5DVOA 4XP4L 4MCZB 1IFHL 5IHZB 4YHNB 1UWGL 2HT2D 2WZ6A 1KYFA 3T3MB 5C71A 2BCKA 3KXFD 1QASA 3WU1A 1LE5B 1MFDH 3M1BB 2Y69B 4U3SB 5I8OH 4Y0GA 3KPRA 3VQ2C 2VDQH 5JXEA 5KSBE 5J9PA 3GI9H 1Z2KA 3TBTB 1NSNH 4Y16A 3I75A 3O2DA 5HPOA 2JK5A 3QQNA 4UV7L 5ECGA 4U05A 1BF5A 3K2UH 4ZUWA 2DWEA 5KVEE 2Q3AA 5EUOB 1Y1UA 4Y88A 1WITA 4WO4B 4YHYB 3Q2LA 1LEGA 1JTOA 1CZ8L 1T4KB 4KK5D 1NMCB 4ETYA 4K94H 3DVGA 3IS0X 4F7KA 1RZIA 1HZHL 4HJ0C 1HZLA 3Q7JA 1F4YH 4XMPH 3BI9X 4IRSA 1S46A 2QTEA 2W1NA 1NCHA 2KC0A 2V3FA 4X7TA 5D96B 3RL1A 5HDBF 5D7IE 1YNKL 3MACH 1VHPA 2QKIB 1P7QD 1DUYB 3G04B 1T3FB 3SE8H 2V5YA 3GMMB 3Q0HA 3RNQB 1BP3B 3GFUA 1MY7A 1OTTD 3HE7A 5D9SA 2BVEA 1XR9A 2PO6C 4F57H 4OIFA 5CM1A 4DETA 1YN7A 4K9JA 1UXMA 2V7NB 4BHUI 3PAVA 1B2YA 3BUTA 3TWCH 5D7LD 4E9YA 5FOJA 4M9OA 4Y4KA 3CN3A 1CLVA 2OMYB 2VLKD 3DSNB 4E9WA 4BK5C 1AZRA 1WBZB 4BFIA 3B5HA 3CDGB 2FAUA 5I9QC 3TYGH 3IE4A 3GSNB 3H4FA 4FZ8L 5C0CB 4AOFA 5KSAB 15C8H 4GJTB 3LZPA 5TPWH 3PFQA 4R84A 1JGDA 1NPJA 5ALCL 5E7FA 1I9IH 5F44A 2ZOWA 2DQEH 2QGEA 2VLMD 5MEPA 2JJTC 4UANA 4Q14A 4WKZB 1WIOA 5HHVL 2X05A 3GINA 3T08A 2W81C 4NKOA 1GL4B 1L6XA 1LO3L 4F5CA 5EULV 2FQGA 4MS8C 4H0HB 4JN2A 4JY6A 4XNXL 5EOTB 1BVOA 2VDMH 3EF7A 2NDGA 5KBPA 4QRPB 3MRMB 2YPVL 2E3VA 3KXFE 3GRWH 4AV4A 3JWNC 4PCYA 1KBWA 2A74B 3QIUB 4QTIL 4TL5A 3RDTC 1AIZA 3SDDA 5J1TC 5JTWA 5D2NE 4C56E 1XFPA 4UM9A 1FORH 3TT1H 3GJFK 5C0ND 4URKA 4WU5A 5FCUH 1H3VA 3MFFB 4KROD 2IBZY 5C0BD 1OARH 3BJ91 4JREB 1FO0L 5DMIH 2BW5A 4JDZB 4L1DA 1DFXA 1Q9WB 4MTMA 4HISA 4TUKL 3V0VB 4C58B 3FN3A 2Z4TA 3TA3A 2FJGB 2PPCA 1I4FA 2F6AA 3QDMD 1BW8A 3O8XA 1QSFD 1RP9A 1RZJH 2GAZB 2IAND 2VLLA 4WW1A 3CLFL 3LPFA 5EOCH 1A1NB 4CMHC 3R8QA 5C86A 2OAAA 5I8EB 4NJ9L 1B9ZA 1GCYA 4GW5A 2UX6A 4ZX5A 4BZ1L 1A6TB 4A2EA 5DHVH 3RIKA 4ENEC 1EHAA 1FIGL 2NY5H 1PZ5A 3VA6A 1NGWA 2G2RB 4YHKL 1I7UA 2R9HC 3OXSB 3VXTB 3C8DA 2IJ0C 2NYZA 4D3CH 1V3JA 1M7DA 1F56A 1BREA 3KYOA 1LK3L 5DLMH 1HEZA 1FVCB 2VR8A 4G6FD 5JQHC 1N67A 3RTLA 5DZNA 2F2HA 4ABVA 1XTMA 3CFQA 2ZPKL 3IJ7A 4MJ2A 4JCLA 3FQWB 4BCXA 1QUNA 3LV3A 1YQVH 4UOQA 5ISZD 1IAOA 3DPBB 2C3GA 4IK7A 2YHGA 4WNJA 3KL0A 3VXSB 2ENPA 4RAVB 1MFAL 4XPBL 2IIJA 2DAVA 4HT1L 5DRXA 5A2BA 5I1HH 3UABA 2DJMA 4X99A 3GHPA 3HE7D 2UWEF 1BVNP 1W0VB 2E86A 4NGHL 5DDHA 5GS0L 1A4BA 3MBXH 3ULVC 4LMQI 3FO9A 1P4LA 3SBRA 4C59B 2G75B 2AXJA 3QQ4A 5J1AA 5CD5C 1O6VA 2NY6C 2FWLB 1TSHA 3ZHDA 4B9PA 4NQQA 3ARDA 4Y19D 2R0WH 3P3YA 3HC4L 3A6OA 3MRDB 2FEEI 5ID0A 5KBKA 4E9LA 4G1MA 4LF3B 3UH8A 5DF0A 5GHWH 5JPNA 3AACA 3LZFH 2JNZA 5B1BB 5I30H 1TFPA 4ORZC 2FNBA 4GXUM 5EN3A 1NOLA 3DUSA 4YC2B 1GR7A 3HVDA 2PCYA 4M6MH 4O58L 4FQIL 4R0LA 4EXPX 2WB1A 4ICWA 1A14L 4OAWA 4KWUA 4RNRB 3JVFC 4XN1A 4YMPA 4CMHB 2KDYA 2R69L 4UNTA 3JWNH 3O4LE 4JFFD 1ZLSL 1EPFA 3W82A 3VA2C 1VGKA 1YHPA 1PG7X 4QXTA 3UTPD 3MOAH 4KJPD 1IVLA 2AXFA 1U3HC 4MQTB 4OJFL 5F6IC 3TH4T 3HZYA 2GW5A 4Y9GA 3B2XA 2J2ZA 2CM6A 4PREA 1V7NL 2QPUA 3CK0H 3T1FA 2ADJA 4G8AC 2NNCA 3BD3A 4GQQA 4I2XB 4HIJB 4TUOA 3W9EB 4PJGB 1MCPL 4Q0XH 3LRSA 4ODSH 2CGYA 4HMEA 5EBWB 4RFOL 5GJTL 1IEHA 1IIKA 1WUZA 1WFUA 2R1XA 4OCYH 1BX2B 3CFJA 1NC4D 1IC0A 2YXVA 1ZIAA 2K4AA 1VA9A 2MOQA 3ES6A 3MLTB 4JUSA 3GTNA 1KXQA 2CGRH 2ZCHL 1KJ2L 3PGFH 3RWEB 4H40A 4J2QA 1BV8A 3BP5B 3D12B 1ZLSH 4MWFB 1U8NB 4ZOBA 4LP4A 3ULUC 3O11A 1OAQH 1G9NH 2EDXA 2F5BH 3DMMA 3EYUL 5AWNH 3D2TA 3SO3B 2XXMB 2VN6A 3H9SB 2A73A 3ETBJ 2H3NA 3FJTA 1G5GA 4Y2DB 3DTDA 5D8JH 1A9EA 1XSKA 4P4RA 2E6QA 2ZKHL 2FX7L 3LNFA 1KLFA 2TSBA 4U31A 1IAKB 1IM9D 4F8PA 1JTPA 4AYEC 5EBWA 2IMMA 3QORD 3QULB 4I0PA 4JKKA 1C9SA 3V0EA 2Y07H 2NY0B 3L9RA 2GABA 3PWJB 3RL2A 3C6SA 2BNUA 5DZLA 4X5LA 1Z5HA 1CVSC 4MQ7B 4B95C 1FH5L 2X4OA 4OLYL 2DWXA 2AK4A 3B2UC 1WWWX 1WWBX 1B3IA 1ETB1 1E3FA 2CRYA 1N7MH 2EIJB 3MCLH 4TTDC 5CGYC 5GRVL 2A73B 3W0WD 3QYMA 2AEQL 4IM8A 4XP6H 1AC6A 4E42B 3IJSA 3ZKNC 2P8PB 4CN1A 1X5JA 3SKMA 1EFXB 3SPHA 5KVDL 5B38A 4LKXB 4FXGB 5HXMA 4XVSH 4MAYA 3C6SB 2DOCA 4EBQL 1E4KA 4YSPA 5F0MB 1OP3H 4AYBA 5C2BH 4CN4A 2WNGA 3F7YA 3JWOH 3ZO9A 1JXDA 1TTCA 1UXWA 5H94A 1E8WA 1RJZB 2PXYC 4WHDA 3B9AA 5JR1H 1ETJA 3HC2A 1UCTA 2VXTH 3MGTA 1I1AC 1YEJH 2Z7ZA 3NJNA 4FN0A 4BKSC 3BSHA 1SMOA 4MNGA 3HBZA 1KB5L 3DTUB 2VISB 4F37F 3QT2A 3WNLA 4AZUA 5IOPB 4JDTH 2XG4A 3ZYOA 4PJAF 1Q0YL 5AVSB 3PYCA 1K9TA 5D1QD 2ZUSA 3S4SA 4Z7WF 4I3SH 5DK3A 1QFUL 3OPUA 2I24N 3EH3B 2OSWA 3W3BA 4YHZL 4BRJA 1AHWB 3FU7B 5I15L 4P59L 2BNRB 4K7PH 4RGOH 5D1QE 5IMKA 5BZWB 2FWOA 1I7ZB 4X7SL 4G42B 2BXZA 2P7TA 2WZ5A 3F2LA 1M2OA 3RHWK 3FO1A 3T8VA 4DKEL 1GXEA 1DHKA 1NWPA 3MRKB 2IDFA 2CLVB 3NRQA 1GCFA 5EOQH 4KVPA 4AKOA 2BMKA 1AZNA 3PDOA 3RWJB 2EYTA 3FT4A 5BO1H 4RAHA 3QDHA 5I1DB 1EAOA 4NRZB 2XTJD 1E28B 3AU1A 3BW9A 3FUKA 4HBCH 2BJML 5B8CA 2BNRA 5IMKB 1JNLL 1DVUA 3O9WD 3WEAA 3CH1B 1DVXA 2G5UA 4XO4A 4NRXA 3H9SE 1U8IA 2GKIA 2FHFA 1IKNC 3L4ZA 4A68A 3GSVB 2EXYC 2BDNH 3N1MC 1Q0XH 4XMXA 3ZE2E 3OPZL 4JFPB 4MX7B 5FX3A 2AQRA 4G5ZH 3T8XA 5I0WA 1C16B 5I73C 35C8L 2DWYA 4X4YB 5IHBA 1MCWM 3Q3GB 1AGDB 1OF2B 2X4PB 4EN3C 4K0OA 2IQ9L 3I6GB 3NPSB 4N1HB 5IG7A 4ODVL 5DMIL 5HJDA 2XN1A 1THAA 1A65A 3NK4A 1GGYA 2BVUA 3P4NA 3CH1A 4TPRL 4PJCA 2W0FB 2O93L 5CP7A 2PMZA 2EQDA 3GSVA 1B0GB 1G7LB 4P2QD 2VLKA 2XXCB 2F54D 3B9EA 3ZKXC 3L5WB 1CFSB 3D05A 2QPFA 4KTEH 2CUAA 4TVPD 5IKCA 2H9GB 2ZNWA 5BOPA 4JGJA 3GEWB 1U8OB 4KPHL 4GI6A 4AGQA 4JKNA 2SEBB 2PYFA 1NCCL 2EVJA 3AQDA 5HYSG 3S35H 1FNAA 5F0PB 4BDVA 4CC4C 3Q6FA 2JMRA 2WNKA 5SWZD 3L4YA 2W60A 1J86A 3GSXA 4Q6YA 3KLKA 4W81A 1DE4B 5HPMB 4GUOA 1ULVA 1EZSA 4UT9A 2NX5B 1KXQE 4DKFH 3CXHK 2FIKA 4JMNA 4KX7A 1SYSB 3IBEA 4CADA 2P43B 4LPUA 2HFGH 1UA6H 4LSPH 5L88L 3MRPA 1U8OA 5IP4A 3OG6B 1L3NA 4M1CC 3X13A 3BXNB 1GC1C 3LNDA 2A99A 3BRGC 4MA1C 4MS8D 2YD8A 5AKRA 1N3NA 1TO5A 2ARJA 2P5WB 3WUWA 4DP6X 2X1QA 3MRFA 4AY0A 4G6FB 2ZXBA 3D4ZA 3IDNA 2FR4B 2G3XA 2XY2A 3QXDA 4WEEA 3VW3L 1HIML 3C5ZD 1Q1JH 2DQ6A 1DN0B 3QDGE 2FQFA 4R26L 4UU9B 3DOIA 2IANB 4LSVL 1E27B 1IC7L 3MACL 4G8GB 3C75A 4NSKA 4U6YB 2WBWB 2F7QA 1FCCA 4AQOA 2AS5M 2P8MA 3BVNB 3QNYA 2YC1A 2VQUA 4E9TA 5D7KD 1IAMA 3IFLL 5DK0B 5D70H 4I3RL 1F42A 5HHNB 4PWKA 5A3ID 3KXFA 4FKEA 4ZO9A 2OA9A 1ML0A 4DEPC 1KXHA 1CD8A 5B21A 1HILA 1SLUA 1M1XB 3RP1A 4I1RA 2NSXA 1KG0B 2DDQL 4LCCB 3T0AA 2VLJA 5J6HA 3KL3A 4TQIA 2VDLH 1K8DA 6FABH 3UGUA 4AIEA 1KN2H 3APDA 3NH7L 4TN9A 1QNZH 2XWDA 3AWFA 4AITA 3WTYA 4KX8A 1KYOJ 2VXQA 1D9KA 5EF0A 4XXDA 1IMHC 2XA8L 4XOAA 4I0KA 4R7LA 3RB7A 1ZTMA 4DKEH 5L2JA 4OCWH 4GXVH 3N0PB 4X4XA 4ZAKD 5CEZE 1PX3A 3TASA 2Z1PA 1HE7A 5H4ZA 4B9GA 1U42A 3LKSA 3KVPA 4HD9A 3STZB 5C0GB 1WD9A 4NKIL 5TE4H 1XGRB 5A7EA 3MJ9H 2DBLL 4WAFA 4OCYL 4HH9A 3RIAK 3RI5K 3DI3B 5BPPA 3NFSL 1H6TA 1I53A 4G72B 1WICA 1QFWL 1KB5H 5D2LF 2FATL 2V5SA 2FRGP 4PJ7F 1MN4A 4ADJA 1HYSD 2BY2A 3QJHA 1ORQB 3L4XA 2WWMC 2Y25A 4OLYH 3ABZA 5EZLA 1G4RA 3APFA 3EFOA 5AAWA 3B2MA 4YWGH 3LSOB 2ARJQ 1UJ3B 1CZ8H 1PZBA 5GZOA 2RACA 4JLRB 5TE7H 3FU8A 5EU4B 1AP2B 1KCSL 3HEIB 1WFMA 4XP1L 4OGXL 1MHEB 4IOSA 3V8CA 3REWA 1G6RL 3DHPA 5EOQL 5E6ZA 2M26A 3W0WA 3BZEB 1HJCA 3ALPA 4U1LB 4P5MA 1DO6A 4M6OL 3DUHA 4ZX6A 2X4SA 3MLRH 3MA9H 5IQNA 3U9WA 4OZIE 2AQ2A 4EN3D 4DHLA 4YBHA 1EJOH 1YRKA 3RWFB 4L3FA 3BDBA 3K5SA 4G3YL 1NIDA 2BO0A 2B2XH 4GKZA 5DTFB 5BRZE 1FL5A 1SBSH 3KPMB 3VDAA 2BW4A 4WJKB 2X2YA 2WCSA 3L81A 3RWDA 2WN2A 4RFOH 2MCMA 5ERWA 1NGYB 4GRLB 4JDTL 3MMEA 4DIXA 5T1MB 2FATH 4WHTB 5IROC 1MAML 5DFVD 1SY6L 5IQ9A 5E51A 4G8GE 2PPDA 5IQLA 3UJTL 3UPRA 2FX7H 3FQNA 1HKFA 4Y9CA 2XTJC 3INOA 1G9ML 4PJEB 4GKZB 5DTFA 4UQ9A 2ZOOA 3BHBA 4CJ0A 4PJ7A 3V4PA 1KCRH 4H8VA 1URIA 4I0PC 1XF2B 4XVUC 3DGDA 3MV7A 5DURD 2X4RA 4CU8A 5SWSD 1UACH 5ICZA 2IAMB 3MAWA 4JZJB 1BM7A 1D5IH 1NCBL 3QK0A 2NYYD 4QT5A 5GIRB 3UPRB 3LS4L 3FQNB 2AABL 4J3OF 2A38A 2VQ4A 4M1CD 1YAIA 1SUJA 4PJ8B 2VXUH 3I84A 5E2WH 3BHBB 4LRNH 4RQQA 2WXGA 1BQSA 1AKJD 1Z5LB 4GW1A 1K6QH 4N2AA 5AFAA 2XWTA 2NY2C 4OCNC 4A66A 3V79C 1IGCH 4K8RL 3VUAA 43CAB 1QG3A 5C0DA 3C5SA 1FNSL 4YPGB 4JKWA 3SY0A 4WFGE 1A7PH 1P9MA 1YMHB 5DQDH 3WDIA 5JORA 1L9OA 3ZT5A 3NP4A 1U93B 5DGRA 3NJIA 4ZYKB 5E2VH 3EJUA 1SMDA 3BKML 3ZZSA 4ANUA 3OC8A 5IB5B 3LXUX 4GLRI 4NNXA 4XPBH 3T4YA 1AOZA 1CTMA 4ZMWA 3TFKD 3V5HB 4X6BA 4L3ED 3KYKH 5BRZA 5C0RH 2YD5A 3ZKND 2P80D 1KTKE 3KMDA 2DTMH 2NXZB 4DO6A 4EJ1C 3FRUB 4PVMA 4OCMC 4NN7B 1PAMA 2XOTA 1TJGH 3TF4A 3DECA 5F1NA 3UYPB 2ENYA 3CK0L 4ZYKA 4BSWB 2XV2A 3U46A 25C8H 4IU2B 4Q89A 7PCYA 3V0WL 5EC2A 3FQUA 4MMYA 5CILH 5EEXA 1A0QH 2R2EB 4FEMA 1BXAA 3ZRCC 2WLYA 4EIZC 3WJLC 3DVFA 4PJGA 3JWNG 1ASPA 4L9LA 2VXUL 3HC0A 3LKRB 5DJ2B 3QFJA 3CVIL 3GMLB 3KVDD 4HJEA 1NKGA 3HG4A 4ZK8A 5FA3B 2H0JA 5D7SL 1AXIB 5HBBA 2CE6A 1RSFA 5FYJU 5I74C 3BUYB 2YPKA 1PGRB 1BZ7A 1VIWA 2VCOA 3GF8A 4MJHA 5FW7A 5KTEL 5ITBL 4MDIA 5KVEH 1OXYA 5JDJA 3FQUB 3ULVH 5FYKL 2K9FB 3FQRA 3MGAA 5I0DA 3RNKA 5HHPA 4W4NA 1A9EB 4NCC1 2J4WL 4FNQA 4LSSL 4NQXB 2HTKD 4XCEA 5BRQA 2B14A 2VIRB 3HI5H 2HG0A 3PS6A 4PS4H 4X6FA 4PU2A 5D71H 4AYMC 1A0QL 3QDMA 4GPVA 1W80A 4R7XA 3DXAE 2VR6A 3CVHB 1OT2A 5FA3A 4NUGL 2UYLA 5CLTA 3SCMA 4Y1AB 4QRTA 1IEBB 4YSEA 5IQMA 1FVEA 3VSQA 3P2DA 4F33A 2X42A 3QXWA 5J89A 5CD3A 4JPSA 4AX3A 5IQ7H 1H3XA 1R47A 1N2RB 2BOLA 3DHMA 1EFXD 3T2QA 4J1UB 1JHLH 4JFEB 5C0AA 4ONFH 1CD1B 4QRUA 5C07D 2QZ5A 3B7TA 4EIBA 3GBMH 3EJZC 4CVUA 1QTYT 1F4YL 3ZTCC 1CDYA 5B38B 4PJ5D 1SJHB 3RTQC 1FG2B 2BY1A 3MRJA 4WF7A 4NN7C 1ZANH 1O9ZA 4Z3HA 1ZDQA 1AMXA 4XBGB 5J13B 4D0DA 4FZEL 1L9NA 1OP5K 1KZYA 1M4KA 3JYCA 3UZVB 3ARQA 3VFPB 2R59A 1DSFL 1A4KA 3AREC 1D7CA 4JFEA 1F4AA 1JFHA 3O4LB 3QG6B 3ZSSA 1ZOXA 3VM5A 4AC4A 3H9SD 1I9RH 3FFDB 3TONA 3TVMC 1I8AA 1ZTXL 2NQCA 3AQYA 4FQHB 4I13B 5ICXB 4A55A 3U6XA 2DH2A 5BVJA 1MFVA 2QFPA 1XD0A 4XWOD 1GKOA 3CLFH 1VADA 4BWWA 3E7JA 2WAHA 4NOBA 1O6TA 2HG5A 4BELD 3TYGL 2AJYH 3DXAA 2F9BT 3C6LD 4H1LA 1MW0A 3CQPA 4Z7WE 5ICUA 3T2NL 4KKCD 2COQA 2YZ1A 4XP4H 1J0HA 5IEHA 5D1ZA 4KGLA 1MWAB 5AKTA 3HE6B 3NJVA 4MXVF 3VGEA 4ZMPA 1R9FA 2B5IB 3CQFA 3MNVB 3MVSA 4WEUD 2BVOB 4TSBL 3JV6B 4PN6A 2WSKA 5J0BA 3E8VA 4OGAD 1Q9KA 1Q1PA 3F04A 2DEWX 3O2WL 2EC8A 1S7QB 1KLUA 1P0SE 2HKFL 4YS4A 2CCWA 1MREH 4O9HL 5T5FL 4XCYA 4CL7A 5K69A 5BCAA 3O0LA 5LNDA 1V27A 3BN3B 5I82A 5FYLD 4ZW5A 1SEQH 5D1ZB 4NZFA 4PJGE 5CNHA 1NPNA 2A6KA 3KJ4B 2P5PA 4PRBA 1QX1A 2YK1L 4KUZL 3JTTB 3ARFA 2YXFA 1TVHB 4LCYB 4ZUUA 4LNRB 3KH4A 1ZTXE 1ZGLP 1A4CA 1FHGA 2EVIA 4PCSA 4NYLB 1ET8A 4L8BB 4W9HC 7FABH 3QJXA 4Y1AE 1MW2A 2VAAA 2X12A 4M4RA 2GIXA 4QYOB 5IVXB 3VXRB 2XKNA 1MY5A 2CO6A 2PO6B 3QUYD 1KUMA 1LP9F 4HHAB 4XZUB 5FYLH 3N04A 2F5AH 1RIHL 3MV8D 3N42B 5IGXH 4NOFA 2YGPA 2X28A 4JFEE 5CJQL 5FCSH 1XR8A 4XPHL 5SWZA 3LKPA 4G6KH 1S78D 1QVOA 5AVRB 1T0NB 4M61A 1S7VB 2UVEA 5JYMA 1E9QA 3NVQA 3NCJH 3OGCB 3DO4A 1LXMA 1I8IA 3U83A 3RI5F 4FQ1H 5ILTH 3KNBA 3MNDA 4A6YA 1MW1A 1XB6A 3G5ZB 3VG0H 3NOIA 4KY1L 2EEXA 4U1MA 2DI8A 3EOBB 1VESA 4P2QA 4Z3TA 2CKBA 3R4DA 5DEJA 1DBKL 3GMMA 3HC3H 2P5EE 2IOIA 2ZX8A 4AM0A 3S88H 6PCYA 2Y7OA 1MDTA 2JFCA 2OP4H 2Z31D 4JANA 4KUCD 3ZT6A 3VWJA 4WWKC 1LK2B 3LMJL 4FTVB 3CHSA 5EU5B 1UOVA 1IQWH 4YHNA 1SN0A 2VN5A 4OQ1A 3TIEA 4MD5B 2BC4A 3FSVA 1W6LA 3G7TA 3Q6GH 3VRIA 5IREA 3F58L 3UROR 2BOCB 4GS7C 4P2QB 1XH3A 2P28B 3A4AA 4GSQA 4QLRA 3V52H 4AUUA 3WE6B 3PDDA 5ITBH 4KKNA 1KGXA 1VENA 3PV6B 1OSPH 3ARGA 3D85D 3FONA 3TO4D 2C4XA 3C2AL 3MUGA 3V5DB 3PWPB 4FYTA 4OJYA 2AV7B 3SJVD 4BA8A 4WI9A 3QJOA 4ZSOE 1J9RA 1CLOL 3D2UA 43C9B 4XNMA 1P1VA 3GSUB 3ZUCA 2QSTA 5E1HB 1YZZA 2WYZA 3LRMA 3UO8B 5ALBL 3RIFF 4KKAC 1SFDA 3G6JE 1FDLH 4NKOB 4WJ5A 3X3FL 4DGVH 5GZNC 4CW1B 3H1ZA 1WQVT 2LLGA 4QGYA 3QP3A 3M1BA 4Z78A 3RZCB 3T6VA 1G7MA 4L05A 1BZDA 2FQEA 1JDDA 4LVNC 8FABA 2LW3A 4IIQA 1ZS8A 4YSAA 3VCLA 1HH9A 1FZOB 3L3KA 4UM9B 4KKRA 2FLBT 3MZTA 2Z93A 1MCEA 1X5HA 3IKCA 1HCYA 3FMGL 2LLNA 4ECNA 4IOIA 5F7FA 4HKBA 5AKVA 2FO4A 2HFEA 4RMUA 1UA7A 2Q86B 3HBGA 1DJWA 3KS0J 1LO2L 3GXIA 3TA3B 3IBOA 3EYQD 4X4XB 3CAFA 4H8WH 4X98A 3SE9H 2V7NA 4QHKI 4FKKA 1F4WL 3D1MC 3L2LA 5F6HJ 5T1LA 3O2DL 5IBLC 4MCYB 5I8EA 2R51A 3QWOB 4RGNB 4IOSD 5C3IA 2H1LM 3IJHA 3DWTA 5E00A 5F7KC 4JRXE 2DICA 3GSRB 4HWBA 1BMGA 3BPOB 2ODIA 3QIWA 5IB4A 1S2EA 1S9VB 3CN4A 1WHOA 5GGTL 3S37H 3SDAD 1HVXA 3BSZH 1Q94B 2P26A 2WLLA 1A7NL 4PB0L 3ZE1B 4UAHA 1BZ8A 1MRDL 3HN5A 1EWHA 2DF3A 4HUWB 4NZJA 3LAFA 3FOMB 4PRHA 5C0FA 1ZSDB 2AK4D 2ZAIA 3RGBA 2VMCA 1B88A 5DZPA 2KUTA 2IFFH 2EJ1A 3RKDC 4CKQA 3DIDA 1PLGL 5K9QG 1AXSA 1ZT4B 1JMXA 2PTTA 4XC3L 3W2DH 2UZIH 3ARDC 3U6RA 5IQ7L 4G5ZL 5HHOB 4J12A 3C09C 2FD6H 2VH5L 4NCDA 2WBJB 5F7YC 4J3OC 3PDGA 2EKSA 3P9WB 2QLYA 1N7ML 3KLLA 3MCLL 5KVDE 3EJPA 1BECA 2ATPA 1I85A 2AEWA 5ABZA 1NDGB 1MF2L 1N10A 4LLVB 4PH8A 5T1MA 1IM3D 1VAHA 2Z64C 2LABA 4YBQD 4Z7VE 2EDOA 3VACA 4MCZA 3KLSA 3RLSA 3G6JB 3U48A 4OZGE 4ELMB 1CLOH 3BWAA 1N5YH 3LVTA 5FYKH 3IMTA 3L3IA 5FYLE 1JF1B 1U4EA 3SDXA 4JFHD 2VXVH 4L4TE 5LBSA 4XNUL 3OMIB 3X11A 4MXQC 4OH2A 4R97C 4X8CA 4AIZB 3C2SA 4TULL 1W8OA 1CUOA 4I9WE 3AITA 1QSVA 1IAIM 5DJAB 1YUKB 5I15H 2Q7YB 3K80A 1RUKH 1U8MA 5TH2B 2R0ZL 1Z9MA 1BM3H 2JQAA 4C4KT 4KTGA 4AQ1B 4TNVK 1JDCA 3QQDA 2NXZD 5DRWA 5K1VA 3UTTB 3K71A 2K7PA 3P11L 4OJDH 4IBVA 2VLME 4YHOH 2FECL 4E41E 3QO1B 3B5GA 4LHUA 1TTRA 3VXSA 2WP3O 1SN2A 1Z5LA 4ZUSA 1MVYA 5MHSE 5CLWA 5C6PB 4XZ4A 4WEMB 1ZXQA 3U4BH 2ZWNA 2FZ3A 4GG8A 4PGZA 5BV7H 5LWYH 5KG9A 1U8MB 1WZ1L 1N5AA 4JFOA 5I8KL 4ZX3A 4GKNA 3QQ4B 2AXHA 1MELA 4QJ5B 3VTTA 2ADFL 3VFRA 1IQDB 4W6YB 4N9GB 2CCLA 4WEBL 4YK4B 3A4EA 4UI2A 2RBLA 1RK0A 5IFAH 3OKOB 4FX5A 5TQ2L 3EGDA 4LPWA 4XNBA 5J6GA 3OAYK 5EEVA 3HUJF 4YVUA 4N90D 5HGAB 2DYRB 2OMNA 1QSEB 2QPSA 3WFEH 1ZK5A 3CSYB 3PWJA 2F0CA 1CI5A 1CLZL 5DJYA 3D3VD 5F7LB 4OUUA 4P57B 3SO5A 3EFFB 4J3VA 4Q4EA 3WLWD 4WTXA 3PCYA 5BUPA 1BFOB 4GEIA 4PJIB 1BBJB 1R3KA 3FUIA 1Q72H 4Z23A 3LH2H 5HHOE 3CE1A 4CSTA 4EI6B 1NCWH 2HLFC 3WAKA 2D9CA 3MRDA 3D08A 3WKYA 1JGDB 2IWEA 4F7CB 1ZHKB 5DHVB 1BZ9A 1HT6A 3IGUA 2EIZA 4QNPE 4B9ZA 1Z6JT 3GXDA 3GLAA 3OKLB 1DQJB 1LL1A 3OD3A 3QJFB 1IGYA 4E5XG 3DETC 4HIJA 4S1SH 3W9EA 2NSQA 4FG2A 4TSCH 4BFOA 1E7UA 3RUGA 3GK8L 1CICA 5IB1A 1INQA 5JOPE 3DC0A 2W65A 3T3PF 4D9RE 5K1JA 4ZXBB 4X7CC 4AZ8A 4LCWA 2MH4A 1QFWH 3QPXL 2XPGB 3MUHL 4QJ4B 3RWEA 1A3ZA 2WXFA 1T1WA 3JV4B 1T21A 3BPCA 4KXDA 2NZIA 2WIIA 2QSQA 4XXCC 5JMOC 4J5VA 3GPEA 3PWVB 1P69B 5IM7A 3KBHE 4OJFH 4HC1A 2JKXA 4LOEA 3DTXB 1U8KB 5DK2B 5LAXB 3IFOA 1R3LB 3SPGA 3TFKC 3RFZB 1XH0A 3QULA 3T0DA 4P2OC 5K39A 4WW1B 2BSTA 2D3NA 1IM3A 4AVHA 2AV1A 4K9EL 4JFYA 4M6OH 2IDCA 3J7HA 2ZSWB 4J3OD 4LSTH 4JR9H 3WAJA 4TNEA 1XXDC 1MHPH 1CL7L 4JFDA 5CJOH 2IPUK 2L04A 1J0JA 4ILDA 4JKPL 5I6PA 4M93C 5BO0D 5DVLA 1DLHB 5E2TL 2IPKB 4HWBH 4WUUA 4XBGA 4XWGH 1M7DB 5AYUH 3HFFA 1R24B 4F7TB 2VLKE 5T5NG 1RZPA 3HZVA 3IGFA 4LKXA 4H8HA 4YR6A 3GMPB 3GBML 2AKRA 4GSDL 1EV2E 4GH7B 1D6VL 2BVPB 3WMSA 4LU5L 4DGIH 1C5DA 3ESNA 1DQTA 3FFDA 4PMFA 5CEZL 4N2NA 5M94B 4IW4C 1YPZF 4QXUH 3T4AC 4AEIL 2KPNA 4K3GA 5DMKB 1XVSA 4TM9A 2ISDA 4YHML 2DQJL 5I6XB 1NBZA 3CDZB 3UBHA 3DGGA 4GIAA 1QYGH 4HCFA 1CF1A 2JCCB 3QUZA 5B39G 3K74B 2E9BA 3DBXB 3K46A 5FYJH 3UZQB 3KPPA 4ZODA 2EC9U 1FHNA 4HOWA 1EFXA 3GZQA 2YEVB 2NY6D 5GGTA 4OGZA 3MJ7A 1U3JA 4PJDB 4X83A 1EUUA 4X7EC 2IADB 4XRCB 4G1MB 3AXLB 4LF3A 1YY8A 4UAOC 4WK4B 2BFVL 2ZUTA 3KCPB 4GXUN 3ZO0A 3N40P 1E40A 5C7XH 1S3KL 2P7TB 2FBRA 1NL0H 4LE8A 1U58A 2CO2A 2Q20A 4ZNEE 2XV6B 1WSST 2VTFA 1RU9L 3F6JA 3GGWB 1YJDL 4MGXA 3VXUD 2KZ1B 1LMIA 1Z7JA 2J88H 4BDVB 4KK8C 2D7TH 2BSDA 2C1PA 1B4LA 1MFBL 4NWTH 1DDTA 1U8HA 5E6IA 2W60B 4RNRA 1MNUH 32C2A 5SWQA 3VYPA 1RZFL 4G8GD 4Z95L 2VM9A 2O5ZL 5AUMA 4AEIH 2GI0A 2KYIA 3KPSE 4BKLA 2RGSA 4LO9A 3VMOA 4ZMTA 2E7LA 3I9AA 1AHWA 1JNHA 4NM8H 4OZFB 4QHLB 1T0PB 4JDEA 4OU3A 4UQIM 3ATEA 4DUWA 3D52A 4FFZA 2Q2LA 3C08L 4ZXBD 3SKNA 1OV8A 1UJTA 2VSCA 4R7DB 2EDBA 1OCOB 3MXVH 4BZ2L 4K7FB 4HQQH 2VMEA 3EDKA 3LKPB 2WBXA 4RFNC 4ZMQA 1CWVA 4AMWA 2PR9A 5I71B 3SYOA 1XSJA 1DFBL 3SKJH 1WBXB 4XODA 5FF6B 2Q87A 1UM4L 2D4FA 4YAQA 2WWKT 2O5NA 4Z95H 3QIWC 5C0EB 1QPKA 3NBNA 1URLA 2EUVA 3QG7H 4F3FA 3VFNA 3GI9L 3DMMB 3QWRA 4FERA 4FI8A 4Y5XC 5I23A 1MI5A 3K2IA 3QIBA 1HHGA 4KPHH 1BBDL 3C2AH 3RVVD 1OM3H 3CX5K 4X0KA 2BY0A 4NDMA 3WIIL 4WO0A 3VXUA 5DA0B 2HX8A 3SIKA 5ID1A 3IXTA 4FLOA 4PGJA 5CCKL 1T04B 4M43L 3LNHA 1B4TA 3QDAA 1ESOA 4NO2A 1KLGA 2E47A 2ERJC 4HEME 2NT0A 5F9OH 5AZ2L 2EDDA 3NIGE 3KBEA 3WE1A 1A6WL 4ZFZA 3BP7A 1VKXB 3DJZA 2ZKXA 1OAKH 1SDDB 2BRRL 1QEXA 4HGWA 1V10A 5CAYB 4C56B 3IJSB 4JHBA 1K5NA 4X0KB 4NEHB 2GK0B 1NKOA 4UQ3B 5KZCB 2GBAA 4LARH 4NZ8A 2C1OA 3V6BR 3I02B 2GTWA 3SBQA 2ITDA 2V8LA 4RFEB 3BIKB 4LLWB 1H5BC 3TM6A 7TAAA 1G94A 3LKQB 2PUQT 2X88A 1D7FA 4JPWL 2YOCA 3FT0A 2YLKA 4ZT1A 3EJTA 1UH4A 3WFDH 1N0XH 1LEGB 2RCSL 4ESKA 3AREB 5ISZA 3DROA 2G9KA 1J5IA 3EFOB 4FJ6A 3GSNL 3II1A 1OTUD 3RZCA 4JK0D 2I9TA 2XX0A 2WLNA 4MNHB 5AW3B 4LIQL 2FTAA 3WKML 1D3CA 1P5UC 4N6QA 1HXYB 1PLBA 5F71A 4QHUB 4OFYD 1T6BX 1I1FA 2VL5A 4N0UE 5PCYA 5DHMC 3SKOB 3SQOL 3IMBA 3RUGE 1NAMH 3KS0H 4RFEA 3AS1A 1JOIA 1E5BA 1MHPL 4PJBF 1KEML 3QDJE 1B4RA 4IBZA 1QBAA 1DVQA 1NCGA 2KMWA 1TMCB 2VUYA 2IBGA 3EOAA 3M45A 1WCBB 2P9RA 4P9HH 4C83B 2QZQA 1QKZH 2VDNL 3QUXA 4M5YL 5GSRB 4DVRL 4P4KA 1KSRA 4RGOL 4W9CC 4XX5A 5MERA 4L4TD 4UNIA 2H6UA 4MB1A 5I0VA 2GJ6A 4H25A 4Z7NE 1AZUA 5ERWB 5HVHC 4LRNL 3ZGHA 2H6OA 5I1DA 4O2FA 1UWGH 3SBWC 3MRBA 3BQUC 4S10A 2OMYA 3X3GL 3WDJA 5D96C 4XOBA 2WBJD 3IF1A 3OAZH 4C55A 1IGFH 4GT7A 4L1LA 5AOKA 4DCQB 2CHWA 3WY2A 4P49A 1XCTB 2ZKHH 2ZWSA 4N0FA 2FD6L 3HA0A 3GKWH 3M1OA 2P5EB 1JF5A 5KSAA 4HH9B 2W9EH 1R6VA 5C2UB 4J3BA 2DMKA 5F8QC 1EEYA 5J6HB 1T83C 1X6NA 4LFHD 1KJ2H 1KIUA 5HJGA 3HRZC 2H8PB 2ZONA 4RDQF 4XBEL 3VAEA 1KWGA 5KVEL 5F1KC 5D7JB 1CIUA 1F1DA 4PG9B 1EXGA 2QQKH 1AXTH 1OTSC 3H2WA 5DR5L 2QADB 5JNYA 4ABQA 3CSGA 5A7BA 5BZDB 5I5RA 2YEQA 3R18A 2XZQL 2P5ED 2VXVL 2J43A 4NPJA 1H3PL 1XIWA 4JLRA 4MMXA 1Q72L 1JCKA 4AJYV 2WOBA 4GIOA 1Z3GH 4Z7VB 4OZHF 4QRRE 5GGTH 3OWRA 3CH8A 4ZX4A 3ULVD 1ADWA 3UBXA 1DVFD 2MCG1 5HDLA 3TBBA 1FFNA 2A6IB 1MLBA 3D7PA 1XO8A 1CGWA 2B2XL 2JKJA 1LO0H 4LKCB 4LLVA 2XG5B 2VJXA 2QVMA 4RGND 1ZGLM 2SEBA 3HNSH 2E76C 4UZSA 2XI9A 3TA3D 4PRNA 1HK6A 3QUMA 4Q7DA 3MN8A 2APVA 3PNWB 4R26H 4O51A 1INDL 1V7ML 2GSIB 3GSXB 2J5LB 4WTZG 1MFAH 4XB8A 5EO9A 3V5HA 2ZJSH 3TPUA 4OZGF 3LPGA 3UAJC 1WP6A 2R0KL 2VDLB 1UCBL 2X4UA 1MCRA 1P7QA 4KY2A 4L4TA 5DZ9A 4E41B 3ZKMD 1UB5B 1NC4B 3CVCA 3IMVA 3VXTA 1QWUA 2YAQA 3CC1A 2EE0A 4GP8B 3A6CL 2YFOA 1T1ZB 2F1BA 2UWEE 3GRWL 4HWZA 3T2LA 5EC2B 4ALAL 5B38G 3L9BA 4UTBH 1CU4H 1X4XA 5KSBA 2EH7H 1FYTB 1Z1WA 4IBQA 1E4JA 3E6FB 4ACPA 2V3DA 4LARL 2V5RA 5HHVH 5GISH 1SJMA 1E9PA 3MRHB 3D39D 1JHTA 5LKNA 3V0AC 3GMLA 5C70A 2AJVH 3TVMD 1REIA 1DBBH 3CC5B 4AQ8A 1OK8A 3GJEB 4DFHA 2IFFL 4JO3L 5DMGC 2P8MB 3BDYL 4XMLH 1I8MA 1FF5A 4LL9A 3TJEL 4XC1H 3D69B 2XFXB 4M1DH 5EO0B 5HGHB 3V4LA 4PJHF 3T65B 1LO2H 4RMWA 5K9OB 4G7QB 4F2MB 2F53E 2OMZB 1ZHNA 3NJJA 2HT3C 4NP4H 4PJ7B 5AYTA 4DF9A 1RLWA 4M43H 2NY0D 3OKOA 5FC9A 1YMHA 4XNZB 3TIDA 1QRNA 5ID0B 3TBSA 3NQIA 4WKXA 1A64A 2FSDA 4B96A 2ATKB 3KWWA 2R15A 3QDMB 4DESA 2LU3A 2MPAH 3VMPA 5FYJL 1FVDB 5GGUB 3FUHA 4Y1TA 3O3AA 4X6EA 1VCBC 2YKLH 4AGMA 4NQUA 3FS9A 3G5XB 1P6FA 5BUGA 4BQBA 1MCCA 2NY1D 4OF5A 5EIIA 4XBMA 2ZWKA 4G83A 4NO3A 1PY4A 1RUQH 4PY7A 3P0GB 4KDTA 1IILE 3RDTB 3O41A 2VXSH 4NP9A 2GEEA 4S1QL 3QJSB 4ONHA 3OAUL 2EH8H 1S8DB 3LZNA 3OM3B 4LGSB 4QRRD 1CR9L 5JORB 2V2WB 5ILTL 3U46B 5IESH 1K85A 2X87A 3C6LB 1M6UA 2HP4A 1FVDA 1S9XB 1ZDSA 4FQLL 1FORL 3QJFA 3UTOA 3DSFH 3TV3H 1EEZB 4GG6B 1BZOA 2ZPKH 1U95A 2B5IC 1JXGA 3DJTA 2N0KA 3MUJA 4YL4A 2R1WB 1HXKA 4JVWA 2RHEA 1X7QB 3BVWA 3HAEB 2ZX9A 3ZDZB 4ONHB 2NW2A 3KDMB 3TEYA 3TBYA 2GTZA 3BLKA 3SGEI 4F9PA 1TTGA 5BXFA 2PPFA 4HS8L 3CXDH 3CFCH 4WHYH 3BN9D 3LD8B 2L0DA 3IKKA 3UP1A 3F7QA 4LAQH 4UINL 4IU2A 3TEZA 5IM7B 1E2WA 3C5ZC 4OZGB 4ELME 4PJFE 2C3WA 2AEPH 5E8OB 3LZRA 1KIRB 5T1LD 3WXWL 3RG1C 1WJ3A 1CXFA 2HRGA 3ZSTA 4Y4HC 1FL5B 5JA9A 1IFHH 4NN6B 5F3FA 5JUEH 2DYPB 3QPXH 4QXVA 5HYJA 1FFPB 2ENQA 2APBA 2UY7B 5E7BA 4BH7A 5DQJB 4MQ7A 2B7DT 5E6ID 4LDEB 3QCVL 2N59A 5F7EL 3V2AR 4NI6A 2BH0A 3CFKA 4OZGA 5MEQA 3HG1D 1GYVA 5B7MA 4OR1A 3VFOA 3D25B 5E8OA 2A4CA 1L0QA 1PX4A 5FHBH 2W0LA 1YYMH 4ADIA 2QR0A 2WO4A 4WWID 4XR8C 5HGBB 1BWMA 1FDLL 4D8PA 5TTRA 1TEGA 3VQ1C 3ZGIA 5TK4A 2FBJH 1QSEE 3I50H 3VE0B 3ENEA 1VFAB 4ZUUB 4HFWB 3U7YH 3VG9B 4PJAE 4B3VA 1RUPH 4OD1L 3IFLH 4KO7A 2CBOA 1NBQA 4N1CA 4OD2B 5D5MA 3SOTA 2MTPA 3EH2A 4HIXH 4G5AA 3DX3A 5GIRA 2EDNA 2OXGA 5AALA 4JPQA 2DQDH 2WZPD 4H8PA 2QV2A 3KBFA 2N56A 4RWYL 4TF4A 3QUMH 4KAQL 1LO5B 5C0CD 3ATFA 5EDSA 5JIMA 2BXYA 3N40F 1T03L 1HH6A 3WFEL 3HJ0A 1QHOA 2J1YA 4MQSB 4NQCB 5TDNB 1UXSA 4AJWA 3BVUA 5IOPA 3E3QC 1RZGA 4ENZA 4CA4A 3HI1A 5JW4M 2FJUB 1DL7L 4Y5VB 2I25N 3QCVH 4IRZH 3R4RA 4UV7H 4XE5B 3Q1SL 3TYFA 5F6IB 5KSUA 1QSZA 3KYMB 5IESL 1CB4A 4NO0B 4LSRH 3WFDL 4K3JL 4AK1A 2PXYB 2CG9X 3QORA 2VSDA 4AE1A 2MHAB 3MJ6A 1I1AB 5C07E 4MA8H 5JPNC 1XCQB 4FFVD 1B0RA 1BJ1J 3RVVC 4L9LC 32C2B 5SWQB 4AM0B 5C0IA 3HI1B 4HWNA 4TLSA 1QPPA 2ITCA 4DP2X 3ZR5A 3LDBB 5EORH 3WNOA 1KXVA 5F72S 3DUUB 4N2DA 2JJSA 3UAJD 1KTCA 3ZHFA 4FP8H 4L8SB 4R7VA 4IHBA 4HGMA 2BP3A 1PNDA 3OHXA 1J8HB 3DYMA 2NZ9C 2OL3L 1LWRA 4PY8I 3PHOB 2PYED 1YG9A 4FFZH 4QHMB 3P9LA 5F96L 1A4AA 5LGJB 2NX5E 1JZIA 1U8IB 1LEIB 3K8KA 2QPEB 4LSUL 4PJ9D 3SODB 1WHPA 5FAAA 5GRYA 1QFHA 1OTUC 4KKZA 1UURA 4K7FA 2ZCZA 4IHOA 1CYXA 5DSCA 4L8BA 4GRMA 3QUML 4CNIB 1H9DA 2WCGA 4PTTB 4RMSA 3TO4A 1RJYA 3HC0B 2OR9L 4LEEA 1UTDA 4WTQA 5FPIA 1Q0EA 4OVVA 4HYTB 1GY2A 1N59B 1OPGH 1PJ9A 4IIZA 2CO6B 3K0YA 4NX0A 5E4AA 5HI3D 3DV6B 2ADYA 4PJGF 5IG7B 5FWRA 3CLEL 1N5YL 4MKMA 4H4NA 2EDKA 4YDZA 4V1DB 2IXQA 1YEDB 4WJ5B 1CFVL 2ZTBA 4F27A 4L4VE 3QDGB 4FL4B 5FOBA 4LP8A 5LGHH 1ZEAH 1FNLA 2Z4QB 2MOVA 1I3UA 2NDFA 2E7DA 3ARFB 3EGSB 1IX2A 1SOQA 3N44F 3PWNA 4HJJL 1JCVA 4UTBL 2AAAA 4CU6A 3ECVA 4L4VD 1A7RH 2XTSA 1CFSA 2A1WH 4UQDA 5H37H 1DR9A 1ILSA 3KD4A 1ZVSA 4R8WL 3N5AA 1OGPA 1Z9LA 3P3TA 1O5DT 4KRLB 3CHRA 2O1AA 1UATA 2HTLD 3US0A 4ZTEA 3VH8G 4IOIB 5AZUA 1YECH 1U4FA 3LKNA 2KI6A 3FT2B 2DKUA 2JCCE 3FQ2A 2CGRL 1I9JL 2Z31A 3FNKA 3BDXA 3L95B 3DO7B 2IH1A 5JHMA 4FXGC 3T2NH 3INUL 3EYVA 3MBWA 4YHPB 2AAVA 4G82A 3L5XH 4WK0B 3ZVVA 4C56A 2I60H 1CLYH 3AVEA 2YQGA 3F12B 4ZS7H 1B9KA 3H2QA 2NNAB 3WTSA 4M61B 3TWYA 3T0XA 4ABUA 3D4CA 4A6YH 4GAJL 3EO9H 3T09A 3F00A 3MRPB 5AOZA 4P05A 3ASWA 3CFCL 1VJSA 1DBJH 2XFGB 3CFEA 4Q58C 4XHQA 1ZK9A 4I3SL 4YPJA 1TT6A 1N3NB 1FZJA 1OAYH 5K33A 4F58H 1TZGH 4PP2B 4PV9A 2UZYA 1CGYA 3N1FC 2XKSA 2EYRA 3F6LA 4QR7A 5CEYA 4JDVB 2KLSA 2ESVE 1ZLVK 1EXUB 3O4LA 3OR7A 2NNAA 4PLNC 4QUOA 4NQVB 4YSDA 2M2DA 4N5ED 5BOZG 1HXYA 3Q8CA 2CPCA 3T4AB 4JZNA 4WO4A 5L7XH 4J8RA 5T3ZH 4ZZKA 3L5XL 2BVQB 4R96B 1GZHA 3WKNA 4HX1A 1AQMA 4PG2C 1KGCD 1KPUB 2CBTA 4J23A 2CPUA 1IC1A 3BOVA 2A9NH 4FFYH 4PGEB 5C09D 4AT6B 3GS0A 4B6ZA 4RLDA 2Z0UA 3LQAC 3HOGA 4MQXD 4WHYG 1EXUA 3ARFC 1AQKL 3QQ3A 4QY8A 3NZ8B 1X9RA 3P3SA 3MLXL 4HKBB 2C9PA 4JN1L 4JRYA 4HUVA 1AR1B 3H9HA 1PL3A 3G04A 3BEWB 5BV7C 1KN4L 2ED8A 4GMSL 4K3DL 5FGRA 4XCYB 3HG1E 4MA7L 2AHIA 3UC0H 3L4VA 1G7MB 2Y6SC 2HVJA 2G2PA 4MCYA 4HS3A 1EH9A 3CLEH 4WNQA 2XNAA 4GBXA 4HOZA 4HKXA 3UTZA 4FXKC 2CBMA 4QMEA 2ZXCA 2HFFB 1YQVL 1PZ2A 1J0YA 15C8L 5E4EB 5HHQA 4UZUA 5T3ZL 3ZTEA 1EEYB 1BPLB 3H3KA 4LCYA 4PD4J 4UILL 4H7VA 5DD0H 1IRAY 1L9PA 2AJ3A 2XRAH 4N85A 3INUH 1ETZB 4X4MA 3SGEH 2R0LH 5DFAA 4U4IA 1BVKA 4X7SH 3CPUA 4OBRA 4F7EA 3U7AA 3CSPA 4Y8AA 2IWKA 3IGAB 2H1PH 3IU4H 3OTTA 4YH6A 4RMVA 2Y2WA 4WNQB 4RCAA 2FVNA 4F57L 4O5LL 4BXVA 1DUZB 3PREA 4B50A 2XUWA 3UJTH 4LCIL 3IDGA 3SPCA 3GSOB 4OKDA 3VWJC 2EE3A 3BPNB 4W1TA 3M07A 1V3LA 4L0YA 3VGAC 2DLEA 4PMEA 1JZJA 4IEFA 2A4ZA 4TVPE 4LEOA 1TR7A 3CMOH 3QHZL 1T89C 5GJSH 2ED9A 1F6AB 3V9CA 5FUCE 4AKQA 3BUBA 2DLGA 3NJKA 2CLZB 2EKSB 5AOMA 1KTBA 1QHPA 3B5TA 4F37K 3PNWA 2W38A 4C47A 3BAIA 1CFNA 2YRLA 1OP5H 3ZIMA 1GGCL 2JKTM 3P0YL 1BYOA 1HHIA 2UWEB 3B7RL 3BIAX 1HC1A 4HSQA 1T20B 3PGDA 3R7QA 2W9DH 1F02I 3ARUA 5ANMB 3KYAA 3MTRA 3K72B 2OS7A 4KMTH 4L29A 4YLBA 4YWGL 2H7WA 1KT2A 4PEEA 2Y5TB 1RZKL 5D2LB 5DJDB 4JQIA 4IIQC 1EXHA 3WNIA 2AFNA 3QFJD 2OYLA 1V55B 2Q7YA 3AB0B 2DW5A 3MV7B 3PWPA 1HHKA 2XTJE 1D2OA 2AV7A 4Y2OB 1JV5A 3GJFA 4OJAA 2B59A 4ODXB 4PJ7E 4YDJB 5DRWB 2WP3T 3VI4E 2X1WL 5A2AA 5E1GA 1TUPA 2X1PA 4Y16D 1MCOL 5K9KA 1X44A 2JQMA 4ABWA 4AXWA 2WNXA 1C5BH 1PZDA 4MZ3A 4FFZL 4W68A 5F96H 3IDYC 4NUPA 3A6BH 4KDWA 3LIUA 3VD5A 1ADQA 1PZSA 2N7BA 2A6JB 2FIRT 4P2AA 1INQB 4L0PB 4KUCF 1FL6A 4PJHE 3SJVA 4ONOA 1U41A 5HYSA 3WIFA 2AJUH 3GUFA 3H55A 2NW3B 1N0XL 4Y4FC 2YPLA 4DH2A 4JZOB 3JVGC 4KI5F 4M6NH 3H7BB 3AUWB 4EI5D 3K71B 3WG7B 3RDTD 1ZJBA 3EGDB 3HLAB 2F7RA 2OZ4L 4NNXB 5F1IB 1RZFH 3U0PB 3IPEA 4Y4HD 1UM6H 3UTQB 4R6UA 2F7PA 2YD2A 2X3AA 4NO5B 4FQXA 2JJUA 3IMUA 1IC7H 4APQB 5TF0A 1YYLH 5D7HA 1X5AA 3BX7C 4HFUL 3CSTA 3IS1X 3VD9A 4OGXH 2DQIL 4K5MA 4RZCA 3EH5B 1MJ8L 5HYQA 5CGYD 4EUPG 5FO2A 1EEZA 1S9VA 4G7VH 2XVLA 4BFKA 5IQOA 3BC9A 1ID5I 2FT7A 3QRGL 4M8QA 2R1WA 2YPLD 1ZXKA 3RRQA 4MYWB 5FK9B 3MRLA 1BZ9B 4HK3N 3HZVB 4PV1C 4AV0A 4XAWH 5DJ2A 2R83A 3ARVA 5IWLA 2Y5QA 4JM4L 5KANI 3EO0B 5EEUA 4QJ3B 2TAAA 1BVLA 1K8IB 3MBXL 1HCVA 1LO3H 1HKLL 1A3QA 3OHXC 3EJSA 2QMJA 1CBJA 2EABA 3ARBA 3IT8D 4N0YL 1BFOA 5FUZL 2J6EH 3QRFM 3R8BB 1GHFL 5IV2B 2UY6B 5EU7E 4E5XB 2MTAA 1JZDC 2OMTB 1QR1A 3CHXA 4R5TA 1DZ0A 3BRFA 1MRFH 4ZAKA 1I7TB 3DX8B 3D39A 1A6WH 5GZND 1ZV9A 5D5ME 4HOMA 1U3HD 2ZG2A 1U6AL 2VR3A 3VB9A 2XTJB 5DRZA 3VYOA 2X1OA 2H2PD 4GXFA 2GIYA 3CDFA 3L08A 4JJ5A 2P52A 4JM2A 2DQUL 4Y1AD 2J55A 3O9WB 3O8XD 1EQWA 4BE6A 5IT2L 5IV2A 4NQEE 1FBIL 2CK2A 4TPRH 3TNNB 1AQDB 5IROA 5T3ZD 1U91B 3W9DB 1DDHA 5BS0B 3X11B 3U0TA 1KNOA 3MHZA 2CCVA 1CJYA 4YXHL 4WFEE 1IGIH 4PRAB 5DYOA 4KTYA 3QCTH 4L4JA 3TN0D 1S7XB 2WIMA 4H13C 4NQCE 4DPCX 1Y18B 1MLCB 2EH7L 5BRPA 1MJ7H 3K8MA 2ERJB 3L4CA 5TH2A 2LTQB 3GTTA 3K6IA 3GLEA 1VFBA 3UZVA 2R23A 4NZRH 3VFPA 3FO0L 1AYOA 2G30A 1AD9A 4XPTL 1ZVHA 3X1BA 2KZBA 4WU7A 1WA0X 4PJFA 4AEHH 2EYSB 4O00A 4U1IA 5MI0C 1PZAA 4XI5D 1PG7H 3Q8AA 4YIQA 1RZGB 3HR6A 4JGMA 4OF6A 1UXWB 1PFCA 1QLFB 1TETL 3KYKL 5C0RL 3WD5H 3RWHA 4ONFL 2ZUQC 1B2WL 3B2UD 1DLHA 3HJEA 4LNVA 3GRWA 1RHHB 4HIEA 4HCIA 4XGZB 5IW1B 1MZZA 3NN8A 5MEND 5I1IH 1KOAA 2YMXH 3II2A 1CXLA 5C97A 5I8CB 3V0IA 4QGTA 2MCPH 4DEPB 2HJKA 2PXYA 1QTSA 1U2HA 3P30H 5KBNC 4DKAA 3ZY7A 3HE6A 1D2PA 1GTFA 1RK0B 1I3RB 3RVTD 1UD4A 4JQIH 3STBA 4MNQB 1L7IL 3SQRA 1HHGB 3HZKB 5EZIL 3AS0A 1U58B 2X70B 1KY7A 4AE0A 4D94A 5GGRB 5B4MD 3D3VA 4TVPH 1NAMB 4LLUA 2VR9A 4FABL 5DHXB 1GZHC 5I17B 4NHUB 2K1MA 3NABL 5A2FA 2WO2B 3EFFA 1QRND 1J18A 3QUZB 4JCMA 4ZZFA 2AF2A 4NKMA 3NSDA 1JPSH 4KK9C 1SXSA 4NRZA 4JO3H 3DYOA 4Y19B 2NTFB 3VXQB 1AQHA 3HMWL 1AS7A 1T1YA 4LCWD 4KZ0A 3BCFA 4X42A 4F7CA 2KERA 2R27A 4RMQA 1SQMA 4AV5A 4NC0B 3G5VB 4NRXB 4DTGL 2XU9A 5B39B 1VPOH 3QEQB 4U1HA 2CKBH 1WTGT 4YDMA 1YPZA 1CGUA 1S7RA 3OB0K 2YQ3A 4I8DA 1RULH 3UERA 3I6KB 4XAWL 5L9DH 3BCDA 1T1XB 1M1SA 2WXOA 2X2HA 2XPYA 3GK8H 5TGBA 1QVOB 3D30A 3WOVA 1P6WA 1J7VR 3BEVA 5DUBB 4LSQL 2PLTA 1RZQA 2R0ZH 2ZOLB 4PFEA 3SKOA 1GZQB 1EANA 4PRIE 1MCSA 2GTQA 3S34H 3UPCA 2WCPA 4WFFE 3U36B 1MI5B 1QZNA 1RLBA 2R69H 3BKJL 3LKNB 3LYRA 3DNKA 3K6DA 3DTXA 1F11A 4U1MB 3V55A 1MW3A 4GO9A 4OQTH 3QEGL 4TULH 3NIFF 3TCXA 4XHJC 4M1GL 4OTXH 1TJIH 3KPSD 1T04A 2FDBP 2EO7A 4XCCH 3VQMA 3MRGA 3WENA 4RGMC 2JKIS 3GTVA 2PWFA 3I2CH 3MOBL 4QF1A 1NICA 2VQ1A 3I6SA 1WBXA 2Z3FA 4UV4H 2QHLA 1FH5H 3TIEB 4MNGE 4MD5A 1CC3A 5L9DL 1AD0B 4RRPA 1KPVA 3WLBA 4Q0XL 3D07A 1L0YA 1EA9C 1SJEB 1AMYA 3QUZC 1WBYA 3PL6B 1D5IL 3TEUA 1P53A 1CQYA 2AEIT 4K2UH 1VPOL 2H26A 4NC2B 4CADB 4DUXA 3FU3A 3PV6A 3QJUB 2HJFA 2OZ4A 2QPDB 5F2FA 1J0ZA 1J48A 5IUCA 1JHKH 2YSSB 2ZX6A 3GHEH 4NQVA 3KWUA 5C2BL 4DO5A 3DPDA 1LWJA 4JZNB 2J20A 2DQTH 4M7JH 4U6TA 3QWRD 1I9EA 3QEGH 2Y7LA 1CMOA 2NZ1A 4XVOA 4Y4FD 5AEAA 4G7SB 1J1OL 4WK2B 2WQSA 4HZAA 5FKAB 4JM2F 4NT6A 3GZKA 3H53A 4XVTL 4ZO6A 4P46B 1N8ZA 5EWIH 1X5KA 3FQYA 2DDQH 4WV1B 4NZDA 1UZ8B 5LXVA 4U6YA 3Q5OA 1HNFA 3U79A 5A2KH 5ES4B 1J05B 2Z93B 3GXPA 2CO7B 5GGVH 3SPIA 1WC7B 4U1SA 2I69A 4L1SA 1JPTL 5D1ZC 5GSRA 3UCRA 3UTTE 4ZMLA 2QL1A 4NJ9H 1EBPA 1NBYA 1BA9A 3LOWA 2VZOA 3FSAA 4LLYA 3UAJA 5FDWA 3MRMA 3LN5B 1GPOH 3FW6A 4BCYA 2D0HA 3B9VA 4GMTH 1CDBA 1ITBB 3DKHA 2NXZC 2R1YA 4QHUA 4XC3H 3SE3A 4AYSA 1F1AA 4NQEA 1LD9B 4A2MA 4P5KB 5TE7L 5DMJB 2ZOKA 4PGBB 3U7WH 3WN5C 1OANA 1EX0A 4I3GA 5FCUL 4MA7H 4GAAA 3K4AA 5GGSB 5D9SB 4Z0BH 3UAAA 2CO4A 2EP6A 3VX0A 4F5CE 1S9WA 4OB5L 1FNEB 2HVBA 5HDQL 3GM8A 4H8WC 3N1QC 1VZIA 1FN4A 1I1CA 3GKZA 4R90L 2E8YA 1G7JB 1JXJA 3A5VA 4JN1H 4A2LA 1NUNB 3NIDE 5DD5H 4KQ0A 1OP4A 1U0QA 2ICEA 5JIKA 3WIIH 4YEFA 3E6FA 4DOHE 2NY0C 2DQCL 3LPOA 3RGVB 1FJ1A 4MJ5A 1WYJA 4ZRGA 5FO7B 4HXAH 4PGBA 5EBLB 1ZSHA 2J4WH 3V6OC 2XKUA 2APTA 4I7ZC 3SDAA 4MAYD 3CDCA 1AY1L 3QIWD 1A25A 4UT6H 3ARGD 2B39A 3D85A 2XBDA 4CN6A 4Z8FL 3AT9A 4D9RD 4K9EC 1S6NA 1JZ4A 5D2NB 5L0QB 1TNNA 4MJ5B 2Y36H 2OFQA 4RIRA 1D6EA 5ID1B 3MODH 1IC5L 4PRNB 1AH1A 2NY5L 3IDUA 2H32B 1BQ5A 1DBJL 5E56A 1FA4A 1NMAH 1OAUL 2AXGA 4M3HA 1KCUH 3V10A 4LLMA 5DDHB 1N64L 1LILA 2E9WA 2WTRB 2YRZA 5F7HA 2K3TA 3RVWC 3SOBL 4QAMB 1YCSA 4YO0B 1B0WA 2ESVB 5GS0H 1G0YR 1P5UA 2GJJA 3A67L 3LD8C 3VFUB 3ZZQA 3O41B 4JFUA 2DWDA 2LU4A 3COOA 4N90E 3ZE2F 2OJEA 3PWUB 2ZUXA 4JFDE 4HPOL 4XE0A 3M8OL 2NQDA 3MI6A 3EKCA 4MD4B 2NXYD 1DJXA 2GTWB 1JV5B 1OQXA 3GJFB 3OKEA 4PV8B 2DJSA 3DJSA 1UD8A 2GAZA 4PS8A 4RRPM 3LKQA 4DP8X 1ADQL 1VACA 5KSBB 2W8CA 3G6DH 2VDPH 1QWHA 1E5UI 4K3EH 3VTMA 5K9KB 3G9VA 4GG6A 4HUXB 2W80C 3PP3H 1L0XA 1TQCB 4XXWA 4RISL 3MV8A 1JVLA 1GYAA 3UO1H 3AGWA 1NGWB 2IDTA 3C5XA 4Q2ZB 2HT4D 3QEQD 3RVXC 1MJ7L 1UWXK 5EIQA 4HFUH 1MG2C 1YEWA 3GMQA 2BHYA 2VJ0A 1VGKB 5F1SA 3EOTL 4P48A 2YAHA 3B3IA 1PVHA 4AL8H 1LHZA 1OGAD 1XBRA 5H4YA 2PPAA 4LQFH 1HSBA 4GB9A 2X4NA 4HUUB 4K4KA 3S96B 1FO0A 1YEGL 1QUNB 4HXAL 4XTRC 4YX2L 4JPIB 43CAA 3BZ4B 4QCIA 5D4QA 4HZ1A 4DZ8B 1ZAGA 4PPTA 2ATKA 3KWWB 1EVUA 4GINA 2V9UA 4H8UA 4FRWA 4E41D 1U93A 1D6VH 1ZMYA 4EAEA 2R1XB 3BPOC 3VGBA 3WFBH 1TETH 1BWWA 3H2PA 3G5XA 4WENB 1UENA 2G0LA 4BH7B 1KXTB 2KBGA 1FZKA 4DK3A 3C8KB 1MNNA 4N5UA 4OFPA 3D69A 2W92A 2XFXA 5HGHA 1BZQK 4ZUTB 3LZOA 1GMEA 4N1EA 2D31B 4OF0A 2WXMA 3LB6D 4JPIA 3U2IA 3S8FB 4MASA 4UIMA 3SDDD 3PUUA 1RIHH 3QUZD 5JPNB 5CINL 2K6WA 5EU6D 5FGSA 35C8H 1Z9SA 3BGAA 4G70B 4JFHE 2CIKA 1UKQA 1DJHA 4MA8L 2MQ0A 3MV9E 1DQJA 2D3VA 2G5RA 5I1KL 4MNQD 5J56B 4XMPL 2ZP0T