2IWEA

Structure of a cavity mutant (h117g) of pseudomonas aeruginosa azurin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGGSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Click-Chemistry with an Active Site Variant of Azurin
doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords AZURIN
total genus 29
structure length 128
sequence length 128
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2006-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2iweA00
3H4HA 1OCRB 2YAMA 3HEIB 2JXMA 4NB7A 3H4FA 1JERA 3UADA 2QPEB 2YARA 5B1JA 2IDSA 2BZ7A 1GSKA 7PCYA 3X1BA 1RKRA 2IH8A 4F2EA 1N68A 2XWZA 2DWTA 4HIPA 2BP0A 3GXUB 2FWLB 1JXDA 5I6KA 4G7QB 2YAPA 3PAUA 3T6WA 1OE2A 2BWIA 1JZEA 2EILB 2PPAA 4E9YA 1AANA 3DIVA 1HFUA 4E9XA 2N0MA 1JZIA 3UAEA 1BXAA 3EH3B 3OMNB 3PAVA 4Q89A 4UF7C 1OCOB 5PCYA 2CJ3A 3FQ2A 1F56A 3EHBB 4A66A 4E9VA 2UX7A 1CYWA 4KO7A 2H3XC 4A68A 5B7MA 1TU2A 1AZBA 1KGYE 3FU9A 3ABGA 4RH4A 2XXFA 3IBOA 3WNIA 4A67A 2TSAA 2GSMB 2XXGA 5TK2A 3N2JA 4E9WA 2GHZA 3FPXA 1E67A 1SFDA 5IY5B 4KNSA 2YAHA 1RZQA 3T9WA 1PZBA 3PLYA 3AG2B 3GYRA 1ETJA 3ABLB 3L45A 2CUAA 2OJ1A 1FA4A 3NSCA 1GW0A 1OF0A 4HHGA 2X87A 3JT2A 1SDDB 3FSAA 2PP9A 2BW5A 1J5DA 1HAUA 5FC9A 4N4YB 3UAAA 2R7EB 2VSKB 1CUOA 3PXLA 4G7SB 2J55A 4NAJA 1AS8A 1PLBA 1QNIA 1KYAA 2QPDB 2XVBA 5LDUA 1SF3A 1ASPA 1KDIA 2EIKB 5PAZA 2DYRB 3FPYA 1DZ0A 4YVNA 3EF4A 1AR1B 1EZLA 5I6MA 1A4AA 2BP8B 3UACA 3ZX1A 2QT6A 3T6ZA 1BAWA 2VN3A 2ZONA 3AZUA 3QJTB 3CVCA 6PAZA 1B3IA 4DP8X 2XU9A 1NIBA 1OCZB 3FU7A 4HAKA 5F7BA 1ZIAA 2FJSA 2FQEA 1E65A 2VW7A 3NP4A 3IEAA 1YLBB 4TXVB 3IE9A 1JZJA 3NJMA 4JKNA 1WS7A 4GP5B 1BQRA 1L9RA 2TSBA 4GP8B 3AG4B 1RZPA 2XLLA 3ZDWA 3N55A 4G7RB 1ID2A 3FYEB 3PCYA 1E30A 4YVUA 3WG7B 2FQFA 2YXVA 1JOIA 2YAFA 5I6PA 5TK4A 1JVLA 1AIZA 2AZAA 4BWUA 3WIAA 4KO9A 2PPEA 1JXGA 3FU7B 2PLTA 2LLNA 2NRDA 2XX1A 4E9SA 3T71A 1KBVA 1PAZA 2EINB 2EIJB 2IDQA 3NSYA 2IDFA 3X2QB 1PZCA 1ILSA 3NJHA 4E9RA 3NJNA 1NPJA 4FAAB 2BW4A 2IH9A 1GS6X 1KCBA 4GXFA 1NIFA 1GYCA 3EH5B 2GB2A 3ASNB 1CURA 1BQ5A 3QJVB 1A65A 4X4KA 1ET7A 2IWKA 1AAJA 5F7AA 3UGEA 3V9EA 4GP4B 1JXFA 3TBBA 2HX7A 1AZRA 1L9OA 2VMJA 3CVBA 4KOCA 2ZXWB 4PCYA 2GIMA 1WA2X 1SHXA 4W1TA 4HHWA 1EHKB 1AACA 1IC0A 2GC7C 2WO2B 4AKPA 4BWWA 1FWXA 1V10A 4DPCX 1ZIBA 3FT0A 3CZUB 2Y1AA 1PNDA 4UANA 5D4JA 3AW5A 4DP6X 3HB3B 1NIDA 2CBPA 1PMYA 1A4CA 1MG3C 1GY1A 3NSDA 4F7KA 5AZUA 2BZCA 4UAHA 4GYBA 3X1NA 1OV8A 3X1GA 5E9NA 1AQ8A 1GR7A 1ZPUA 2XX0A 2RACA 5ANHA 1CC3A 1SDDA 4WTQA 4N8UA 1RCYA 3AG3B 1SJMA 2DV6A 4KO5A 2FTAA 2UXVA 4E9TA 4G71B 1ET5A 3G5WA 3NJIA 3FSVA 4WKXA 1XB8A 5B1KA 4YSOA 3OQRA 5I5MA 1BYPA 5I6NA 4NERA 5B7EA 4E9QA 1L9PA 4YSEA 1KBWA 1AZCA 5AFAA 4HCGA 5D4HA 2UXTA 1AZUA 2GC4C 1JZHA 1M57B 2PPDA 2XYBA 3ERXA 3QPKA 4KOBA 3WKPA 3BVDB 3BQVA 4QKTA 5I26A 2YXWA 1A3ZA 1TEGA 4AKOA 2ZWNA 4GY4A 1ASOA 3FU8A 1PY0A 4K9JA 1AOZA 1PLCA 1J5CA 4DP5X 2VW6A 3TBCA 4DPBX 5I5JA 5B1AB 1E5YA 4A2EA 4YSDA 1AS7A 1M56B 1A8ZA 2HRHA 4W9ZA 2PP7A 1IBZA 2FT7A 1SF5A 5I6LA 2HX8A 1QLEB 2UX6A 3C75A 1KV7A 2I7SA 2IAAC 3WI9A 3T6XA 1OE1A 3FS9A 4AZUA 1KDJA 2A3TA 2HLEB 3CVDA 5B1JC 2XV0A 3U25A 1E5ZA 2UXGA 5AKRA 2P80D 4KNUA 2DWSA 2VW4A 1HAWA 1NTDA 3QJSB 3QJUB 2X88A 5I6OA 2PCYA 1L9SA 1NPNA 1GS8A 6PCYA 2HRGA 1NZRA 2VSMB 5B7FA 4HZ1A 3S3DB 1JZFA 4DPAX 4DP1X 2DYSB 2H5UA 3TA4D 1XMEB 1V54B 1L9TA 2AFNA 1J9TA 2B3IA 3NJJA 2CALA 4Q8BA 3MX0B 3T6VA 2CCWA 4P5SA 2PPFA 2E86A 1VLXA 1CYXA 3PPSA 1AS6A 4YSTA 1BQKA 2UXFA 3CDZA 1L9QA 1PZAA 3NP3A 4A2DA 2AVFA 1DYZA 2YQBA 3AG1B 4M4RB 3S8GB 3UABA 3NJGA 3RYMA 3NT0A 4DP9X 2CAKA 1W6WA 4YSPA 1JVOA 3ABMB 3SBPA 1NWOA 4G72B 2XUWA 1R1CA 1IUZA 2YAOA 4CSPA 4BK5C 4YSCA 1NINA 4YSSA 1MDAA 2BHFA 2PCFA 4FA7B 4L0PB 4HALA 3KW8A 2I85A 1M9WA 1QHQA 2IWEA 3CG8A 5EHFA 2JKWA 2IWFA 4KNTA 2PP8A 2HX9A 3FQ1A 3NYKA 2FNWA 1PNCA 5B1BB 1XB6A 4KO6A 1N70A 1SNRA 1IKOP 4G70B 1ZDSA 2DY2A 3KW7A 3S3CB 3IN0A 3TASA 5I28A 5B3SB 1J9RA 1ET8A 3ASOB 4YSAA 1NIAA 2Q9OA 4BDVB 1UATA 4PAZA 2OCCB 2B08A 3S3BB 3SBQA 1A4BA 4DP0X 8PAZA 2MTAA 2HZHA 1WA1X 3JTBA 2BP8A 3FSZA 3QQXA 4F2FA 3CDZB 2VM3A 1BXUA 3S8FB 3SBRA 2Y69B 3NJFA 2YAEA 2YAQA 4BXVA 4YSRA 1FFTB 4AX3A 2XV2A 1URIA 2J57A 4AI7A 1X9RA 2AANA 5A7EA 1NICA 1ZDQA 1GS7A 1NWPA 5I5IA 2XV3A 2GI0A 2QDVA 3EH4B 2JFCA 1WS8A 1ASQA 2Q5BA 2WO3B 2OV0A 2WSDA 3OD3A 2IDUA 1GY2A 1NDTA 2IDTA 3PAZA 3OMAB 4MFHA 1W6LA 4AKQA 3DTUB 1ADWA 3QJRB 3SQRA 4JHUA 1BEXA 1OE3A 4DP2X 4BDVA 5D4IA 3V9CA 2HXAA 2BWDA 3IN2A 1MZYA 3TU6A 7PAZA 3H56A 4BXSV 1OCCB 4A2FA 2ZOOA 4EF3A 2MRYA 1TKWA 1JZGA 1BYOA 9PCYA 4ZK8A 4ENZA 1AG6A 2FT6A 4DP4X 4M3HA 1SHWA 1J9SA 1ILUA 3WKQA 2W8CA 1V55B 3AY2A 3OMIB 4BWTA 3FYIB 4DP7X 1OOWA 2J56A 3GDCA 2BO0A 1ZV2A 1PCSA 3FSWA 1J9QA 2AZUA 4QLWA 1AG0A 1T5KA 3OM3B 1PLAA 2FT8A 4CSZA 1NIEA 4YSUA 1WA0X 1SFHA 1TEFA 2GBAA 2P80A 4A2GA 2H47C 3WNJA 1XB3A 3MBWB 2J5WA 4YL4A 1KCWA 2EIMB 2FQGA 3ABKB 4HCIA 4YSQA 3NSFA 1X9UA 2VM4A 4A2HA 3NJLA 1BXVA 2R7EA 3DKHA 2W88A 1WAEA 3FQYA 1PF3A 1IBYA 2I7OA 3NJKA 1MG2C 2QDWA 2FQDA 1MZZA 3D12B 4JHVA 3ZBMA 3ZIYA 3X1FA 1W8EA 2BP0B 3QJQB 1AZNA 4P5RA 4HCFA 1I53A 2PPCA 3X1EA
chains in the Genus database with same CATH superfamily
3QI9B 4BZ2A 2BSRB 2EQDA 2QHLA 4LLWB 1K4CA 3RVVD 3DHUA 2FX7L 3WIFA 2JB6B 3NIDB 5HDWA 2YA2A 3PWNB 3NCYP 5GJTH 5KYUA 4DEPB 4ZXBA 4LSDA 1WAAF 4U2ZA 3RWGA 2BZ7A 1P7QA 3X1BA 4JFYA 3MXWH 5D1ZI 2Y0SA 4MJID 1A9VA 2BP0A 5GPRA 4PM1A 2IXQB 4X6CF 1S7TB 2YAPA 3PAUA 3DBXA 3LPPA 4LGPB 1YEJL 3CVIH 5KYNA 2X6MA 2CSPA 1I1YA 3M86A 4OZFA 1JYVA 4ZFZA 1J05A 1DTUA 2BS71 1A4KA 1QO3A 3QRLA 4XVSH 5MERA 1JZIA 3ZHLA 2ADFL 5C8JA 3R7QA 4UDTA 1NH6A 2YKKA 3ULUL 4JO2L 4X5QA 5KSBE 1F86A 3T8XA 1WZAA 1OVZA 4W9FC 4FJYA 3AWGA 4KO7A 1NCGA 1PL3A 4OAWA 4FXGB 4M8QA 4AV0A 2MNJB 2QKIA 3WL9B 5CIPH 3ZYOA 2G3ZA 1AGCA 2XXFA 1I7ZB 3IBOA 4MQTB 4J7RA 4NWTH 3MRPA 4HAFA 4DF9A 4YXLH 4I89A 1T04A 4FL4C 4CGTA 1ETJA 4Q56A 4APQD 1F4WL 1G9MH 3I6KB 3ROLB 3STZA 1HYSC 2IBZX 1NBYA 4KK5C 5D7EA 2NUTA 1M3IA 2ARJA 3HPJA 3Q5YA 2GI7A 5ID0B 5B39G 4LCCB 3F7KA 1TJIL 4Y9GA 1E28A 1S7SB 5E8OB 4P4RB 4JFDB 5LHDA 2BRQA 5I0DA 5AOMA 3CC5A 2MOVA 2R1WA 1QLRA 2GKIA 2RIKA 5IGXH 2EIKB 3JWOC 4GAYB 1WWBX 2BRRH 5PAZA 1WFUA 4PS4H 3V0JA 2Z4QB 1QSFA 4HETA 2NY6D 4LCIL 4OJEH 3O4OC 5T3ZL 1YEEH 1NANH 3FRPB 1BAWA 1MJ8H 4TKWA 4G9FB 2W38A 4G5AA 2ZKWA 5IF0B 4DZ8A 3FF7A 1RUAL 3DTDA 1RSFA 2FJGB 3QG6B 5E00A 1NIBA 1OCZB 3SKOA 2VDKB 3CN4A 4UILL 4FLQA 5AVWB 3TPUB 5BOJA 3N50A 5JXEA 3PNWA 2NT1A 3SDXF 4TXVB 3GJFA 3LS4L 1H0DB 3VI3E 4CSSA 3KYMB 3L3JA 1XXFC 3KLKA 3UJJH 3W9DA 1HEZA 4U6HB 5DHYB 3B7YA 1EBAA 3PCYA 3D25A 5HYIA 1F18A 3WY2A 2EEAA 3U2SB 4JQIA 1RERA 2EH7L 5T1MB 1H8OA 5AVZB 2MHAB 5TK4A 2HTLC 2AZAA 3VWJB 5FS5A 4BWUA 4MCNA 2MOGA 3WFHA 5HJGA 5JMRA 2AXGB 1FYTD 2IBZY 3LRKA 2C9PA 2NNCA 1MI5A 4DAGL 2UY6B 2BY3A 4PJBA 2O72A 3KPSD 3TCXA 3VNYA 2IDFA 2ZCLL 3ZZ1A 1RJCA 1GSMA 1GCFA 4AGMA 5FA3A 3EYOA 1IC7L 2ATKB 4XN2A 2F7RA 2GEQA 4H88H 3LKNA 3MRQA 3ALXA 1LO0H 3ARBB 3ASNB 2VXSL 4UNVA 4D0BA 5ABDE 4BFOA 2P8MB 2RAMA 1FFOB 3RVTD 1IC7H 2BS8A 2EXTA 2MWCA 2Y7NA 3MA9H 4EKXA 5IEKB 5JXEC 2Z91B 3FCGA 4OFDA 2N1KA 4FERA 1A1MB 4MQSB 4A6YB 4DN4L 3HMWH 3NG5A 1W8NA 3UBXB 3ATBA 3UTOA 1GL4B 4KZEL 1OQXA 2QPUA 3NZSA 3FUKA 3QIUC 1MCBA 1KT2B 7TAAA 4OLWL 3NN8B 2AQNA 1Q0YH 4P3WA 2D03H 3TBVA 2DI9A 3L3DB 3GNML 3KWUA 3RFZA 1EHAA 2FL5B 4M9OA 3V6OA 1GY1A 5CZKA 4B97A 3NSDA 1ZLVH 3UYPA 3VXSB 5J1SC 3QXUA 1KTJA 1QHOA 5CWSB 1VCAA 2CKBH 4PRPB 1L9NA 4G82A 1KCVL 3MRPB 4MRCA 4KO5A 4OTXL 5IHHA 1IJNA 1NEZA 5I8EA 3D1MC 1FE8L 3N85L 2W92A 5FO2A 1E42A 3T8VA 1HI6A 2CGRL 4GRLB 4LQFL 4APQB 3NTCL 4YSOA 3MCLH 5HI5D 1DSYA 3SQOH 3VXTB 1IIKA 1RMFH 4HW6A 4AYFB 4E42B 4BYHA 2DBJA 4U2YA 4ADJA 1QASA 2HJLB 4MXQC 4ENED 5ALCH 5EBLA 1Q1PA 1G1CA 5BRZD 3RU8H 5CU9A 1X5FA 3KLHD 4PG2A 1WFOA 1EXUB 3EJPA 1YJDL 3CZFA 5D7IB 3E1F1 3LDBB 1NCJA 2G3NA 3BH8A 1QFOA 5IB4B 1F3JA 4ZNEE 3BP5A 1JHKL 3GIZL 4EQ3A 1ACCA 3F7RA 5JIKA 2X9XA 3MV7D 3QHTC 4F8OA 3HIZA 1QRKA 4GRMA 4HGWB 3F62A 4JEGB 1F11B 3I2CL 3WTUA 4P2RB 3TH3T 3GLAA 1QKZH 1T83C 4JM2F 4HZAA 1MCSA 4YSDA 4JR9L 4ZAKD 2XQYA 4L3AA 4LLWA 1CBJA 1UFGA 3QVAA 4PJCB 1IAKB 4MJ5A 1HS6A 1IO4C 2EEBA 4JVWA 1OL0A 5GS0L 2WINA 3ZE2F 4IIQA 3ZKQD 4BQCA 4UDTB 2PO6A 1PKQE 4ELMF 4PJGE 3FS9A 5TF0A 4F7EA 2A3TA 3JV4A 4PS3A 4DOHB 1AXTL 5F1IB 4RZKA 3RGHA 3B9EA 5B38B 1FUNA 3BEVA 2L0DA 4WU5B 5GRJL 3UBFA 4PY7A 3WENA 2NW3B 4I3RH 1OSZB 1D6VL 2MKWA 3ETSA 2X88A 3BOVA 1Z9OA 4L05A 5EOTA 2KZKA 4AC4A 2C1PB 1QA9A 1RPQA 5EG6C 1QATA 2YBRA 2YQ3A 3KM1A 1ETA1 2VYRE 4LSPH 4O02H 4DPAX 5IVOA 2CNYA 2EO9A 1CL7I 1MJUL 3DJRA 1YEEL 3LZNA 1J9TA 1A6TB 3E2HC 4MD5A 4HIXH 5I73B 4F9LA 2I9TA 2B14A 5HYQA 1LQBC 2PPFA 5IHBA 4L2LA 2PYFB 4DO5A 4FFWC 2BPBA 1EO8H 4BZ1H 2VLRE 4YDIH 2H0JA 3QUKB 2OL3A 4LDEB 4A2DA 1IT9L 2JQMA 2VDMH 5L4FA 5FM8A 3GSVB 5GRZA 3H9HB 5IBTH 5IJBC 1MIEL 3VFTB 5E1AB 1AKJB 3UOAB 4X7TB 2WSKA 3APFA 2DJUA 2VTFA 1TCMA 4RMRA 2CQVA 2XUWA 3DV4B 5EUKB 3APMA 4X9GA 3R8QA 1UQSA 3A4DA 1NOFA 2B9AA 3DJ9A 4L8SA 4YSSA 5FO8A 4JVUA 4X5LA 3VXUD 4M7LH 4U1GB 1R0AL 4B9KC 4KRNA 3N42F 4MYPA 3ZDXF 1E4XI 3FUFA 4MTMA 5FA4B 3HHSB 4LASH 3BZEA 3QIUD 4JG0L 4QGYA 5JHDE 3TA3D 4CVZB 3IFPA 5EN3A 3TH2T 2R29H 3CXDL 4XMVA 3PGFH 3O81A 2NY0D 3KPLB 4XMPL 4ZNCD 2FATH 1N64H 3GXNA 2FL5A 3H9YA 3VUAA 2XV6B 5ITFA 3KEHA 5IMLB 2HFFB 3LVEA 2DKUA 3FO1A 4PJDE 2BC4A 3VSQA 3TNMA 4KROB 2X2UA 3EYQD 2VDNL 1H6TA 3BKYH 3FQ4A 3SE3C 4Z7OF 5EF3A 4QD2E 5JA8B 1KIUA 1BXUA 1T89C 2FX9H 1EEZB 3M6DA 4UTBL 5DD1H 4XNUL 4UM8B 1LK2B 4I77H 1N8ZA 1T21B 5HJ3A 5I1IH 3OL2A 1T5WB 5HHXL 3D87B 5DJZA 1E0OB 4H25B 1JN6B 3OSVA 5KBKA 4TSBL 4PJ8B 4FQXD 3MSPA 4U1LA 3TN0D 3DJZA 3EH4B 2NTSP 3RL1B 1WCBA 4LK4A 4MQXC 5AW3B 1RIUH 3MODH 5L9DH 2E7DA 2WO3B 2O6FA 5GGUA 1JFQL 4GO9A 1ZK9A 5GGSY 2W0KA 3MJ7A 2HPOA 4MFHA 2ZCKH 4KROC 4RCAA 3FU3A 3RNQA 5I71B 1IEAA 2F53D 5IB2A 3P0GB 1IGCL 1GAFL 1KTLB 1ZA6B 3WAJA 1NCHA 2AERT 3TU6A 4WCYL 3LEVL 1ZWIA 3MKGA 4D0CB 3DURB 4G7VL 1CFTA 3AGVA 2ZOOA 3IYLW 5I1DB 1IEBA 1XO8A 1QLFB 4FA8A 1RUML 2EH7H 2EIZB 3OGCB 4MBOA 4ENZA 4DJMA 4QTIH 4U6YB 4XOCA 3RWJA 5IFAL 4E5XB 5ERWA 3GRGA 4AIZA 2J8UA 3OMIB 3MACH 1I3GH 4JHWL 3FB6A 4YGAB 4XMLL 5BUAA 3L5XL 2ZG1A 5T5FH 4OCYH 4DKDC 4Z6AT 3BE1L 3DARA 3HR5A 1M2OA 4X6DF 5TDNA 3TEYA 3N44F 3IGAA 4HU2A 4UTAH 3H9HA 4NNYB 4JPIA 1A4KB 1QO3B 3N6YA 4YHZL 1PD6A 4N0UA 4O58L 3RWEA 5FPIA 4EDXA 3NSFA 2QQKL 4WV1A 2YRLA 1IM9D 1DQML 1X5JA 1X5GA 5HVHC 4FFYH 5DSCB 3MLZH 1NANI 2X44D 1HHJA 1CE6A 3AREC 2ICCA 2QQKH 3Q1EA 5C0BB 3GIVA 2KZ1B 5KJRL 3L4CA 4JRXB 2H1XA 4AMKH 2R4RL 3OF6D 4IOFD 3G5XB 5D7SL 1BMWA 1E9PA 2YC1B 4JHVA 4PRIA 5DLML 1OSPL 2ZNWA 4X9IA 5DHXB 4HS8L 4ES8A 2CR0A 4MJ6A 3DX9A 2AK1L 2J8UF 4FKKA 4XMUA 4MAUH 3VD4A 1OAJA 3H4HA 3SOBH 5F1OB 1HZKA 1G1YA 3EYUH 4PGEA 5B38G 2C3WA 3ARDA 2XVGA 3EOTH 4LCWE 3D69A 3L7EB 3EUDA 3QHFL 2X4OA 1OGSA 3VI3B 5J13C 4V1DE 3C5JA 5H2BA 2ED6A 3O6FC 1V8HA 2BC4B 2UY7A 2XWZA 3T3MB 2FWLB 1JXDA 4N3TA 3UDWC 3V8OA 1YSOA 3O9WB 3GI9H 2XWJA 1WC7A 4WWPA 3T6WA 1JZ2A 1XF4A 2BWIA 5EIIG 3QFJE 4KI5D 1XD0A 2Q8AH 4D9LL 4F7PB 4ZI8A 1I7TB 1AD0B 4QLRA 3VFSB 1H3PL 4NZJA 5C7ZA 3DX3A 3BZ4B 4LKCB 1XGYH 5C9JA 3K5SA 4OJDH 4I1PA 3B1TA 3EHBB 2QVTA 1MRCL 1F42A 3VM7A 3RWFA 2DQFA 4NQEE 1DJHA 1KIUB 3ZMRA 3EZ8A 1WWAX 1IC4H 3I9IA 3B9VA 1A3RL 2ICWB 1TU2A 3B43A 3JWDL 2JKIS 4NUQA 1U8KA 3DO4A 3VI4F 3BAYA 4PB0H 5FDYA 4ZZFA 2KKQA 1QP1A 3S5LA 4CMHB 5I18H 5BQ7A 2GHZA 4K2UL 1GGYA 1FV1B 1XAKA 1E5CA 2PW2B 2I60L 3BAEH 4BFEA 4N2MA 3PLYA 3NA9L 2WC7A 2BDNH 2CUAA 3HG2A 4EVNA 3MI6A 4ISVB 4LARH 5DQJA 5KJ7E 4AGNA 4YAQA 3IMSA 4WUKH 5GRVL 2X87A 4PJ5A 2BOCA 1SEBB 1UVQA 3WFDH 2OCJA 1IZKA 1J5DA 4KH9A 4BUHA 1HAUA 2O6DA 2ZXAA 1YNKH 4QY8B 1TPXC 4JHAL 1MFCL 3PP4H 2WZPD 4W70A 2JELL 1RFDL 4D7BA 4XNXL 5HJBA 2UZYB 3KLLA 3UC2A 1JAEA 5K1VA 2XZCH 4LF3A 2EDLA 2WP3O 2AJVL 3OJDB 5DJ2B 2EDBA 1WBYA 4YFLF 4LSUH 4JRYE 4GRLC 1FO0L 4KXCA 4XNXH 1PBYA 2GUOA 1CDGA 4Y4HA 5D7JC 5CR1A 3ZE1B 3L4ZA 1ML0A 2VZSA 1IAII 1UD6A 2GCYA 3HUJB 3ZX1A 5AVYB 4A7QA 1JF6A 3GSNB 4PJAA 1RQ5A 3CD4A 4N8VA 4YLCA 4PJIE 4X6BA 4Z76B 3HC0B 3W38A 1EHLL 3K4AA 2VZ1A 4LVOB 4L1SA 4PJ5D 1I85A 4P04A 3WV0A 2RFXB 3I50H 2R2EB 1OF2B 1RK1A 2Y6SD 4KC3B 4X9YA 1FN4B 4G8GD 1MJJA 1MHCB 2TSBA 4LP8A 4UCFA 3DHJA 1N3NA 3MO1B 4IQHA 5J12C 3VYNA 2ZSVA 1AYOA 4KKNA 1Z2KA 1KFAH 4Z7VB 3W3BA 5BUGA 3G6JA 3O6LH 2VDQL 4NLHA 1ZHNA 1GOHA 3HNVL 3HA0A 3U48A 3R06B 4G11A 4OCWL 1T4KB 3EDJA 4HPYH 3OAYH 4AUJA 1JXGA 3P0YH 3AITA 3H6JA 3RDTD 4F3FB 4KMQA 3V6BR 5T5FL 4O2CB 2HUHA 2EIJB 4LMQI 1LMIA 2ODIA 4DAGH 2W65B 4FZEH 4JZJC 5J6HB 4ZS6C 1L4IA 4WI0B 3VD7A 4K15A 3T4AB 2XQBL 4R4FH 1BVKB 1MPAH 4H1LB 4XNMA 4NDMA 2OQJA 4KKBD 5IJKA 1GYCA 2Z1PA 3EGDA 5HHMD 4FI7A 3MJ9L 2F58H 1M1XB 1YZZA 4OZGF 3J27A 2R8SH 2YUXA 3VWJC 5IF0A 3ESOA 3QZWG 2IWGA 4IRZH 1L6XA 3GBML 2R56H 3EO0B 1DL7L 1ES0A 1NGWA 3T0BA 3D85B 3L5IA 3KPNA 2YJLA 4PS4L 1EUUA 4UUJA 3CFCL 5GGTA 5CCKH 3CFIC 3OR6A 3AS1A 1RU9H 2H3NB 1OSPH 3BLPX 3ZTEA 1RXLA 2H6UA 4N28A 2CO7A 3NCCB 3HS0B 3QO0B 2V2WB 1KGUA 2V37A 2LT9A 5FKPB 2DEYX 3QCVL 3RL2A 4P2OD 1UZ8B 4N9OB 4GQPH 3UYPB 3VXSA 3F64A 1MW0A 4G6FD 1T66D 3HR5B 3NH7L 2FTAA 1KN2H 2CLRA 2GJ6E 5KSAB 1E4XH 4MNGE 1WVZA 3P4NB 2RCSL 4LNRB 2ZCZA 3LQAC 3U6XA 5AKVA 2A9BA 1WISA 3DYMA 4PJFF 1XB8A 1WLHA 1SQMA 4X6EA 4U33A 4XVTH 2F54B 3DROB 1FRGH 5B7EA 3VWJA 1PQZB 4H8QA 4HCGA 3SZ6A 3APCA 1NFAA 3CN1A 4GI8A 1LDPH 2DQDH 1MW2A 3V5DB 1CFTB 2GC4C 2OMNA 5I1DA 3P0VL 2HRLA 4PJDF 1ZLSL 5E5MA 4TQHA 2L7JA 4AKOA 5C0GB 1HDMA 1BWMA 2C3VB 3WE1A 3ZKXB 1ASOA 3HG5A 1BX2A 2LOEA 4EI5B 4XODA 2NZ1A 2UY7B 4JY5L 5I1GL 1MH5A 3PY9A 5FLUA 5AOIA 5GS0D 3BWAB 4OFYA 4RFEA 4B0MB 3T3PB 1GYWA 1RULL 5I19L 2E8ZA 2W60A 3LH8A 3ECQA 1GGCH 4ICWA 1T7ZA 4DGYL 1UXSB 1NBQA 4F1ZA 3S4SA 2KDGA 4L1HA 4NNPH 3BFQG 4K5OA 3HZKA 1NM4A 4KKAC 4L4JA 4XGZB 3ZKMD 5I15L 2WZAA 3WL9A 3ULUC 3F7YB 1JIBA 3GSQA 2FX7H 1BECA 4G6AD 3HMXL 1I4FA 3VD5A 3QG7L 1A3LH 4BGDA 3GJEA 3VWKB 1OAZL 4PHZA 1F6AA 1OAQL 4NUJB 5GGVY 3B34A 1KLFB 3BUDA 3H85A 1ITBB 4H20L 3AWEA 4L8DB 5GS3A 5HGGS 3WFEL 5I2IB 3INOA 2NY7H 5L2KD 2AV7A 5E94A 5LQBH 4KI5E 4QJ5B 2J6EL 3F3HA 4UWQB 2WLIB 5I6XB 4L5FL 2I32A 2Z1KA 2A0LD 5SWZA 2O61A 1AIFA 3CX5K 1ZSDA 1Z9MA 4TNWK 2VDLH 1K3IA 3GDBA 3AQYA 5KSVB 1G6RB 2E86A 4PGDB 1NCAH 5CD5C 4L4TB 1L9QA 3MRMA 4P5MA 3AG1B 4UT6L 2IPKB 5JLZA 1L9MA 1GGBL 3ECVA 3UG3A 5D2NC 4NDMB 3SPVB 4DGVL 2CO1A 3CAFA 2GVYA 1G4MA 2AV1A 4HUCA 2ZSWB 5C0EB 1IUZA 3WXVH 1N6UA 1JPTL 3IDNB 1E5AA 4R9HA 3RHWK 5L0QB 1WHOA 1LVEA 3MRKA 3VGGA 1Q8MA 3BQUA 3DV4A 4XT1C 2PF6A 1SLWA 2VJ8A 2J6EA 1BVLB 3BYYA 4FKHA 1THAA 4KMLB 2P28B 1QKZL 2YFNA 4PJAB 5I9QB 4A2MA 1BMZA 1S8DA 3CK0L 3WTTA 1CICD 3MJ7B 4OF0A 4XO8A 1HKFA 3LRLA 2N56A 3HZMA 2B20A 4XN9A 4X4YA 3IFPB 2WN2A 4YSAA 2BLFA 1J7VR 1PYWB 3DA0A 3JT0A 1O75A 4GQ9L 3FQRB 2YD8A 5T1LB 1OWRM 3L2NA 3OAZK 2OJZL 3CDZB 4HVBA 3T4YA 1R17A 1KEGL 2C1PA 1ESOA 1SOSA 5JHAA 4J3TA 5D1XA 4OGXH 2NW2A 4JO1L 4ICXA 4Y5VC 5A16A 1OGAB 2LGNA 4OLVL 3OAYK 3CXHK 1X9RA 3AGWA 4PY7B 2AANA 3QDGB 4ZFFB 1DJXA 1ZDQA 2A74C 2BIHA 2PYEB 2WNKA 4FHBD 1EJ8A 3IJ9A 1PG7L 2BSTB 3UBXG 1UA3A 5DFAA 4XOEA 2EAEA 2ITCA 4ZTOL 5ITBL 3QXAB 1I9RL 3V9FA 2DI7A 2JCCB 1ZSHA 2G0LA 4NP9A 3PGDA 3VG9B 4JPSA 4F7CB 2APBA 1XH0A 1CQKA 3RWCA 3HHRB 4OCSH 5DK0B 3HNVH 5FIEA 5MHSE 5T3ZD 2BWDA 3NCMA 2E27H 3MFFB 4FFTA 3CSTA 3P0YL 4B5ZA 5FFLA 5D5ME 4UQ3B 1GOFA 4BSWB 1RSYA 3PL6A 3UG5A 5AEAA 4ZK8A 3TIEB 2FT6A 4HCRL 1OAXL 4WJG3 1TDQA 2NYYC 3O4LB 1HXMB 1QQDB 2FATL 2O6PA 4BH8A 2A6KA 3FYIB 1QVOA 4FHJA 4ZUWA 2CGYA 3FHEA 2BO0A 3QI9C 5KYXB 3KPQA 4ZBJA 3BP7B 4MCMA 5GRXG 4P9HC 4YLBA 1F6AB 4L8BB 5IHUH 1JV5B 4L4VD 1T1WB 3K46A 3U7AA 2AEQH 2R1XA 2O93L 1JRHH 1EEQA 4DGYH 4OLWH 3O4LD 1MCJA 2LFEA 3RILA 1X9UA 1NLBH 1G6RA 1DLHA 4MDJB 1ZHLA 1HEHC 3H7BA 1TNMA 1QR1A 5L7XH 1DJSA 3V5KA 1WTGT 3LXUX 1ZGLM 4I5BA 2WCPA 2BIIA 3WUZA 4M5ZH 4PLJC 4WV1B 3ZW3A 4WY7H 5C0DA 3T5WA 1ZVSA 2XVKA 2CRIA 4OLZL 3OKDA 1MG2C 4R96B 5TPWL 3QPXH 2AW2A 2FQDA 1OAZH 1SN2A 2BSSB 2DF3A 2Z8SA 3ULUD 5HPMA 4K23H 4AK1A 4UM9D 3AM8C 5F7MC 1CYGA 3KDPB 4OLZH 1IAKA 3SGJA 2OMWB 5JW4M 4BE6A 2NZ9C 5HHPB 3BDBA 3RGVA 1TFHA 4OIAA 3H4FA 1Y0LA 3ESPA 5DMIH 3TEWA 4XCCL 1QTYT 3ULAB 5ABAA 1IGCH 4AIZB 1TTBA 2XPGB 3J2PA 5FGBA 1E4XL 1UT2A 1KN4L 1FORL 3D6GA 4A6YH 3F7VB 1FL3B 5C6TL 2PYED 1JVKA 2NX5E 4RMSA 6TAAA 3ISRA 4WF7A 2OXGB 1OW0C 4KQ4L 1ZHBA 3OPUA 3IGAB 4W9LC 4RSYA 1GTFA 1P4BL 4PJHB 5BW7C 1A4JA 2YD3A 1MCQA 4YO0B 1R24B 2DTSA 3GMOB 4ONGH 1KXTB 4RVBA 3FOMB 2A99A 3Q0HA 5DC0A 5IB5A 1NFKA 3TTSA 4LO9A 4RISH 4LSRH 1YPZF 3BFWA 3EXJA 4BCZA 2EO1A 4ZX4A 5A2AA 3UBXI 3GTVA 4QHKI 5FA4A 3B5TA 3QT2A 4HKXA 4LDCA 2ZUTA 3EJTA 4P5KA 2EUWA 3ELQA 1A21A 3FKUS 4XCNA 4FA6A 2QPFA 4ZO8A 1PKQA 3DUUB 3TJEH 4AMKL 1KB3A 3J8F7 2Z9TA 5IQ9A 3VXME 1ZVYA 1GPOH 4IGBB 4TNGA 4WENB 5FB8A 2R9HC 3PXLA 4S1RH 2ZOTA 4QTHA 2ITDA 1IAIL 5HDBB 2FECL 1RIHL 5D2LB 3QIUB 4YBHA 2YPVA 4EN3A 1NL0L 1QSFE 1TO4A 3UPCA 4JO3L 2X3AA 3ZO0A 2VAJA 3TVMD 3NGBB 1NSNH 2EKSB 1T1WA 4URKA 3IPFA 2X6BA 1U3HB 5LKNA 2VN3A 3NJXA 4EBQH 2HTLD 3LSOB 5ESQA 3H9SA 2AAAA 3AM8A 1LK2A 2YO3A 5E6YA 3RNKB 3TNNB 1IKNC 1CPUA 3BVNA 4NN6C 5CSZB 3KPQB 1DVFB 2FQEA 2XI9A 4XB8A 1HL9A 3C5XA 5DZVA 3ZR5A 3IEAA 4QHUA 1YDPB 1CBVL 4KK6C 1J1PH 5G4MA 5CN2A 4DGVH 1TCRA 2RFXA 1WBXB 2PXYA 1W0VA 3WFBH 5DA4A 3ZDWA 1HCFX 5FV1L 1UKQA 4XMKL 1J8SA 4W81A 4M8RA 2VDNB 1WIOA 4ZO9A 3CV5A 3MZGB 2E7CA 3WEAA 1MIMH 5CZRA 4HJJL 1AGEA 1OAXH 2YSSA 3MRRB 1EANA 3FO2A 2F6AA 2ATPB 3ZO9A 2MOQA 1L0XA 1RD6A 3MRHA 3FONA 1QNZH 5G5DB 1KB5A 2VH5H 1BZ8A 1Q9LB 2FX9L 4XOAA 4K0OA 3BH8B 3IDJA 1UB5A 3BEWB 1PZCA 5C0ND 2BVQA 1G6RH 2P1YA 2JNZA 3FQWA 4MA7H 1NGQH 1HJCA 3CHSA 1R33A 4HQQL 1F6FB 1S9VA 2QZ5A 2N1TE 3TCLB 5AB0A 2C1OA 1CFQB 1BQ5A 4OLVH 3D7PA 1AGFA 4HIJA 5F7AA 4RA0C 4OD1H 5GGSA 3FTGA 4PJIB 4ES9A 2VM9A 2ZOUA 5GSRB 4YBLC 4IU3A 2HX7A 2VDPH 2NSQA 1KJVB 3COOA 4H5SB 3OKOA 3V4VH 1IE4A 2FGWH 4NJAH 2GUOB 1W72H 4Y4HB 3IF1B 4JFUA 4LSSL 3RIAK 5AWNH 2JKNA 4U3SA 1W0YT 4BFGA 4WTZG 3ZOAA 1RUAH 5D4JA 3AW5A 1MFUA 3NCBB 2W0PA 2WVUA 3HB3B 5BQ7B 4WTZA 1R9FA 5TD4A 2R9HD 1GC1H 4TUOB 3Q5OA 4ZTOH 1U8PA 2UV3A 2R39A 5F21B 4JJHA 5BO0D 2BSTA 2WNXA 3WKML 1TJGH 2EDWA 4MS6A 3BIAX 2BMKA 2BX5A 4IIQC 2Y6SC 3T77B 5DJCA 4KTEH 1OIOA 1G9HA 2CG9X 5HY9B 3BUQA 1I3VA 1PSKL 3MHZA 1R3LB 4TPRH 3BN3B 4CDGC 3TEZA 3UZEC 5C08A 2BY2A 3CH1A 4OD2B 4F33A 4OCYL 1H8LA 1DDHB 3EDFA 5LXGL 4OT1H 1CFSB 4YN3A 2X4QA 4GRLA 4W6YB 4AW7A 2OYMA 1AGDA 4O5LH 2X4OB 3WKPA 2KT6A 1M57B 4GRMB 4XAWH 3QZOA 4AL8C 3BIBX 1IZJA 1K3ZA 1LO4L 3GUFA 3OXRA 4RWYH 1A3ZA 1X4ZA 5HGHB 5I8OH 2ZWNA 5IB3A 3HAEB 2MCPH 3HPLA 4K8RH 4YPGA 2WWNA 2CHWA 4XRCA 2XG4B 1EXUA 2CIIA 1PLCA 1U6AH 4DP5X 5I5JA 4XVOA 1AHKA 4YE4H 3B37A 5BO1H 3WIHL 1WYJA 1TTRA 4JAMB 5KYWA 4DETA 2IFFH 4JO8A 2PW2A 3KLAA 4HWBH 1MLCB 5TPWH 4FMVA 4OLXH 1ZD6A 1OB1A 3GRWH 2ZSWA 3AREA 1D5ZB 1MFVA 5JHLA 1TQVA 3GXFA 4LL9A 3HVNA 2VSDA 3DNKA 3VGEA 2DWSA 1L0YA 4WK0B 4K23L 4R7NB 2BY0A 2OP4L 3ULVL 4GAFB 2HRGA 1IGIL 2VSMB 5C6PB 1NOAA 4M6OL 1KN4H 3MRNB 3UZVB 4A6YL 3E8UL 5C0BE 2CKNA 3TA4D 1BLIA 4P5KB 5DEFB 5DUPH 1V54B 4YNYA 4ZDHB 3N1MC 4S1SH 4XCCH 3ARVA 2XN9E 3QR1A 1TENA 2MTPA 3RB5A 3MX0B 5D1QC 5F9OH 2K9UA 4X6DE 3HOGA 5DHEA 3ZZLA 1S7RB 5KSAC 3QULA 3TH4T 3VACA 1SJEB 3KM2A 4ODWA 1FO0A 3GI9L 4GKOA 5IEHA 5C0CD 4N1HB 1BHGA 1NMCC 3P11L 3UABA 5JXAH 1Z0NA 1MHEB 3BZFB 3P1VA 3NT0A 4HJEA 3MMEA 3NIDF 1W6WA 1K85A 1MAML 4YDLC 4LCIH 1CDIA 4K2UH 5BVJB 3IAGC 3MKKA 2YA0A 5A6LA 3G5YB 4U1IA 3AB0B 1A6UH 4DESA 3DIFA 3HE6D 4RAHA 4WDIA 3EDDA 2DQUL 3O6KL 2GY7B 1KJ2B 3TF4A 1H15A 3JUYA 2J8UB 5SX4H 4HALA 3VXUE 2BVUA 1BSIA 1ZTXL 3MN8A 4G7YH 2ZNXA 2HX9A 3QUML 4G9DA 1QLFA 3W5MA 1TF4A 1EAJA 3NYKA 2VQ1B 2NDFA 4KITB 2B15A 2WUBL 2XBDA 5B1BB 2XZAL 1P5UC 2B1AL 3TN0B 5I28A 4G7YL 4L3CB 3FCBA 1YAZA 4ONHA 5IESL 2JKXA 1QFWL 5DI8A 3WN6A 3DECA 4P06A 4PAZA 5L0QC 3ZLQC 2F5AL 1A4BA 1UWEL 4DP0X 2P52A 2QQQA 4Y2NA 5EBWB 1J0KA 5FDWB 5IESH 3MLVL 3PUUA 4Y5YC 3W39A 1E3XA 1XVSA 5C0NC 3HKFA 4GRWF 3M46A 3MXVL 1F3RB 2GJ6A 2HKFL 2X4NB 1NL0H 5IQNA 2V4LA 1DBKH 4Y8DC 5F0MB 1E2ZA 3RVUD 2EXWC 2XHNA 2YC1A 4EUPH 5AOKA 1D7BA 1TLKA 3MDJA 2QFPA 4JN1L 3S37L 2XZCL 2VXSH 3OKYA 3QC5X 5KW9H 5KS9A 5F9WB 2LU5A 1M05A 2ZOKA 1TZGL 3BUIA 1K4CB 2DQHH 4OBRA 5EZOL 1JN6A 1N6VA 3TONA 4C4KO 4P2RE 4XN8A 2JFCA 4P59H 4WHTA 3S34H 1RZKC 5EU3B 1LMKA 5F96L 1J0YA 2QHRL 4OGZA 3OZ9L 1LHZA 1N9PA 2J1XA 4JDEB 1S9YB 2Q87A 1G84A 2CHDA 5GISL 4M8UA 3SYQA 5J8OA 3O11A 3D18A 5HDBE 2A77L 3QQ9D 4UUJB 4PV8A 3ESUF 4JHUA 4V1DD 1MCDA 3JZYA 2JJSA 4TM9A 5KEZA 7PAZA 5KYWB 4NWTL 1HSBA 5MEPA 5E8EB 5LXGH 4L9LA 4F8PA 3T2OA 3X14B 4H8WC 3LRHA 1I8IB 2C26A 2WNGA 1DBML 2NY3C 3D33A 2E76C 4MX7A 2WQUA 4YMPA 2WWMD 1N8ZB 1AGCB 1LO4H 4XXDB 3EFDL 1ZMYA 4YNYB 3WN5B 3P3TA 1M6OA 1G0DA 1S3KH 1BV8A 2ADIA 4NZUL 4PJFE 5IHWA 1E2WA 1U6AL 4WUUD 4F91B 2IAMC 4PJ9B 2FZ3B 2BNRA 1PLAA 2WKOA 5GRWA 1NIEA 1B0RB 2NY3D 2P5EE 5E2JA 4OI7A 1S3KL 2V0AA 4KHXH 4NGHH 1RZJL 4ZAKB 1QEWB 1C8QA 2IV9A 3SDCC 4QRRB 5DF0A 4PV9A 3VFPB 2G60L 5FYKD 4Y4FD 4Z7UF 5GZNA 3F04A 1KGXA 1BVNP 4LIQL 4NGHL 1OT1A 4LVNB 2M2DA 1GJIA 2LU4A 5H37A 3PWUB 2WZ6A 2DJ4A 3S97C 3Q44A 3ARDD 3ZQWA 3PGDB 1NFIA 1ETZA 5L7XL 1W0WB 3FT4B 1PTZA 2F2HA 2JMRA 3E38A 2SEBB 3PWNA 5H94B 3LMJL 5K9QI 5J3HD 3U9WA 3Q2VA 3T3PF 3QXAA 4JFFE 5IROC 5I74C 2FR4B 3IAPA 1S9WA 4NOBA 4S1DD 1KXQE 2P43B 5HI3C 3T1FB 4P5RA 4D8PA 4ODVL 4ACTA 1KCUH 5K59E 5DZNA 4M6NL 1W15A 3ZE0B 3O2DH 3U79A 3OXRB 4CMHC 4DN3H 3GBEA 4XO4A 3QIBC 5B1JA 2C9VA 3ZL2A 3G6DH 2IADB 4ODSH 1Z9SA 2Z92B 2WIIA 4NXKA 2JXMB 3O4LA 4FNLH 1UACH 3D4YA 1N68A 1KGIA 3JTSB 5IMMA 4D8OA 4GW1A 5CS7A 4UV4H 1KWGA 4WO4D 1ZANH 5D1XC 5F8QC 1NGYB 3CVHH 4FFWD 3PU7A 4MWFA 3ZMNA 4Z7NB 1OE2A 2OL3L 3O3AA 2IPUG 4JAMA 4B9ZA 3IDUA 4GNKB 3QB7C 4RNRA 2AS5M 4RZCA 3AQXA 4NSKA 1FVEA 4JJOA 3UFIA 5D9SA 43CAB 4CC0A 4XVTL 3UAEA 1D5MA 2DQFB 2EC8A 4ABWA 5FOBB 3PNRB 5LGKA 5T33L 1UD2A 4TYUA 3Q8FA 3SIKA 1JP5A 4KKCC 1LILA 1SOQA 3ARSA 3US1A 2UWEA 2YR3A 3IMTA 5JOPE 2VDKH 3VXUB 4EMZA 1B9KA 3MRLB 4GG8B 4A68A 2WY3B 1FIGH 4JFZH 1KYOK 4XN4A 5JZ7D 1EGJL 4C58B 3O0RH 4PRAA 3U2IA 1DUZB 2BVTA 4OLUH 3RKDD 2F8XC 5JO5B 3MLXH 4K8RC 4E9WA 2XXGA 4M1GL 5KG9A 3RFZB 3C9NA 3UDWA 5CP7B 2B1AH 2J44A 5D93C 4Q9RL 2CDGB 2B0SH 3O4LE 1SOKA 4OLUL 2B7DT 4AV5A 3VFWA 5H4ZA 3B2PA 2VLJD 4X6CE 1AY1H 1FNSH 3ZDYB 1UWEH 3T4AC 2KZBA 3HG4A 4L2YA 1NKRA 2HCZX 2X4UA 1MFNA 3WJMB 1VERA 3N41B 1WFTA 2F7QA 3WS3A 4EUPA 2CCLA 1C5CH 3K0YA 2NUPB 35C8L 2RMNA 5I82A 3MOQA 3RRQA 4G5ZL 4OZHA 3KPSA 1I8IA 1CGTA 2Q7AA 2WBJC 2YPKA 5DJXA 4KJQD 1WT5C 2HT3C 5FC9A 4HFUH 2ZX6A 1CU4L 4R5XA 1RHHA 5E6SB 5EU4A 1WK0A 3RKPA 3RG1C 2D73A 3G6JE 4JN1H 2JCCE 2ZYRA 3EGSA 1JI2A 4QRBA 3KL0A 4FG6C 4QTHB 3W81A 2QBWA 3N44B 5IMKA 3ZXAC 3S0PA 3BWUF 5CXPA 1X5ZA 3F7LA 3MOBL 5F96H 5DD1L 4MJIE 1RMFL 1CVSC 3M88A 5T1MA 5IROD 5GGRA 1DQLH 3X11B 6PAZA 2VR9A 4FTDA 5EBWA 1KGJA 1BPLB 3NVQA 2EIBA 1TTCA 4APQA 4YEEA 4NZRL 1YYCA 4IKLA 5GIRA 3EYOB 5IQLA 1DUYA 5GZNC 3KLHC 2K7PA 2OMBA 1RZPA 3ALPA 5F7NC 3PJNA 5FK9B 1YUHB 2DICA 5AW8B 4N2DA 4WI6A 2AJSH 3F85A 3PDOA 4OB5H 3OXSA 1HH9A 2NY6C 3BCFA 4U05A 3RI5F 3RIAF 4DGWC 4BZ2H 5CSGA 4XP1H 3VWJD 1KXTA 4NO0D 1SUJA 1KJ2A 1PLGH 2BIMA 4EN3D 1VFAB 3K7UA 3MBEC 5FUOL 2DQIL 3RJDA 4BKLB 4L48A 1M42A 2QR0A 1DP0A 1ONQA 3ZKXC 4PJAE 4B7LA 2E47A 4K9EL 3ARFB 2DEWX 3GSXB 4UV7H 4ABUA 3NK3A 3RA7L 4HGMA 2VQ1A 1PD1A 2I5YH 1K8DA 5FCUH 2WOBA 2DQIH 5F88A 4PBWD 5FYKH 2R1YB 3GMQB 4FAAB 1TQTA 1MVUB 2IH1A 4WFGD 1NIFA 2OXGA 1VENA 1E3FA 2E4FA 3GF8A 4PWHA 3RA7H 3G6AB 2FJGA 1EZVX 3PGCA 4H26A 3SKOB 5D1QA 1J10A 4FFVD 1XX9C 1AAJA 5HD8D 7CGTA 4RAUB 1A47A 4U0RB 4GUQA 3GPSA 2EYTA 3DUSB 4U3XA 1CICC 3NGBC 5BNXD 3B2VH 2QSCL 4LPXA 4UZUA 1JYNA 4J4PC 3CZSA 3TF7C 1VPOH 15C8L 5D7LB 1NCWH 4NN6B 4U6HA 1VA9A 3DSFH 3C6EA 4WIQA 4IIZA 5GISH 1A0QH 1I3RB 2QSCH 3QUYB 4MJ4A 4E2OA 4EBQL 1V05A 1YC7A 2YEVB 2YOAA 4QOKE 4FNQA 2Q20A 1AC0A 1CIUA 1MWAL 1DLHB 3MA9L 4K7FA 2F19L 4K94L 3MRFA 3IT8D 1MLBB 4TLUA 3WUWG 1B90A 2HFEB 1CK0L 4PWJA 4ZOCA 4D0DA 1E4JA 4WTQA 4CJ0A 4JDVA 3S3PA 4S0HA 3TBSB 3C9NB 2BNRD 4Q7DA 2ZP8A 3E6HA 5DS8A 3VXPA 5KBNC 2Q86B 1BVOA 5EO0B 2HFGH 3KVPA 4OJFH 1Q72H 3U4EA 3TEUA 1OGTA 3ZDZE 1AZVA 2XIDA 3IWUA 3VW3H 5FO8B 4HUNB 3HKZA 3WJMA 1FHGA 5IVXE 3MV7A 3BWUC 4FCHA 3SDAC 5CINL 2R59A 4YDVB 1VKXA 2PPDA 3VQ1C 3N1FC 4XHJD 2CKBL 3HG0A 3A4FA 5KAQG 1S7UB 3P77A 4BZYA 5GXBB 2YXWA 2FEDD 1PX4A 4XNAA 4MCZA 5TE6L 1P4UA 2XN1A 3OLIA 4U1JA 1REIA 1JPGB 4WFED 1DQJA 1CFVL 1UXWB 4JO4H 5GGRB 3JTSA 5K39A 2FYYB 2B0SL 3ARPA 5EC1B 3MQIA 4ELMB 3BZEB 4AWJC 2RQ8A 1KCSL 4KI5C 1W9XA 3C09B 4WEBH 5SX4I 1I1YB 4OZFB 4JFOB 5DXWA 4ONFH 5I6LA 2VXQL 1K2DB 3IKCA 4XPAH 1JYXA 3HHMA 4DUVA 2EADA 1P7KB 3LKPA 3G5YA 3T6XA 3IDYC 5E56A 3QK0A 4QXVA 3UJTL 3MR9B 1AQDB 4J5VA 4MB3A 5F3BB 5L9DL 1HNYA 3QZNA 3AROA 4H25A 4GBXA 4DFIA 5CKAA 5KS9E 2OXHB 3FQNA 1FZKB 4RRPA 1N0XH 1Q94A 1JGEA 4PJBF 4AGQA 4GSRA 5K33A 3CVHB 2FB4H 3PE9A 4JHZA 2WAHA 5I0YA 4L9LC 1HXYA 4XN5A 2CBMA 2ZP0T 5A1AA 5B7FA 4PJ5E 1N0XL 2WCGA 3WMPA 1SBBA 2ICWI 4C56E 3VNZA 5GRUH 3PYCA 3G6DL 3RJQB 1CD0A 1R5WB 3BIKB 3RIKA 1Z5YD 3EF7A 4TUJA 5IT2H 4OZGB 1U8PB 4F37F 5CFHA 1S9VB 2LTQB 5CZVL 5EO9A 5KG9B 1VLXA 2VABA 3TT3H 1AR1D 2WJ7A 5SWSA 4DK5A 2UXFA 2OTWB 1P6FA 4LKXA 2K7QA 4HFWA 3H3BC 3BHBB 2AVFA 1DYZA 3S8GB 4PJGF 2IPTL 3SDXA 5CZVH 4NQCD 5C3TA 2E9JA 4Y5VA 2IXQA 3ABMB 3U0WL 1B2YA 2E9IA 1AO7E 2X4UB 1U8JB 2R4SH 2LFGA 2H4EA 1D9KA 3L3IB 3QEHB 2PO6B 3DK0A 5J6SA 5AW5B 2GTZA 2Y5TA 1HVXA 2V5SA 1CD1B 3BPNB 1CFSA 1NCCL 1LL1A 5EBGA 1FIGL 4JFZL 1HXMA 1QQDA 4WWID 4UBDC 2IAMA 3GMRB 3O41B 4PJXE 4E41D 4LVEA 1RULH 1F45A 1QHQA 2ZWKA 4EQ2A 5EHFA 4NS0A 3CLFL 1E43A 2FJFB 4LSVH 5BO1L 4NO0A 1XB6A 1UZGA 1IGYB 4YXLL 4BHUA 2H2PD 1OSEA 1G9NH 1TCRB 3KWWB 5C0JA 1SVCP 1ET8A 4JKPL 4WTWA 2QLVB 1RJYA 4CBZA 2ZUWA 3QJFB 1CL7H 3D39E 4HJ0D 3JWDC 4YLQT 2FCBA 5T1DL 1A3LL 1WA1X 1WE5A 4PGDA 1BMGA 1DBBL 3BWSA 2M83A 4JO3H 1BAFL 5C0BA 5HGBB 5JIDA 5KBDA 2EZ0D 3MLTA 3VCLB 4FLRA 1W16A 4L5FH 3IETB 4S0SD 2CLVB 2WXMA 5HYSG 3O3DA 4V33A 1V7NH 5HD8C 2JTYA 3PWVA 4PJ6A 4H1LH 1NICA 1KUMA 3ESNA 4HJGB 4PRHB 1JGUH 1N7ML 1GS7A 3IDXL 5I5IA 1BD2B 3H8NA 3ARDB 3DXAD 2Q7YB 5I1KL 4UNTA 1VEPA 4GBXC 1CFQA 3WGVB 4YJZL 3WNNA 3ISYA 3W0WE 5ISZA 4L3FA 3RWIA 5FECB 4L0YA 4DKEH 1MRDH 1JHLL 1QPPA 1MCWM 3ELAT 3U4BH 3JTTB 4ZODA 3PAZA 5DD6A 1XZ0B 1N6QL 1F11A 1IC4L 1OM9A 1LXMA 3U46B 1QRND 1XBDA 1PYWA 2GITB 2YBGA 2ARWA 1SRDA 3WTVA 1MFAH 4W4OC 1SQ2N 5I18L 5CJ5A 5JHLL 4TN9A 3RTQC 4WO0A 1H3UA 1PAMA 1FFOA 4BK5A 2IBGA 3U4KA 4ZUVB 2APVA 3TJHC 4PJ8C 1SMOA 3SPHA 3UPRA 5KSUA 5CM1A 4HJJH 2UZIL 4KUCD 1W8OA 2H45A 3AT9A 3D25B 4MJ2A 4L3CA 2C3HA 2R0WL 2BWQA 3QDJA 3UTSE 1XZWA 3KPPA 1CGVA 4MASA 2ICEC 5J06A 4ZQKA 1CFVH 1SJHA 4JO4L 4XE5B 1NUGA 2IPUK 2PO6D 4M62L 1T5KA 3S48A 1UA6H 1BFVH 1HKLL 3QUMB 5DRXA 1LP9F 3FT9A 3ULVF 2Y1VA 4PWEA 3B2XA 3ASWA 4NCC2 2FQGA 5DMKA 3U30B 4IDLA 4TLTA 3RX7A 4N5UA 3V95A 2H1LM 2R1WB 3Q1SH 4PJHE 4HULB 5HVHB 2YN5A 3OQ3B 5IB2B 3DX2A 1NUFA 4FLHA 2X0VA 4FXKC 2Y24A 3OMZA 4H2AA 2C9QA 3PNWB 1S4IA 4DQOH 3D69B 3L7EA 5DVNA 1KCRL 5BS0B 5GS0H 4ANKA 3P40A 5C08E 4P4KB 4B95C 1KB5L 2O4EA 4WI5A 1PJWA 3GSWA 5ELIA 3BH9B 3LMJH 4MVBC 4NRXB 4LSQL 4O2FB 2O6CA 3KCPB 1QW9A 2NT0A 1QTSA 3KLAB 1OCRB 3T8MA 4EN3C 3US0A 2DPKA 2NY4C 1M05B 4M8VA 3QORD 3GUTB 1Q72L 3L9EA 5FO9A 5F6IB 3TESA 1TZAA 1EAPB 3QNXB 1V5JA 4MKTA 4ABQA 1RUQL 5HHPA 1E9QB 4GW4B 5L2JB 2CMRL 4CVZA 2IH8A 4F2EA 3HFMH 2OMXB 3M17B 4LSPL 4O02L 4DEWA 1JV5A 1W80A 4NO3B 4B3VA 4X50A 4F24A 5CD5D 2X70B 2Y22A 2EDRA 1ZEAH 5GZND 2A73B 4HIXL 5E6ZA 2MHAA 3FO1B 2CLVA 3P9LB 4NKQB 2VKWA 2BNRE 1YMMA 1P5VB 4AQ1C 1IAMA 1YEFH 2ICWJ 3MBEA 4K71B 1FVEB 1ZHLB 3H7BB 4NQED 4RQQA 5D71L 1R34A 5AYTA 3UAJA 3HZ3A 1MCOL 1NKGA 1XGPA 4ALAC 5J56B 3V52L 1PFOA 3FB5B 4XAWL 4KZDL 2BXYA 1XH1A 1A4JB 1IFHH 4F58L 4KHTL 4S10A 3KBEA 2Q2LA 1AXSA 4GAGL 3WNIA 4MJIB 5F72S 5E8PA 1ZT4A 3QQ9C 3GTTA 2YEQA 1CDCA 4APXB 3D0LB 1PZBA 3NSJA 5IKCB 5HXMA 4D8PB 3RUGF 3II2A 3ULVC 4F7TA 2GTWA 1DUYB 4JY4A 3SDAB 1A9BB 1PY9A 3NSCA 3SKNB 2YD0A 1JPFB 1OF0A 5CILL 3GBDA 5ILTH 4XN1A 3V0EA 2X0WA 4IOSA 5AUMA 3LV3A 3A6OA 1U3HC 1BBDH 4S1SL 3GSVA 4GIOA 2I27N 2ZXBA 4EUPB 4BBWA 4AYGA 4OZIF 4P5TA 4J3BA 1KIQB 1I1RA 4F7EB 3CFEB 4A7GA 5C0IB 2AJXH 5TTRA 4EOWL 1PLBA 1U8JA 1BBJA 2PXYC 4PREB 2B59A 1FZKA 1I85C 5GJSL 4Y4FB 1HHIA 4IHOB 3FPYA 4MD4A 2KUTA 4XNUH 3D39A 3C60B 3O45B 1WT5A 2BVPA 3ETBJ 4PU2A 3TYGH 5FV2A 3GBLA 2YBRB 2A9AA 3IDYB 4HUMB 3VFNA 3GXPA 3WIIH 3WBDA 1QAWA 4G8GA 1NAMB 4NT6A 5DJ8B 1OTSC 4TVPE 5FYLL 1NJ9B 1P6WA 4IOSD 4AL8L 4AUUA 5HYJD 2J8HA 2BXZA 4BINA 2VT0A 3NFPA 1TOXA 3A4AA 5D2LF 5DRWA 4KI1A 2WQXA 2CU9A 4QHMB 1AQKH 3QRBA 4BA8A 2GHWB 4HISA 4LSVL 4RNRB 1YYLH 4P2CG 2DWXA 2BS9A 2X0UA 1U2YA 1ID2A 4MJ5B 2WM0A 2AEPL 2PXYB 3C09C 2FQFA 3V4PH 1D7FA 2O5XH 1RUPL 2WYZA 3INUH 3L6FA 3CCHB 3LPWA 2ZYHA 5E6RB 5C70A 4Q9QL 4X9HA 1PU0A 1EZSA 3ARZA 3IDJB 4GG8A 2AK4A 1XGUA 2XY2A 3IDNA 3FU7B 4HIIB 5IW6A 2XX1A 5JHDB 5LGHH 1A7NL 3ENEA 1YA5A 2K6WA 1O7DC 4ELDA 5FUCC 3X2QB 1XFPA 4RFOL 3CFTA 1JD9A 4YZFE 5TFSL 1OANA 1M7IB 4JFFB 4UOJA 3VB9A 4F7MB 4G42A 3WHXA 4IKJA 1JMZA 4GXFA 4HCRH 4MB4A 3DXAB 3VTMA 1SMDA 4Z0BH 1PG7W 2ZKHH 4EDWH 1NEZG 4KI5F 1N8OE 3D2UA 2JJUA 5J12B 2E46A 4W9HC 3ULUE 1P5VA 4PPTA 2VDPB 4XI5D 4GP4B 3GRWA 4JY6B 5JDSA 2ZXWB 1A6ZB 2GIMA 3MNMA 5AL0A 5DJDA 1OO2A 2Z6FA 1ZXQA 3RJOA 3P4OA 4O58H 3US9A 1CD8A 4L8DA 2ZKXA 4DPCX 4PSRA 3EOYG 3J07A 3DV6B 3GTNA 4MSWA 1AE6L 3KHQA 1AI1L 4UANA 4CSTA 4DP6X 1E9OB 2VKXA 5EUOA 1CLYL 3K6FA 4JQXA 4N22A 4N2NA 3PHOB 1X5LA 5IKCA 3S5ZA 3X1GA 1WFNA 3BN9D 4JFQB 1K2DA 4C83A 4J3SA 4Y19E 2PYEA 4GLRI 3GM8A 4X5WA 1HZHL 2KERA 4MJIA 1I8KB 3G04A 5DC4B 4GOSA 2UXVA 2OSXA 4NQQA 2HA1A 2LW3A 4P3DA 4TVPH 1DJYA 1DVZA 2AJSL 1BJ1H 4AMWA 2EDHA 4I0PB 5KSBA 4KDTA 1XGTA 4NUMA 2UUDK 3FB7B 5BUPA 2G2RA 3L4VA 1QNZL 4JQIH 2MPVA 3QIBD 2JIXA 4UQBA 3UBHA 3EUUA 3HZKB 1N10A 1QFHA 3SDCD 2IJ0C 3DSNA 3HG1A 2Y1ZA 2Y3AA 3EFDH 3QARA 3TZVB 5E6UB 3KPRD 3WTWA 1NGQL 2DLEA 4LVHB 4P2OC 4YGVA 2WBXA 5EORH 4GY4A 4XBGB 4HIHA 2YXMA 1B2WH 3T3PE 4EIBA 5CBEA 3DGDA 2VISB 4M3KB 3LNIA 3UIZA 2J43A 2OMXA 3M17A 2D2CC 4HD5A 4ORZC 2FD6H 5EORL 4UQ2B 2ALWA 5G55A 3TBVB 3V5HA 3ARFA 4W9ZA 1U8CA 2XZQL 3RUGB 2FT7A 1CDYA 4FTVE 4HKJB 3WKYA 1VADA 2DQDL 4HIQA 4AENB 2EVIA 4TUUA 1GRWA 1UZ8A 3L3JB 1J1XH 2X4NA 2X3CA 1MLBA 4AZUA 4N0RA 4PRDB 4N0UB 3RWEB 2AV7B 2ICEB 3OXSB 4XP4L 2DQCL 1E5ZA 2LVEA 3D48R 3GMMA 4GO8A 4GUPA 2YQ2A 4I2XA 4MNQE 1T1XA 5EN2A 1JDAA 4MB5A 4QRAA 2X2HA 3QZWA 4K3HA 4TQEL 4YHPB 3P3YA 4N2CA 2QTEA 3DOSA 3PV6A 2UZXB 4R7NA 3EBAA 4D0DB 1B88A 4UIMB 4X83A 1V7ML 1AZZC 4J8QA 4KFMA 1LM8V 1CFNA 2P7TB 4HWZA 3RWDB 5ICYA 1QLRB 1RL1A 1DO5A 4XBEH 2VN4A 2R1YA 3DVFA 3GMQA 4G3YH 1J1OH 3CQFA 3AU1B 2X4TA 3PPSA 4MMZB 4N0CD 1M2VB 1KIRB 1BQKA 5JR1H 4GH7B 5DZLA 2CBOA 1BW8A 4Y16B 3REWA 5H4YA 4JB9L 2QSQA 5FGBC 5F2FA 5H37H 1PDKB 3NJGA 2DOCA 1X5XA 5TDNB 1JVOA 2FHBA 1ZHKB 4XPGL 5JA9A 1MLCA 2XYCA 5J0BA 3QDME 3WXWL 1PZ5B 4BSWA 3FQUA 4GAGH 1KPVB 2Z8WC 3N0PB 1RPUA 4UMSA 3ETTA 4OLEA 3K71A 3CMOH 1IGTA 4HH9B 2DJMA 4H0HB 3PWPB 1Z3GL 4NQEB 1ZXKA 1UJTA 1UYWL 3KYKL 2GK2A 1DJZA 5E95B 2JI2A 3UTQB 3WFCH 2Y9RT 4LAQL 2HVJB 4A7TA 2IALB 1WHPA 3IMWA 2Q6WA 3BRGC 1AGBB 1A7NH 1KG0B 4M8QB 3WFBL 1F1DA 3KW7A 2QKIB 5DD6B 4N2EA 4MCYA 2FIRT 1J9RA 3Q2NA 5JPMC 2ZAIA 3NUKA 3W9DB 2HH0L 1V3JA 1RK1B 2O5ZH 3F12A 3VA6A 4KK8C 5I0XA 2ETWA 2VC2H 4PS7A 4GS7C 4C56B 1FNSL 1KELL 4IBQA 1JZ4A 1LEGB 2AJXL 1DN0B 1TLMA 4K5MA 2L4OA 2CD0A 3QUZA 4MA1C 4MYWB 1N64L 2E7BA 4RRPM 3SDAD 3DJSA 4ZFFA 2YLKA 3LN9A 5EWIH 1MFDH 2FH6A 3JQOB 1RZFL 1G7IB 5LCVL 2OYKA 3OG4B 1F5WA 4M4PA 4LNRA 4OGYH 1N2RB 5D1ZA 5J13B 4KTYA 1FBIL 5HGBA 4LQ1A 3GQFA 4OVVA 3V0IA 4DKFL 4GBXD 4JZOA 4AXWA 3QQ3B 2F58L 2ADJB 5IWLA 2X9ZA 3KPMB 3OKLB 3JV5A 4NZDA 3TOPA 3FN3A 1H5BB 1ACXA 4PB9H 3OV6A 1X5YA 2ESVD 3FT4A 3OX8A 3ARWA 2QDVA 3WN5C 2VABB 1EMTL 4LPWA 1TJHH 1CLZL 4UTAA 3SKMB 1BVKA 1ASQA 1L6ZA 1YMMD 2Q5BA 2VDPL 3B9KB 2GK0B 1J0JA 1IV8A 1KPUA 2WSDA 1YMME 4A7UA 3EGDB 3JVFC 3BW9A 4F15B 1GZQB 4JREB 2IDTA 1NCOA 1PG7X 2OX5A 1A6VH 1XSIA 4MZ3A 2LAGB 3QFJB 4AKQA 4JFPA 4X6DB 1UJ3C 4U1MB 2Q0ZX 3ILDA 4U1KA 2O5XL 1TQBC 5D4IA 4ADGA 4DP2X 1NGWB 1RZ8A 4TSCH 4DKTA 5F3HA 4WO4B 1MJ8L 1YYLL 1HTYA 2Q8BL 3RHWF 1C08A 3SDYL 2VNCA 5C71A 3U7YL 2F0CA 5T3XH 2XWEA 1D9KB 3HE6C 3WD5L 1MCEA 3VFRA 3P4LA 5GQBA 2WLMA 1CCZA 1TQSA 4NM4H 2YLHA 4Z5RB 2HMIC 1EFXB 2HJLA 4BGLA 4EVNB 1JWMB 1JPEA 2VLKE 2QADB 2WLNA 5AB1A 4GSUA 3V4VA 3NIFF 3EG9A 2J4WL 1K6QH 4PJXA 4L4VB 5EO9B 4LHUB 4NO0B 1AG0A 5CLXA 4CSZA 2E27L 2RQEA 1EFQA 2F53B 4YK4B 5BOPA 3T2PA 3WNJA 1TR7A 2CHXA 5EEZA 1JL8A 1CXLA 4HEPA 4WW2B 5ICZB 4DW2H 4XNBA 5IQ7L 1HHHA 5FYJU 2W9DH 4HCIA 5GS1B 3OC8A 4ZPTA 1BXVA 1M2VA 3ES6A 4QHUB 5FUCE 5FB8B 1MFMA 2R69L 5F9JA 3CIQA 3N40P 3OJDA 1MWAH 1P69B 4PD4K 1K5NB 3DYPA 4J3OH 4OIBA 4RWHA 1JCVA 3UTZA 3NAAL 3VH8A 1WH0A 2R0LH 2I7OA 5EU6B 5SWZD 3H9SE 3UTTA 4R90L 1MCRA 1RU9L 4R8WL 3UTQA 4WFFE 5BZZA 4DVRH 2VXVH 1KIPB 2SEBA 2W59A 1EVTC 4LNVA 3IKCB 4H5SA 4ALAL 3HEIB 5CN1A 2BIOA 2JXMA 1QUNB 3IJHA 1B3JA 3GBNH 4YZWA 4C54A 3KGRA 5TQ2L 3Q2CA 2VR8A 1N67A 3MRBA 2VXTL 3JV4B 4KROD 2Q76A 4K3EH 1Q0YL 3ULSA 4KJWD 2D7TH 3IJYB 4FG6D 5T1KD 4G7QB 3VD2A 3G08B 4G8IB 4ESKA 3B7UX 4QGTA 1HEJC 3A6BH 5HI4D 1U8CB 2C1OB 3OKMA 4KQ3L 1YY9D 1P5UB 2K45A 3ZE0F 3WXWH 4YDMA 3ATEA 3ZJAA 4BSJA 1U36A 2ZPKH 1R75A 1ZT7A 3E3QE 3UP6A 1K4DB 1YDPA 5KN5B 2NZ9D 3B7TA 3PWPE 1JF1A 4E68A 3MRRA 4ZS7L 3V6OE 3N9GL 1CJYA 2DH3A 3VGDA 4N2HA 4ONFL 1GVIA 1RH8A 2D4FA 4OJCA 3V55A 4FYQA 1MWAA 1FGVL 3DRTB 1XGYL 4GQQA 4PJBE 5DJYB 3FU9A 5AW7B 2HT3D 5FYJL 4PGCB 3QCUH 5GRYA 3I2CH 3QDMD 3IFNH 3A22A 4AC2A 2WXIA 3VFMA 1E67A 2C3VA 1D5XB 1T6BX 5BV7C 1JYWA 2WLIA 1E40A 2BINA 4JRFA 1IEAB 4ZW6A 5IHZB 5LNGA 2YK1H 5LAXB 5D8JL 2ADGA 3M45A 2VIRB 3UMNA 1CE1H 5TQ0H 2WMPA 4QRPB 5JOFA 4YBQC 4OF7A 1L7IL 1F4XL 3FSAA 3BVNB 5JHBA 2GFBB 2PP9A 1IEBB 3BGFB 1GZPA 1COBA 5AOLA 4QRTB 5KOVC 5E2TH 1NGPH 1TXKA 2DM2A 4RMUA 4RMWA 4PW4A 5IBUB 2GEEA 5HVFB 1CZ8L 3DRQB 4HUXA 4ZRGA 5SWSE 3BPOC 2XVBA 2F5AH 4MXWL 3RX8A 5E5LA 1T1XB 4EOWH 3ATDA 1UZ6F 2VZOA 1W72B 5GJTL 2OZ4H 3HW7A 4B96A 5FR3A 1RK0B 4YVNA 3CC5B 1EZLA 2P24B 4LPCA 4IEFB 5I2IA 2VMEA 3VVWA 2EE3A 2IOOA 4QHLB 4AQ8A 3QJOA 1X9LA 3MCKA 2OZ4L 4ZPVB 4FXGA 3FT1A 4NNYA 2YKLH 4EXPX 3RWDA 4EI5A 4HAKA 4N2BA 1ZIAA 3KXFD 3MREA 3ZSSA 1UEMA 5CBAA 2LAAA 3NP4A 4JM2B 2Y07H 3IE9A 1JZJA 3BUYB 3REVB 1L0QA 1PIGA 2QMJA 2UZPA 2QHRH 5DD3L 3N55A 4G7RB 2N01B 5L4MA 3NIFE 1RZGA 1IVTA 1OTTC 3KXFB 3SQBA 3FT3B 5DEGA 4YXHL 3L17A 4M5SA 2YAFA 4NM4L 4MNHA 4M61A 1JVLA 1MRCH 4Q4EA 1ZS2A 4Y9CA 4P9ML 3UPRB 4R3SA 1SMAA 2J4WH 4JJ5B 3T71A 3P02A 2G2PA 4Y5XB 2PR4L 1ZA6A 5KVEL 2DQEH 1XSJA 2EINB 3K3QA 3NACL 1HINL 4JBSA 5CILH 4PJIF 3PWLA 4MHHI 1K8IB 4PJGB 1X6NA 5MERB 1F0LA 1TMCB 4MMXA 2CIIB 5ISZE 1DR9A 4DKFH 4YHOH 2X05A 1QSVA 1U3YA 2B1OA 4FZEL 1ZA3B 3S37X 1OP5K 4AYDC 1ET7A 1OAUL 4KTGA 3U36A 2OLDA 3LKOA 4XMPH 1UENA 2EYSA 1K4DA 1IGJB 4Y2OB 5CHNA 4EI6B 5E6IC 5AOJA 3MV8B 2VMJA 1A1NA 1T0NA 3MBXH 1OY3B 1WA2X 4XCFH 1XCQB 4MJJA 5HGDA 43C9A 3EBGA 2WO2B 2OJEB 5I1LB 5F89A 4G1MB 1I7RB 3ARGA 3VXRA 1N6QH 3CFBB 4FNRA 5F7UA 4Q97A 4NRYB 3U6RA 5GS2H 1WITA 5AAWA 3DVGB 3TZVD 2M26A 4L9DA 3TO4B 4S1DC 5TDOA 4AL8H 5E8OA 3SCMC 3E9TA 3MX0A 4WY7L 2YD4A 4PRHD 1T1ZA 5K9JH 4QIRA 4WW2A 5ICZA 1O7VA 2F15A 5J4MA 5EZJA 1CC3A 5I1EL 2HKHH 4ECNA 2K8QA 6FABH 1OGAD 3PHOA 3NQKA 2HG5B 4UOZA 3GMPA 2WLLA 3IRZA 5I1EH 4WKXA 4XNZC 4F20A 1VGKA 2D2OA 3U7YH 4W9CC 5BV7L 4HWNA 3QDHA 5I8CA 2QGEA 3CFQA 2JJSC 4HBCH 2CZNA 2KQNA 4I18C 4ZX5A 3CZEA 4KX8A 4CL7A 2X2YA 1YECL 2DS4A 3C08L 4OGQC 3RZWA 2UXTA 4ZXBB 4BQ6A 3X3GL 4X4ZA 1J8HB 1DLFH 3QPKA 4U1JB 5DYOB 3HB3C 3ARBD 3BQVA 4L9LB 1MCKA 5ETUB 4XZ4A 5FYKU 4PLKD 2NR6C 2Y06L 1O6VA 1ZK5A 3MXVH 4D94A 4TPRL 2GG1A 1IILE 2HLAB 2DIEA 3DETD 2CIKB 3KYNA 4HKBB 3V0FA 3PWPD 4NENA 1OPGL 3LHPL 2J25A 1A8ZA 3LD8B 2BIPA 3NFPB 4WI2A 4ZUSB 2W9DL 3QRFM 4LSRL 1LNUB 4NPYB 1SF5A 2X2JA 5AVRB 1QLEB 4FG4A 5A16B 3UTPD 3EYVA 3T0DA 4OUUB 4G9FE 5MEQB 4Y1AA 5CWSA 3UO1L 5B1JC 1JD7A 1WD9A 4AJYV 3U1QA 3HS0C 4OFVA 1DEDA 2NDGA 1NLDH 3H2PA 1HSBB 1AXTH 4NNPL 3GKWL 5CJQL 1WFMA 3CN0A 3QJSB 5DSCA 1HI6B 5I6OA 3CSFA 5E70A 3ZHNA 4Z3TA 3CJJA 5HI3D 2H9GB 4I3RL 3HMWL 3B56A 1NKOA 4HG4J 3GKWH 2W80C 4ISVA 2HFTA 4BELD 3QG7H 1HSAB 2IANB 1DQDL 3AADB 4CU8A 5TH2A 1N5AB 1XMEB 4FJZA 3P2TA 4OFKA 5C0AA 4TQPA 4AGLA 9CGTA 4Q8BA 1CLOL 3OKNB 3WFEH 4KVPA 4PJ9A 4LQFH 3V0WH 4YSTA 5D70H 4NN5C 5C0CE 2WQVA 1G1KA 1KZQA 3K72B 3AACA 4HXBL 4KZDH 3GJFK 3A6CH 3RAJL 3S8WA 3AAZA 4OQTA 2W91A 1JRHI 3D06A 5CEXA 1HHGB 3Q3GB 5FFOA 4MMXB 1PZUB 4G8FA 4KK5D 3TVMA 1CF1A 1NWOA 2WMPB 2XRAL 3OJMB 4RMVA 1QRNB 5BZWB 2EDQA 1F90L 2DKMA 5L88L 2PYEE 4YS4A 1I7TA 1RZIA 1NINA 4M5TA 4GKZA 5MEPB 3EDEA 3FH5A 3MRGB 1OXYA 1FZJA 4QRPD 5ACZA 1S6NA 4LLUA 5FHAL 1QD0A 5CD3B 1RJLA 4ODUA 4WEBL 4YHNB 1WDAA 3I75A 4R2GB 2FZ3A 4PP1C 3ILQC 2K3TA 2PR4H 4G2AA 4NRZB 1BBDL 5DDHB 3DRTA 2WLHA 1L7IH 2R29L 3CXDH 2CWRA 3WN5A 1KLGB 1KLFA 4BQ8A 1CLCA 3JWDH 1SYSA 5F71A 2N7BA 4QXTA 3TBTB 4LOFA 4FYRA 3ARDC 1BGXL 1U3HA 3TO4D 5SWSD 3SBQA 2V5TA 2VC2L 2P7TA 1R47A 2VLKA 2CCVA 4HWZB 3W37A 2H8PA 2EVHA 4GSDH 4K55A 1WAPA 5FX3A 1LD9A 4Y5YB 3B5GA 1RURH 2WHVA 3MPCA 5E1GA 4G1EB 4KY1L 3L5HA 1TETH 4J12A 4PIRF 3MLUH 2Y69B 3VA2C 5FKAB 3VRIB 2NNFA 3D0AA 3OZKA 4FLSA 2EDXA 2XV2A 3QHZH 3GSWB 1OKEA 1G7IA 5IUCA 4AI7A 3VXMA 1PDKA 1EEZA 4GUPB 2NY1C 2IG2H 3AWFA 2EZ0C 1E8WA 4JDEA 4I9WE 1S7XA 4KKZA 4XBEL 4TL4A 1FQ9C 3QHZL 2WQSA 2QEJA 3SN6N 4BCYA 2HWZH 1KC5L 5ESAB 3HB3D 1X7QB 2WQRA 1S7VA 1EDHA 2G9KA 2XN2A 1OK8A 4XVJH 2IDUA 3L3DA 3OHXC 2Z31D 3RUGA 4LLVB 4PJEA 2ORBH 1H6EA 1OHZA 1FFPA 1XD1A 3BLKA 4W9DC 1BEYL 4AYEC 5IM7A 5KOMC 5HDQL 2QV2A 4GLRH 2ED8A 4XNYH 3INUL 3FO0L 4KDTC 3U9UA 5B4MC 5HI4C 1NDMB 2OMTB 4BDVA 3L4XA 3V9CA 3BSGA 3GLDA 5EU6E 5CGMA 1TFPA 4PMEA 1U2HA 3ULUH 2A9CA 4FQ1L 3D3VD 4XNDA 2QADD 2KL6A 5BZDB 2XN9A 4P9MH 5FDWA 2CJUL 3D07A 5IG7B 4KRPC 3MRCA 4RESB 1MAJA 3RY4A 4EIZC 1MHCA 5GGQL 3TNMB 4K5PA 3D50A 3GS7A 1JZGA 1AD9A 4F5CA 1BOYA 1IB5A 4GFXA 5JTWA 3ZTNL 1FHNA 2CK0L 3Q2LA 2YJQA 2G2RB 3QBTB 5F9WC 5JO5A 1KJMB 4XC3H 2B9BA 2HLFC 4L5FE 3TV3L 5AZEH 1ZHNB 2NY5L 3NABL 4BWTA 2Z8VC 3EBIA 3VXUA 1NGXB 3TL5A 4QLWA 3MFGB 1G7QB 4WUUE 4P9HH 1KJ3L 4KXAA 2DRUA 2NXYB 2W07A 3LN4A 2NY5H 3QQDB 3R18A 4HIHB 4UDUA 4UINH 4CW1B 4PJ7F 5DEFA 1LLAA 2VDOL 1H3XA 5DRNA 4HJ0C 3CFJA 2LU7A 3CSYA 4X6FA 1P7QB 4N87A 3NBNA 4FQCH 2DIBA 2YMXL 3MOBH 4UOW0 1KXVC 2WP3T 3C6LD 4HGKC 4XPHL 5IB1A 2WQAA 3GXMA 3QORA 4GUCA 3WO3B 1CFMA 4JFPB 2NYZA 2WAQA 5DVOA 1MCPH 5CIPA 4F93B 4WGWB 5K9KA 2NUPA 4RX4A 4ZFZB 1QWHA 4PUBL 32C2A 3LY6A 2V5MA 2VXQH 4DO6A 5IMKB 2B4CL 3D12B 4LHQB 1QLEL 1XT5A 3LXAA 4DVBA 2BP0B 5C0RH 5HHXH 3H0TB 3FL7A 4ODXA 4DNLA 1I53A 1FL5B 1ZTXE 3H53A 1XR8B 2D3JA 5E99H 4RGNB 4JFEE 4HC1L 4URTB 3N0AA 4TTDC 3FMGL 4NQVB 4GAYA 4LCWD 2ATAA 4OQTH 3NPZB 5IBLC 3I6LE 3KNBA 1KN2L 3FQRA 3EYVB 1A7QL 2H32H 3GLZA 4WW2F 5I6KA 3B5HA 3OPZH 4GMTL 2NW3A 1IM9A 3CLEL 1Q9LA 4WFHD 4Y2DD 3C6SA 3VQMA 1GW6A 3JV6A 4JZJA 3DX7B 4LP4A 4E9YA 4P5TC 4OAWB 1G0XA 3ZHDA 3EO1B 1QI5A 1P9MC 5HHOA 4E9XA 4LPVA 3H3PL 4M5YL 4X9BA 2WWKT 3FO2B 4Q89A 3FN0H 4HX1B 5F3HB 1OGAA 2DM3A 3QEUB 5LXVA 4UAOC 4Y9BA 3WO4B 5CP7A 3EHBC 3MACL 4F33B 1DDHA 1JK9B 4PJXB 1YJDH 5TH2B 2Z0BA 4K3DL 4X2UA 1PX8A 5C92A 1J05B 2B2XH 2ZTBA 3RE0A 4AE1A 1ZANL 1L6PA 2FO4B 5K59F 3KGUA 3HLAA 2WVSA 3B9KA 4C4BA 1AR1C 2ZCLH 1WUZA 3BT2H 5D93B 3IFOA 3KPOB 3L7FA 4NQDE 1RZQA 4A7GF 3GYRA 1OP9A 1XGUB 2E6JA 3SE8L 5E4EC 3UYRH 1YQVL 1NCWL 3K2KA 2I24N 4JE4B 1S9XA 3K74B 4ILDA 3RWGB 1IX2A 1F1GA 1KCRH 1IAIM 3EGXB 4HHGA 3TTYA 5HP5A 3OG6B 5JHDD 1IC5L 1C12B 3QZLA 4JPWH 4HH8A 3H9SD 3C5JB 5H2BB 2X89D 4N2GA 3D18B 3PHQA 3R0NA 1MFBH 1NA8A 2EE6A 2ESVE 1OM3L 3VMOA 2DDQH 4F8QA 4NP4H 2HRPH 2R7EB 3MAWA 4NCC1 2CRYA 5ENWB 5FGSA 4B27A 2J20A 4HS6B 5DK3A 5FO7A 1ND0A 1I3RA 3QUYA 2ZYIA 4FI6A 4BFIB 1SLUA 1CZ8H 3FN9A 2BMKB 4Y5XA 3QZMA 3QHFH 2X6UA 1LEKA 5JQ6H 1KJ2L 3RFZC 4NAQA 4G8GB 3L2MA 1O7DE 3FQXA 4XAKD 3VTAA 4U6XB 1BIIB 5EOTB 3QJTB 2ZOWA 1EPFA 3CVCA 3CXFA 2ADIB 2ROYA 5KW9L 4ORGB 5SWZB 2EDYA 3D0LA 1IT9H 1M53A 1FH5H 3B9DA 3MZTA 1IM3A 4DGUA 5F88B 4QRSB 2XRAH 3AVEA 3IDIA 5DTFB 4LCCC 4I13B 3GFUA 1M9SA 2OK0L 2G75B 5FEBA 2OSLA 4G1MA 1XAUA 1XCTB 2YGNA 1UGNA 3FYEB 2QR0B 3K6DA 3L16A 5E4AA 3PS6A 3KR3L 1WGVA 1XIWB 3D09A 1MCLA 1YNLH 5IMOA 1JOIA 2Y7LA 1QSEA 1KELH 5DK2B 1CR9H 1V3LA 1F4WH 1G9ML 4HGWA 3BUBA 2ZX5A 3SQBB 4LKCA 4A55A 3UERA 5A6MA 1Q1JL 2PLTA 3G6AA 2DEXX 3MA7A 3PIQA 4GRWB 3RPKA 2XZAH 4F2MA 5IM7B 3RWJB 3CZFB 2XTSA 3FUJA 4WHTB 3C8DA 5ANMA 2EYTB 3QDAA 4GIPD 5KBMA 3KH3A 3NJHA 3IMRA 2R83A 1JPGA 3LEXA 2PWGA 4JFDD 4XP6L 3FH8A 1GIGH 2QQLH 3QJVB 4JRXE 1LDSA 1A65A 1ZTMA 2UUDH 5I1HL 2Y7QA 1MFCH 3PP4L 4X4KA 3UBGA 2ENYA 5DS2A 2KLTA 2YOCA 4PJHA 4UTBH 4UT9H 4OGXL 3BAJA 1FNGB 3TBBA 1WCQA 4PCYA 2HWZL 1FNFA 1LO2L 3VGBA 5MENA 1VACB 1TVHA 1BZDA 1RK0A 1QX1A 1IU1A 1ACYH 4PLOB 2AMUA 3ZQXA 4JFHD 3S37H 1HX0A 1UWXK 3DBSA 5GGVH 4I0PC 3GMNA 4HUXB 3BSZH 2CBPA 3GIVB 4LSTL 4NKOB 2YD2A 1QRNE 4QNPF 1RIUL 1K72A 1WPCA 3MODL 4JUTA 4LOUD 4F7KA 2Z7UA 3QZWB 3C87A 4UQAA 1ZPUA 4PJ8A 3WEMA 1YEJH 3CVIL 3EJQA 4P2OA 1CXKA 3A5VA 4XVUC 4FQJH 5LG1A