2IWTA

Thioredoxin h2 (hvtrxh2) in a mixed disulfide complex with the target protein basi
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
EVISVHSLEQWTMQIEEANTAKKLVVIDFTASWCGPSRIMAPVFADLAKKFPNAVFLKVDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTAKVGLHAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN H ISOFORM 2
publication title Structural Basis for Target Protein Recognition by the Protein Disulfide Reductase Thioredoxin.
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Oxidoreductase
total genus 33
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2006-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2iwtA01
3E0UA 1BX9A 4G9HA 4N0VA 4OFMA 2B7JA 4TR0A 1AAZA 3IR4A 4G2EA 2YOIA 5IO2A 2MMNA 3ZREA 3FW2A 4JE1A 2LUSA 3C1SA 3GKNA 3UARA 3J7Yb 3UVHA 4MZBA 1R5PA 4I6XA 2HZEB 3FR3A 1QXHA 1MDKA 2RM5A 1ML6A 3LXTA 1F37A 5DBQA 4ZL8A 2P0GA 4E8HA 2GDRA 2K18A 3KEBA 1RW1A 1QGVA 1YEXA 1N2AA 1N8JA 3DRNA 5KN1A 2H6ZA 5AN1A 1U6TA 1T1VA 1XW5A 4HOJA 3RDWA 1HD2A 3FRCA 3P90A 1YEPA 3HDCA 4EO3A 5DVBA 1EEMA 2HE3A 1H75A 4BL7A 4PXOA 3GRXA 5IIZA 3DEXA 3W6GA 3MAKA 1JFUA 2E2MA 2VD1A 2C0GA 4KNDA 2YJ7A 3TDGA 1A0RP 1M9BA 1SL2B 1YQ1A 2WFCA 3TJKA 1FO5A 1MD4A 3UOMA 3F3RA 1OVNA 4MLYA 4I97A 4IP1A 1PSQA 1GSSA 5IPGA 3GSTA 2H74A 1GL8A 5EY6A 1KBNA 1GWCA 2LRCA 2KLXA 4HUAA 2M72A 4WBJA 5H5RA 3HY2A 4N30A 1EWXA 1V40A 1QUWA 5EVOA 5IOXA 5DAKB 4K1FA 4EC0A 4DEJA 5A4WA 2WJUA 1ZYEA 5ECKB 5GZZB 1VGLA 1SJ6A 6GSYA 2EIOA 2FA8A 2ES7A 4PNGA 2VCXA 2C0EA 2VCQA 4IN0A 4ECIA 2B5YA 2A2RA 3RAZA 1FVKA 1MDJA 1B9YC 3IA1A 1TRVA 1OKDA 3MSZA 5ELAA 1G6YA 1FVJA 1TP9A 4I5QA 2CVBA 3DVWA 3D21A 1O8WA 2GSQA 2ON7A 1SKSB 1USBA 5IOWA 2MBTA 5D9VA 4QQ7A 1EEJA 2IN3A 4FYCA 1JLWA 4HJMA 4FH8A 1A24A 1SENA 1BJXA 2L5OA 3GIXA 1WRYA 4IJIA 2REMA 1TXXA 4EXJA 4MH3A 1PX6A 3D4MA 4KH7A 2B3SA 2AYTA 5G31A 3Q74A 2C0DA 1FW1A 2RIIA 1F6MC 2ON5A 2IMEA 4EDYA 5AIXA 4EDZA 3VPTA 1K0CA 2V2GA 1G7OA 2I9HA 14GSA 4ACSA 2HYXA 2J9HA 2IFQA 2OBKA 4L0WA 3CSHA 4POBA 3D4TA 1CQHA 3BCKA 1YY7A 2M46A 1SKRB 3C71A 2PVQA 4PNFA 4DSRA 4DSQA 5J9BA 2XC2A 2PPTA 1HQOA 4ML1A 3TOTA 1G7EA 1OYJA 4HZ2A 4D73B 3EE2A 4YQMA 1AQWA 1SL0B 4BWSA 4OWYA 5F0GA 1Z5YE 1EOGA 2CAIA 2CQ9A 2GZZA 2JZRA 4ISDA 2YWIA 3P2AA 3DYRA 1WPIA 3Q18A 4F82A 3CSIA 5J4UA 3F9UA 2MZCA 4XS4A 3EINA 1SL1B 1ZL9A 3TKSE 4HQZA 2H0HA 2VCVA 5E59A 1SK0A 2TRXA 1K0AA 1ERTA 2F51A 3J7Yk 4CHSA 3IC4A 1R5AA 5GSTA 1WIKA 4O5RA 2H8LA 2L57A 2HSHA 2R4VA 2V32A 4PGTA 1TRUA 5JCWA 2MMZA 2XBIA 4WEYA 3SBCA 1PA3A 1EGOA 2G2QA 2P5RA 7GSSA 5JWQB 1PL2A 2N5FA 1RQMA 2VLUA 4MJBA 2V1MA 4EF0A 3HYPA 1HNCA 2F8AA 5F8BA 3GH9A 2C3TA 3VI7A 4ZB9A 5F07A 1EV4A 1BQ7A 4BVYA 4GTUA 2L5LA 2GZYA 1F3BA 1JZWA 6GSVA 1FOVA 5IMAA 3G7JA 1G6WA 1K3OA 1A8LA 1Q98A 2YNXA 2N5AA 3IXRA 5IMDA 4Q5QA 4OO5A 2IMIA 1O8XA 4BVXA 5ECSA 1FAAA 3F8UA 3ZZXA 3CYNA 1PX7A 1GTBA 3KD0A 3UL3A 2QSIA 4ECCA 4OD7A 1ZOFA 5IM9A 4OCFA 2GQLA 3HJOA 1VF1A 3UBLA 2DSAA 2PWJA 1LBKA 3QOUA 4ECJA 2LSTA 1FG4A 4GQFA 1JZRA 4YAPA 3F6DA 1THOA 2E0QA 3D5JA 3G9BA 2HT9A 1TRSA 1EP7A 1NHYA 4TXOA 1XVWA 4K9ZA 1ILOA 2C3QA 5ECHB 4PURA 3IV4A 1O6JA 5DQSA 2IPAA 4Z7XA 3KTBA 1ZZYA 2H66A 2CA8A 4KAEA 1GSEA 1IYIA 3DD3A 1AC1A 2DIYA 3HCZA 1YJ6A 2F9SA 4NHZA 2BTOT 2FA4A 1U3AA 2LV3A 3IPZA 2GT6A 4NMUA 4V2MA 1XWCA 3WGXA 2H0IA 4IQAA 1GTAA 2D2ZA 1AW9A 4ZB6A 5JWRB 3WGDA 3N5OA 5HR2A 1WJKA 6GSSA 3P8WA 5IMVA 3QPMA 4AF2A 4MA9A 4WR5A 3WD6A 4HJ2A 2CZ2A 2WZ9A 2OACA 4L8EA 2IFQB 1EOHA 5F06A 3H79A 5HFIA 2IMKA 1T4ZA 5D9WA 3LXZA 2JADA 1M7TA 3WT1A 3GSSA 5G2ZA 5ECLB 1B8XA 4IS0A 3MWHA 2DMLA 2K8SA 2LJAA 5CRWA 2H75A 3FEUA 4Q5FA 2VLTA 2K9FA 3H93A 2MMOA 4IW9A 4ILFA 4ZB8A 4XRAA 1QFNA 3VPQA 2X99A 2GQKA 1DE1A 3ZVJD 2X64A 4JZQA 3RBTA 1Z7PA 2GSRA 4TXVA 5G1KA 3PH9A 1R26A 5D93A 1PRXA 4GSNA 4XS4B 3IBHA 1TTZA 4XS6A 1ERWA 3QDNA 2YWNA 1TJDA 1R7HA 2H0GA 2V6KA 1SJZA 3JCML 2V6OA 2B5XA 2OA7A 1M0UA 3F0IA 3FY7A 1XOBA 1XPVA 2ZCTA 1ERVA 1XWAA 2JSYA 3BBYA 5IO0A 2AHEA 5G30A 5HR0A 4MF6A 5EPFA 2VM1A 3GMFA 4YH2A 4KDXA 2QGVA 2YANA 2CZ3A 3QFAC 4JEDA 1KTEA 2VOCA 4GRFA 2R3XA 4FO5A 3HKRA 2DJ1A 2PVOC 1U87A 1XXUA 4MF7A 2HXKA 2VAFA 5G5FA 2FCHA 3BCIA 2XPDA 2FHEA 2H1BA 1PMTA 1SU9A 1ZCPA 2IMFA 9GSSA 3F4SA 2DJ0A 4NXIA 5CO3A 3TJJA 4K7OA 4NV5A 1NHOA 3QCPA 1SD9A 4J2FA 2H6YA 5AISA 5KN3A 1V98A 3QFBC 3KH9A 2B5EA 2FD3A 5CRDA 2FWGA 4N11A 2DJ3A 2LRTA 1TU8A 1E2YA 3KM6A 1SKWB 4L0UA 5ID2A 3VWUA 4ZXGA 2AJQB 4PUAA 3L4NA 2GQMA 1GSYA 4MK3A 2LRNA 2TRCP 1FB6A 3CRUA 18GSA 2VL2C 3K8NA 4K0GA 5FWGA 1BYEA 2KP2A 1OAZA 2KUCA 4N0ZA 1XIYA 1R4WA 5AGYA 2PN8A 2R6KA 2H76A 3IHQA 1XOAA 2GGTA 5DCHA 3ZVJA 1M99A 2RUFA 4TXOB 4LL1B 3TKPA 3ERWA 1CQGA 2C3NA 4ZBBA 5CYYA 3EMXA 1S3CA 3MNGA 1BG5A 3ZMLA 1Y6EA 4BA7A 2LNTA 4KCEA 5INYA 4FIWA 3IE3A 2DMMA 5J3RA 1XFLA 3FZAA 5ECQB 1X9MB 3CXGA 2PBJA 5A4VA 3FR6A 3O76A 3RPPA 4IVFA 2L6DA 1GSDA 2YP6A 3TJGA 3ZFBA 3I9V2 2LQQA 3TGZA 1GULA 1EGRA 3GN3A 4HEA2 2LJRA 3L9SA 2L4CA 3EU3A 2CT6A 5B6NA 5KN2A 4AJ7A 3HXSA 2K8VA 4RUVA 4GXZA 3GL5A 3D0ZA 4EUYA 1B9XC 4TR3A 3RHCA 2H70A 4I2TA 4XHMA 2YWMA 5G1LA 2LJKA 2K6VA 1XW6A 4TRXA 1TDIA 3NIVA 1K0DA 4LLRA 5JCGA 1VF4A 1J0FA 5J41A 1Z6MA 3CMIA 2C1YA 3C7MA 3L0HA 2ALBA 2MMAA 1Q4JA 2IJYA 4JBBA 3Q6OA 4ECBA 4OMVA 3EWLA 1YDKA 2YZUA 2DJJA 2XPEA 1T7PB 3GTUA 2KOKA 1GNWA 4V2NA 1SYXA 4POKA 3I69A 2WB9A 3GA4A 4HI7A 4IELA 3RPNA 4LMWA 1GTIA 4IHUA 2B7KA 2PMTA 4TR1A 5CP1A 5LD0A 1IYHA 4KA0A 5JCUA 2GTUA 5AIVA 2H1GA 4ZL7A 3O6TA 2P31A 2C4JA 4KB3A 1UVZA 1GLPA 4KGIA 3HVVA 2LTKA 3QR6A 4G10A 1A2JA 1OE8A 1JLVA 1SJIA 1JHBA 2WDUA 3VLNA 2GLRA 2FNOA 3KIJA 3O3TA 5B8AA 4X1UA 3DWVA 1K0NA 2DLXA 4YAVA 1NW2A 4LMVA 4GSSA 2G0FA 4L5OA 3GKKA 3I6AA 2CAQA 5DALA 1F3AA 3LYKA 1XW9A 1S3AA 3HZ4A 5FHIA 3TJFA 2B6MA 5CREA 4ZBAA 4I8BA 5ENUA 3QMXA 4WR4A 1AXDA 4EVMA 3C73A 22GSA 5CAXA 2R37A 4ZBDA 1TK0B 3VWXA 1TOFA 5IQYA 3ME7A 3WYWA 2HI7A 1Z3EA 4F2IA 2VCWA 1PD21 4IKHA 2I81A 4O7HA 1G0TA 1JZOA 3LSZA 1V57A 4MJCA 4MMMA 1ZMAA 3GKMA 4XIHA 2DIZA 1V58A 19GSA 3IOSA 1EV9A 3PINA 4PUFC 5ID2B 4MABA 1X9SB 4GSTA 4F03A 4DVCA 4XS1A 1ACVA 4KSMA 3RHBA 2FWHA 2OADA 4KDYA 3TB2A 5CRHA 3LORA 5IMCA 3LJRA 4OFTA 1EZKA 1Z6NA 4HS1A 4GWRA 1AIUA 2DC5A 4Q5RA 1AQVA 3FR9A 3DIEA 3CTFA 1PGTA 1YKCA 3GNJA 1FHEA 4TKYA 1NSWA 2JSZA 1URMA 2IL3A 2MYGA 2JL4A 16GSA 1TKDB 4PQHA 1SK2A 2NPBA 1AUCA 4MZCA 4QL7A 3KP9A 1TK5B 2IIYA 13GSA 2LEGA 1J9BA 4MDCA 1U88A 2JACA 3KTLA 1KEBA 4AJ6A 3P7XA 2VL3A 3DKSA 2GSTA 4V1Ag 2NTOA 1THXA 4K7NA 4YQVA 3TRXA 3W8JA 4OFNA 3TUEA 1PKWA 2WS2A 4PQ1A 1X5EA 4OCEA 1MDIA 3A5WA 2RM6A 4BWQA 5GAND 3TKSA 3KCMA 2OBIA 3HVXA 1V2AA 2OKAA 2R2JA 4KE3A 4WETA 5L71A 1BEDA 4RQRA 1ABAA 3UAPA 1TI3A 2I4AA 1QMVA 3ZL5A 3ZTLA 3FHKA 2R5GA 1T3BA 2LNSA 2NBSA 5GSSA 1FB0A 2TIRA 3LYPA 2YZHA 3IAS2 5CNWA 3FYGA 3APQA 1ERUA 2KHPA 1GH2A 3IK7A 2ZUPA 5ELGA 5GAPD 2L59A 3SWLA 2X8CA 2E7PA 1GP1A 3KGKA 2OE0A 2GVPA 1J08A 1WP0A 3APSA 3KMNA 2JU5A 1VF3A 4KUNA 2I1UA 2H19A 2QC7A 3R2QA 1GSUA 1X9WB 3M3MA 3GTUB 2OE1A 3BOAA 3D22A 2GT5A 2VL9A 3TKSC 2EIQA 4TR1B 1A2LA 12GSA 2H6XA 1DSBA 2CV4A 3G7IA 4LL4B 4E8EA 4K2DA 4DSSA 4WF5A 10GSA 5G5EA 2CX4A 3DMLA 4JU5A 3EURA 2NDOA 1X5CA 2B1LA 5A4UA 3TCOA 4XTSA 4RQXA 3GX8A 3PR8A 1I5GA 5H5SA 3OR5A 1GUHA 3KP8A 1YF1A 3UIWA 3L78A 2AB6A 2KP1A 1ON4A 3C8EA 2HZFA 3A2XA 3KZQA 4NPBA 1Y25A 5ECPB 3TRQA 2YJHA 3N9JA 4K7IA 2VIMA 3HD5A 3Q19A 1I9DA 4MJAA 1MEKA 4L5LA 1S3DA 2YN1A 5DALB 3H8QA 4IQ1A 1OC8A 1QK8A 2VL2A 3EYTA 3TKQA 2VLVA 3ISOA 2BJXA 1OC9A 5J5NA 4MPFA 1MD3A 1XZOA 3TJBA 1W89A 3AY8A 1H4OA 5CRGA 3ME8A 5E4WA 4J56E 1A23A 3IAM2 4HQSA 1KNGA 2OE3A 3IDVA 4IGJA 3LWAA 3UJ1A 5ECMB 5ECOB 4X43A 4WBRD 2QKEA 3M1GA 6GSXA 2BMXA 2A4VA 2JZTA 5EL8A 3ZIJA 3GL3A 1ZGNA 3HJMA 3LEFA 2AAWA 1EP8A 4QL9A 3NZNA 5FT3A 1A2MA 1TW9A 1XWGA 1TRWA 2FWFA 2O7KA 3VWVA 1AQXA 1RK4A 2IWTA 2YV7A 1A0FA 4POMA 2HFDA 4HZ4A 1PKZA 2JZSA 3A3TA 3ZIVA 1C72A 1GLQA 2O85A 4V1Ap 2F8FA 3U6VA 2NVLA 6GSUA 3HA9A 2FGXA 3EMPA 3M9KA 4MF5A 4CDOA 2LS5A 3VWWA 4ML6A 1M2DA 3CRTA 1DE2A 1O7UA 2EIRA 2H01A 4IBPA 3S9FA 5D96A 1TI1A 4PQIA 1M2BA 3L9UA 1UN2A 1OKTA 3VK9A 1XBSA 4RI7A 4TOPA 5DJLA 5DJMA 1PL1A 2V41A 5B6MA 4YQUA 4GCIA 1GRXA 2AUVA 4ZILA 4ZIJA 1K0BA 1MTCA 2VCZA 1X5DA 4NV2A 1B4QA 5ECRB 2GZPA 4N10A 4F0BA 4TW5A 1ST9A 3H1NA 3ZITA 1GUKA 3ZYWA 2MBSA 4KX4A 3NOFA 2HRNA 2HLSA 1K0MA 4V2LA 4OO4A 2RLIA 3ZMKA 2VUPA 2HSYA 2DJ2A 4MCUA 4KDUA 3GUSA 1T00A 1OC3A 4P3YB 4I2UA 3WGEA 5HFKA 2E2GA 1HYUA 1DUGA 3M9JA 3GFKA 5DCGA 3ZLPA 1X0RA 2H73A 1M2AA 5HR3A 5IMZA 2PERA 3GV1A 1GTUA 4HU7A 4TR4A 4O32A 2X8GA 2L6CA 2GS3A 4PX1A 3CTGA 2FY6A 3L9VA 3LQ7A 2HNLA 1V9WA 1UA5A 2H72A 3M0FA 4MH2A 4GQCA 1WOUA 2EC4A 3E9JB 4IJ3A 3MDKA 3E3EA 3FK8A 2YWOA 3UBKA 3F4TA 4KW6A 3V1WA 3ERGA 1O73A 2N5BA 2C80A 3GKXA 4J57E 2VO4A 4HU9A 4WKWA 1TU7A 2XHFA 2H1DA 4KCAA 4XCSA 3DGQA 4NAXA 4DSSB 1HNBA 4AGSA 4POLA 1XCCA 4K0NA 4ZL9A 3KH7A 1WWJA 2HZEA 2B1KA 4ULXA 2PU9C 4GF0A 4GLTA 4H86A 4CW9A 3APOA 5B8BA 1PN9A 4K8MA 3F63A 5D8IA 5LNKe 3FZ5A 5ECIB 3UMAA 1VRSD 3VI5A 2H30A 3GURA 1A8YA 1OE7A 4WF4A 1SK1A 3FKFA 1W4VA 3KXOA 1XVQA 1YKAA 3HZ8A 4F0CA 1B4PA 3FZ4A 3ERFA 5D9XA 2PGTA 1B48A 2M80A 4HDEA 3CBUA 3KMOA 2XBQA 3UEMA 2CVKA 1SYRA 6GSWA 1XWKA 3LG6A 1OC9B 3C1RA 2RUEA 5HQPA 5ECNB 3I43A 3F6FA 1BAYA 5HR1A 1PQNA 1F2EA 1T8EB 2GSSA 4NWYA 4RI6A 20GSA 4Q5NA 2OJLA 1K3YA 1GSFA 3HHVA 5IMFA 2YPMA 2VM2A 4MJEA 2DJKA 3A2WA 1E6BA 2PUKC 2WRTA 2HRFA 4AJ8A 4MP4A 2J23A 1T4YA 4O92A 3BD2A 5DAKA 3WT2A 5DQYA 1F9MA 4X0XA 2FLSA 2H1AA 2O87A 4F9ZA 2Z9SA 3FZ9A 4XRDA 3ZFLA 2AV4A 3GYKA 5JWOB 2F3MA 3F3QA 17GSA 3A2VA 5J9CA 3TOUA 3VURA 4NHWA 3ED3A 2I3YA 2P5QA 4EE0A 1LU4A 4EL1A 6GSTA 5KN0A 4FYBA 2O8VB 1QQ2A 5HFGA 3KJYA 3U5RE 2H71A 2IMDA 3G7YA 1GSQA 3EC3A 1K0OA 2YCDA 4JRRA 3QD9A 1VF2A 4ID0A 3TRPA 1YF0A 3H4KA 1GNEA 4MPGA 4BPYA 1HNAA 1O81A 3QAGA 5C00A 11GSA 4FYUA 3PGTA 1NM3A 1GUMA 2C0FA 3GX0A 3UVTA 4TVEA 3HJPA 2LKUA 3IRAA 1Z9HA 2WULA 5ABRA 3TKRA 2A2SA 3D6IA 3EU4A 3US3A 1U3IA 2L4QA 2FUG2 3DXBA 5A5KA 1O85A 2WGRA 5LCZA 5D73A 3CSJA 3W8SA 3F4RA 8GSSA 5D9TA 2DBCA 3GH6A 1LJRA 1XWBA 3LFLA 1Z7RA 4JR4A 3LGCA 2WCIA 1K3LA 1JZDA 4MZWA 3GHAA 1SD8A 2VD0A 4WXTA 2YV9A 2C8UA 2CVDA 3IK9A 5C04A 1ZYQB 2X8HA 3EVIA 4D73A 1TK8B 4EKZA 1WE0A 2O89A 5B7CA 4JR6A 3M8NA 1UC7A 4KSOA 4TN8A 3HVSA 1YZXA 1WMJA 2VCTA 5H5QA 5F05A 2ZNMA 5COHA 4LA1A 2FWEA 5IPHA 1DBYA 3ZRDA 3VFIA 5KEJA 2CX3A 3QAVA 3DVXA 2LQOA 3QAWA 4K6XA 4IP6A 4G19A 5DDLA 3BJ5A 1M9AA
chains in the Genus database with same CATH superfamily
3E0UA 1BX9A 4G9HA 4N0VA 4OFMA 2B7JA 4TR0A 1AAZA 3IR4A 4G2EA 2YOIA 5IO2A 2MMNA 3ZREA 3FW2A 4JE1A 2LUSA 3C1SA 3GKNA 3UARA 3J7Yb 3UVHA 4MZBA 1R5PA 4I6XA 2HZEB 3FR3A 1QXHA 1MDKA 2RM5A 1ML6A 3LXTA 1F37A 5DBQA 4ZL8A 2P0GA 4E8HA 2GDRA 2K18A 3KEBA 1RW1A 1QGVA 1YEXA 4K5SA 1N2AA 1N8JA 3DRNA 5KN1A 2H6ZA 5AN1A 1U6TA 1T1VA 1XW5A 4HOJA 3RDWA 4G0LA 1HD2A 3FRCA 3P90A 1YEPA 4Z2TA 3HDCA 4EO3A 5DVBA 1EEMA 2HE3A 1H75A 4BL7A 4PXOA 3GRXA 5IIZA 3DEXA 3W6GA 3MAKA 1JFUA 2E2MA 2VD1A 2C0GA 4KNDA 2YJ7A 3TDGA 1A0RP 1M9BA 1SL2B 1YQ1A 2WFCA 3TJKA 1FO5A 1MD4A 3UOMA 3F3RA 1OVNA 4MLYA 4I97A 4IP1A 1PSQA 1GSSA 5IPGA 3GSTA 2H74A 1GL8A 5EY6A 1KBNA 1GWCA 2LRCA 2KLXA 4HUAA 2M72A 4WBJA 5H5RA 3HY2A 4N30A 1EWXA 1V40A 1QUWA 5EVOA 5IOXA 5DAKB 4K1FA 4EC0A 4DEJA 5A4WA 2WJUA 1ZYEA 5ECKB 5GZZB 1VGLA 1SJ6A 3MIXA 6GSYA 2EIOA 2FA8A 2ES7A 4PNGA 2VCXA 2C0EA 2VCQA 4IN0A 4ECIA 2B5YA 2A2RA 3RAZA 1FVKA 1MDJA 1B9YC 3IA1A 1TRVA 1OKDA 2UZ8A 3MSZA 5ELAA 1G6YA 1FVJA 1TP9A 4I5QA 2CVBA 3DVWA 3D21A 1O8WA 2GSQA 2ON7A 1SKSB 1USBA 5IOWA 2MBTA 5D9VA 4QQ7A 1EEJA 2IN3A 4FYCA 2DKHA 1JLWA 4HJMA 4FH8A 1A24A 1SENA 1BJXA 2L5OA 3GIXA 1WRYA 4IJIA 2REMA 1TXXA 4EXJA 4MH3A 1PX6A 3D4MA 1ZYNA 4KH7A 2B3SA 2AYTA 5G31A 3Q74A 2C0DA 1FW1A 2RIIA 1F6MC 2ON5A 2IMEA 4EDYA 5AIXA 4EDZA 3VPTA 1K0CA 2V2GA 1G7OA 2I9HA 14GSA 4ACSA 2HYXA 2J9HA 2IFQA 2OBKA 4L0WA 3CSHA 4POBA 3D4TA 1CQHA 3BCKA 1YY7A 2M46A 1SKRB 3C71A 2PVQA 4PNFA 4DSRA 4DSQA 5J9BA 2XC2A 2PPTA 1HQOA 4ML1A 3TOTA 1G7EA 1OYJA 4HZ2A 4D73B 3MYDA 4FQUA 3EE2A 4YQMA 1AQWA 1SL0B 4Z2UA 4BWSA 4OWYA 5F0GA 1Z5YE 1EOGA 2CAIA 4G0KA 2CQ9A 2GZZA 2JZRA 4ISDA 2YWIA 3P2AA 3DYRA 1WPIA 3Q18A 4F82A 3CSIA 5J4UA 3F9UA 2MZCA 4XS4A 3EINA 1SL1B 1ZL9A 3TKSE 4HQZA 2H0HA 2VCVA 5E59A 1SK0A 2TRXA 1K0AA 1ERTA 2F51A 3J7Yk 4CHSA 3IC4A 1R5AA 5GSTA 1WIKA 4O5RA 2H8LA 2L57A 2HSHA 2R4VA 2V32A 4PGTA 1TRUA 5JCWA 2MMZA 2XBIA 4WEYA 3SBCA 1PA3A 1EGOA 2G2QA 2P5RA 7GSSA 5JWQB 1PL2A 2N5FA 1RQMA 2VLUA 4MJBA 2V1MA 4EF0A 3HYPA 1HNCA 2F8AA 4PTSA 5F8BA 3GH9A 2C3TA 3VI7A 4ZB9A 5F07A 1EV4A 1BQ7A 4BVYA 4GTUA 2L5LA 2GZYA 1F3BA 1JZWA 6GSVA 1FOVA 5IMAA 3G7JA 1G6WA 1K3OA 1A8LA 1Q98A 4BL7B 2YNXA 2N5AA 3IXRA 5IMDA 4Q5QA 4OO5A 2IMIA 1O8XA 4BVXA 5ECSA 1FAAA 3F8UA 1M3IA 3ZZXA 3CYNA 1PX7A 1GTBA 3KD0A 3UL3A 2QSIA 4ECCA 4OD7A 1ZOFA 5IM9A 4OCFA 2GQLA 3HJOA 2X49A 1VF1A 3UBLA 2DSAA 2PWJA 1LBKA 3QOUA 4ECJA 2LSTA 1FG4A 4GQFA 1JZRA 4YAPA 5KOXA 3F6DA 1THOA 2E0QA 3D5JA 3G9BA 2HT9A 1TRSA 1EP7A 1NHYA 4TXOA 5BMUA 1XVWA 4K9ZA 1ILOA 2C3QA 5ECHB 4PURA 3IV4A 1O6JA 5DQSA 2IPAA 4Z7XA 3KTBA 3A5IA 1ZZYA 2H66A 2CA8A 4KAEA 1GSEA 1IYIA 3DD3A 1AC1A 2DIYA 3HCZA 1YJ6A 2F9SA 4NHZA 2BTOT 2FA4A 1U3AA 2LV3A 3IPZA 2GT6A 4NMUA 4V2MA 1XWCA 3WGXA 2H0IA 4IQAA 1GTAA 2D2ZA 1AW9A 4ZB6A 5JWRB 3WGDA 3N5OA 5HR2A 1WJKA 6GSSA 3P8WA 5IMVA 3QPMA 4AF2A 4MA9A 4WR5A 3WD6A 4HJ2A 2CZ2A 2WZ9A 2OACA 4L8EA 4K2XA 2IFQB 1EOHA 5F06A 3H79A 5HFIA 2IMKA 1T4ZA 5D9WA 3LXZA 2JADA 1M7TA 3WT1A 3GSSA 5G2ZA 1B8XA 4IS0A 5ECLB 3MWHA 2DMLA 2K8SA 2LJAA 5CRWA 2H75A 3FEUA 4Q5FA 2VLTA 2K9FA 3H93A 2MMOA 4IW9A 4ILFA 4ZB8A 4XRAA 1QFNA 3VPQA 2X99A 2GQKA 1DE1A 3ZVJD 2X64A 4JZQA 3RBTA 1Z7PA 2GSRA 4TXVA 5G1KA 3PH9A 1R26A 5D93A 1PRXA 4GSNA 4XS4B 3IBHA 1TTZA 4XS6A 1ERWA 3QDNA 2YWNA 1TJDA 1R7HA 2H0GA 2V6KA 1SJZA 3JCML 2V6OA 2B5XA 2OA7A 1M0UA 3F0IA 3FY7A 1XOBA 1XPVA 2ZCTA 1ERVA 1XWAA 2JSYA 3BBYA 5IO0A 2AHEA 5G30A 5HR0A 4MF6A 5EPFA 2VM1A 3GMFA 4YH2A 4KDXA 2QGVA 2YANA 2CZ3A 3QFAC 4JEDA 1KTEA 2VOCA 4GRFA 2A4HA 2R3XA 4FO5A 4BVYB 3HKRA 2DJ1A 2PVOC 1U87A 1XXUA 4MF7A 2HXKA 2VAFA 5G5FA 2FCHA 3BCIA 2XPDA 2FHEA 2H1BA 1PMTA 1SU9A 1ZCPA 2IMFA 9GSSA 3F4SA 2DJ0A 4NXIA 5CO3A 4K5RA 3TJJA 4K7OA 4NV5A 1NHOA 3QCPA 3PPUA 1SD9A 4J2FA 2H6YA 4BVXB 4Z2RA 5AISA 5KN3A 1V98A 3FMWA 3KH9A 3QFBC 2B5EA 2FD3A 5CRDA 2FWGA 4N11A 2DJ3A 2LRTA 1TU8A 1E2YA 3KM6A 1SKWB 4L0UA 5ID2A 3VWUA 4ZXGA 2AJQB 4PUAA 3L4NA 2GQMA 1GSYA 4MK3A 2LRNA 2TRCP 1FB6A 3CRUA 18GSA 2VL2C 3K8NA 4K0GA 5FWGA 1BYEA 2KP2A 1OAZA 2KUCA 4N0ZA 1XIYA 1R4WA 5AGYA 2PN8A 2R6KA 2H76A 3IHQA 1XOAA 2GGTA 5DCHA 3ZVJA 1M99A 2RUFA 4TXOB 4LL1B 3TKPA 3ERWA 1CQGA 2C3NA 4ZBBA 5CYYA 3EMXA 1S3CA 3MNGA 1BG5A 3ZMLA 1Y6EA 4MNNA 4BA7A 2LNTA 4KCEA 5INYA 4FIWA 3IE3A 2DMMA 5J3RA 1XFLA 3FZAA 5ECQB 1X9MB 3CXGA 2PBJA 2QA2A 5A4VA 3FR6A 3O76A 3RPPA 4IVFA 2L6DA 2QA1A 1GSDA 2YP6A 3TJGA 2HSMA 3ZFBA 3I9V2 4G0IA 2LQQA 3TGZA 2DKIA 1GULA 1EGRA 3GN3A 4HEA2 4EIPA 2LJRA 3L9SA 2L4CA 3EU3A 2CT6A 5B6NA 5KN2A 4AJ7A 3HXSA 2K8VA 4RUVA 4GXZA 3GL5A 3D0ZA 4EUYA 1B9XC 4TR3A 3RHCA 2H70A 4I2TA 4XHMA 2YWMA 5G1LA 2LJKA 2K6VA 1XW6A 4TRXA 3R3EA 1TDIA 3NIVA 1K0DA 4LLRA 4EIQA 5JCGA 1VF4A 1J0FA 5J41A 1Z6MA 3CMIA 2C1YA 3C7MA 3L0HA 2ALBA 2MMAA 1Q4JA 2IJYA 4JBBA 3Q6OA 4ECBA 4OMVA 3EWLA 1YDKA 2YZUA 2DJJA 2XPEA 1T7PB 3GTUA 2KOKA 1GNWA 4V2NA 1SYXA 4POKA 3I69A 2WB9A 3GA4A 4HI7A 4IELA 3RPNA 4LMWA 1GTIA 4IHUA 2B7KA 2PMTA 4TR1A 5CP1A 5LD0A 1IYHA 4KA0A 5JCUA 2GTUA 5AIVA 2H1GA 4ZL7A 3O6TA 2P31A 1M3JA 2C4JA 4KB3A 1UVZA 1GLPA 4KGIA 3HVVA 2LTKA 3QR6A 4G10A 1A2JA 1OE8A 3IHGA 1JLVA 1SJIA 1JHBA 2WDUA 3VLNA 2GLRA 2FNOA 3KIJA 3O3TA 5B8AA 4X1UA 3DWVA 1K0NA 2DLXA 4YAVA 1NW2A 4LMVA 4GSSA 2G0FA 4L5OA 4YKGA 3GKKA 3I6AA 2CAQA 5DALA 1F3AA 3LYKA 1XW9A 1S3AA 3HZ4A 5FHIA 3TJFA 4CY6A 2B6MA 5CREA 4ZBAA 4I8BA 5ENUA 3QMXA 4WR4A 1AXDA 4EVMA 3C73A 22GSA 5CAXA 2R37A 4ZBDA 1TK0B 3VWXA 1TOFA 5IQYA 3ME7A 3WYWA 2HI7A 1Z3EA 4F2IA 2VCWA 1PD21 4IKHA 2I81A 4O7HA 1G0TA 1JZOA 3LSZA 1V57A 1PN0A 4MJCA 4MMMA 1ZMAA 3GKMA 4XIHA 2DIZA 1V58A 19GSA 3IOSA 1EV9A 3PINA 4PUFC 5ID2B 4MABA 1X9SB 4GSTA 4F03A 4DVCA 4XS1A 1ACVA 4KSMA 3RHBA 2FWHA 2OADA 4KDYA 3TB2A 5CRHA 3LORA 5IMCA 3LJRA 4OFTA 1EZKA 1Z6NA 4HS1A 4GWRA 1AIUA 2DC5A 4Q5RA 1AQVA 3FR9A 3DIEA 4O5QA 3CTFA 1PGTA 1YKCA 3GNJA 1FHEA 4TKYA 1NSWA 2JSZA 1URMA 2IL3A 2MYGA 2JL4A 16GSA 1TKDB 4PQHA 1SK2A 2NPBA 1AUCA 4MZCA 4QL7A 3KP9A 1TK5B 2IIYA 13GSA 2LEGA 1J9BA 4MDCA 1U88A 2JACA 3KTLA 1KEBA 4AJ6A 3P7XA 2VL3A 3DKSA 4O5UA 2GSTA 4V1Ag 2NTOA 1THXA 4K7NA 4YQVA 3TRXA 3W8JA 4OFNA 3TUEA 1PKWA 2WS2A 4PQ1A 1X5EA 4OCEA 1MDIA 3LW9A 3A5WA 2RM6A 4BWQA 5GAND 3TKSA 3KCMA 2OBIA 3HVXA 1V2AA 2OKAA 2R2JA 4KE3A 4WETA 5L71A 1BEDA 4RQRA 1ABAA 3UAPA 1TI3A 2I4AA 1QMVA 3ZL5A 3ZTLA 3FHKA 2R5GA 1T3BA 2LNSA 2NBSA 5GSSA 1FB0A 2TIRA 3LYPA 1ZYPA 2YZHA 3IAS2 5CNWA 3FYGA 3APQA 1ERUA 2KHPA 1GH2A 3IK7A 2ZUPA 5ELGA 4YKFA 5GAPD 2L59A 3SWLA 2X8CA 2E7PA 1GP1A 3KGKA 2OE0A 2GVPA 1J08A 1WP0A 3APSA 3KMNA 2JU5A 1VF3A 4KUNA 2I1UA 2H19A 2QC7A 3R2QA 1GSUA 1X9WB 3M3MA 3GTUB 2OE1A 3BOAA 3D22A 2GT5A 2VL9A 3TKSC 2EIQA 4TR1B 1A2LA 12GSA 2H6XA 1DSBA 2CV4A 3G7IA 4LL4B 4E8EA 4K2DA 4DSSA 4WF5A 10GSA 5G5EA 2CX4A 3DMLA 4JU5A 3EURA 2NDOA 1X5CA 2B1LA 5A4UA 3TCOA 4XTSA 4RQXA 3GX8A 3PR8A 1I5GA 5H5SA 3OR5A 1GUHA 3KP8A 1YF1A 3UIWA 3L78A 2AB6A 2KP1A 1ON4A 3C8EA 2HZFA 3A2XA 2R0GA 3KZQA 4NPBA 1Y25A 5ECPB 3TRQA 2YJHA 3N9JA 4K7IA 2VIMA 3HD5A 3Q19A 1I9DA 4MJAA 1MEKA 4L5LA 1S3DA 2YN1A 5DALB 3H8QA 4IQ1A 1OC8A 4CY8A 1QK8A 2VL2A 3EYTA 3TKQA 2R0CA 2VLVA 3ISOA 2BJXA 1OC9A 5J5NA 4MPFA 1MD3A 1XZOA 3TJBA 1W89A 3AY8A 1H4OA 5CRGA 3ME8A 5E4WA 4J56E 1A23A 3IAM2 4HQSA 1KNGA 2OE3A 3IDVA 4IGJA 3LWAA 3UJ1A 5ECMB 5ECOB 4X43A 4WBRD 2QKEA 3M1GA 6GSXA 2BMXA 2A4VA 2JZTA 4HSCX 1FOHA 5EL8A 3ZIJA 3GL3A 1ZGNA 3HJMA 3LEFA 2AAWA 1EP8A 4QL9A 3HVNA 3NZNA 5FT3A 1A2MA 1TW9A 1XWGA 1TRWA 2FWFA 2O7KA 3VWVA 1AQXA 1RK4A 2IWTA 2YV7A 1A0FA 4POMA 2HFDA 4HZ4A 1PKZA 2JZSA 3A3TA 3ZIVA 1C72A 1GLQA 2O85A 4V1Ap 2F8FA 3U6VA 2NVLA 6GSUA 3HA9A 2FGXA 3EMPA 3M9KA 4MF5A 4CDOA 2LS5A 3VWWA 4ML6A 1M2DA 3CRTA 1DE2A 1O7UA 2EIRA 2H01A 4IBPA 3S9FA 5D96A 1TI1A 4PQIA 1M2BA 3L9UA 1UN2A 1OKTA 3VK9A 1XBSA 4RI7A 4TOPA 5DJLA 4A5PA 5DJMA 4USSA 1PL1A 2V41A 5B6MA 4YQUA 4GCIA 1GRXA 2AUVA 4ZILA 4ZIJA 1K0BA 1MTCA 4BIKA 2VCZA 1X5DA 4NV2A 1B4QA 5ECRB 2X4AA 2GZPA 4N10A 4X4JA 4TW5A 4F0BA 1ST9A 3H1NA 4KF9A 3ZITA 1GUKA 3ZYWA 2MBSA 4KX4A 3NOFA 2HRNA 2HLSA 1K0MA 4V2LA 4OO4A 2RLIA 3ZMKA 2VUPA 2HSYA 2DJ2A 4MCUA 4KDUA 3GUSA 1T00A 1OC3A 4P3YB 4I2UA 3WGEA 5HFKA 2E2GA 1HYUA 1DUGA 3M9JA 3GFKA 5DCGA 3ZLPA 1X0RA 2H73A 1M2AA 5HR3A 1S3RA 5IMZA 2PERA 3GV1A 1GTUA 4HU7A 4TR4A 4O32A 2X8GA 3IC8A 2L6CA 2GS3A 4PX1A 3CTGA 2FY6A 3L9VA 3LQ7A 2HNLA 1V9WA 1UA5A 2H72A 3M0FA 4MH2A 4GQCA 1WOUA 2EC4A 3E9JB 4IJ3A 3MDKA 3E3EA 3FK8A 2YWOA 3UBKA 3F4TA 4KW6A 3V1WA 3ERGA 1O73A 2N5BA 2C80A 3GKXA 4J57E 2VO4A 4HU9A 4WKWA 1TU7A 2XHFA 2H1DA 4KCAA 4XCSA 3DGQA 4NAXA 4DSSB 1HNBA 4AGSA 4POLA 1XCCA 4K0NA 4ZL9A 3KH7A 1WWJA 2HZEA 2B1KA 4ULXA 3EPTA 2PU9C 4GF0A 4GLTA 4H86A 4CW9A 2HRAA 3APOA 5B8BA 1PN9A 4K8MA 3F63A 5BRTA 5D8IA 5LNKe 3FZ5A 5ECIB 3UMAA 1VRSD 3VI5A 2H30A 3GURA 1A8YA 1OE7A 4WF4A 1SK1A 3FKFA 1W4VA 3KXOA 1XVQA 1YKAA 3HZ8A 4F0CA 1B4PA 3FZ4A 3ERFA 5D9XA 2PGTA 1B48A 2M80A 4HDEA 3CBUA 3KMOA 2XBQA 3UEMA 2R0PA 2CVKA 1SYRA 6GSWA 1XWKA 3LG6A 1OC9B 3C1RA 2RUEA 5HQPA 5ECNB 3I43A 3F6FA 1BAYA 3CQFA 5HR1A 1PQNA 1F2EA 1T8EB 2GSSA 4NWYA 4RI6A 20GSA 4Q5NA 2OJLA 1K3YA 1GSFA 3HHVA 5IMFA 2YPMA 2VM2A 4MJEA 2DJKA 3A2WA 1E6BA 2PUKC 2WRTA 2HRFA 1XG8A 4AJ8A 4MP4A 2J23A 1T4YA 4O92A 3BD2A 5DAKA 3WT2A 5DQYA 1F9MA 4X0XA 2FLSA 2H1AA 2O87A 4F9ZA 1PFOA 2Z9SA 3FZ9A 4XRDA 3ZFLA 2AV4A 3GYKA 5JWOB 2F3MA 3F3QA 17GSA 3A2VA 5J9CA 3TOUA 3VURA 4NHWA 3ED3A 2I3YA 2P5QA 4EE0A 1LU4A 4EL1A 6GSTA 5KN0A 4FYBA 2O8VB 1QQ2A 5HFGA 3KJYA 3U5RE 2H71A 2IMDA 3G7YA 1GSQA 3EC3A 1K0OA 2YCDA 4JRRA 3QD9A 1VF2A 4ID0A 3TRPA 1YF0A 3H4KA 1GNEA 4MPGA 4BPYA 1HNAA 1O81A 3QAGA 5C00A 11GSA 4FYUA 3PGTA 1NM3A 4ICYA 5KOWA 1GUMA 2C0FA 3GX0A 3UVTA 4TVEA 3HJPA 2LKUA 3IRAA 1Z9HA 2WULA 5ABRA 3TKRA 2A2SA 3D6IA 3EU4A 3US3A 1U3IA 2L4QA 2FUG2 3DXBA 5A5KA 1O85A 2WGRA 5LCZA 5D73A 3CSJA 3W8SA 3F4RA 8GSSA 5D9TA 2DBCA 3GH6A 1LJRA 1XWBA 3LFLA 1Z7RA 4JR4A 3LGCA 2WCIA 1K3LA 1JZDA 4MZWA 3GHAA 1SD8A 2VD0A 4WXTA 2YV9A 2C8UA 2CVDA 3IK9A 5C04A 1ZYQB 2X8HA 3EVIA 4D73A 1TK8B 4EKZA 1WE0A 2O89A 5B7CA 4JR6A 2A2PA 3M8NA 1UC7A 4KSOA 4TN8A 3HVSA 1YZXA 1WMJA 2VCTA 5H5QA 5F05A 2ZNMA 5COHA 4LA1A 2FWEA 5IPHA 2HRKA 1DBYA 3ZRDA 3VFIA 5KEJA 2CX3A 3QAVA 3DVXA 2LQOA 3QAWA 4K6XA 4IP6A 4G19A 5DDLA 3BJ5A 1M9AA
chains in the Genus database with same CATH topology
3E0UA 1BX9A 4G9HA 4N0VA 4OFMA 2B7JA 4TR0A 1AAZA 3IR4A 4G2EA 2YOIA 5IO2A 2MMNA 3ZREA 3FW2A 4JE1A 2LUSA 3C1SA 3GKNA 3UARA 3J7Yb 3UVHA 4MZBA 1R5PA 4I6XA 2HZEB 3FR3A 1QXHA 1MDKA 2RM5A 1ML6A 3LXTA 1F37A 5DBQA 4ZL8A 2P0GA 4E8HA 2GDRA 2K18A 3KEBA 1RW1A 1QGVA 1YEXA 4K5SA 1N2AA 1N8JA 3DRNA 5KN1A 2H6ZA 5AN1A 1U6TA 1T1VA 1XW5A 4HOJA 3RDWA 4G0LA 1HD2A 3FRCA 3P90A 1YEPA 4Z2TA 3HDCA 4EO3A 5DVBA 1EEMA 2HE3A 1H75A 4BL7A 4PXOA 3GRXA 5IIZA 3DEXA 3W6GA 3MAKA 1JFUA 2E2MA 2VD1A 2C0GA 4KNDA 2YJ7A 3TDGA 1A0RP 1M9BA 1SL2B 1YQ1A 2WFCA 3TJKA 1FO5A 1MD4A 3UOMA 3F3RA 1OVNA 4MLYA 4I97A 4IP1A 1PSQA 1GSSA 5IPGA 3GSTA 2H74A 1GL8A 5EY6A 1KBNA 1GWCA 2LRCA 2KLXA 4HUAA 2M72A 4WBJA 5H5RA 3HY2A 4N30A 1EWXA 1V40A 1QUWA 5EVOA 5IOXA 5DAKB 4K1FA 4EC0A 4DEJA 5A4WA 2WJUA 1ZYEA 5ECKB 5GZZB 1VGLA 1SJ6A 3MIXA 6GSYA 2EIOA 2FA8A 2ES7A 4PNGA 2VCXA 2C0EA 2VCQA 4IN0A 4ECIA 2B5YA 2A2RA 3RAZA 1FVKA 1MDJA 1B9YC 3IA1A 1TRVA 1OKDA 2UZ8A 3MSZA 5ELAA 1G6YA 1FVJA 1TP9A 4I5QA 2CVBA 3DVWA 3D21A 1O8WA 2GSQA 2ON7A 1SKSB 1USBA 5IOWA 2MBTA 5D9VA 4QQ7A 1EEJA 2IN3A 4FYCA 2DKHA 1JLWA 4HJMA 4FH8A 1A24A 1SENA 1BJXA 2L5OA 3GIXA 1WRYA 4IJIA 2REMA 1TXXA 4EXJA 4MH3A 1PX6A 3D4MA 1ZYNA 4KH7A 2B3SA 2AYTA 5G31A 3Q74A 2C0DA 1FW1A 2RIIA 1F6MC 2ON5A 2IMEA 4EDYA 5AIXA 4EDZA 3VPTA 1K0CA 2V2GA 1G7OA 2I9HA 14GSA 4ACSA 2HYXA 2J9HA 2IFQA 2OBKA 4L0WA 3CSHA 4POBA 3D4TA 1CQHA 3BCKA 1YY7A 2M46A 1SKRB 3C71A 2PVQA 4PNFA 4DSRA 4DSQA 5J9BA 2XC2A 2PPTA 1HQOA 4ML1A 3TOTA 1G7EA 1OYJA 4HZ2A 4D73B 3MYDA 4FQUA 3EE2A 4YQMA 1AQWA 1SL0B 4Z2UA 4BWSA 4OWYA 5F0GA 1Z5YE 1EOGA 2CAIA 4G0KA 2CQ9A 2GZZA 2JZRA 4ISDA 2YWIA 3P2AA 3DYRA 1WPIA 3Q18A 4F82A 3CSIA 5J4UA 3F9UA 2MZCA 4XS4A 3EINA 1SL1B 1ZL9A 3TKSE 4HQZA 2H0HA 2VCVA 5E59A 1SK0A 2TRXA 1K0AA 1ERTA 2F51A 3J7Yk 4CHSA 3IC4A 1R5AA 5GSTA 1WIKA 4O5RA 2H8LA 2L57A 2HSHA 2R4VA 2V32A 4PGTA 1TRUA 5JCWA 2MMZA 2XBIA 4WEYA 3SBCA 1PA3A 1EGOA 2G2QA 2P5RA 7GSSA 5JWQB 1PL2A 2N5FA 1RQMA 2VLUA 4MJBA 2V1MA 4EF0A 3HYPA 1HNCA 2F8AA 4PTSA 5F8BA 3GH9A 2C3TA 3VI7A 4ZB9A 5F07A 1EV4A 1BQ7A 4BVYA 4GTUA 2L5LA 2GZYA 1F3BA 1JZWA 6GSVA 1FOVA 5IMAA 3G7JA 1G6WA 1K3OA 1A8LA 1Q98A 4BL7B 2YNXA 2N5AA 3IXRA 5IMDA 4Q5QA 4OO5A 2IMIA 1O8XA 4BVXA 5ECSA 1FAAA 3F8UA 3ZZXA 3CYNA 1PX7A 1GTBA 3KD0A 3UL3A 2QSIA 4ECCA 4OD7A 1ZOFA 5IM9A 4OCFA 2GQLA 3HJOA 2X49A 1VF1A 3UBLA 2DSAA 2PWJA 1LBKA 3QOUA 4ECJA 2LSTA 1FG4A 4GQFA 1JZRA 4YAPA 5KOXA 3F6DA 1THOA 2E0QA 3D5JA 3G9BA 2HT9A 1TRSA 1EP7A 1NHYA 4TXOA 5BMUA 1XVWA 4K9ZA 1ILOA 2C3QA 5ECHB 4PURA 3IV4A 1O6JA 5DQSA 2IPAA 4Z7XA 3KTBA 3A5IA 1ZZYA 2H66A 2CA8A 4KAEA 1GSEA 1IYIA 3DD3A 1AC1A 2DIYA 3HCZA 1YJ6A 2F9SA 4NHZA 2BTOT 2FA4A 1U3AA 2LV3A 3IPZA 2GT6A 4NMUA 4V2MA 1XWCA 3WGXA 2H0IA 4IQAA 1GTAA 2D2ZA 1AW9A 4ZB6A 5JWRB 3WGDA 3N5OA 5HR2A 1WJKA 6GSSA 3P8WA 5IMVA 3QPMA 4AF2A 4MA9A 4WR5A 3WD6A 4HJ2A 2CZ2A 2WZ9A 2OACA 4L8EA 4K2XA 2IFQB 1EOHA 5F06A 3H79A 5HFIA 2IMKA 1T4ZA 5D9WA 3LXZA 2JADA 1M7TA 3WT1A 3GSSA 5G2ZA 1B8XA 4IS0A 5ECLB 3MWHA 2DMLA 2K8SA 2LJAA 5CRWA 2H75A 3FEUA 4Q5FA 2VLTA 2K9FA 3H93A 2MMOA 4IW9A 4ILFA 4ZB8A 4XRAA 1QFNA 3VPQA 2X99A 2GQKA 1DE1A 3ZVJD 2X64A 4JZQA 3RBTA 1Z7PA 2GSRA 4TXVA 5G1KA 3PH9A 1R26A 5D93A 1PRXA 4GSNA 4XS4B 3IBHA 1TTZA 4XS6A 1ERWA 3QDNA 2YWNA 1TJDA 1R7HA 2H0GA 2V6KA 1SJZA 3JCML 2V6OA 2B5XA 2OA7A 1M0UA 3F0IA 3FY7A 1XOBA 1XPVA 2ZCTA 1ERVA 1XWAA 2JSYA 3BBYA 5IO0A 2AHEA 5G30A 5HR0A 4MF6A 5EPFA 2VM1A 3GMFA 4YH2A 4KDXA 2QGVA 2YANA 2CZ3A 3QFAC 4JEDA 1KTEA 2VOCA 4GRFA 2A4HA 2R3XA 4FO5A 4BVYB 3HKRA 2DJ1A 2PVOC 1U87A 1XXUA 4MF7A 2HXKA 2VAFA 5G5FA 2FCHA 3BCIA 2XPDA 2FHEA 2H1BA 1PMTA 1SU9A 1ZCPA 2IMFA 9GSSA 3F4SA 2DJ0A 4NXIA 5CO3A 4K5RA 3TJJA 4K7OA 4NV5A 1NHOA 3QCPA 3PPUA 1SD9A 4J2FA 2H6YA 4BVXB 4Z2RA 5AISA 5KN3A 1V98A 3FMWA 3KH9A 3QFBC 2B5EA 2FD3A 5CRDA 2FWGA 4N11A 2DJ3A 2LRTA 1TU8A 1E2YA 3KM6A 1SKWB 4L0UA 5ID2A 3VWUA 4ZXGA 2AJQB 4PUAA 3L4NA 2GQMA 1GSYA 4MK3A 2LRNA 2TRCP 1FB6A 3CRUA 18GSA 2VL2C 3K8NA 4K0GA 5FWGA 1BYEA 2KP2A 1OAZA 2KUCA 4N0ZA 1XIYA 1R4WA 5AGYA 2PN8A 2R6KA 2H76A 3IHQA 1XOAA 2GGTA 5DCHA 3ZVJA 1M99A 2RUFA 4TXOB 4LL1B 3TKPA 3ERWA 1CQGA 2C3NA 4ZBBA 5CYYA 3EMXA 1S3CA 3MNGA 1BG5A 3ZMLA 1Y6EA 4MNNA 4BA7A 2LNTA 4KCEA 5INYA 4FIWA 3IE3A 2DMMA 5J3RA 1XFLA 3FZAA 5ECQB 1X9MB 3CXGA 2PBJA 2QA2A 5A4VA 3FR6A 3O76A 3RPPA 4IVFA 2L6DA 2QA1A 1GSDA 2YP6A 3TJGA 2HSMA 3ZFBA 3I9V2 4G0IA 2LQQA 3TGZA 2DKIA 1GULA 1EGRA 3GN3A 4HEA2 4EIPA 2LJRA 3L9SA 2L4CA 3EU3A 2CT6A 5B6NA 5KN2A 4AJ7A 3HXSA 2K8VA 4RUVA 4GXZA 3GL5A 3D0ZA 4EUYA 1B9XC 4TR3A 3RHCA 2H70A 4I2TA 4XHMA 2YWMA 5G1LA 2LJKA 2K6VA 1XW6A 4TRXA 3R3EA 1TDIA 3NIVA 1K0DA 4LLRA 4EIQA 5JCGA 1VF4A 1J0FA 5J41A 1Z6MA 3CMIA 2C1YA 3C7MA 3L0HA 2ALBA 2MMAA 1Q4JA 2IJYA 4JBBA 3Q6OA 4ECBA 4OMVA 3EWLA 1YDKA 2YZUA 2DJJA 2XPEA 1T7PB 3GTUA 2KOKA 1GNWA 4V2NA 1SYXA 4POKA 3I69A 2WB9A 3GA4A 4HI7A 4IELA 3RPNA 4LMWA 1GTIA 4IHUA 2B7KA 2PMTA 4TR1A 5CP1A 5LD0A 1IYHA 4KA0A 5JCUA 2GTUA 5AIVA 2H1GA 4ZL7A 3O6TA 2P31A 2C4JA 4KB3A 1UVZA 1GLPA 4KGIA 3HVVA 2LTKA 3QR6A 4G10A 1A2JA 1OE8A 3IHGA 1JLVA 1SJIA 1JHBA 2WDUA 3VLNA 2GLRA 2FNOA 3KIJA 3O3TA 5B8AA 4X1UA 3DWVA 1K0NA 2DLXA 4YAVA 1NW2A 4LMVA 4GSSA 2G0FA 4L5OA 4YKGA 3GKKA 3I6AA 2CAQA 5DALA 1F3AA 3LYKA 1XW9A 1S3AA 3HZ4A 5FHIA 3TJFA 4CY6A 2B6MA 5CREA 4ZBAA 4I8BA 5ENUA 3QMXA 4WR4A 1AXDA 4EVMA 3C73A 22GSA 5CAXA 2R37A 4ZBDA 1TK0B 3VWXA 1TOFA 5IQYA 3ME7A 3WYWA 2HI7A 1Z3EA 4F2IA 2VCWA 1PD21 4IKHA 2I81A 4O7HA 1G0TA 1JZOA 3LSZA 1V57A 1PN0A 4MJCA 4MMMA 1ZMAA 3GKMA 4XIHA 2DIZA 1V58A 19GSA 3IOSA 1EV9A 3PINA 4PUFC 5ID2B 4MABA 1X9SB 4GSTA 4F03A 4DVCA 4XS1A 1ACVA 4KSMA 3RHBA 2FWHA 2OADA 4KDYA 3TB2A 5CRHA 3LORA 5IMCA 3LJRA 4OFTA 1EZKA 1Z6NA 4HS1A 4GWRA 1AIUA 2DC5A 4Q5RA 1AQVA 3FR9A 3DIEA 4O5QA 3CTFA 1PGTA 1YKCA 3GNJA 1FHEA 4TKYA 1NSWA 2JSZA 1URMA 2IL3A 2MYGA 2JL4A 16GSA 1TKDB 4PQHA 1SK2A 2NPBA 1AUCA 4MZCA 4QL7A 3KP9A 1TK5B 2IIYA 13GSA 2LEGA 1J9BA 4MDCA 1U88A 2JACA 3KTLA 1KEBA 4AJ6A 3P7XA 2VL3A 3DKSA 4O5UA 2GSTA 4V1Ag 2NTOA 1THXA 4K7NA 4YQVA 3TRXA 3W8JA 4OFNA 3TUEA 1PKWA 2WS2A 4PQ1A 1X5EA 4OCEA 1MDIA 3LW9A 3A5WA 2RM6A 4BWQA 5GAND 3TKSA 3KCMA 2OBIA 3HVXA 1V2AA 2OKAA 2R2JA 4KE3A 4WETA 5L71A 1BEDA 4RQRA 1ABAA 3UAPA 1TI3A 2I4AA 1QMVA 3ZL5A 3ZTLA 3FHKA 2R5GA 1T3BA 2LNSA 2NBSA 5GSSA 1FB0A 2TIRA 3LYPA 1ZYPA 2YZHA 3IAS2 5CNWA 3FYGA 3APQA 1ERUA 2KHPA 1GH2A 3IK7A 2ZUPA 5ELGA 4YKFA 5GAPD 2L59A 3SWLA 2X8CA 2E7PA 1GP1A 3KGKA 2OE0A 2GVPA 1J08A 1WP0A 3APSA 3KMNA 2JU5A 1VF3A 4KUNA 2I1UA 2H19A 2QC7A 3R2QA 1GSUA 1X9WB 3M3MA 3GTUB 2OE1A 3BOAA 3D22A 2GT5A 2VL9A 3TKSC 2EIQA 4TR1B 1A2LA 12GSA 2H6XA 1DSBA 2CV4A 3G7IA 4LL4B 4E8EA 4K2DA 4DSSA 4WF5A 10GSA 5G5EA 2CX4A 3DMLA 4JU5A 3EURA 2NDOA 1X5CA 2B1LA 5A4UA 3TCOA 4XTSA 4RQXA 3GX8A 3PR8A 1I5GA 5H5SA 3OR5A 1GUHA 3KP8A 1YF1A 3UIWA 3L78A 2AB6A 2KP1A 1ON4A 3C8EA 2HZFA 3A2XA 2R0GA 3KZQA 4NPBA 1Y25A 5ECPB 3TRQA 2YJHA 3N9JA 4K7IA 2VIMA 3HD5A 3Q19A 1I9DA 4MJAA 1MEKA 4L5LA 1S3DA 2YN1A 5DALB 3H8QA 4IQ1A 1OC8A 4CY8A 1QK8A 2VL2A 3EYTA 3TKQA 2R0CA 2VLVA 3ISOA 2BJXA 1OC9A 5J5NA 4MPFA 1MD3A 1XZOA 3TJBA 1W89A 3AY8A 1H4OA 5CRGA 3ME8A 5E4WA 4J56E 1A23A 3IAM2 4HQSA 1KNGA 2OE3A 3IDVA 4IGJA 3LWAA 3UJ1A 5ECMB 5ECOB 4X43A 4WBRD 2QKEA 3M1GA 6GSXA 2BMXA 2A4VA 2JZTA 1FOHA 5EL8A 3ZIJA 3GL3A 1ZGNA 3HJMA 3LEFA 2AAWA 1EP8A 4QL9A 3NZNA 5FT3A 1A2MA 1TW9A 1XWGA 1TRWA 2FWFA 2O7KA 3VWVA 1AQXA 1RK4A 2IWTA 2YV7A 1A0FA 4POMA 2HFDA 4HZ4A 1PKZA 2JZSA 3A3TA 3ZIVA 1C72A 1GLQA 2O85A 4V1Ap 2F8FA 3U6VA 2NVLA 6GSUA 3HA9A 2FGXA 3EMPA 3M9KA 4MF5A 4CDOA 2LS5A 3VWWA 4ML6A 1M2DA 3CRTA 1DE2A 1O7UA 2EIRA 2H01A 4IBPA 3S9FA 5D96A 1TI1A 4PQIA 1M2BA 3L9UA 1UN2A 1OKTA 3VK9A 1XBSA 4RI7A 4TOPA 5DJLA 4A5PA 5DJMA 4USSA 1PL1A 2V41A 5B6MA 4YQUA 4GCIA 1GRXA 2AUVA 4ZILA 4ZIJA 1K0BA 1MTCA 2VCZA 1X5DA 4NV2A 1B4QA 5ECRB 2X4AA 2GZPA 4N10A 4X4JA 4TW5A 4F0BA 1ST9A 3H1NA 4KF9A 3ZITA 1GUKA 3ZYWA 2MBSA 4KX4A 3NOFA 2HRNA 2HLSA 1K0MA 4V2LA 4OO4A 2RLIA 3ZMKA 2VUPA 2HSYA 2DJ2A 4MCUA 4KDUA 3GUSA 1T00A 1OC3A 4P3YB 4I2UA 3WGEA 5HFKA 2E2GA 1HYUA 1DUGA 3M9JA 3GFKA 5DCGA 3ZLPA 1X0RA 2H73A 1M2AA 5HR3A 5IMZA 2PERA 3GV1A 1GTUA 4HU7A 4TR4A 4O32A 2X8GA 3IC8A 2L6CA 2GS3A 4PX1A 3CTGA 2FY6A 3L9VA 3LQ7A 2HNLA 1V9WA 1UA5A 2H72A 3M0FA 4MH2A 4GQCA 1WOUA 2EC4A 3E9JB 4IJ3A 3MDKA 3E3EA 3FK8A 2YWOA 3UBKA 3F4TA 4KW6A 3V1WA 3ERGA 1O73A 2N5BA 2C80A 3GKXA 4J57E 2VO4A 4HU9A 4WKWA 1TU7A 2XHFA 2H1DA 4KCAA 4XCSA 3DGQA 4NAXA 4DSSB 1HNBA 4AGSA 4POLA 1XCCA 4K0NA 4ZL9A 3KH7A 1WWJA 2HZEA 2B1KA 4ULXA 3EPTA 2PU9C 4GF0A 4GLTA 4H86A 4CW9A 2HRAA 3APOA 5B8BA 1PN9A 4K8MA 3F63A 5BRTA 5D8IA 5LNKe 3FZ5A 5ECIB 3UMAA 1VRSD 3VI5A 2H30A 3GURA 1A8YA 1OE7A 4WF4A 1SK1A 3FKFA 1W4VA 3KXOA 1XVQA 1YKAA 3HZ8A 4F0CA 1B4PA 3FZ4A 3ERFA 5D9XA 2PGTA 1B48A 2M80A 4HDEA 3CBUA 3KMOA 2XBQA 3UEMA 2R0PA 2CVKA 1SYRA 6GSWA 1XWKA 3LG6A 1OC9B 3C1RA 2RUEA 5HQPA 5ECNB 3I43A 3F6FA 1BAYA 5HR1A 1PQNA 1F2EA 1T8EB 2GSSA 4NWYA 4RI6A 20GSA 4Q5NA 2OJLA 1K3YA 1GSFA 3HHVA 5IMFA 2YPMA 2VM2A 4MJEA 2DJKA 3A2WA 1E6BA 2PUKC 2WRTA 2HRFA 4AJ8A 4MP4A 2J23A 1T4YA 4O92A 3BD2A 5DAKA 3WT2A 5DQYA 1F9MA 4X0XA 2FLSA 2H1AA 2O87A 4F9ZA 2Z9SA 3FZ9A 4XRDA 3ZFLA 2AV4A 3GYKA 5JWOB 2F3MA 3F3QA 17GSA 3A2VA 5J9CA 3TOUA 3VURA 4NHWA 3ED3A 2I3YA 2P5QA 4EE0A 1LU4A 4EL1A 6GSTA 5KN0A 4FYBA 2O8VB 1QQ2A 5HFGA 3KJYA 3U5RE 2H71A 2IMDA 3G7YA 1GSQA 3EC3A 1K0OA 2YCDA 4JRRA 3QD9A 1VF2A 4ID0A 3TRPA 1YF0A 3H4KA 1GNEA 4MPGA 4BPYA 1HNAA 1O81A 3QAGA 5C00A 11GSA 4FYUA 3PGTA 1NM3A 4ICYA 5KOWA 1GUMA 2C0FA 3GX0A 3UVTA 4TVEA 3HJPA 2LKUA 3IRAA 1Z9HA 2WULA 5ABRA 3TKRA 2A2SA 3D6IA 3EU4A 3US3A 1U3IA 2L4QA 2FUG2 3DXBA 5A5KA 1O85A 2WGRA 5LCZA 5D73A 3CSJA 3W8SA 3F4RA 8GSSA 5D9TA 2DBCA 3GH6A 1LJRA 1XWBA 3LFLA 1Z7RA 4JR4A 3LGCA 2WCIA 1K3LA 1JZDA 4MZWA 3GHAA 1SD8A 2VD0A 4WXTA 2YV9A 2C8UA 2CVDA 3IK9A 5C04A 1ZYQB 2X8HA 3EVIA 4D73A 1TK8B 4EKZA 1WE0A 2O89A 5B7CA 4JR6A 2A2PA 3M8NA 1UC7A 4KSOA 4TN8A 3HVSA 1YZXA 1WMJA 2VCTA 5H5QA 5F05A 2ZNMA 5COHA 4LA1A 2FWEA 5IPHA 2HRKA 1DBYA 3ZRDA 3VFIA 5KEJA 2CX3A 3QAVA 3DVXA 2LQOA 3QAWA 4K6XA 4IP6A 4G19A 5DDLA 3BJ5A 1M9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E0U A;  1BX9 A;  4G9H A;  4N0V A;  4OFM A;  2B7J A;  4TR0 A;  1AAZ A;  3IR4 A;  4G2E A;  2YOI A;  5IO2 A;  2MMN A;  3ZRE A;  3FW2 A;  4JE1 A;  2LUS A;  3C1S A;  3GKN A;  3UAR A;  3J7Y b;  3UVH A;  4MZB A;  1R5P A;  4I6X A;  2HZE B;  3FR3 A;  1QXH A;  1MDK A;  2RM5 A;  1ML6 A;  3LXT A;  1F37 A;  5DBQ A;  4ZL8 A;  2P0G A;  4E8H A;  2GDR A;  2K18 A;  3KEB A;  1RW1 A;  1QGV A;  1YEX A;  1N2A A;  1N8J A;  3DRN A;  5KN1 A;  2H6Z A;  5AN1 A;  1U6T A;  1T1V A;  1XW5 A;  4HOJ A;  3RDW A;  1HD2 A;  3FRC A;  3P90 A;  1YEP A;  3HDC A;  4EO3 A;  5DVB A;  1EEM A;  2HE3 A;  1H75 A;  4BL7 A;  4PXO A;  3GRX A;  5IIZ A;  3DEX A;  3W6G A;  3MAK A;  1JFU A;  2E2M A;  2VD1 A;  2C0G A;  4KND A;  2YJ7 A;  3TDG A;  1A0R P;  1M9B A;  1SL2 B;  1YQ1 A;  2WFC A;  3TJK A;  1FO5 A;  1MD4 A;  3UOM A;  3F3R A;  1OVN A;  4MLY A;  4I97 A;  4IP1 A;  1PSQ A;  1GSS A;  5IPG A;  3GST A;  2H74 A;  1GL8 A;  5EY6 A;  1KBN A;  1GWC A;  2LRC A;  2KLX A;  4HUA A;  2M72 A;  4WBJ A;  5H5R A;  3HY2 A;  4N30 A;  1EWX A;  1V40 A;  1QUW A;  5EVO A;  5IOX A;  5DAK B;  4K1F A;  4EC0 A;  4DEJ A;  5A4W A;  2WJU A;  1ZYE A;  5ECK B;  5GZZ B;  1VGL A;  1SJ6 A;  6GSY A;  2EIO A;  2FA8 A;  2ES7 A;  4PNG A;  2VCX A;  2C0E A;  2VCQ A;  4IN0 A;  4ECI A;  2B5Y A;  2A2R A;  3RAZ A;  1FVK A;  1MDJ A;  1B9Y C;  3IA1 A;  1TRV A;  1OKD A;  3MSZ A;  5ELA A;  1G6Y A;  1FVJ A;  1TP9 A;  4I5Q A;  2CVB A;  3DVW A;  3D21 A;  1O8W A;  2GSQ A;  2ON7 A;  1SKS B;  1USB A;  5IOW A;  2MBT A;  5D9V A;  4QQ7 A;  1EEJ A;  2IN3 A;  4FYC A;  1JLW A;  4HJM A;  4FH8 A;  1A24 A;  1SEN A;  1BJX A;  2L5O A;  3GIX A;  1WRY A;  4IJI A;  2REM A;  1TXX A;  4EXJ A;  4MH3 A;  1PX6 A;  3D4M A;  4KH7 A;  2B3S A;  2AYT A;  5G31 A;  3Q74 A;  2C0D A;  1FW1 A;  2RII A;  1F6M C;  2ON5 A;  2IME A;  4EDY A;  5AIX A;  4EDZ A;  3VPT A;  1K0C A;  2V2G A;  1G7O A;  2I9H A;  14GS A;  4ACS A;  2HYX A;  2J9H A;  2IFQ A;  2OBK A;  4L0W A;  3CSH A;  4POB A;  3D4T A;  1CQH A;  3BCK A;  1YY7 A;  2M46 A;  1SKR B;  3C71 A;  2PVQ A;  4PNF A;  4DSR A;  4DSQ A;  5J9B A;  2XC2 A;  2PPT A;  1HQO A;  4ML1 A;  3TOT A;  1G7E A;  1OYJ A;  4HZ2 A;  4D73 B;  3EE2 A;  4YQM A;  1AQW A;  1SL0 B;  4BWS A;  4OWY A;  5F0G A;  1Z5Y E;  1EOG A;  2CAI A;  2CQ9 A;  2GZZ A;  2JZR A;  4ISD A;  2YWI A;  3P2A A;  3DYR A;  1WPI A;  3Q18 A;  4F82 A;  3CSI A;  5J4U A;  3F9U A;  2MZC A;  4XS4 A;  3EIN A;  1SL1 B;  1ZL9 A;  3TKS E;  4HQZ A;  2H0H A;  2VCV A;  5E59 A;  1SK0 A;  2TRX A;  1K0A A;  1ERT A;  2F51 A;  3J7Y k;  4CHS A;  3IC4 A;  1R5A A;  5GST A;  1WIK A;  4O5R A;  2H8L A;  2L57 A;  2HSH A;  2R4V A;  2V32 A;  4PGT A;  1TRU A;  5JCW A;  2MMZ A;  2XBI A;  4WEY A;  3SBC A;  1PA3 A;  1EGO A;  2G2Q A;  2P5R A;  7GSS A;  5JWQ B;  1PL2 A;  2N5F A;  1RQM A;  2VLU A;  4MJB A;  2V1M A;  4EF0 A;  3HYP A;  1HNC A;  2F8A A;  5F8B A;  3GH9 A;  2C3T A;  3VI7 A;  4ZB9 A;  5F07 A;  1EV4 A;  1BQ7 A;  4BVY A;  4GTU A;  2L5L A;  2GZY A;  1F3B A;  1JZW A;  6GSV A;  1FOV A;  5IMA A;  3G7J A;  1G6W A;  1K3O A;  1A8L A;  1Q98 A;  2YNX A;  2N5A A;  3IXR A;  5IMD A;  4Q5Q A;  4OO5 A;  2IMI A;  1O8X A;  4BVX A;  5ECS A;  1FAA A;  3F8U A;  3ZZX A;  3CYN A;  1PX7 A;  1GTB A;  3KD0 A;  3UL3 A;  2QSI A;  4ECC A;  4OD7 A;  1ZOF A;  5IM9 A;  4OCF A;  2GQL A;  3HJO A;  1VF1 A;  3UBL A;  2DSA A;  2PWJ A;  1LBK A;  3QOU A;  4ECJ A;  2LST A;  1FG4 A;  4GQF A;  1JZR A;  4YAP A;  3F6D A;  1THO A;  2E0Q A;  3D5J A;  3G9B A;  2HT9 A;  1TRS A;  1EP7 A;  1NHY A;  4TXO A;  1XVW A;  4K9Z A;  1ILO A;  2C3Q A;  5ECH B;  4PUR A;  3IV4 A;  1O6J A;  5DQS A;  2IPA A;  4Z7X A;  3KTB A;  1ZZY A;  2H66 A;  2CA8 A;  4KAE A;  1GSE A;  1IYI A;  3DD3 A;  1AC1 A;  2DIY A;  3HCZ A;  1YJ6 A;  2F9S A;  4NHZ A;  2BTO T;  2FA4 A;  1U3A A;  2LV3 A;  3IPZ A;  2GT6 A;  4NMU A;  4V2M A;  1XWC A;  3WGX A;  2H0I A;  4IQA A;  1GTA A;  2D2Z A;  1AW9 A;  4ZB6 A;  5JWR B;  3WGD A;  3N5O A;  5HR2 A;  1WJK A;  6GSS A;  3P8W A;  5IMV A;  3QPM A;  4AF2 A;  4MA9 A;  4WR5 A;  3WD6 A;  4HJ2 A;  2CZ2 A;  2WZ9 A;  2OAC A;  4L8E A;  2IFQ B;  1EOH A;  5F06 A;  3H79 A;  5HFI A;  2IMK A;  1T4Z A;  5D9W A;  3LXZ A;  2JAD A;  1M7T A;  3WT1 A;  3GSS A;  5G2Z A;  5ECL B;  1B8X A;  4IS0 A;  3MWH A;  2DML A;  2K8S A;  2LJA A;  5CRW A;  2H75 A;  3FEU A;  4Q5F A;  2VLT A;  2K9F A;  3H93 A;  2MMO A;  4IW9 A;  4ILF A;  4ZB8 A;  4XRA A;  1QFN A;  3VPQ A;  2X99 A;  2GQK A;  1DE1 A;  3ZVJ D;  2X64 A;  4JZQ A;  3RBT A;  1Z7P A;  2GSR A;  4TXV A;  5G1K A;  3PH9 A;  1R26 A;  5D93 A;  1PRX A;  4GSN A;  4XS4 B;  3IBH A;  1TTZ A;  4XS6 A;  1ERW A;  3QDN A;  2YWN A;  1TJD A;  1R7H A;  2H0G A;  2V6K A;  1SJZ A;  3JCM L;  2V6O A;  2B5X A;  2OA7 A;  1M0U A;  3F0I A;  3FY7 A;  1XOB A;  1XPV A;  2ZCT A;  1ERV A;  1XWA A;  2JSY A;  3BBY A;  5IO0 A;  2AHE A;  5G30 A;  5HR0 A;  4MF6 A;  5EPF A;  2VM1 A;  3GMF A;  4YH2 A;  4KDX A;  2QGV A;  2YAN A;  2CZ3 A;  3QFA C;  4JED A;  1KTE A;  2VOC A;  4GRF A;  2R3X A;  4FO5 A;  3HKR A;  2DJ1 A;  2PVO C;  1U87 A;  1XXU A;  4MF7 A;  2HXK A;  2VAF A;  5G5F A;  2FCH A;  3BCI A;  2XPD A;  2FHE A;  2H1B A;  1PMT A;  1SU9 A;  1ZCP A;  2IMF A;  9GSS A;  3F4S A;  2DJ0 A;  4NXI A;  5CO3 A;  3TJJ A;  4K7O A;  4NV5 A;  1NHO A;  3QCP A;  1SD9 A;  4J2F A;  2H6Y A;  5AIS A;  5KN3 A;  1V98 A;  3QFB C;  3KH9 A;  2B5E A;  2FD3 A;  5CRD A;  2FWG A;  4N11 A;  2DJ3 A;  2LRT A;  1TU8 A;  1E2Y A;  3KM6 A;  1SKW B;  4L0U A;  5ID2 A;  3VWU A;  4ZXG A;  2AJQ B;  4PUA A;  3L4N A;  2GQM A;  1GSY A;  4MK3 A;  2LRN A;  2TRC P;  1FB6 A;  3CRU A;  18GS A;  2VL2 C;  3K8N A;  4K0G A;  5FWG A;  1BYE A;  2KP2 A;  1OAZ A;  2KUC A;  4N0Z A;  1XIY A;  1R4W A;  5AGY A;  2PN8 A;  2R6K A;  2H76 A;  3IHQ A;  1XOA A;  2GGT A;  5DCH A;  3ZVJ A;  1M99 A;  2RUF A;  4TXO B;  4LL1 B;  3TKP A;  3ERW A;  1CQG A;  2C3N A;  4ZBB A;  5CYY A;  3EMX A;  1S3C A;  3MNG A;  1BG5 A;  3ZML A;  1Y6E A;  4BA7 A;  2LNT A;  4KCE A;  5INY A;  4FIW A;  3IE3 A;  2DMM A;  5J3R A;  1XFL A;  3FZA A;  5ECQ B;  1X9M B;  3CXG A;  2PBJ A;  5A4V A;  3FR6 A;  3O76 A;  3RPP A;  4IVF A;  2L6D A;  1GSD A;  2YP6 A;  3TJG A;  3ZFB A;  3I9V 2;  2LQQ A;  3TGZ A;  1GUL A;  1EGR A;  3GN3 A;  4HEA 2;  2LJR A;  3L9S A;  2L4C A;  3EU3 A;  2CT6 A;  5B6N A;  5KN2 A;  4AJ7 A;  3HXS A;  2K8V A;  4RUV A;  4GXZ A;  3GL5 A;  3D0Z A;  4EUY A;  1B9X C;  4TR3 A;  3RHC A;  2H70 A;  4I2T A;  4XHM A;  2YWM A;  5G1L A;  2LJK A;  2K6V A;  1XW6 A;  4TRX A;  1TDI A;  3NIV A;  1K0D A;  4LLR A;  5JCG A;  1VF4 A;  1J0F A;  5J41 A;  1Z6M A;  3CMI A;  2C1Y A;  3C7M A;  3L0H A;  2ALB A;  2MMA A;  1Q4J A;  2IJY A;  4JBB A;  3Q6O A;  4ECB A;  4OMV A;  3EWL A;  1YDK A;  2YZU A;  2DJJ A;  2XPE A;  1T7P B;  3GTU A;  2KOK A;  1GNW A;  4V2N A;  1SYX A;  4POK A;  3I69 A;  2WB9 A;  3GA4 A;  4HI7 A;  4IEL A;  3RPN A;  4LMW A;  1GTI A;  4IHU A;  2B7K A;  2PMT A;  4TR1 A;  5CP1 A;  5LD0 A;  1IYH A;  4KA0 A;  5JCU A;  2GTU A;  5AIV A;  2H1G A;  4ZL7 A;  3O6T A;  2P31 A;  2C4J A;  4KB3 A;  1UVZ A;  1GLP A;  4KGI A;  3HVV A;  2LTK A;  3QR6 A;  4G10 A;  1A2J A;  1OE8 A;  1JLV A;  1SJI A;  1JHB A;  2WDU A;  3VLN A;  2GLR A;  2FNO A;  3KIJ A;  3O3T A;  5B8A A;  4X1U A;  3DWV A;  1K0N A;  2DLX A;  4YAV A;  1NW2 A;  4LMV A;  4GSS A;  2G0F A;  4L5O A;  3GKK A;  3I6A A;  2CAQ A;  5DAL A;  1F3A A;  3LYK A;  1XW9 A;  1S3A A;  3HZ4 A;  5FHI A;  3TJF A;  2B6M A;  5CRE A;  4ZBA A;  4I8B A;  5ENU A;  3QMX A;  4WR4 A;  1AXD A;  4EVM A;  3C73 A;  22GS A;  5CAX A;  2R37 A;  4ZBD A;  1TK0 B;  3VWX A;  1TOF A;  5IQY A;  3ME7 A;  3WYW A;  2HI7 A;  1Z3E A;  4F2I A;  2VCW A;  1PD2 1;  4IKH A;  2I81 A;  4O7H A;  1G0T A;  1JZO A;  3LSZ A;  1V57 A;  4MJC A;  4MMM A;  1ZMA A;  3GKM A;  4XIH A;  2DIZ A;  1V58 A;  19GS A;  3IOS A;  1EV9 A;  3PIN A;  4PUF C;  5ID2 B;  4MAB A;  1X9S B;  4GST A;  4F03 A;  4DVC A;  4XS1 A;  1ACV A;  4KSM A;  3RHB A;  2FWH A;  2OAD A;  4KDY A;  3TB2 A;  5CRH A;  3LOR A;  5IMC A;  3LJR A;  4OFT A;  1EZK A;  1Z6N A;  4HS1 A;  4GWR A;  1AIU A;  2DC5 A;  4Q5R A;  1AQV A;  3FR9 A;  3DIE A;  3CTF A;  1PGT A;  1YKC A;  3GNJ A;  1FHE A;  4TKY A;  1NSW A;  2JSZ A;  1URM A;  2IL3 A;  2MYG A;  2JL4 A;  16GS A;  1TKD B;  4PQH A;  1SK2 A;  2NPB A;  1AUC A;  4MZC A;  4QL7 A;  3KP9 A;  1TK5 B;  2IIY A;  13GS A;  2LEG A;  1J9B A;  4MDC A;  1U88 A;  2JAC A;  3KTL A;  1KEB A;  4AJ6 A;  3P7X A;  2VL3 A;  3DKS A;  2GST A;  4V1A g;  2NTO A;  1THX A;  4K7N A;  4YQV A;  3TRX A;  3W8J A;  4OFN A;  3TUE A;  1PKW A;  2WS2 A;  4PQ1 A;  1X5E A;  4OCE A;  1MDI A;  3A5W A;  2RM6 A;  4BWQ A;  5GAN D;  3TKS A;  3KCM A;  2OBI A;  3HVX A;  1V2A A;  2OKA A;  2R2J A;  4KE3 A;  4WET A;  5L71 A;  1BED A;  4RQR A;  1ABA A;  3UAP A;  1TI3 A;  2I4A A;  1QMV A;  3ZL5 A;  3ZTL A;  3FHK A;  2R5G A;  1T3B A;  2LNS A;  2NBS A;  5GSS A;  1FB0 A;  2TIR A;  3LYP A;  2YZH A;  3IAS 2;  5CNW A;  3FYG A;  3APQ A;  1ERU A;  2KHP A;  1GH2 A;  3IK7 A;  2ZUP A;  5ELG A;  5GAP D;  2L59 A;  3SWL A;  2X8C A;  2E7P A;  1GP1 A;  3KGK A;  2OE0 A;  2GVP A;  1J08 A;  1WP0 A;  3APS A;  3KMN A;  2JU5 A;  1VF3 A;  4KUN A;  2I1U A;  2H19 A;  2QC7 A;  3R2Q A;  1GSU A;  1X9W B;  3M3M A;  3GTU B;  2OE1 A;  3BOA A;  3D22 A;  2GT5 A;  2VL9 A;  3TKS C;  2EIQ A;  4TR1 B;  1A2L A;  12GS A;  2H6X A;  1DSB A;  2CV4 A;  3G7I A;  4LL4 B;  4E8E A;  4K2D A;  4DSS A;  4WF5 A;  10GS A;  5G5E A;  2CX4 A;  3DML A;  4JU5 A;  3EUR A;  2NDO A;  1X5C A;  2B1L A;  5A4U A;  3TCO A;  4XTS A;  4RQX A;  3GX8 A;  3PR8 A;  1I5G A;  5H5S A;  3OR5 A;  1GUH A;  3KP8 A;  1YF1 A;  3UIW A;  3L78 A;  2AB6 A;  2KP1 A;  1ON4 A;  3C8E A;  2HZF A;  3A2X A;  3KZQ A;  4NPB A;  1Y25 A;  5ECP B;  3TRQ A;  2YJH A;  3N9J A;  4K7I A;  2VIM A;  3HD5 A;  3Q19 A;  1I9D A;  4MJA A;  1MEK A;  4L5L A;  1S3D A;  2YN1 A;  5DAL B;  3H8Q A;  4IQ1 A;  1OC8 A;  1QK8 A;  2VL2 A;  3EYT A;  3TKQ A;  2VLV A;  3ISO A;  2BJX A;  1OC9 A;  5J5N A;  4MPF A;  1MD3 A;  1XZO A;  3TJB A;  1W89 A;  3AY8 A;  1H4O A;  5CRG A;  3ME8 A;  5E4W A;  4J56 E;  1A23 A;  3IAM 2;  4HQS A;  1KNG A;  2OE3 A;  3IDV A;  4IGJ A;  3LWA A;  3UJ1 A;  5ECM B;  5ECO B;  4X43 A;  4WBR D;  2QKE A;  3M1G A;  6GSX A;  2BMX A;  2A4V A;  2JZT A;  5EL8 A;  3ZIJ A;  3GL3 A;  1ZGN A;  3HJM A;  3LEF A;  2AAW A;  1EP8 A;  4QL9 A;  3NZN A;  5FT3 A;  1A2M A;  1TW9 A;  1XWG A;  1TRW A;  2FWF A;  2O7K A;  3VWV A;  1AQX A;  1RK4 A;  2IWT A;  2YV7 A;  1A0F A;  4POM A;  2HFD A;  4HZ4 A;  1PKZ A;  2JZS A;  3A3T A;  3ZIV A;  1C72 A;  1GLQ A;  2O85 A;  4V1A p;  2F8F A;  3U6V A;  2NVL A;  6GSU A;  3HA9 A;  2FGX A;  3EMP A;  3M9K A;  4MF5 A;  4CDO A;  2LS5 A;  3VWW A;  4ML6 A;  1M2D A;  3CRT A;  1DE2 A;  1O7U A;  2EIR A;  2H01 A;  4IBP A;  3S9F A;  5D96 A;  1TI1 A;  4PQI A;  1M2B A;  3L9U A;  1UN2 A;  1OKT A;  3VK9 A;  1XBS A;  4RI7 A;  4TOP A;  5DJL A;  5DJM A;  1PL1 A;  2V41 A;  5B6M A;  4YQU A;  4GCI A;  1GRX A;  2AUV A;  4ZIL A;  4ZIJ A;  1K0B A;  1MTC A;  2VCZ A;  1X5D A;  4NV2 A;  1B4Q A;  5ECR B;  2GZP A;  4N10 A;  4F0B A;  4TW5 A;  1ST9 A;  3H1N A;  3ZIT A;  1GUK A;  3ZYW A;  2MBS A;  4KX4 A;  3NOF A;  2HRN A;  2HLS A;  1K0M A;  4V2L A;  4OO4 A;  2RLI A;  3ZMK A;  2VUP A;  2HSY A;  2DJ2 A;  4MCU A;  4KDU A;  3GUS A;  1T00 A;  1OC3 A;  4P3Y B;  4I2U A;  3WGE A;  5HFK A;  2E2G A;  1HYU A;  1DUG A;  3M9J A;  3GFK A;  5DCG A;  3ZLP A;  1X0R A;  2H73 A;  1M2A A;  5HR3 A;  5IMZ A;  2PER A;  3GV1 A;  1GTU A;  4HU7 A;  4TR4 A;  4O32 A;  2X8G A;  2L6C A;  2GS3 A;  4PX1 A;  3CTG A;  2FY6 A;  3L9V A;  3LQ7 A;  2HNL A;  1V9W A;  1UA5 A;  2H72 A;  3M0F A;  4MH2 A;  4GQC A;  1WOU A;  2EC4 A;  3E9J B;  4IJ3 A;  3MDK A;  3E3E A;  3FK8 A;  2YWO A;  3UBK A;  3F4T A;  4KW6 A;  3V1W A;  3ERG A;  1O73 A;  2N5B A;  2C80 A;  3GKX A;  4J57 E;  2VO4 A;  4HU9 A;  4WKW A;  1TU7 A;  2XHF A;  2H1D A;  4KCA A;  4XCS A;  3DGQ A;  4NAX A;  4DSS B;  1HNB A;  4AGS A;  4POL A;  1XCC A;  4K0N A;  4ZL9 A;  3KH7 A;  1WWJ A;  2HZE A;  2B1K A;  4ULX A;  2PU9 C;  4GF0 A;  4GLT A;  4H86 A;  4CW9 A;  3APO A;  5B8B A;  1PN9 A;  4K8M A;  3F63 A;  5D8I A;  5LNK e;  3FZ5 A;  5ECI B;  3UMA A;  1VRS D;  3VI5 A;  2H30 A;  3GUR A;  1A8Y A;  1OE7 A;  4WF4 A;  1SK1 A;  3FKF A;  1W4V A;  3KXO A;  1XVQ A;  1YKA A;  3HZ8 A;  4F0C A;  1B4P A;  3FZ4 A;  3ERF A;  5D9X A;  2PGT A;  1B48 A;  2M80 A;  4HDE A;  3CBU A;  3KMO A;  2XBQ A;  3UEM A;  2CVK A;  1SYR A;  6GSW A;  1XWK A;  3LG6 A;  1OC9 B;  3C1R A;  2RUE A;  5HQP A;  5ECN B;  3I43 A;  3F6F A;  1BAY A;  5HR1 A;  1PQN A;  1F2E A;  1T8E B;  2GSS A;  4NWY A;  4RI6 A;  20GS A;  4Q5N A;  2OJL A;  1K3Y A;  1GSF A;  3HHV A;  5IMF A;  2YPM A;  2VM2 A;  4MJE A;  2DJK A;  3A2W A;  1E6B A;  2PUK C;  2WRT A;  2HRF A;  4AJ8 A;  4MP4 A;  2J23 A;  1T4Y A;  4O92 A;  3BD2 A;  5DAK A;  3WT2 A;  5DQY A;  1F9M A;  4X0X A;  2FLS A;  2H1A A;  2O87 A;  4F9Z A;  2Z9S A;  3FZ9 A;  4XRD A;  3ZFL A;  2AV4 A;  3GYK A;  5JWO B;  2F3M A;  3F3Q A;  17GS A;  3A2V A;  5J9C A;  3TOU A;  3VUR A;  4NHW A;  3ED3 A;  2I3Y A;  2P5Q A;  4EE0 A;  1LU4 A;  4EL1 A;  6GST A;  5KN0 A;  4FYB A;  2O8V B;  1QQ2 A;  5HFG A;  3KJY A;  3U5R E;  2H71 A;  2IMD A;  3G7Y A;  1GSQ A;  3EC3 A;  1K0O A;  2YCD A;  4JRR A;  3QD9 A;  1VF2 A;  4ID0 A;  3TRP A;  1YF0 A;  3H4K A;  1GNE A;  4MPG A;  4BPY A;  1HNA A;  1O81 A;  3QAG A;  5C00 A;  11GS A;  4FYU A;  3PGT A;  1NM3 A;  1GUM A;  2C0F A;  3GX0 A;  3UVT A;  4TVE A;  3HJP A;  2LKU A;  3IRA A;  1Z9H A;  2WUL A;  5ABR A;  3TKR A;  2A2S A;  3D6I A;  3EU4 A;  3US3 A;  1U3I A;  2L4Q A;  2FUG 2;  3DXB A;  5A5K A;  1O85 A;  2WGR A;  5LCZ A;  5D73 A;  3CSJ A;  3W8S A;  3F4R A;  8GSS A;  5D9T A;  2DBC A;  3GH6 A;  1LJR A;  1XWB A;  3LFL A;  1Z7R A;  4JR4 A;  3LGC A;  2WCI A;  1K3L A;  1JZD A;  4MZW A;  3GHA A;  1SD8 A;  2VD0 A;  4WXT A;  2YV9 A;  2C8U A;  2CVD A;  3IK9 A;  5C04 A;  1ZYQ B;  2X8H A;  3EVI A;  4D73 A;  1TK8 B;  4EKZ A;  1WE0 A;  2O89 A;  5B7C A;  4JR6 A;  3M8N A;  1UC7 A;  4KSO A;  4TN8 A;  3HVS A;  1YZX A;  1WMJ A;  2VCT A;  5H5Q A;  5F05 A;  2ZNM A;  5COH A;  4LA1 A;  2FWE A;  5IPH A;  1DBY A;  3ZRD A;  3VFI A;  5KEJ A;  2CX3 A;  3QAV A;  3DVX A;  2LQO A;  3QAW A;  4K6X A;  4IP6 A;  4G19 A;  5DDL A;  3BJ5 A;  1M9A A; 
#chains in the Genus database with same CATH topology
 3E0U A;  1BX9 A;  4G9H A;  4N0V A;  4OFM A;  2B7J A;  4TR0 A;  1AAZ A;  3IR4 A;  4G2E A;  2YOI A;  5IO2 A;  2MMN A;  3ZRE A;  3FW2 A;  4JE1 A;  2LUS A;  3C1S A;  3GKN A;  3UAR A;  3J7Y b;  3UVH A;  4MZB A;  1R5P A;  4I6X A;  2HZE B;  3FR3 A;  1QXH A;  1MDK A;  2RM5 A;  1ML6 A;  3LXT A;  1F37 A;  5DBQ A;  4ZL8 A;  2P0G A;  4E8H A;  2GDR A;  2K18 A;  3KEB A;  1RW1 A;  1QGV A;  1YEX A;  4K5S A;  1N2A A;  1N8J A;  3DRN A;  5KN1 A;  2H6Z A;  5AN1 A;  1U6T A;  1T1V A;  1XW5 A;  4HOJ A;  3RDW A;  4G0L A;  1HD2 A;  3FRC A;  3P90 A;  1YEP A;  4Z2T A;  3HDC A;  4EO3 A;  5DVB A;  1EEM A;  2HE3 A;  1H75 A;  4BL7 A;  4PXO A;  3GRX A;  5IIZ A;  3DEX A;  3W6G A;  3MAK A;  1JFU A;  2E2M A;  2VD1 A;  2C0G A;  4KND A;  2YJ7 A;  3TDG A;  1A0R P;  1M9B A;  1SL2 B;  1YQ1 A;  2WFC A;  3TJK A;  1FO5 A;  1MD4 A;  3UOM A;  3F3R A;  1OVN A;  4MLY A;  4I97 A;  4IP1 A;  1PSQ A;  1GSS A;  5IPG A;  3GST A;  2H74 A;  1GL8 A;  5EY6 A;  1KBN A;  1GWC A;  2LRC A;  2KLX A;  4HUA A;  2M72 A;  4WBJ A;  5H5R A;  3HY2 A;  4N30 A;  1EWX A;  1V40 A;  1QUW A;  5EVO A;  5IOX A;  5DAK B;  4K1F A;  4EC0 A;  4DEJ A;  5A4W A;  2WJU A;  1ZYE A;  5ECK B;  5GZZ B;  1VGL A;  1SJ6 A;  3MIX A;  6GSY A;  2EIO A;  2FA8 A;  2ES7 A;  4PNG A;  2VCX A;  2C0E A;  2VCQ A;  4IN0 A;  4ECI A;  2B5Y A;  2A2R A;  3RAZ A;  1FVK A;  1MDJ A;  1B9Y C;  3IA1 A;  1TRV A;  1OKD A;  2UZ8 A;  3MSZ A;  5ELA A;  1G6Y A;  1FVJ A;  1TP9 A;  4I5Q A;  2CVB A;  3DVW A;  3D21 A;  1O8W A;  2GSQ A;  2ON7 A;  1SKS B;  1USB A;  5IOW A;  2MBT A;  5D9V A;  4QQ7 A;  1EEJ A;  2IN3 A;  4FYC A;  2DKH A;  1JLW A;  4HJM A;  4FH8 A;  1A24 A;  1SEN A;  1BJX A;  2L5O A;  3GIX A;  1WRY A;  4IJI A;  2REM A;  1TXX A;  4EXJ A;  4MH3 A;  1PX6 A;  3D4M A;  1ZYN A;  4KH7 A;  2B3S A;  2AYT A;  5G31 A;  3Q74 A;  2C0D A;  1FW1 A;  2RII A;  1F6M C;  2ON5 A;  2IME A;  4EDY A;  5AIX A;  4EDZ A;  3VPT A;  1K0C A;  2V2G A;  1G7O A;  2I9H A;  14GS A;  4ACS A;  2HYX A;  2J9H A;  2IFQ A;  2OBK A;  4L0W A;  3CSH A;  4POB A;  3D4T A;  1CQH A;  3BCK A;  1YY7 A;  2M46 A;  1SKR B;  3C71 A;  2PVQ A;  4PNF A;  4DSR A;  4DSQ A;  5J9B A;  2XC2 A;  2PPT A;  1HQO A;  4ML1 A;  3TOT A;  1G7E A;  1OYJ A;  4HZ2 A;  4D73 B;  3MYD A;  4FQU A;  3EE2 A;  4YQM A;  1AQW A;  1SL0 B;  4Z2U A;  4BWS A;  4OWY A;  5F0G A;  1Z5Y E;  1EOG A;  2CAI A;  4G0K A;  2CQ9 A;  2GZZ A;  2JZR A;  4ISD A;  2YWI A;  3P2A A;  3DYR A;  1WPI A;  3Q18 A;  4F82 A;  3CSI A;  5J4U A;  3F9U A;  2MZC A;  4XS4 A;  3EIN A;  1SL1 B;  1ZL9 A;  3TKS E;  4HQZ A;  2H0H A;  2VCV A;  5E59 A;  1SK0 A;  2TRX A;  1K0A A;  1ERT A;  2F51 A;  3J7Y k;  4CHS A;  3IC4 A;  1R5A A;  5GST A;  1WIK A;  4O5R A;  2H8L A;  2L57 A;  2HSH A;  2R4V A;  2V32 A;  4PGT A;  1TRU A;  5JCW A;  2MMZ A;  2XBI A;  4WEY A;  3SBC A;  1PA3 A;  1EGO A;  2G2Q A;  2P5R A;  7GSS A;  5JWQ B;  1PL2 A;  2N5F A;  1RQM A;  2VLU A;  4MJB A;  2V1M A;  4EF0 A;  3HYP A;  1HNC A;  2F8A A;  4PTS A;  5F8B A;  3GH9 A;  2C3T A;  3VI7 A;  4ZB9 A;  5F07 A;  1EV4 A;  1BQ7 A;  4BVY A;  4GTU A;  2L5L A;  2GZY A;  1F3B A;  1JZW A;  6GSV A;  1FOV A;  5IMA A;  3G7J A;  1G6W A;  1K3O A;  1A8L A;  1Q98 A;  4BL7 B;  2YNX A;  2N5A A;  3IXR A;  5IMD A;  4Q5Q A;  4OO5 A;  2IMI A;  1O8X A;  4BVX A;  5ECS A;  1FAA A;  3F8U A;  1M3I A;  3ZZX A;  3CYN A;  1PX7 A;  1GTB A;  3KD0 A;  3UL3 A;  2QSI A;  4ECC A;  4OD7 A;  1ZOF A;  5IM9 A;  4OCF A;  2GQL A;  3HJO A;  2X49 A;  1VF1 A;  3UBL A;  2DSA A;  2PWJ A;  1LBK A;  3QOU A;  4ECJ A;  2LST A;  1FG4 A;  4GQF A;  1JZR A;  4YAP A;  5KOX A;  3F6D A;  1THO A;  2E0Q A;  3D5J A;  3G9B A;  2HT9 A;  1TRS A;  1EP7 A;  1NHY A;  4TXO A;  5BMU A;  1XVW A;  4K9Z A;  1ILO A;  2C3Q A;  5ECH B;  4PUR A;  3IV4 A;  1O6J A;  5DQS A;  2IPA A;  4Z7X A;  3KTB A;  3A5I A;  1ZZY A;  2H66 A;  2CA8 A;  4KAE A;  1GSE A;  1IYI A;  3DD3 A;  1AC1 A;  2DIY A;  3HCZ A;  1YJ6 A;  2F9S A;  4NHZ A;  2BTO T;  2FA4 A;  1U3A A;  2LV3 A;  3IPZ A;  2GT6 A;  4NMU A;  4V2M A;  1XWC A;  3WGX A;  2H0I A;  4IQA A;  1GTA A;  2D2Z A;  1AW9 A;  4ZB6 A;  5JWR B;  3WGD A;  3N5O A;  5HR2 A;  1WJK A;  6GSS A;  3P8W A;  5IMV A;  3QPM A;  4AF2 A;  4MA9 A;  4WR5 A;  3WD6 A;  4HJ2 A;  2CZ2 A;  2WZ9 A;  2OAC A;  4L8E A;  4K2X A;  2IFQ B;  1EOH A;  5F06 A;  3H79 A;  5HFI A;  2IMK A;  1T4Z A;  5D9W A;  3LXZ A;  2JAD A;  1M7T A;  3WT1 A;  3GSS A;  5G2Z A;  1B8X A;  4IS0 A;  5ECL B;  3MWH A;  2DML A;  2K8S A;  2LJA A;  5CRW A;  2H75 A;  3FEU A;  4Q5F A;  2VLT A;  2K9F A;  3H93 A;  2MMO A;  4IW9 A;  4ILF A;  4ZB8 A;  4XRA A;  1QFN A;  3VPQ A;  2X99 A;  2GQK A;  1DE1 A;  3ZVJ D;  2X64 A;  4JZQ A;  3RBT A;  1Z7P A;  2GSR A;  4TXV A;  5G1K A;  3PH9 A;  1R26 A;  5D93 A;  1PRX A;  4GSN A;  4XS4 B;  3IBH A;  1TTZ A;  4XS6 A;  1ERW A;  3QDN A;  2YWN A;  1TJD A;  1R7H A;  2H0G A;  2V6K A;  1SJZ A;  3JCM L;  2V6O A;  2B5X A;  2OA7 A;  1M0U A;  3F0I A;  3FY7 A;  1XOB A;  1XPV A;  2ZCT A;  1ERV A;  1XWA A;  2JSY A;  3BBY A;  5IO0 A;  2AHE A;  5G30 A;  5HR0 A;  4MF6 A;  5EPF A;  2VM1 A;  3GMF A;  4YH2 A;  4KDX A;  2QGV A;  2YAN A;  2CZ3 A;  3QFA C;  4JED A;  1KTE A;  2VOC A;  4GRF A;  2A4H A;  2R3X A;  4FO5 A;  4BVY B;  3HKR A;  2DJ1 A;  2PVO C;  1U87 A;  1XXU A;  4MF7 A;  2HXK A;  2VAF A;  5G5F A;  2FCH A;  3BCI A;  2XPD A;  2FHE A;  2H1B A;  1PMT A;  1SU9 A;  1ZCP A;  2IMF A;  9GSS A;  3F4S A;  2DJ0 A;  4NXI A;  5CO3 A;  4K5R A;  3TJJ A;  4K7O A;  4NV5 A;  1NHO A;  3QCP A;  3PPU A;  1SD9 A;  4J2F A;  2H6Y A;  4BVX B;  4Z2R A;  5AIS A;  5KN3 A;  1V98 A;  3FMW A;  3KH9 A;  3QFB C;  2B5E A;  2FD3 A;  5CRD A;  2FWG A;  4N11 A;  2DJ3 A;  2LRT A;  1TU8 A;  1E2Y A;  3KM6 A;  1SKW B;  4L0U A;  5ID2 A;  3VWU A;  4ZXG A;  2AJQ B;  4PUA A;  3L4N A;  2GQM A;  1GSY A;  4MK3 A;  2LRN A;  2TRC P;  1FB6 A;  3CRU A;  18GS A;  2VL2 C;  3K8N A;  4K0G A;  5FWG A;  1BYE A;  2KP2 A;  1OAZ A;  2KUC A;  4N0Z A;  1XIY A;  1R4W A;  5AGY A;  2PN8 A;  2R6K A;  2H76 A;  3IHQ A;  1XOA A;  2GGT A;  5DCH A;  3ZVJ A;  1M99 A;  2RUF A;  4TXO B;  4LL1 B;  3TKP A;  3ERW A;  1CQG A;  2C3N A;  4ZBB A;  5CYY A;  3EMX A;  1S3C A;  3MNG A;  1BG5 A;  3ZML A;  1Y6E A;  4MNN A;  4BA7 A;  2LNT A;  4KCE A;  5INY A;  4FIW A;  3IE3 A;  2DMM A;  5J3R A;  1XFL A;  3FZA A;  5ECQ B;  1X9M B;  3CXG A;  2PBJ A;  2QA2 A;  5A4V A;  3FR6 A;  3O76 A;  3RPP A;  4IVF A;  2L6D A;  2QA1 A;  1GSD A;  2YP6 A;  3TJG A;  2HSM A;  3ZFB A;  3I9V 2;  4G0I A;  2LQQ A;  3TGZ A;  2DKI A;  1GUL A;  1EGR A;  3GN3 A;  4HEA 2;  4EIP A;  2LJR A;  3L9S A;  2L4C A;  3EU3 A;  2CT6 A;  5B6N A;  5KN2 A;  4AJ7 A;  3HXS A;  2K8V A;  4RUV A;  4GXZ A;  3GL5 A;  3D0Z A;  4EUY A;  1B9X C;  4TR3 A;  3RHC A;  2H70 A;  4I2T A;  4XHM A;  2YWM A;  5G1L A;  2LJK A;  2K6V A;  1XW6 A;  4TRX A;  3R3E A;  1TDI A;  3NIV A;  1K0D A;  4LLR A;  4EIQ A;  5JCG A;  1VF4 A;  1J0F A;  5J41 A;  1Z6M A;  3CMI A;  2C1Y A;  3C7M A;  3L0H A;  2ALB A;  2MMA A;  1Q4J A;  2IJY A;  4JBB A;  3Q6O A;  4ECB A;  4OMV A;  3EWL A;  1YDK A;  2YZU A;  2DJJ A;  2XPE A;  1T7P B;  3GTU A;  2KOK A;  1GNW A;  4V2N A;  1SYX A;  4POK A;  3I69 A;  2WB9 A;  3GA4 A;  4HI7 A;  4IEL A;  3RPN A;  4LMW A;  1GTI A;  4IHU A;  2B7K A;  2PMT A;  4TR1 A;  5CP1 A;  5LD0 A;  1IYH A;  4KA0 A;  5JCU A;  2GTU A;  5AIV A;  2H1G A;  4ZL7 A;  3O6T A;  2P31 A;  1M3J A;  2C4J A;  4KB3 A;  1UVZ A;  1GLP A;  4KGI A;  3HVV A;  2LTK A;  3QR6 A;  4G10 A;  1A2J A;  1OE8 A;  3IHG A;  1JLV A;  1SJI A;  1JHB A;  2WDU A;  3VLN A;  2GLR A;  2FNO A;  3KIJ A;  3O3T A;  5B8A A;  4X1U A;  3DWV A;  1K0N A;  2DLX A;  4YAV A;  1NW2 A;  4LMV A;  4GSS A;  2G0F A;  4L5O A;  4YKG A;  3GKK A;  3I6A A;  2CAQ A;  5DAL A;  1F3A A;  3LYK A;  1XW9 A;  1S3A A;  3HZ4 A;  5FHI A;  3TJF A;  4CY6 A;  2B6M A;  5CRE A;  4ZBA A;  4I8B A;  5ENU A;  3QMX A;  4WR4 A;  1AXD A;  4EVM A;  3C73 A;  22GS A;  5CAX A;  2R37 A;  4ZBD A;  1TK0 B;  3VWX A;  1TOF A;  5IQY A;  3ME7 A;  3WYW A;  2HI7 A;  1Z3E A;  4F2I A;  2VCW A;  1PD2 1;  4IKH A;  2I81 A;  4O7H A;  1G0T A;  1JZO A;  3LSZ A;  1V57 A;  1PN0 A;  4MJC A;  4MMM A;  1ZMA A;  3GKM A;  4XIH A;  2DIZ A;  1V58 A;  19GS A;  3IOS A;  1EV9 A;  3PIN A;  4PUF C;  5ID2 B;  4MAB A;  1X9S B;  4GST A;  4F03 A;  4DVC A;  4XS1 A;  1ACV A;  4KSM A;  3RHB A;  2FWH A;  2OAD A;  4KDY A;  3TB2 A;  5CRH A;  3LOR A;  5IMC A;  3LJR A;  4OFT A;  1EZK A;  1Z6N A;  4HS1 A;  4GWR A;  1AIU A;  2DC5 A;  4Q5R A;  1AQV A;  3FR9 A;  3DIE A;  4O5Q A;  3CTF A;  1PGT A;  1YKC A;  3GNJ A;  1FHE A;  4TKY A;  1NSW A;  2JSZ A;  1URM A;  2IL3 A;  2MYG A;  2JL4 A;  16GS A;  1TKD B;  4PQH A;  1SK2 A;  2NPB A;  1AUC A;  4MZC A;  4QL7 A;  3KP9 A;  1TK5 B;  2IIY A;  13GS A;  2LEG A;  1J9B A;  4MDC A;  1U88 A;  2JAC A;  3KTL A;  1KEB A;  4AJ6 A;  3P7X A;  2VL3 A;  3DKS A;  4O5U A;  2GST A;  4V1A g;  2NTO A;  1THX A;  4K7N A;  4YQV A;  3TRX A;  3W8J A;  4OFN A;  3TUE A;  1PKW A;  2WS2 A;  4PQ1 A;  1X5E A;  4OCE A;  1MDI A;  3LW9 A;  3A5W A;  2RM6 A;  4BWQ A;  5GAN D;  3TKS A;  3KCM A;  2OBI A;  3HVX A;  1V2A A;  2OKA A;  2R2J A;  4KE3 A;  4WET A;  5L71 A;  1BED A;  4RQR A;  1ABA A;  3UAP A;  1TI3 A;  2I4A A;  1QMV A;  3ZL5 A;  3ZTL A;  3FHK A;  2R5G A;  1T3B A;  2LNS A;  2NBS A;  5GSS A;  1FB0 A;  2TIR A;  3LYP A;  1ZYP A;  2YZH A;  3IAS 2;  5CNW A;  3FYG A;  3APQ A;  1ERU A;  2KHP A;  1GH2 A;  3IK7 A;  2ZUP A;  5ELG A;  4YKF A;  5GAP D;  2L59 A;  3SWL A;  2X8C A;  2E7P A;  1GP1 A;  3KGK A;  2OE0 A;  2GVP A;  1J08 A;  1WP0 A;  3APS A;  3KMN A;  2JU5 A;  1VF3 A;  4KUN A;  2I1U A;  2H19 A;  2QC7 A;  3R2Q A;  1GSU A;  1X9W B;  3M3M A;  3GTU B;  2OE1 A;  3BOA A;  3D22 A;  2GT5 A;  2VL9 A;  3TKS C;  2EIQ A;  4TR1 B;  1A2L A;  12GS A;  2H6X A;  1DSB A;  2CV4 A;  3G7I A;  4LL4 B;  4E8E A;  4K2D A;  4DSS A;  4WF5 A;  10GS A;  5G5E A;  2CX4 A;  3DML A;  4JU5 A;  3EUR A;  2NDO A;  1X5C A;  2B1L A;  5A4U A;  3TCO A;  4XTS A;  4RQX A;  3GX8 A;  3PR8 A;  1I5G A;  5H5S A;  3OR5 A;  1GUH A;  3KP8 A;  1YF1 A;  3UIW A;  3L78 A;  2AB6 A;  2KP1 A;  1ON4 A;  3C8E A;  2HZF A;  3A2X A;  2R0G A;  3KZQ A;  4NPB A;  1Y25 A;  5ECP B;  3TRQ A;  2YJH A;  3N9J A;  4K7I A;  2VIM A;  3HD5 A;  3Q19 A;  1I9D A;  4MJA A;  1MEK A;  4L5L A;  1S3D A;  2YN1 A;  5DAL B;  3H8Q A;  4IQ1 A;  1OC8 A;  4CY8 A;  1QK8 A;  2VL2 A;  3EYT A;  3TKQ A;  2R0C A;  2VLV A;  3ISO A;  2BJX A;  1OC9 A;  5J5N A;  4MPF A;  1MD3 A;  1XZO A;  3TJB A;  1W89 A;  3AY8 A;  1H4O A;  5CRG A;  3ME8 A;  5E4W A;  4J56 E;  1A23 A;  3IAM 2;  4HQS A;  1KNG A;  2OE3 A;  3IDV A;  4IGJ A;  3LWA A;  3UJ1 A;  5ECM B;  5ECO B;  4X43 A;  4WBR D;  2QKE A;  3M1G A;  6GSX A;  2BMX A;  2A4V A;  2JZT A;  4HSC X;  1FOH A;  5EL8 A;  3ZIJ A;  3GL3 A;  1ZGN A;  3HJM A;  3LEF A;  2AAW A;  1EP8 A;  4QL9 A;  3HVN A;  3NZN A;  5FT3 A;  1A2M A;  1TW9 A;  1XWG A;  1TRW A;  2FWF A;  2O7K A;  3VWV A;  1AQX A;  1RK4 A;  2IWT A;  2YV7 A;  1A0F A;  4POM A;  2HFD A;  4HZ4 A;  1PKZ A;  2JZS A;  3A3T A;  3ZIV A;  1C72 A;  1GLQ A;  2O85 A;  4V1A p;  2F8F A;  3U6V A;  2NVL A;  6GSU A;  3HA9 A;  2FGX A;  3EMP A;  3M9K A;  4MF5 A;  4CDO A;  2LS5 A;  3VWW A;  4ML6 A;  1M2D A;  3CRT A;  1DE2 A;  1O7U A;  2EIR A;  2H01 A;  4IBP A;  3S9F A;  5D96 A;  1TI1 A;  4PQI A;  1M2B A;  3L9U A;  1UN2 A;  1OKT A;  3VK9 A;  1XBS A;  4RI7 A;  4TOP A;  5DJL A;  4A5P A;  5DJM A;  4USS A;  1PL1 A;  2V41 A;  5B6M A;  4YQU A;  4GCI A;  1GRX A;  2AUV A;  4ZIL A;  4ZIJ A;  1K0B A;  1MTC A;  4BIK A;  2VCZ A;  1X5D A;  4NV2 A;  1B4Q A;  5ECR B;  2X4A A;  2GZP A;  4N10 A;  4X4J A;  4TW5 A;  4F0B A;  1ST9 A;  3H1N A;  4KF9 A;  3ZIT A;  1GUK A;  3ZYW A;  2MBS A;  4KX4 A;  3NOF A;  2HRN A;  2HLS A;  1K0M A;  4V2L A;  4OO4 A;  2RLI A;  3ZMK A;  2VUP A;  2HSY A;  2DJ2 A;  4MCU A;  4KDU A;  3GUS A;  1T00 A;  1OC3 A;  4P3Y B;  4I2U A;  3WGE A;  5HFK A;  2E2G A;  1HYU A;  1DUG A;  3M9J A;  3GFK A;  5DCG A;  3ZLP A;  1X0R A;  2H73 A;  1M2A A;  5HR3 A;  1S3R A;  5IMZ A;  2PER A;  3GV1 A;  1GTU A;  4HU7 A;  4TR4 A;  4O32 A;  2X8G A;  3IC8 A;  2L6C A;  2GS3 A;  4PX1 A;  3CTG A;  2FY6 A;  3L9V A;  3LQ7 A;  2HNL A;  1V9W A;  1UA5 A;  2H72 A;  3M0F A;  4MH2 A;  4GQC A;  1WOU A;  2EC4 A;  3E9J B;  4IJ3 A;  3MDK A;  3E3E A;  3FK8 A;  2YWO A;  3UBK A;  3F4T A;  4KW6 A;  3V1W A;  3ERG A;  1O73 A;  2N5B A;  2C80 A;  3GKX A;  4J57 E;  2VO4 A;  4HU9 A;  4WKW A;  1TU7 A;  2XHF A;  2H1D A;  4KCA A;  4XCS A;  3DGQ A;  4NAX A;  4DSS B;  1HNB A;  4AGS A;  4POL A;  1XCC A;  4K0N A;  4ZL9 A;  3KH7 A;  1WWJ A;  2HZE A;  2B1K A;  4ULX A;  3EPT A;  2PU9 C;  4GF0 A;  4GLT A;  4H86 A;  4CW9 A;  2HRA A;  3APO A;  5B8B A;  1PN9 A;  4K8M A;  3F63 A;  5BRT A;  5D8I A;  5LNK e;  3FZ5 A;  5ECI B;  3UMA A;  1VRS D;  3VI5 A;  2H30 A;  3GUR A;  1A8Y A;  1OE7 A;  4WF4 A;  1SK1 A;  3FKF A;  1W4V A;  3KXO A;  1XVQ A;  1YKA A;  3HZ8 A;  4F0C A;  1B4P A;  3FZ4 A;  3ERF A;  5D9X A;  2PGT A;  1B48 A;  2M80 A;  4HDE A;  3CBU A;  3KMO A;  2XBQ A;  3UEM A;  2R0P A;  2CVK A;  1SYR A;  6GSW A;  1XWK A;  3LG6 A;  1OC9 B;  3C1R A;  2RUE A;  5HQP A;  5ECN B;  3I43 A;  3F6F A;  1BAY A;  3CQF A;  5HR1 A;  1PQN A;  1F2E A;  1T8E B;  2GSS A;  4NWY A;  4RI6 A;  20GS A;  4Q5N A;  2OJL A;  1K3Y A;  1GSF A;  3HHV A;  5IMF A;  2YPM A;  2VM2 A;  4MJE A;  2DJK A;  3A2W A;  1E6B A;  2PUK C;  2WRT A;  2HRF A;  1XG8 A;  4AJ8 A;  4MP4 A;  2J23 A;  1T4Y A;  4O92 A;  3BD2 A;  5DAK A;  3WT2 A;  5DQY A;  1F9M A;  4X0X A;  2FLS A;  2H1A A;  2O87 A;  4F9Z A;  1PFO A;  2Z9S A;  3FZ9 A;  4XRD A;  3ZFL A;  2AV4 A;  3GYK A;  5JWO B;  2F3M A;  3F3Q A;  17GS A;  3A2V A;  5J9C A;  3TOU A;  3VUR A;  4NHW A;  3ED3 A;  2I3Y A;  2P5Q A;  4EE0 A;  1LU4 A;  4EL1 A;  6GST A;  5KN0 A;  4FYB A;  2O8V B;  1QQ2 A;  5HFG A;  3KJY A;  3U5R E;  2H71 A;  2IMD A;  3G7Y A;  1GSQ A;  3EC3 A;  1K0O A;  2YCD A;  4JRR A;  3QD9 A;  1VF2 A;  4ID0 A;  3TRP A;  1YF0 A;  3H4K A;  1GNE A;  4MPG A;  4BPY A;  1HNA A;  1O81 A;  3QAG A;  5C00 A;  11GS A;  4FYU A;  3PGT A;  1NM3 A;  4ICY A;  5KOW A;  1GUM A;  2C0F A;  3GX0 A;  3UVT A;  4TVE A;  3HJP A;  2LKU A;  3IRA A;  1Z9H A;  2WUL A;  5ABR A;  3TKR A;  2A2S A;  3D6I A;  3EU4 A;  3US3 A;  1U3I A;  2L4Q A;  2FUG 2;  3DXB A;  5A5K A;  1O85 A;  2WGR A;  5LCZ A;  5D73 A;  3CSJ A;  3W8S A;  3F4R A;  8GSS A;  5D9T A;  2DBC A;  3GH6 A;  1LJR A;  1XWB A;  3LFL A;  1Z7R A;  4JR4 A;  3LGC A;  2WCI A;  1K3L A;  1JZD A;  4MZW A;  3GHA A;  1SD8 A;  2VD0 A;  4WXT A;  2YV9 A;  2C8U A;  2CVD A;  3IK9 A;  5C04 A;  1ZYQ B;  2X8H A;  3EVI A;  4D73 A;  1TK8 B;  4EKZ A;  1WE0 A;  2O89 A;  5B7C A;  4JR6 A;  2A2P A;  3M8N A;  1UC7 A;  4KSO A;  4TN8 A;  3HVS A;  1YZX A;  1WMJ A;  2VCT A;  5H5Q A;  5F05 A;  2ZNM A;  5COH A;  4LA1 A;  2FWE A;  5IPH A;  2HRK A;  1DBY A;  3ZRD A;  3VFI A;  5KEJ A;  2CX3 A;  3QAV A;  3DVX A;  2LQO A;  3QAW A;  4K6X A;  4IP6 A;  4G19 A;  5DDL A;  3BJ5 A;  1M9A A; 
#chains in the Genus database with same CATH homology
 3E0U A;  1BX9 A;  4G9H A;  4N0V A;  4OFM A;  2B7J A;  4TR0 A;  1AAZ A;  3IR4 A;  4G2E A;  2YOI A;  5IO2 A;  2MMN A;  3ZRE A;  3FW2 A;  4JE1 A;  2LUS A;  3C1S A;  3GKN A;  3UAR A;  3J7Y b;  3UVH A;  4MZB A;  1R5P A;  4I6X A;  2HZE B;  3FR3 A;  1QXH A;  1MDK A;  2RM5 A;  1ML6 A;  3LXT A;  1F37 A;  5DBQ A;  4ZL8 A;  2P0G A;  4E8H A;  2GDR A;  2K18 A;  3KEB A;  1RW1 A;  1QGV A;  1YEX A;  4K5S A;  1N2A A;  1N8J A;  3DRN A;  5KN1 A;  2H6Z A;  5AN1 A;  1U6T A;  1T1V A;  1XW5 A;  4HOJ A;  3RDW A;  4G0L A;  1HD2 A;  3FRC A;  3P90 A;  1YEP A;  4Z2T A;  3HDC A;  4EO3 A;  5DVB A;  1EEM A;  2HE3 A;  1H75 A;  4BL7 A;  4PXO A;  3GRX A;  5IIZ A;  3DEX A;  3W6G A;  3MAK A;  1JFU A;  2E2M A;  2VD1 A;  2C0G A;  4KND A;  2YJ7 A;  3TDG A;  1A0R P;  1M9B A;  1SL2 B;  1YQ1 A;  2WFC A;  3TJK A;  1FO5 A;  1MD4 A;  3UOM A;  3F3R A;  1OVN A;  4MLY A;  4I97 A;  4IP1 A;  1PSQ A;  1GSS A;  5IPG A;  3GST A;  2H74 A;  1GL8 A;  5EY6 A;  1KBN A;  1GWC A;  2LRC A;  2KLX A;  4HUA A;  2M72 A;  4WBJ A;  5H5R A;  3HY2 A;  4N30 A;  1EWX A;  1V40 A;  1QUW A;  5EVO A;  5IOX A;  5DAK B;  4K1F A;  4EC0 A;  4DEJ A;  5A4W A;  2WJU A;  1ZYE A;  5ECK B;  5GZZ B;  1VGL A;  1SJ6 A;  3MIX A;  6GSY A;  2EIO A;  2FA8 A;  2ES7 A;  4PNG A;  2VCX A;  2C0E A;  2VCQ A;  4IN0 A;  4ECI A;  2B5Y A;  2A2R A;  3RAZ A;  1FVK A;  1MDJ A;  1B9Y C;  3IA1 A;  1TRV A;  1OKD A;  2UZ8 A;  3MSZ A;  5ELA A;  1G6Y A;  1FVJ A;  1TP9 A;  4I5Q A;  2CVB A;  3DVW A;  3D21 A;  1O8W A;  2GSQ A;  2ON7 A;  1SKS B;  1USB A;  5IOW A;  2MBT A;  5D9V A;  4QQ7 A;  1EEJ A;  2IN3 A;  4FYC A;  2DKH A;  1JLW A;  4HJM A;  4FH8 A;  1A24 A;  1SEN A;  1BJX A;  2L5O A;  3GIX A;  1WRY A;  4IJI A;  2REM A;  1TXX A;  4EXJ A;  4MH3 A;  1PX6 A;  3D4M A;  1ZYN A;  4KH7 A;  2B3S A;  2AYT A;  5G31 A;  3Q74 A;  2C0D A;  1FW1 A;  2RII A;  1F6M C;  2ON5 A;  2IME A;  4EDY A;  5AIX A;  4EDZ A;  3VPT A;  1K0C A;  2V2G A;  1G7O A;  2I9H A;  14GS A;  4ACS A;  2HYX A;  2J9H A;  2IFQ A;  2OBK A;  4L0W A;  3CSH A;  4POB A;  3D4T A;  1CQH A;  3BCK A;  1YY7 A;  2M46 A;  1SKR B;  3C71 A;  2PVQ A;  4PNF A;  4DSR A;  4DSQ A;  5J9B A;  2XC2 A;  2PPT A;  1HQO A;  4ML1 A;  3TOT A;  1G7E A;  1OYJ A;  4HZ2 A;  4D73 B;  3MYD A;  4FQU A;  3EE2 A;  4YQM A;  1AQW A;  1SL0 B;  4Z2U A;  4BWS A;  4OWY A;  5F0G A;  1Z5Y E;  1EOG A;  2CAI A;  4G0K A;  2CQ9 A;  2GZZ A;  2JZR A;  4ISD A;  2YWI A;  3P2A A;  3DYR A;  1WPI A;  3Q18 A;  4F82 A;  3CSI A;  5J4U A;  3F9U A;  2MZC A;  4XS4 A;  3EIN A;  1SL1 B;  1ZL9 A;  3TKS E;  4HQZ A;  2H0H A;  2VCV A;  5E59 A;  1SK0 A;  2TRX A;  1K0A A;  1ERT A;  2F51 A;  3J7Y k;  4CHS A;  3IC4 A;  1R5A A;  5GST A;  1WIK A;  4O5R A;  2H8L A;  2L57 A;  2HSH A;  2R4V A;  2V32 A;  4PGT A;  1TRU A;  5JCW A;  2MMZ A;  2XBI A;  4WEY A;  3SBC A;  1PA3 A;  1EGO A;  2G2Q A;  2P5R A;  7GSS A;  5JWQ B;  1PL2 A;  2N5F A;  1RQM A;  2VLU A;  4MJB A;  2V1M A;  4EF0 A;  3HYP A;  1HNC A;  2F8A A;  4PTS A;  5F8B A;  3GH9 A;  2C3T A;  3VI7 A;  4ZB9 A;  5F07 A;  1EV4 A;  1BQ7 A;  4BVY A;  4GTU A;  2L5L A;  2GZY A;  1F3B A;  1JZW A;  6GSV A;  1FOV A;  5IMA A;  3G7J A;  1G6W A;  1K3O A;  1A8L A;  1Q98 A;  4BL7 B;  2YNX A;  2N5A A;  3IXR A;  5IMD A;  4Q5Q A;  4OO5 A;  2IMI A;  1O8X A;  4BVX A;  5ECS A;  1FAA A;  3F8U A;  3ZZX A;  3CYN A;  1PX7 A;  1GTB A;  3KD0 A;  3UL3 A;  2QSI A;  4ECC A;  4OD7 A;  1ZOF A;  5IM9 A;  4OCF A;  2GQL A;  3HJO A;  2X49 A;  1VF1 A;  3UBL A;  2DSA A;  2PWJ A;  1LBK A;  3QOU A;  4ECJ A;  2LST A;  1FG4 A;  4GQF A;  1JZR A;  4YAP A;  5KOX A;  3F6D A;  1THO A;  2E0Q A;  3D5J A;  3G9B A;  2HT9 A;  1TRS A;  1EP7 A;  1NHY A;  4TXO A;  5BMU A;  1XVW A;  4K9Z A;  1ILO A;  2C3Q A;  5ECH B;  4PUR A;  3IV4 A;  1O6J A;  5DQS A;  2IPA A;  4Z7X A;  3KTB A;  3A5I A;  1ZZY A;  2H66 A;  2CA8 A;  4KAE A;  1GSE A;  1IYI A;  3DD3 A;  1AC1 A;  2DIY A;  3HCZ A;  1YJ6 A;  2F9S A;  4NHZ A;  2BTO T;  2FA4 A;  1U3A A;  2LV3 A;  3IPZ A;  2GT6 A;  4NMU A;  4V2M A;  1XWC A;  3WGX A;  2H0I A;  4IQA A;  1GTA A;  2D2Z A;  1AW9 A;  4ZB6 A;  5JWR B;  3WGD A;  3N5O A;  5HR2 A;  1WJK A;  6GSS A;  3P8W A;  5IMV A;  3QPM A;  4AF2 A;  4MA9 A;  4WR5 A;  3WD6 A;  4HJ2 A;  2CZ2 A;  2WZ9 A;  2OAC A;  4L8E A;  4K2X A;  2IFQ B;  1EOH A;  5F06 A;  3H79 A;  5HFI A;  2IMK A;  1T4Z A;  5D9W A;  3LXZ A;  2JAD A;  1M7T A;  3WT1 A;  3GSS A;  5G2Z A;  1B8X A;  4IS0 A;  5ECL B;  3MWH A;  2DML A;  2K8S A;  2LJA A;  5CRW A;  2H75 A;  3FEU A;  4Q5F A;  2VLT A;  2K9F A;  3H93 A;  2MMO A;  4IW9 A;  4ILF A;  4ZB8 A;  4XRA A;  1QFN A;  3VPQ A;  2X99 A;  2GQK A;  1DE1 A;  3ZVJ D;  2X64 A;  4JZQ A;  3RBT A;  1Z7P A;  2GSR A;  4TXV A;  5G1K A;  3PH9 A;  1R26 A;  5D93 A;  1PRX A;  4GSN A;  4XS4 B;  3IBH A;  1TTZ A;  4XS6 A;  1ERW A;  3QDN A;  2YWN A;  1TJD A;  1R7H A;  2H0G A;  2V6K A;  1SJZ A;  3JCM L;  2V6O A;  2B5X A;  2OA7 A;  1M0U A;  3F0I A;  3FY7 A;  1XOB A;  1XPV A;  2ZCT A;  1ERV A;  1XWA A;  2JSY A;  3BBY A;  5IO0 A;  2AHE A;  5G30 A;  5HR0 A;  4MF6 A;  5EPF A;  2VM1 A;  3GMF A;  4YH2 A;  4KDX A;  2QGV A;  2YAN A;  2CZ3 A;  3QFA C;  4JED A;  1KTE A;  2VOC A;  4GRF A;  2A4H A;  2R3X A;  4FO5 A;  4BVY B;  3HKR A;  2DJ1 A;  2PVO C;  1U87 A;  1XXU A;  4MF7 A;  2HXK A;  2VAF A;  5G5F A;  2FCH A;  3BCI A;  2XPD A;  2FHE A;  2H1B A;  1PMT A;  1SU9 A;  1ZCP A;  2IMF A;  9GSS A;  3F4S A;  2DJ0 A;  4NXI A;  5CO3 A;  4K5R A;  3TJJ A;  4K7O A;  4NV5 A;  1NHO A;  3QCP A;  3PPU A;  1SD9 A;  4J2F A;  2H6Y A;  4BVX B;  4Z2R A;  5AIS A;  5KN3 A;  1V98 A;  3FMW A;  3KH9 A;  3QFB C;  2B5E A;  2FD3 A;  5CRD A;  2FWG A;  4N11 A;  2DJ3 A;  2LRT A;  1TU8 A;  1E2Y A;  3KM6 A;  1SKW B;  4L0U A;  5ID2 A;  3VWU A;  4ZXG A;  2AJQ B;  4PUA A;  3L4N A;  2GQM A;  1GSY A;  4MK3 A;  2LRN A;  2TRC P;  1FB6 A;  3CRU A;  18GS A;  2VL2 C;  3K8N A;  4K0G A;  5FWG A;  1BYE A;  2KP2 A;  1OAZ A;  2KUC A;  4N0Z A;  1XIY A;  1R4W A;  5AGY A;  2PN8 A;  2R6K A;  2H76 A;  3IHQ A;  1XOA A;  2GGT A;  5DCH A;  3ZVJ A;  1M99 A;  2RUF A;  4TXO B;  4LL1 B;  3TKP A;  3ERW A;  1CQG A;  2C3N A;  4ZBB A;  5CYY A;  3EMX A;  1S3C A;  3MNG A;  1BG5 A;  3ZML A;  1Y6E A;  4MNN A;  4BA7 A;  2LNT A;  4KCE A;  5INY A;  4FIW A;  3IE3 A;  2DMM A;  5J3R A;  1XFL A;  3FZA A;  5ECQ B;  1X9M B;  3CXG A;  2PBJ A;  2QA2 A;  5A4V A;  3FR6 A;  3O76 A;  3RPP A;  4IVF A;  2L6D A;  2QA1 A;  1GSD A;  2YP6 A;  3TJG A;  2HSM A;  3ZFB A;  3I9V 2;  4G0I A;  2LQQ A;  3TGZ A;  2DKI A;  1GUL A;  1EGR A;  3GN3 A;  4HEA 2;  4EIP A;  2LJR A;  3L9S A;  2L4C A;  3EU3 A;  2CT6 A;  5B6N A;  5KN2 A;  4AJ7 A;  3HXS A;  2K8V A;  4RUV A;  4GXZ A;  3GL5 A;  3D0Z A;  4EUY A;  1B9X C;  4TR3 A;  3RHC A;  2H70 A;  4I2T A;  4XHM A;  2YWM A;  5G1L A;  2LJK A;  2K6V A;  1XW6 A;  4TRX A;  3R3E A;  1TDI A;  3NIV A;  1K0D A;  4LLR A;  4EIQ A;  5JCG A;  1VF4 A;  1J0F A;  5J41 A;  1Z6M A;  3CMI A;  2C1Y A;  3C7M A;  3L0H A;  2ALB A;  2MMA A;  1Q4J A;  2IJY A;  4JBB A;  3Q6O A;  4ECB A;  4OMV A;  3EWL A;  1YDK A;  2YZU A;  2DJJ A;  2XPE A;  1T7P B;  3GTU A;  2KOK A;  1GNW A;  4V2N A;  1SYX A;  4POK A;  3I69 A;  2WB9 A;  3GA4 A;  4HI7 A;  4IEL A;  3RPN A;  4LMW A;  1GTI A;  4IHU A;  2B7K A;  2PMT A;  4TR1 A;  5CP1 A;  5LD0 A;  1IYH A;  4KA0 A;  5JCU A;  2GTU A;  5AIV A;  2H1G A;  4ZL7 A;  3O6T A;  2P31 A;  2C4J A;  4KB3 A;  1UVZ A;  1GLP A;  4KGI A;  3HVV A;  2LTK A;  3QR6 A;  4G10 A;  1A2J A;  1OE8 A;  3IHG A;  1JLV A;  1SJI A;  1JHB A;  2WDU A;  3VLN A;  2GLR A;  2FNO A;  3KIJ A;  3O3T A;  5B8A A;  4X1U A;  3DWV A;  1K0N A;  2DLX A;  4YAV A;  1NW2 A;  4LMV A;  4GSS A;  2G0F A;  4L5O A;  4YKG A;  3GKK A;  3I6A A;  2CAQ A;  5DAL A;  1F3A A;  3LYK A;  1XW9 A;  1S3A A;  3HZ4 A;  5FHI A;  3TJF A;  4CY6 A;  2B6M A;  5CRE A;  4ZBA A;  4I8B A;  5ENU A;  3QMX A;  4WR4 A;  1AXD A;  4EVM A;  3C73 A;  22GS A;  5CAX A;  2R37 A;  4ZBD A;  1TK0 B;  3VWX A;  1TOF A;  5IQY A;  3ME7 A;  3WYW A;  2HI7 A;  1Z3E A;  4F2I A;  2VCW A;  1PD2 1;  4IKH A;  2I81 A;  4O7H A;  1G0T A;  1JZO A;  3LSZ A;  1V57 A;  1PN0 A;  4MJC A;  4MMM A;  1ZMA A;  3GKM A;  4XIH A;  2DIZ A;  1V58 A;  19GS A;  3IOS A;  1EV9 A;  3PIN A;  4PUF C;  5ID2 B;  4MAB A;  1X9S B;  4GST A;  4F03 A;  4DVC A;  4XS1 A;  1ACV A;  4KSM A;  3RHB A;  2FWH A;  2OAD A;  4KDY A;  3TB2 A;  5CRH A;  3LOR A;  5IMC A;  3LJR A;  4OFT A;  1EZK A;  1Z6N A;  4HS1 A;  4GWR A;  1AIU A;  2DC5 A;  4Q5R A;  1AQV A;  3FR9 A;  3DIE A;  4O5Q A;  3CTF A;  1PGT A;  1YKC A;  3GNJ A;  1FHE A;  4TKY A;  1NSW A;  2JSZ A;  1URM A;  2IL3 A;  2MYG A;  2JL4 A;  16GS A;  1TKD B;  4PQH A;  1SK2 A;  2NPB A;  1AUC A;  4MZC A;  4QL7 A;  3KP9 A;  1TK5 B;  2IIY A;  13GS A;  2LEG A;  1J9B A;  4MDC A;  1U88 A;  2JAC A;  3KTL A;  1KEB A;  4AJ6 A;  3P7X A;  2VL3 A;  3DKS A;  4O5U A;  2GST A;  4V1A g;  2NTO A;  1THX A;  4K7N A;  4YQV A;  3TRX A;  3W8J A;  4OFN A;  3TUE A;  1PKW A;  2WS2 A;  4PQ1 A;  1X5E A;  4OCE A;  1MDI A;  3LW9 A;  3A5W A;  2RM6 A;  4BWQ A;  5GAN D;  3TKS A;  3KCM A;  2OBI A;  3HVX A;  1V2A A;  2OKA A;  2R2J A;  4KE3 A;  4WET A;  5L71 A;  1BED A;  4RQR A;  1ABA A;  3UAP A;  1TI3 A;  2I4A A;  1QMV A;  3ZL5 A;  3ZTL A;  3FHK A;  2R5G A;  1T3B A;  2LNS A;  2NBS A;  5GSS A;  1FB0 A;  2TIR A;  3LYP A;  1ZYP A;  2YZH A;  3IAS 2;  5CNW A;  3FYG A;  3APQ A;  1ERU A;  2KHP A;  1GH2 A;  3IK7 A;  2ZUP A;  5ELG A;  4YKF A;  5GAP D;  2L59 A;  3SWL A;  2X8C A;  2E7P A;  1GP1 A;  3KGK A;  2OE0 A;  2GVP A;  1J08 A;  1WP0 A;  3APS A;  3KMN A;  2JU5 A;  1VF3 A;  4KUN A;  2I1U A;  2H19 A;  2QC7 A;  3R2Q A;  1GSU A;  1X9W B;  3M3M A;  3GTU B;  2OE1 A;  3BOA A;  3D22 A;  2GT5 A;  2VL9 A;  3TKS C;  2EIQ A;  4TR1 B;  1A2L A;  12GS A;  2H6X A;  1DSB A;  2CV4 A;  3G7I A;  4LL4 B;  4E8E A;  4K2D A;  4DSS A;  4WF5 A;  10GS A;  5G5E A;  2CX4 A;  3DML A;  4JU5 A;  3EUR A;  2NDO A;  1X5C A;  2B1L A;  5A4U A;  3TCO A;  4XTS A;  4RQX A;  3GX8 A;  3PR8 A;  1I5G A;  5H5S A;  3OR5 A;  1GUH A;  3KP8 A;  1YF1 A;  3UIW A;  3L78 A;  2AB6 A;  2KP1 A;  1ON4 A;  3C8E A;  2HZF A;  3A2X A;  2R0G A;  3KZQ A;  4NPB A;  1Y25 A;  5ECP B;  3TRQ A;  2YJH A;  3N9J A;  4K7I A;  2VIM A;  3HD5 A;  3Q19 A;  1I9D A;  4MJA A;  1MEK A;  4L5L A;  1S3D A;  2YN1 A;  5DAL B;  3H8Q A;  4IQ1 A;  1OC8 A;  4CY8 A;  1QK8 A;  2VL2 A;  3EYT A;  3TKQ A;  2R0C A;  2VLV A;  3ISO A;  2BJX A;  1OC9 A;  5J5N A;  4MPF A;  1MD3 A;  1XZO A;  3TJB A;  1W89 A;  3AY8 A;  1H4O A;  5CRG A;  3ME8 A;  5E4W A;  4J56 E;  1A23 A;  3IAM 2;  4HQS A;  1KNG A;  2OE3 A;  3IDV A;  4IGJ A;  3LWA A;  3UJ1 A;  5ECM B;  5ECO B;  4X43 A;  4WBR D;  2QKE A;  3M1G A;  6GSX A;  2BMX A;  2A4V A;  2JZT A;  1FOH A;  5EL8 A;  3ZIJ A;  3GL3 A;  1ZGN A;  3HJM A;  3LEF A;  2AAW A;  1EP8 A;  4QL9 A;  3NZN A;  5FT3 A;  1A2M A;  1TW9 A;  1XWG A;  1TRW A;  2FWF A;  2O7K A;  3VWV A;  1AQX A;  1RK4 A;  2IWT A;  2YV7 A;  1A0F A;  4POM A;  2HFD A;  4HZ4 A;  1PKZ A;  2JZS A;  3A3T A;  3ZIV A;  1C72 A;  1GLQ A;  2O85 A;  4V1A p;  2F8F A;  3U6V A;  2NVL A;  6GSU A;  3HA9 A;  2FGX A;  3EMP A;  3M9K A;  4MF5 A;  4CDO A;  2LS5 A;  3VWW A;  4ML6 A;  1M2D A;  3CRT A;  1DE2 A;  1O7U A;  2EIR A;  2H01 A;  4IBP A;  3S9F A;  5D96 A;  1TI1 A;  4PQI A;  1M2B A;  3L9U A;  1UN2 A;  1OKT A;  3VK9 A;  1XBS A;  4RI7 A;  4TOP A;  5DJL A;  4A5P A;  5DJM A;  4USS A;  1PL1 A;  2V41 A;  5B6M A;  4YQU A;  4GCI A;  1GRX A;  2AUV A;  4ZIL A;  4ZIJ A;  1K0B A;  1MTC A;  2VCZ A;  1X5D A;  4NV2 A;  1B4Q A;  5ECR B;  2X4A A;  2GZP A;  4N10 A;  4X4J A;  4TW5 A;  4F0B A;  1ST9 A;  3H1N A;  4KF9 A;  3ZIT A;  1GUK A;  3ZYW A;  2MBS A;  4KX4 A;  3NOF A;  2HRN A;  2HLS A;  1K0M A;  4V2L A;  4OO4 A;  2RLI A;  3ZMK A;  2VUP A;  2HSY A;  2DJ2 A;  4MCU A;  4KDU A;  3GUS A;  1T00 A;  1OC3 A;  4P3Y B;  4I2U A;  3WGE A;  5HFK A;  2E2G A;  1HYU A;  1DUG A;  3M9J A;  3GFK A;  5DCG A;  3ZLP A;  1X0R A;  2H73 A;  1M2A A;  5HR3 A;  5IMZ A;  2PER A;  3GV1 A;  1GTU A;  4HU7 A;  4TR4 A;  4O32 A;  2X8G A;  3IC8 A;  2L6C A;  2GS3 A;  4PX1 A;  3CTG A;  2FY6 A;  3L9V A;  3LQ7 A;  2HNL A;  1V9W A;  1UA5 A;  2H72 A;  3M0F A;  4MH2 A;  4GQC A;  1WOU A;  2EC4 A;  3E9J B;  4IJ3 A;  3MDK A;  3E3E A;  3FK8 A;  2YWO A;  3UBK A;  3F4T A;  4KW6 A;  3V1W A;  3ERG A;  1O73 A;  2N5B A;  2C80 A;  3GKX A;  4J57 E;  2VO4 A;  4HU9 A;  4WKW A;  1TU7 A;  2XHF A;  2H1D A;  4KCA A;  4XCS A;  3DGQ A;  4NAX A;  4DSS B;  1HNB A;  4AGS A;  4POL A;  1XCC A;  4K0N A;  4ZL9 A;  3KH7 A;  1WWJ A;  2HZE A;  2B1K A;  4ULX A;  3EPT A;  2PU9 C;  4GF0 A;  4GLT A;  4H86 A;  4CW9 A;  2HRA A;  3APO A;  5B8B A;  1PN9 A;  4K8M A;  3F63 A;  5BRT A;  5D8I A;  5LNK e;  3FZ5 A;  5ECI B;  3UMA A;  1VRS D;  3VI5 A;  2H30 A;  3GUR A;  1A8Y A;  1OE7 A;  4WF4 A;  1SK1 A;  3FKF A;  1W4V A;  3KXO A;  1XVQ A;  1YKA A;  3HZ8 A;  4F0C A;  1B4P A;  3FZ4 A;  3ERF A;  5D9X A;  2PGT A;  1B48 A;  2M80 A;  4HDE A;  3CBU A;  3KMO A;  2XBQ A;  3UEM A;  2R0P A;  2CVK A;  1SYR A;  6GSW A;  1XWK A;  3LG6 A;  1OC9 B;  3C1R A;  2RUE A;  5HQP A;  5ECN B;  3I43 A;  3F6F A;  1BAY A;  5HR1 A;  1PQN A;  1F2E A;  1T8E B;  2GSS A;  4NWY A;  4RI6 A;  20GS A;  4Q5N A;  2OJL A;  1K3Y A;  1GSF A;  3HHV A;  5IMF A;  2YPM A;  2VM2 A;  4MJE A;  2DJK A;  3A2W A;  1E6B A;  2PUK C;  2WRT A;  2HRF A;  4AJ8 A;  4MP4 A;  2J23 A;  1T4Y A;  4O92 A;  3BD2 A;  5DAK A;  3WT2 A;  5DQY A;  1F9M A;  4X0X A;  2FLS A;  2H1A A;  2O87 A;  4F9Z A;  2Z9S A;  3FZ9 A;  4XRD A;  3ZFL A;  2AV4 A;  3GYK A;  5JWO B;  2F3M A;  3F3Q A;  17GS A;  3A2V A;  5J9C A;  3TOU A;  3VUR A;  4NHW A;  3ED3 A;  2I3Y A;  2P5Q A;  4EE0 A;  1LU4 A;  4EL1 A;  6GST A;  5KN0 A;  4FYB A;  2O8V B;  1QQ2 A;  5HFG A;  3KJY A;  3U5R E;  2H71 A;  2IMD A;  3G7Y A;  1GSQ A;  3EC3 A;  1K0O A;  2YCD A;  4JRR A;  3QD9 A;  1VF2 A;  4ID0 A;  3TRP A;  1YF0 A;  3H4K A;  1GNE A;  4MPG A;  4BPY A;  1HNA A;  1O81 A;  3QAG A;  5C00 A;  11GS A;  4FYU A;  3PGT A;  1NM3 A;  4ICY A;  5KOW A;  1GUM A;  2C0F A;  3GX0 A;  3UVT A;  4TVE A;  3HJP A;  2LKU A;  3IRA A;  1Z9H A;  2WUL A;  5ABR A;  3TKR A;  2A2S A;  3D6I A;  3EU4 A;  3US3 A;  1U3I A;  2L4Q A;  2FUG 2;  3DXB A;  5A5K A;  1O85 A;  2WGR A;  5LCZ A;  5D73 A;  3CSJ A;  3W8S A;  3F4R A;  8GSS A;  5D9T A;  2DBC A;  3GH6 A;  1LJR A;  1XWB A;  3LFL A;  1Z7R A;  4JR4 A;  3LGC A;  2WCI A;  1K3L A;  1JZD A;  4MZW A;  3GHA A;  1SD8 A;  2VD0 A;  4WXT A;  2YV9 A;  2C8U A;  2CVD A;  3IK9 A;  5C04 A;  1ZYQ B;  2X8H A;  3EVI A;  4D73 A;  1TK8 B;  4EKZ A;  1WE0 A;  2O89 A;  5B7C A;  4JR6 A;  2A2P A;  3M8N A;  1UC7 A;  4KSO A;  4TN8 A;  3HVS A;  1YZX A;  1WMJ A;  2VCT A;  5H5Q A;  5F05 A;  2ZNM A;  5COH A;  4LA1 A;  2FWE A;  5IPH A;  2HRK A;  1DBY A;  3ZRD A;  3VFI A;  5KEJ A;  2CX3 A;  3QAV A;  3DVX A;  2LQO A;  3QAW A;  4K6X A;  4IP6 A;  4G19 A;  5DDL A;  3BJ5 A;  1M9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...