2IWTA

Thioredoxin h2 (hvtrxh2) in a mixed disulfide complex with the target protein basi
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
b'EVISVHSLEQWTMQIEEANTAKKLVVIDFTASWCGPSRIMAPVFADLAKKFPNAVFLKVDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTAKVGLHAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN H ISOFORM 2
publication title Structural Basis for Target Protein Recognition by the Protein Disulfide Reductase Thioredoxin.
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Oxidoreductase
total genus 33
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2006-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2iwtA01
5KEJA 2YZHA 2JL4A 1BX9A 6GSTA 3MSZA 2LJKA 5EPFA 1R5PA 1YZXA 1O6JA 4G9HA 2N5FA 3FKFA 3IV4A 3QR6A 1QK8A 1QMVA 1OKDA 1O8XA 1B9XC 2P0GA 3TOTA 1USBA 2DSAA 2LNSA 3MWHA 1Y6EA 3O3TA 3EWLA 1I9DA 1VF2A 5IPHA 2JADA 3E3EA 3F8UA 3DVXA 2IFQB 1TOFA 5AN1A 4FIWA 4XRDA 2HNLA 1A2JA 4YQUA 4HJMA 14GSA 2H72A 4POBA 5DALB 3BCKA 1SK1A 1XIYA 2VLTA 1B9YC 2DMMA 3LYPA 16GSA 4X1UA 2N5BA 1EP7A 4JE1A 1GP1A 3KCMA 1DSBA 1V2AA 3VK9A 4OCEA 4MJAA 3A3TA 1TK0B 4TKYA 3FR6A 2LJRA 3QMXA 2PUKC 3ERFA 1ON4A 1GUKA 2YV7A 4BVXA 4WR4A 1YKAA 4K0GA 4MMMA 1EV9A 2HRNA 1F9MA 3WYWA 2KP1A 4F0CA 2BTOT 4I6XA 4HZ2A 3HJMA 1XVQA 2A4VA 1OC9A 1JZWA 4XHMA 4Q5NA 4KGIA 4GLTA 2WJUA 1TI3A 3EINA 5AGYA 4ZB6A 3NOFA 5DQYA 2L5LA 1WJKA 1QGVA 5ELGA 5KN0A 2B7JA 5DJMA 1K0AA 1ST9A 4L5OA 3UMAA 3HVSA 4N10A 4NWYA 2AV4A 2R3XA 2EC4A 5F06A 5A5KA 1O8WA 3LSZA 1ZZYA 2R5GA 5CP1A 3GKXA 3L9SA 3H93A 1M99A 3QOUA 3I9V2 3Q18A 2YWMA 3OR5A 3QFBC 3VLNA 3FZ4A 2H66A 5ECPB 4ID0A 4PXOA 3E9JB 3IAM2 2FA4A 2L6DA 5CAXA 4XCSA 3TKSE 1SL0B 2FWGA 4HI7A 2B1KA 3F9UA 2KOKA 1B48A 3C71A 3ERGA 4GWRA 1GTUA 1RW1A 4FYCA 2JU5A 4RI7A 3RPNA 4DVCA 2J23A 3PGTA 4PURA 2V2GA 1Y25A 4PNFA 3E0UA 3KIJA 2WZ9A 2R37A 1T00A 2TRXA 3ZYWA 5AISA 2MBTA 5D9VA 2H0GA 2I9HA 5IO0A 4N0ZA 5ID2A 1PSQA 3L4NA 1T4YA 2B7KA 3F4TA 5A4VA 3UVTA 4MA9A 1TTZA 2O85A 1R26A 1WRYA 5DDLA 2VO4A 3H79A 4NHWA 4KSOA 2CVKA 3AY8A 3ZRDA 1V57A 4XIHA 2HXKA 1SJ6A 4KW6A 1H75A 5DCGA 4V2NA 4BWQA 1XOBA 1GULA 1V40A 5H5SA 18GSA 3G7JA 5B7CA 1EOHA 1PX6A 2B1LA 3WGDA 1E6BA 2H30A 2IWTA 1OVNA 2GSSA 4NMUA 4G2EA 2FHEA 4PQ1A 1Z6NA 4QQ7A 4ULXA 1GNWA 1GSDA 5DAKA 5CREA 2KP2A 2XBQA 1EWXA 3TDGA 2DJ3A 1S3CA 4EO3A 3GH6A 1T8EB 4RI6A 3TJFA 2FNOA 2H6ZA 4J2FA 2CQ9A 2YPMA 1MD3A 2J9HA 2ZNMA 3ME7A 2IMKA 3EC3A 4DSRA 1SYRA 4GSSA 1FOVA 3IHQA 4ECCA 5D73A 4MZCA 5ECQB 3TB2A 4TXVA 1R7HA 1TRUA 4KE3A 5CRHA 1OC3A 3P8WA 5IMZA 1YEPA 2GSTA 1AIUA 4KB3A 1VF4A 5IMVA 4WKWA 5HFGA 6GSWA 1WOUA 3HY2A 3I69A 2LRNA 3VURA 5J5NA 1E2YA 3P2AA 1EP8A 3UBLA 2XPDA 4TR1B 1SKSB 2C0FA 3G9BA 4YH2A 1G6YA 2H01A 4MLYA 3PINA 1TRWA 3TCOA 4K7OA 2EIOA 1R4WA 5B6NA 4ECBA 5GAPD 4I2TA 4WEYA 1HD2A 3VPTA 3NIVA 5G31A 4IP6A 5F0GA 2WB9A 1ZMAA 1A2LA 2H1AA 4KUNA 4I8BA 2F8AA 2DJ2A 4YQMA 2REMA 2P5QA 4K0NA 1SKWB 3M9KA 4TXOA 1TDIA 3CTGA 1GSYA 2ES7A 4OCFA 5F8BA 4N30A 2F8FA 2VL9A 1AXDA 2GZZA 2TIRA 3D21A 3TKSC 4XS4A 4ZL8A 1B4QA 4WBJA 2GSQA 4BA7A 4LL4B 1THXA 5AIXA 2C4JA 1NW2A 4TVEA 1EGRA 5G1KA 2PVQA 1PKZA 4ZXGA 2X64A 2B6MA 3LQ7A 2V41A 1J0FA 4DSSA 2LEGA 3MNGA 2BJXA 2IIYA 4PQHA 1TJDA 5IM9A 4GQCA 4F2IA 4MZBA 3LJRA 3KH7A 4MCUA 3KEBA 3TOUA 5IOXA 1ZYQB 2WCIA 1UVZA 3S9FA 1AW9A 2V1MA 2AB6A 2X8CA 4AJ6A 2YN1A 2DBCA 1VGLA 4FO5A 2FWHA 4L8EA 1CQHA 1SJZA 2RLIA 3WGEA 1J9BA 4JU5A 3GKMA 2YCDA 1YY7A 1XXUA 2GQLA 3BOAA 4ILFA 2VIMA 1F2EA 1AAZA 2QSIA 1SD9A 1OE8A 1JLWA 5IMFA 3GKNA 4WF5A 4E8HA 2VAFA 4H86A 3BD2A 3SBCA 4KCEA 4MK3A 2F9SA 1A2MA 2I81A 2GSRA 2PPTA 2IPAA 3HVVA 1ZGNA 3IOSA 1GSFA 4NAXA 5G1LA 4P3YB 1QXHA 3GHAA 4GRFA 1QFNA 1Q4JA 2H73A 3WGXA 1K3LA 3F6DA 2C1YA 4J57E 2PVOC 2YP6A 3H4KA 4IELA 2LJAA 2A2RA 2JZSA 3CBUA 2VLUA 2N5AA 5B6MA 1MDJA 2OBKA 3EU4A 1A0RP 2KHPA 4IBPA 1PN9A 2HT9A 4Q5FA 5G2ZA 3IPZA 3FR9A 2KUCA 2WULA 1X5CA 2BMXA 3GFKA 3KJYA 1T3BA 3EMXA 2VM2A 3CXGA 3J7Yb 2AHEA 2OA7A 3DD3A 1I5GA 2YV9A 1SU9A 1VF3A 4HQSA 1VRSD 2XC2A 3HJPA 1XW6A 5E59A 3D4TA 2H19A 2HYXA 5IPGA 2CX3A 1ZYEA 4GTUA 2LUSA 3HKRA 4ZL9A 1K0OA 4KCAA 2C0DA 1RQMA 2LSTA 2C3QA 5H5QA 4X43A 2HSYA 1SJIA 1YF1A 1F3BA 2XPEA 2NDOA 3EU3A 3KMOA 4L0WA 4LA1A 1UA5A 2L6CA 3KZQA 3P7XA 1SK0A 5CYYA 1T1VA 3N9JA 13GSA 4K2DA 4V2MA 1PA3A 1XWBA 3W8JA 4AJ7A 3HYPA 1KEBA 4MP4A 2C3TA 1WMJA 2OE3A 2RM6A 3ZVJD 2AUVA 3CRUA 1EGOA 2YANA 2CVBA 3I43A 1K0BA 2K9FA 3BCIA 3GTUB 1K0MA 2RM5A 3GV1A 2ZUPA 5HFIA 4XRAA 1Q98A 3FHKA 1ERTA 2O89A 3RBTA 3RHCA 2LQQA 2DIYA 4BPYA 1GUMA 1IYIA 1O73A 3VI7A 3WT2A 2NTOA 3D4MA 2H75A 3O76A 5C04A 3N5OA 4EXJA 5ABRA 3DKSA 1AC1A 4WR5A 4IJ3A 4TR0A 2LNTA 1GLQA 1U3AA 2YWNA 4RQXA 4HEA2 4HU9A 4D73B 4WBRD 2XBIA 2FA8A 2OJLA 3HXSA 2B5XA 2DLXA 2VCWA 4TW5A 3ERWA 3GSSA 1EEMA 1U87A 4HQZA 5EL8A 1NM3A 2VL2A 4IQ1A 4IW9A 5IOWA 1DBYA 2YNXA 2FY6A 5ENUA 1FG4A 2VCTA 3F3RA 3HVXA 4ECJA 2P31A 4IHUA 1B4PA 5LNKe 1FB6A 4I2UA 2NPBA 3L9UA 1OAZA 4WF4A 4K8MA 3R2QA 3IR4A 2CVDA 3K8NA 2IN3A 3ZMKA 2QC7A 2OKAA 4KNDA 1FW1A 2PU9C 3M8NA 1M2DA 4BL7A 4HS1A 2GLRA 3LWAA 4LLRA 1GTAA 1MDKA 3IE3A 4GSNA 3ME8A 2L59A 3M3MA 1HNAA 2MMOA 1M0UA 3F4SA 1O85A 5GAND 1Z6MA 2A2SA 1AUCA 3TJGA 5EVOA 2V32A 3VFIA 5KN2A 4X0XA 2FWEA 1LJRA 1V9WA 4N0VA 3UAPA 4ZBDA 2PMTA 5COHA 1BQ7A 3ISOA 2YOIA 1SENA 1G6WA 2OE1A 1K3OA 3KXOA 1GSQA 1LBKA 5IMDA 3KMNA 3ZMLA 1M9BA 5INYA 3GRXA 2LRTA 2JACA 1GSUA 1TKDB 4KAEA 2WFCA 4HZ4A 2GGTA 4PNGA 3RAZA 3C1SA 6GSXA 4EC0A 1TK8B 1WE0A 3UVHA 3LXTA 1OE7A 1BJXA 3WT1A 1XBSA 3GIXA 2YWOA 1YF0A 4GXZA 4IP1A 3LXZA 1C72A 1GWCA 1GL8A 1H4OA 4KX4A 3QFAC 1R5AA 4OD7A 3HZ4A 3ZFLA 4QL9A 1FB0A 4YQVA 2MYGA 5JCWA 5B8BA 3FYGA 4I97A 5CNWA 1A0FA 3GYKA 2IL3A 2H1DA 4OFNA 19GSA 1WIKA 3NZNA 1Z3EA 1CQGA 3CTFA 5GSTA 4ZBBA 5GSSA 4OO4A 3KM6A 2HZEB 3VWVA 4G19A 4F9ZA 5ECNB 2EIQA 2HLSA 3M9JA 2IMEA 3QDNA 5D8IA 3L0HA 1N2AA 4AF2A 4N11A 1JZOA 2M72A 2GT6A 2QKEA 4FH8A 3VWXA 1EV4A 4L0UA 3GX0A 5LCZA 4XS1A 5CO3A 4DEJA 4EUYA 4AJ8A 3ZFBA 1Z7RA 1A8LA 4MZWA 3FEUA 2PWJA 5ECRB 2CAQA 2KLXA 4K7IA 4TN8A 4TR3A 1K0CA 1F6MC 4KH7A 4OMVA 3HZ8A 3DYRA 3MDKA 5JCUA 1XPVA 1PKWA 1S3DA 1EZKA 4MH2A 2ON5A 1ZOFA 2VCXA 3DIEA 4TR4A 1M2AA 4NV2A 4MDCA 2V6OA 3GSTA 5D9TA 3GKKA 3A5WA 3JCML 2YJHA 4ZBAA 4XS4B 5G5EA 2LTKA 3LYKA 2CAIA 4IGJA 4J56E 1GNEA 1X5DA 5ECSA 2FGXA 3TRPA 1K0DA 4CDOA 5JWOB 4Q5RA 2B5EA 5IIZA 3F6FA 2B3SA 1KBNA 1UN2A 3A2WA 5ECOB 1X9MB 1NHOA 3C1RA 2I1UA 2E2MA 3TJBA 3CSIA 2OADA 1NHYA 2CA8A 2WGRA 5HR2A 4JZQA 2MBSA 3M0FA 2C3NA 5D9WA 5C00A 4BVYA 5HR0A 3CRTA 2M80A 2E0QA 2FWFA 2K18A 2O8VB 4EKZA 1TW9A 5G30A 3ZITA 17GSA 3Q19A 1SL2B 3LG6A 1V98A 2GTUA 1PD21 2OBIA 8GSSA 5L71A 1PL1A 3FZ5A 4JBBA 3UOMA 4IQAA 5J4UA 6GSSA 1HNBA 2OACA 4JR6A 4LMWA 3EVIA 5AIVA 3IRAA 2OE0A 1VF1A 5J9BA 3HA9A 1F37A 22GSA 4NV5A 5EY6A 3VWUA 2AAWA 1O7UA 2HI7A 4ZB8A 5FWGA 1M7TA 1OC8A 4PUAA 1AQVA 5ECKB 4EE0A 2X8HA 1XWAA 1YKCA 4RQRA 1A24A 2MMZA 2H1GA 3VI5A 3L78A 1Z5YE 2L5OA 1SKRB 3PR8A 2M46A 5FHIA 4PGTA 2H71A 1XW5A 5FT3A 1EOGA 3ZL5A 1ERWA 1WPIA 4PUFC 4IJIA 2K8VA 2MZCA 1MTCA 1SYXA 2P5RA 3HD5A 3APQA 2VD1A 4EL1A 3KTLA 4EVMA 5IQYA 5J3RA 2JZTA 1KTEA 5IO2A 2C0EA 2L4QA 3C8EA 4MJEA 3TUEA 3EURA 2DJKA 3VWWA 2H8LA 1XWCA 2O87A 3SWLA 5D9XA 4OWYA 2H70A 1BAYA 4TRXA 2LKUA 1A8YA 6GSUA 3US3A 2H6XA 1U88A 4AGSA 1FVJA 3DGQA 4OFMA 3F4RA 2DJ0A 1DE1A 4PX1A 4PQIA 5F05A 3HCZA 1DE2A 2VCQA 3KH9A 2I4AA 4GCIA 4L5LA 2C8UA 2Z9SA 1FO5A 2IJYA 2V6KA 9GSSA 2VOCA 2VL2C 1W89A 4NHZA 4HUAA 4O5RA 4HJ2A 1BEDA 1ERVA 3F63A 2AJQB 1G0TA 3KP9A 4G10A 4V2LA 2IMFA 3D22A 3LEFA 4NPBA 1FAAA 4ZIJA 1ERUA 2NBSA 3ZIVA 2WS2A 2FD3A 2IFQA 2MMAA 3ZLPA 3UEMA 4LL1B 1U6TA 3IBHA 3IK7A 3PH9A 4EDYA 5DALA 3DVWA 3IDVA 5D93A 1OC9B 1SD8A 4ACSA 1TU7A 1XCCA 5DVBA 3U6VA 1IYHA 3QCPA 1T4ZA 2DMLA 3IK9A 1ACVA 3FZAA 3KD0A 3GTUA 4YAVA 1OYJA 5DQSA 3EE2A 20GSA 4ECIA 3RDWA 5DJLA 2X99A 3DMLA 1YJ6A 3H1NA 2E7PA 1ZL9A 1LU4A 1BG5A 2LRCA 4POMA 2HFDA 3KP8A 1XZOA 3A2XA 3BBYA 3FRCA 2YZUA 3ZZXA 1HNCA 4MABA 4CW9A 4E8EA 2D2ZA 1HQOA 1PQNA 5B8AA 4MJBA 4IVFA 2FLSA 1AQWA 1SK2A 2VLVA 1JZDA 4ML6A 3FK8A 1DUGA 2G0FA 3D5JA 4IKHA 1HYUA 2PERA 4D73A 4EF0A 2GQMA 2FCHA 4KSMA 5J41A 1GSSA 5HFKA 3Q6OA 3TJJA 5KN3A 4K7NA 4OO5A 4MPGA 4WETA 2F3MA 5JWRB 1PMTA 1V58A 3CSJA 2XHFA 4EDZA 3GNJA 1X9WB 3APOA 3ZIJA 5DCHA 1Z9HA 2DJ1A 4RUVA 1B8XA 1BYEA 3GL3A 3HHVA 4FYBA 1GH2A 5ID2B 1X0RA 3CMIA 2K8SA 2AYTA 4K6XA 5DBQA 1RK4A 4BWSA 11GSA 2GQKA 4OFTA 2EIRA 2R6KA 4IN0A 4JEDA 3UL3A 2RIIA 2CZ2A 2H0HA 4GSTA 5ECMB 7GSSA 2WRTA 2RUEA 3GUSA 4HOJA 4QL7A 2K6VA 4GF0A 2WDUA 1XVWA 2GT5A 3MAKA 3FR3A 1GRXA 3TRXA 2H1BA 1XFLA 2YJ7A 4I5QA 2IMDA 1TP9A 1GSEA 2RUFA 5CRGA 4YAPA 5DAKB 3WD6A 1YDKA 3GA4A 3QAVA 1FHEA 3GH9A 1GTBA 1THOA 2B5YA 4O92A 2R4VA 2PN8A 1ILOA 12GSA 4FYUA 4MF6A 2O7KA 3P90A 2JSYA 1TXXA 2R2JA 3C73A 4IS0A 5A4WA 2VM1A 1M2BA 2L4CA 3IAS2 3QAWA 3TKRA 4K1FA 1URMA 1M9AA 1MD4A 2HSHA 4ML1A 3GX8A 1XW9A 1EEJA 2L57A 3O6TA 1WP0A 3CSHA 3KGKA 1FVKA 1GLPA 3Q74A 2CZ3A 3FZ9A 5G5FA 4POKA 5D96A 5IMCA 1O81A 4F03A 2DJJA 3HJOA 4KDYA 1QQ2A 1TRVA 2PBJA 6GSVA 2C0GA 3FW2A 3CYNA 3IA1A 3I6AA 4O7HA 1X5EA 2GZPA 5GZZB 3C7MA 3V1WA 2VUPA 2FUG2 1K3YA 2TRCP 3GMFA 5ECIB 5J9CA 4ZL7A 4NXIA 4F82A 3QD9A 4O32A 2X8GA 2DC5A 1PGTA 1ML6A 3LORA 5HQPA 10GSA 4POLA 4F0BA 4MF5A 4MF7A 3QAGA 3BJ5A 2HZEA 1TK5B 3HDCA 1SL1B 3G7YA 4ZB9A 1G7OA 2CV4A 3ZVJA 3KTBA 3LGCA 2H74A 2JZRA 5JWQB 4TXOB 5ECLB 3VPQA 2CT6A 1ZCPA 2PGTA 3APSA 4K9ZA 2GZYA 2CX4A 2YWIA 3DEXA 4MPFA 4TR1A 3TKQA 2G2QA 2JSZA 2HRFA 3RPPA 2H6YA 1YQ1A 1TU8A 3EYTA 4HU7A 5HR3A 3UBKA 3ZREA 5E4WA 2ZCTA 4MJCA 1N8JA 3GN3A 3W8SA 1MEKA 2LV3A 2VL3A 1ABAA 4DSQA 2DIZA 3F3QA 3A2VA 3GL5A 1TI1A 4CHSA 4DSSB 4HDEA 1OKTA 3EMPA 5ECHB 3IXRA 2GVPA 2GS3A 4JR4A 3W6GA 1JHBA 4XS6A 4JRRA 5LD0A 2HE3A 1XOAA 4Q5QA 3J7Yk 3DXBA 3TRQA 3TGZA 2VCZA 5IMAA 2C80A 3TKPA 5CRWA 2I3YA 1TRSA 4V1Ag 2QGVA 3TJKA 2ALBA 2H76A 3DWVA 4WXTA 2H0IA 4ZILA 5CRDA 2MMNA 1A23A 1K0NA 1KNGA 1NSWA 3D0ZA 3ZTLA 2LS5A 3U5RE 6GSYA 3H8QA 1GTIA 3RHBA 4KA0A 1PX7A 1U3IA 1UC7A 1JZRA 4GQFA 1Z7PA 2IMIA 4TOPA 2VD0A 1PL2A 1S3AA 1T7PB 2E2GA 1XWGA 1QUWA 4V1Ap 1PRXA 3LFLA 1F3AA 5H5RA 4KDXA 3D6IA 2HZFA 1WWJA 3UARA 3IC4A 1YEXA 5F07A 2VCVA 1JFUA 5JCGA 5A4UA 3FY7A 3ED3A 3L9VA 2LQOA 3TKSA 2GDRA 2ON7A 1G7EA 1AQXA 1W4VA 3GURA 4Z7XA 3M1GA 1XWKA 3F0IA 3G7IA 1J08A 2F51A 1X9SB 4LMVA 3UIWA 1GUHA 4ISDA 4KDUA 1JLVA 3UJ1A 3QPMA 5KN1A 5HR1A 4XTSA 2NVLA 5ELAA 4MH3A 1MDIA 3DRNA
chains in the Genus database with same CATH superfamily
5KEJA 2YZHA 2JL4A 1BX9A 6GSTA 3MSZA 2LJKA 5EPFA 1R5PA 1YZXA 2QA2A 1O6JA 4G9HA 2N5FA 3FKFA 3IV4A 3QR6A 1QK8A 1QMVA 1OKDA 4HSCX 1O8XA 1B9XC 2P0GA 3TOTA 1USBA 2DSAA 2LNSA 3MWHA 1Y6EA 3O3TA 3EWLA 1I9DA 1VF2A 5IPHA 2JADA 3E3EA 3F8UA 3DVXA 2IFQB 1TOFA 5AN1A 4FIWA 4XRDA 2HNLA 1A2JA 4YQUA 4HJMA 14GSA 2H72A 4POBA 5DALB 3BCKA 1SK1A 1XIYA 2VLTA 1B9YC 4CY8A 2DMMA 3LYPA 16GSA 4X1UA 2N5BA 1EP7A 4JE1A 1GP1A 3KCMA 1DSBA 1V2AA 3VK9A 4OCEA 4MJAA 3A3TA 1TK0B 4TKYA 3FR6A 2LJRA 3QMXA 2PUKC 3ERFA 1ON4A 1GUKA 2YV7A 4BVXA 4WR4A 1YKAA 4K0GA 4MMMA 1EV9A 2HRNA 1F9MA 3WYWA 2KP1A 4F0CA 2BTOT 4I6XA 4HZ2A 3HJMA 1XVQA 2A4VA 1OC9A 1JZWA 4XHMA 4Q5NA 4KGIA 4GLTA 2WJUA 1TI3A 3EINA 5AGYA 4ZB6A 3NOFA 5DQYA 2L5LA 1WJKA 1QGVA 5ELGA 5KN0A 2B7JA 5DJMA 1K0AA 1ST9A 4L5OA 3UMAA 3HVSA 4N10A 4NWYA 2AV4A 2R3XA 2EC4A 5F06A 5A5KA 1O8WA 2R0PA 3LSZA 1ZZYA 2R5GA 5CP1A 3GKXA 3L9SA 3H93A 1M99A 3QOUA 3I9V2 3Q18A 2YWMA 2HRAA 3OR5A 4Z2UA 3QFBC 3VLNA 3FZ4A 2H66A 5ECPB 4ID0A 4PXOA 3E9JB 3IAM2 2FA4A 2L6DA 5CAXA 4XCSA 4G0KA 3TKSE 1SL0B 2FWGA 4HI7A 2B1KA 2A2PA 3F9UA 2KOKA 1B48A 3C71A 3ERGA 4GWRA 1GTUA 1RW1A 4FYCA 2JU5A 4RI7A 3RPNA 4DVCA 2UZ8A 2J23A 3PGTA 4PURA 2V2GA 1Y25A 4PNFA 3E0UA 3KIJA 2WZ9A 2R37A 1T00A 2TRXA 3ZYWA 5AISA 2MBTA 4A5PA 5D9VA 2H0GA 2I9HA 5IO0A 4N0ZA 5ID2A 1PSQA 3L4NA 1T4YA 2B7KA 3F4TA 5A4VA 3UVTA 4MA9A 1TTZA 2O85A 1R26A 1WRYA 5DDLA 2VO4A 3H79A 4NHWA 4KSOA 2CVKA 3AY8A 3ZRDA 1V57A 4XIHA 2HXKA 1SJ6A 4KW6A 1H75A 5DCGA 4V2NA 4BWQA 1XOBA 1GULA 1V40A 5H5SA 18GSA 3G7JA 5B7CA 1EOHA 1PX6A 2B1LA 3WGDA 1E6BA 2H30A 2IWTA 1OVNA 2GSSA 4NMUA 4G2EA 2FHEA 4PQ1A 1Z6NA 4QQ7A 4ULXA 1GNWA 1GSDA 5DAKA 5CREA 2KP2A 4G0IA 2XBQA 1EWXA 3TDGA 2DJ3A 1S3CA 4EO3A 3GH6A 1T8EB 4RI6A 3TJFA 2FNOA 2H6ZA 4J2FA 2CQ9A 2YPMA 1MD3A 2J9HA 2ZNMA 3ME7A 2IMKA 3EC3A 4DSRA 1SYRA 4GSSA 1FOVA 3IHQA 4ECCA 1PN0A 5D73A 4MZCA 5ECQB 3TB2A 4TXVA 1R7HA 1TRUA 4KE3A 5CRHA 1OC3A 3P8WA 5IMZA 1YEPA 2GSTA 1AIUA 4YKFA 4KB3A 1VF4A 5IMVA 4WKWA 5HFGA 6GSWA 1WOUA 3HY2A 3I69A 2LRNA 3VURA 5J5NA 1E2YA 3P2AA 1EP8A 3UBLA 2XPDA 4TR1B 1SKSB 2C0FA 3G9BA 4YH2A 1G6YA 2H01A 4MLYA 3PINA 1TRWA 3TCOA 4K7OA 2EIOA 1R4WA 5B6NA 4ECBA 5GAPD 2HSMA 4I2TA 4WEYA 1HD2A 2A4HA 3VPTA 3NIVA 5G31A 4IP6A 5F0GA 2WB9A 1ZMAA 3EPTA 1A2LA 2H1AA 4KUNA 4I8BA 2F8AA 2DJ2A 4YQMA 2REMA 2P5QA 4K0NA 1SKWB 3M9KA 4TXOA 1TDIA 3CTGA 1GSYA 2ES7A 4OCFA 5F8BA 4N30A 2F8FA 2VL9A 1AXDA 2GZZA 2TIRA 3D21A 3TKSC 4XS4A 4ZL8A 1B4QA 4WBJA 2GSQA 4BA7A 4LL4B 1THXA 5AIXA 2C4JA 1NW2A 4TVEA 1EGRA 5G1KA 2PVQA 1PKZA 4ZXGA 2X64A 2B6MA 3LQ7A 2V41A 1J0FA 4DSSA 2LEGA 3MNGA 2BJXA 2IIYA 2R0CA 4PQHA 1TJDA 5IM9A 4GQCA 4F2IA 4MZBA 3LJRA 3KH7A 4MCUA 3KEBA 3TOUA 5IOXA 5KOWA 1ZYQB 2WCIA 1UVZA 3S9FA 1AW9A 2V1MA 2AB6A 2X8CA 4AJ6A 2YN1A 2DBCA 1VGLA 4FO5A 2FWHA 4KF9A 4L8EA 1CQHA 1SJZA 2RLIA 3WGEA 1J9BA 4JU5A 4K2XA 3GKMA 2YCDA 1YY7A 1XXUA 2GQLA 3BOAA 4ILFA 2VIMA 1F2EA 1M3JA 1AAZA 2QSIA 1SD9A 1OE8A 1JLWA 5IMFA 3GKNA 4WF5A 4E8HA 2VAFA 4H86A 3BD2A 5BMUA 3SBCA 4KCEA 4MK3A 2F9SA 1A2MA 2I81A 2GSRA 2PPTA 2IPAA 3HVVA 1ZGNA 3IOSA 1GSFA 4NAXA 5G1LA 4P3YB 1QXHA 3GHAA 4GRFA 1QFNA 4EIQA 1Q4JA 2H73A 3WGXA 1K3LA 3F6DA 2C1YA 4J57E 2PVOC 2YP6A 3H4KA 4IELA 2LJAA 2A2RA 2JZSA 3CBUA 2VLUA 2N5AA 5B6MA 1MDJA 2OBKA 3EU4A 1A0RP 2KHPA 2X49A 4IBPA 1PN9A 2HT9A 4Q5FA 5G2ZA 3IPZA 3FR9A 2KUCA 2WULA 1X5CA 2BMXA 3GFKA 3KJYA 1T3BA 5BRTA 3EMXA 2VM2A 3CXGA 3J7Yb 2AHEA 2OA7A 3DD3A 1I5GA 2YV9A 1SU9A 1VF3A 4HQSA 1ZYPA 1VRSD 2XC2A 3HJPA 1XW6A 5E59A 3D4TA 2H19A 2HYXA 5IPGA 2CX3A 1ZYEA 4GTUA 2LUSA 3HKRA 4ZL9A 1K0OA 4KCAA 2C0DA 1RQMA 2LSTA 2C3QA 5H5QA 4X43A 2HSYA 1SJIA 1YF1A 1F3BA 2XPEA 2NDOA 3EU3A 3KMOA 4L0WA 4LA1A 1UA5A 2L6CA 3KZQA 1ZYNA 3P7XA 1SK0A 5CYYA 1T1VA 3N9JA 13GSA 4K2DA 4V2MA 1PA3A 1XWBA 3W8JA 4AJ7A 3HYPA 1KEBA 4MP4A 2C3TA 1WMJA 2OE3A 2RM6A 3ZVJD 3R3EA 2AUVA 3CRUA 1EGOA 2YANA 2CVBA 3I43A 1K0BA 2K9FA 3BCIA 3GTUB 1K0MA 2RM5A 3GV1A 3IHGA 2ZUPA 5HFIA 4XRAA 1Q98A 3FHKA 1ERTA 3PPUA 2O89A 3RBTA 3RHCA 2LQQA 2DIYA 4BPYA 1GUMA 1IYIA 1O73A 3VI7A 3WT2A 2NTOA 3D4MA 2H75A 3O76A 5C04A 3N5OA 4EXJA 5ABRA 3DKSA 1AC1A 4WR5A 4IJ3A 4TR0A 2DKIA 3LW9A 2LNTA 1GLQA 1U3AA 2YWNA 3IC8A 4RQXA 4HEA2 4HU9A 4D73B 4WBRD 2XBIA 2FA8A 2OJLA 3HXSA 2B5XA 2DLXA 2VCWA 4TW5A 3ERWA 3GSSA 1EEMA 1U87A 4HQZA 5EL8A 1NM3A 2VL2A 4IQ1A 4IW9A 5IOWA 1DBYA 2YNXA 2FY6A 5ENUA 1FG4A 2VCTA 3F3RA 3HVXA 4ECJA 2P31A 4IHUA 1B4PA 5LNKe 1FB6A 4I2UA 2NPBA 3L9UA 1OAZA 4WF4A 4K8MA 3R2QA 3IR4A 2CVDA 3K8NA 2IN3A 3ZMKA 2QC7A 2OKAA 4ICYA 4KNDA 1FW1A 2PU9C 3M8NA 1M2DA 4BL7A 4HS1A 2GLRA 3LWAA 4YKGA 4LLRA 1GTAA 1MDKA 3IE3A 4GSNA 3ME8A 2L59A 3M3MA 1HNAA 4K5SA 2MMOA 1M0UA 3F4SA 1O85A 5GAND 1Z6MA 2A2SA 1AUCA 3TJGA 5EVOA 2V32A 3VFIA 5KN2A 4X0XA 2FWEA 1LJRA 1V9WA 4N0VA 3UAPA 4ZBDA 2PMTA 5COHA 1BQ7A 3ISOA 2YOIA 1SENA 1G6WA 2OE1A 1K3OA 3KXOA 1GSQA 1LBKA 5IMDA 3KMNA 3ZMLA 1M9BA 5INYA 3GRXA 2LRTA 2JACA 1GSUA 1TKDB 4KAEA 2WFCA 4HZ4A 2GGTA 4PNGA 4EIPA 3RAZA 3C1SA 6GSXA 4EC0A 1TK8B 1WE0A 3UVHA 3LXTA 1OE7A 1BJXA 3WT1A 1XBSA 2R0GA 3GIXA 2YWOA 1YF0A 4GXZA 4IP1A 3LXZA 1C72A 1GWCA 2QA1A 1GL8A 1H4OA 3A5IA 4KX4A 3QFAC 1R5AA 4OD7A 3HZ4A 3ZFLA 4QL9A 4USSA 1FB0A 4YQVA 2MYGA 5JCWA 5B8BA 3FYGA 4I97A 5CNWA 1A0FA 3GYKA 2IL3A 2H1DA 4OFNA 19GSA 1WIKA 3NZNA 1Z3EA 1CQGA 3CTFA 5GSTA 5KOXA 4ZBBA 5GSSA 4OO4A 3KM6A 2HZEB 3VWVA 4G19A 4F9ZA 5ECNB 2EIQA 2HLSA 3M9JA 2IMEA 3QDNA 5D8IA 3L0HA 1N2AA 4AF2A 4N11A 1JZOA 2M72A 2GT6A 2QKEA 4FH8A 3VWXA 1EV4A 4L0UA 3GX0A 5LCZA 2HRKA 4XS1A 5CO3A 4DEJA 4EUYA 4AJ8A 3ZFBA 1Z7RA 1A8LA 4MZWA 3FEUA 2PWJA 5ECRB 2CAQA 2KLXA 4K7IA 4TN8A 4TR3A 1K0CA 1F6MC 4KH7A 4OMVA 3HZ8A 3DYRA 3MDKA 5JCUA 1XPVA 1PKWA 1S3DA 1EZKA 4MH2A 2ON5A 1ZOFA 2VCXA 3DIEA 4TR4A 1M2AA 4NV2A 4MDCA 2V6OA 3GSTA 5D9TA 3GKKA 3A5WA 3JCML 2YJHA 4ZBAA 4XS4B 5G5EA 2LTKA 3LYKA 2CAIA 4IGJA 4J56E 1GNEA 1X5DA 5ECSA 2FGXA 3TRPA 1K0DA 4CDOA 5JWOB 4Q5RA 2B5EA 5IIZA 3F6FA 2B3SA 1KBNA 1UN2A 3A2WA 5ECOB 1X9MB 1NHOA 3C1RA 2I1UA 2E2MA 3TJBA 3CSIA 1FOHA 2OADA 1NHYA 2CA8A 2WGRA 5HR2A 4JZQA 2MBSA 3M0FA 2C3NA 5D9WA 5C00A 4BVYA 5HR0A 3CRTA 2M80A 2E0QA 2FWFA 2K18A 2O8VB 4EKZA 1TW9A 5G30A 3ZITA 17GSA 3Q19A 1SL2B 3LG6A 1V98A 2GTUA 1PD21 2OBIA 8GSSA 5L71A 1PL1A 3FZ5A 4JBBA 3UOMA 4K5RA 4IQAA 5J4UA 1PFOA 6GSSA 1HNBA 2OACA 4FQUA 4JR6A 4LMWA 3EVIA 5AIVA 3IRAA 2OE0A 1VF1A 5J9BA 3HA9A 1F37A 22GSA 4NV5A 5EY6A 3VWUA 2AAWA 1O7UA 2HI7A 4ZB8A 5FWGA 1M7TA 1OC8A 3FMWA 4PUAA 1AQVA 5ECKB 4EE0A 2X8HA 1XWAA 1YKCA 4RQRA 1A24A 2MMZA 2H1GA 3VI5A 3L78A 1Z5YE 2L5OA 1SKRB 3PR8A 2M46A 5FHIA 4PGTA 2H71A 1XW5A 5FT3A 1EOGA 3ZL5A 1ERWA 1WPIA 4PUFC 4IJIA 4O5QA 2K8VA 2MZCA 1MTCA 1SYXA 2P5RA 3HD5A 3APQA 2VD1A 4EL1A 3KTLA 4EVMA 5IQYA 5J3RA 2JZTA 1KTEA 5IO2A 2C0EA 2L4QA 3C8EA 4MJEA 3TUEA 3EURA 2DJKA 3VWWA 2H8LA 1XWCA 2O87A 3SWLA 5D9XA 4OWYA 2H70A 1BAYA 4TRXA 2LKUA 1A8YA 6GSUA 3US3A 2H6XA 1U88A 4AGSA 1FVJA 3DGQA 4OFMA 3F4RA 2DJ0A 1DE1A 4PX1A 4PQIA 5F05A 3HCZA 1DE2A 2VCQA 3KH9A 2I4AA 4GCIA 4L5LA 2C8UA 2Z9SA 1FO5A 2IJYA 2V6KA 9GSSA 2VOCA 2VL2C 1W89A 4NHZA 4Z2TA 4HUAA 4O5RA 4HJ2A 1BEDA 1ERVA 3F63A 2AJQB 1G0TA 3KP9A 4BVXB 4G10A 4V2LA 2IMFA 3D22A 2X4AA 3LEFA 4NPBA 1FAAA 4ZIJA 1ERUA 2NBSA 3ZIVA 2WS2A 2FD3A 2IFQA 2MMAA 4O5UA 3ZLPA 3UEMA 4LL1B 1U6TA 3IBHA 3IK7A 3PH9A 4EDYA 5DALA 3DVWA 3IDVA 5D93A 1OC9B 1SD8A 4X4JA 4ACSA 1TU7A 1XCCA 5DVBA 3U6VA 1IYHA 3QCPA 1T4ZA 2DMLA 3IK9A 1ACVA 3FZAA 3KD0A 3GTUA 4YAVA 1OYJA 5DQSA 3EE2A 20GSA 4ECIA 3RDWA 5DJLA 2X99A 3DMLA 1YJ6A 3H1NA 2E7PA 3CQFA 1ZL9A 1LU4A 1BG5A 2LRCA 4POMA 2HFDA 3KP8A 1XZOA 3A2XA 3BBYA 3FRCA 2YZUA 3ZZXA 1HNCA 4MABA 4CW9A 4E8EA 2D2ZA 1HQOA 1PQNA 5B8AA 4MJBA 4IVFA 2FLSA 1AQWA 1SK2A 2VLVA 1JZDA 4ML6A 3FK8A 1DUGA 2G0FA 3D5JA 4IKHA 4BL7B 1HYUA 2PERA 4D73A 4EF0A 2GQMA 2FCHA 4KSMA 5J41A 1GSSA 5HFKA 3Q6OA 3TJJA 5KN3A 4K7NA 4OO5A 4MPGA 4PTSA 2F3MA 4WETA 5JWRB 1PMTA 1V58A 3CSJA 2XHFA 4EDZA 3GNJA 1X9WB 3APOA 3ZIJA 5DCHA 1Z9HA 2DJ1A 4RUVA 1B8XA 1BYEA 3GL3A 3HHVA 3HVNA 4FYBA 1GH2A 5ID2B 1X0RA 3CMIA 2K8SA 2AYTA 4K6XA 5DBQA 1RK4A 4BWSA 11GSA 2GQKA 4OFTA 2EIRA 2R6KA 4IN0A 4JEDA 3UL3A 2RIIA 2CZ2A 2H0HA 4GSTA 5ECMB 3MYDA 7GSSA 2WRTA 2RUEA 3GUSA 4HOJA 4QL7A 2K6VA 4GF0A 2WDUA 1XVWA 2GT5A 3MAKA 3FR3A 1GRXA 3TRXA 2H1BA 1XFLA 2YJ7A 1S3RA 4I5QA 2IMDA 1TP9A 1GSEA 2RUFA 5CRGA 4YAPA 5DAKB 3WD6A 1YDKA 3GA4A 3QAVA 1FHEA 3GH9A 1GTBA 1THOA 2B5YA 4O92A 2R4VA 2PN8A 1ILOA 12GSA 4FYUA 4MF6A 2O7KA 4G0LA 3P90A 2JSYA 1TXXA 2R2JA 3C73A 4IS0A 5A4WA 2VM1A 1M2BA 2L4CA 3IAS2 3QAWA 3TKRA 2DKHA 4K1FA 1URMA 1M9AA 1MD4A 2HSHA 4ML1A 3GX8A 1XW9A 1EEJA 2L57A 3O6TA 1WP0A 3CSHA 3KGKA 1FVKA 1GLPA 3Q74A 2CZ3A 3FZ9A 5G5FA 4POKA 5D96A 5IMCA 1O81A 4F03A 2DJJA 3HJOA 4KDYA 1M3IA 1QQ2A 1TRVA 2PBJA 6GSVA 2C0GA 3FW2A 3CYNA 3IA1A 3I6AA 4O7HA 1X5EA 2GZPA 5GZZB 3C7MA 3V1WA 2VUPA 2FUG2 1K3YA 2TRCP 3GMFA 5ECIB 5J9CA 4CY6A 4Z2RA 4ZL7A 4NXIA 4F82A 3QD9A 4O32A 2X8GA 2DC5A 1PGTA 1ML6A 3LORA 5HQPA 10GSA 4POLA 4F0BA 4MF5A 4MF7A 3QAGA 3BJ5A 2HZEA 1TK5B 3HDCA 1SL1B 3G7YA 4BIKA 4ZB9A 1G7OA 2CV4A 3ZVJA 3KTBA 3LGCA 2H74A 2JZRA 5JWQB 4TXOB 5ECLB 3VPQA 2CT6A 1ZCPA 2PGTA 3APSA 4K9ZA 2GZYA 2CX4A 2YWIA 3DEXA 4MPFA 4TR1A 3TKQA 2G2QA 2JSZA 2HRFA 3RPPA 4MNNA 2H6YA 1YQ1A 1TU8A 3EYTA 4HU7A 5HR3A 3UBKA 3ZREA 5E4WA 2ZCTA 4MJCA 1N8JA 3GN3A 3W8SA 1MEKA 2LV3A 2VL3A 1ABAA 4DSQA 2DIZA 3F3QA 3A2VA 3GL5A 1TI1A 4CHSA 4DSSB 4HDEA 1OKTA 3EMPA 4BVYB 5ECHB 3IXRA 2GVPA 2GS3A 4JR4A 3W6GA 1JHBA 4XS6A 4JRRA 5LD0A 2HE3A 1XOAA 4Q5QA 3J7Yk 3DXBA 3TRQA 3TGZA 2VCZA 5IMAA 2C80A 3TKPA 5CRWA 2I3YA 1TRSA 4V1Ag 2QGVA 3TJKA 2ALBA 2H76A 3DWVA 4WXTA 2H0IA 4ZILA 5CRDA 2MMNA 1A23A 1K0NA 1KNGA 1NSWA 3D0ZA 3ZTLA 2LS5A 3U5RE 6GSYA 3H8QA 1GTIA 3RHBA 4KA0A 1PX7A 1U3IA 1UC7A 1JZRA 4GQFA 1Z7PA 2IMIA 4TOPA 2VD0A 1PL2A 1S3AA 1T7PB 2E2GA 1XWGA 1QUWA 4V1Ap 1PRXA 3LFLA 1F3AA 5H5RA 4KDXA 3D6IA 2HZFA 1WWJA 3UARA 3IC4A 1YEXA 5F07A 2VCVA 1JFUA 5JCGA 5A4UA 3FY7A 3ED3A 3L9VA 2LQOA 3TKSA 2GDRA 2ON7A 1G7EA 1AQXA 1W4VA 3GURA 4Z7XA 3M1GA 3MIXA 1XWKA 3F0IA 3G7IA 1J08A 2F51A 1X9SB 1XG8A 4LMVA 1GUHA 3UIWA 4ISDA 4KDUA 1JLVA 3UJ1A 3QPMA 5KN1A 5HR1A 4XTSA 2NVLA 5ELAA 4MH3A 1MDIA 3DRNA
chains in the Genus database with same CATH topology
5KEJA 2YZHA 2JL4A 1BX9A 6GSTA 3MSZA 2LJKA 5EPFA 1R5PA 1YZXA 2QA2A 1O6JA 4G9HA 2N5FA 3FKFA 3IV4A 3QR6A 1QK8A 1QMVA 1OKDA 1O8XA 1B9XC 2P0GA 3TOTA 1USBA 2DSAA 2LNSA 3MWHA 1Y6EA 3O3TA 3EWLA 1I9DA 1VF2A 5IPHA 2JADA 3E3EA 3F8UA 3DVXA 2IFQB 1TOFA 5AN1A 4FIWA 4XRDA 2HNLA 1A2JA 4YQUA 4HJMA 14GSA 2H72A 4POBA 5DALB 3BCKA 1SK1A 1XIYA 2VLTA 1B9YC 4CY8A 2DMMA 3LYPA 16GSA 4X1UA 2N5BA 1EP7A 4JE1A 1GP1A 3KCMA 1DSBA 1V2AA 3VK9A 4OCEA 4MJAA 3A3TA 1TK0B 4TKYA 3FR6A 2LJRA 3QMXA 2PUKC 3ERFA 1ON4A 1GUKA 2YV7A 4BVXA 4WR4A 1YKAA 4K0GA 4MMMA 1EV9A 2HRNA 1F9MA 3WYWA 2KP1A 4F0CA 2BTOT 4I6XA 4HZ2A 3HJMA 1XVQA 2A4VA 1OC9A 1JZWA 4XHMA 4Q5NA 4KGIA 4GLTA 2WJUA 1TI3A 3EINA 5AGYA 4ZB6A 3NOFA 5DQYA 2L5LA 1WJKA 1QGVA 5ELGA 5KN0A 2B7JA 5DJMA 1K0AA 1ST9A 4L5OA 3UMAA 3HVSA 4N10A 4NWYA 2AV4A 2R3XA 2EC4A 5F06A 5A5KA 1O8WA 2R0PA 3LSZA 1ZZYA 2R5GA 5CP1A 3GKXA 3L9SA 3H93A 1M99A 3QOUA 3I9V2 3Q18A 2YWMA 2HRAA 3OR5A 4Z2UA 3QFBC 3VLNA 3FZ4A 2H66A 5ECPB 4ID0A 4PXOA 3E9JB 3IAM2 2FA4A 2L6DA 5CAXA 4XCSA 4G0KA 3TKSE 1SL0B 2FWGA 4HI7A 2B1KA 2A2PA 3F9UA 2KOKA 1B48A 3C71A 3ERGA 4GWRA 1GTUA 1RW1A 4FYCA 2JU5A 4RI7A 3RPNA 4DVCA 2UZ8A 2J23A 3PGTA 4PURA 2V2GA 1Y25A 4PNFA 3E0UA 3KIJA 2WZ9A 2R37A 1T00A 2TRXA 3ZYWA 5AISA 2MBTA 4A5PA 5D9VA 2H0GA 2I9HA 5IO0A 4N0ZA 5ID2A 1PSQA 3L4NA 1T4YA 2B7KA 3F4TA 5A4VA 3UVTA 4MA9A 1TTZA 2O85A 1R26A 1WRYA 5DDLA 2VO4A 3H79A 4NHWA 4KSOA 2CVKA 3AY8A 3ZRDA 1V57A 4XIHA 2HXKA 1SJ6A 4KW6A 1H75A 5DCGA 4V2NA 4BWQA 1XOBA 1GULA 1V40A 5H5SA 18GSA 3G7JA 5B7CA 1EOHA 1PX6A 2B1LA 3WGDA 1E6BA 2H30A 2IWTA 1OVNA 2GSSA 4NMUA 4G2EA 2FHEA 4PQ1A 1Z6NA 4QQ7A 4ULXA 1GNWA 1GSDA 5DAKA 5CREA 2KP2A 4G0IA 2XBQA 1EWXA 3TDGA 2DJ3A 1S3CA 4EO3A 3GH6A 1T8EB 4RI6A 3TJFA 2FNOA 2H6ZA 4J2FA 2CQ9A 2YPMA 1MD3A 2J9HA 2ZNMA 3ME7A 2IMKA 3EC3A 4DSRA 1SYRA 4GSSA 1FOVA 3IHQA 4ECCA 1PN0A 5D73A 4MZCA 5ECQB 3TB2A 4TXVA 1R7HA 1TRUA 4KE3A 5CRHA 1OC3A 3P8WA 5IMZA 1YEPA 2GSTA 1AIUA 4YKFA 4KB3A 1VF4A 5IMVA 4WKWA 5HFGA 6GSWA 1WOUA 3HY2A 3I69A 2LRNA 3VURA 5J5NA 1E2YA 3P2AA 1EP8A 3UBLA 2XPDA 4TR1B 1SKSB 2C0FA 3G9BA 4YH2A 1G6YA 2H01A 4MLYA 3PINA 1TRWA 3TCOA 4K7OA 2EIOA 1R4WA 5B6NA 4ECBA 5GAPD 2HSMA 4I2TA 4WEYA 1HD2A 2A4HA 3VPTA 3NIVA 5G31A 4IP6A 5F0GA 2WB9A 1ZMAA 3EPTA 1A2LA 2H1AA 4KUNA 4I8BA 2F8AA 2DJ2A 4YQMA 2REMA 2P5QA 4K0NA 1SKWB 3M9KA 4TXOA 1TDIA 3CTGA 1GSYA 2ES7A 4OCFA 5F8BA 4N30A 2F8FA 2VL9A 1AXDA 2GZZA 2TIRA 3D21A 3TKSC 4XS4A 4ZL8A 1B4QA 4WBJA 2GSQA 4BA7A 4LL4B 1THXA 5AIXA 2C4JA 1NW2A 4TVEA 1EGRA 5G1KA 2PVQA 1PKZA 4ZXGA 2X64A 2B6MA 3LQ7A 2V41A 1J0FA 4DSSA 2LEGA 3MNGA 2BJXA 2IIYA 2R0CA 4PQHA 1TJDA 5IM9A 4GQCA 4F2IA 4MZBA 3LJRA 3KH7A 4MCUA 3KEBA 3TOUA 5IOXA 5KOWA 1ZYQB 2WCIA 1UVZA 3S9FA 1AW9A 2V1MA 2AB6A 2X8CA 4AJ6A 2YN1A 2DBCA 1VGLA 4FO5A 2FWHA 4KF9A 4L8EA 1CQHA 1SJZA 2RLIA 3WGEA 1J9BA 4JU5A 4K2XA 3GKMA 2YCDA 1YY7A 1XXUA 2GQLA 3BOAA 4ILFA 2VIMA 1F2EA 1AAZA 2QSIA 1SD9A 1OE8A 1JLWA 5IMFA 3GKNA 4WF5A 4E8HA 2VAFA 4H86A 3BD2A 5BMUA 3SBCA 4KCEA 4MK3A 2F9SA 1A2MA 2I81A 2GSRA 2PPTA 2IPAA 3HVVA 1ZGNA 3IOSA 1GSFA 4NAXA 5G1LA 4P3YB 1QXHA 3GHAA 4GRFA 1QFNA 4EIQA 1Q4JA 2H73A 3WGXA 1K3LA 3F6DA 2C1YA 4J57E 2PVOC 2YP6A 3H4KA 4IELA 2LJAA 2A2RA 2JZSA 3CBUA 2VLUA 2N5AA 5B6MA 1MDJA 2OBKA 3EU4A 1A0RP 2KHPA 2X49A 4IBPA 1PN9A 2HT9A 4Q5FA 5G2ZA 3IPZA 3FR9A 2KUCA 2WULA 1X5CA 2BMXA 3GFKA 3KJYA 1T3BA 5BRTA 3EMXA 2VM2A 3CXGA 3J7Yb 2AHEA 2OA7A 3DD3A 1I5GA 2YV9A 1SU9A 1VF3A 4HQSA 1ZYPA 1VRSD 2XC2A 3HJPA 1XW6A 5E59A 3D4TA 2H19A 2HYXA 5IPGA 2CX3A 1ZYEA 4GTUA 2LUSA 3HKRA 4ZL9A 1K0OA 4KCAA 2C0DA 1RQMA 2LSTA 2C3QA 5H5QA 4X43A 2HSYA 1SJIA 1YF1A 1F3BA 2XPEA 2NDOA 3EU3A 3KMOA 4L0WA 4LA1A 1UA5A 2L6CA 3KZQA 1ZYNA 3P7XA 1SK0A 5CYYA 1T1VA 3N9JA 13GSA 4K2DA 4V2MA 1PA3A 1XWBA 3W8JA 4AJ7A 3HYPA 1KEBA 4MP4A 2C3TA 1WMJA 2OE3A 2RM6A 3ZVJD 3R3EA 2AUVA 3CRUA 1EGOA 2YANA 2CVBA 3I43A 1K0BA 2K9FA 3BCIA 3GTUB 1K0MA 2RM5A 3GV1A 3IHGA 2ZUPA 5HFIA 4XRAA 1Q98A 3FHKA 1ERTA 3PPUA 2O89A 3RBTA 3RHCA 2LQQA 2DIYA 4BPYA 1GUMA 1IYIA 1O73A 3VI7A 3WT2A 2NTOA 3D4MA 2H75A 3O76A 5C04A 3N5OA 4EXJA 5ABRA 3DKSA 1AC1A 4WR5A 4IJ3A 4TR0A 2DKIA 3LW9A 2LNTA 1GLQA 1U3AA 2YWNA 3IC8A 4RQXA 4HEA2 4HU9A 4D73B 4WBRD 2XBIA 2FA8A 2OJLA 3HXSA 2B5XA 2DLXA 2VCWA 4TW5A 3ERWA 3GSSA 1EEMA 1U87A 4HQZA 5EL8A 1NM3A 2VL2A 4IQ1A 4IW9A 5IOWA 1DBYA 2YNXA 2FY6A 5ENUA 1FG4A 2VCTA 3F3RA 3HVXA 4ECJA 2P31A 4IHUA 1B4PA 5LNKe 1FB6A 4I2UA 2NPBA 3L9UA 1OAZA 4WF4A 4K8MA 3R2QA 3IR4A 2CVDA 3K8NA 2IN3A 3ZMKA 2QC7A 2OKAA 4ICYA 4KNDA 1FW1A 2PU9C 3M8NA 1M2DA 4BL7A 4HS1A 2GLRA 3LWAA 4YKGA 4LLRA 1GTAA 1MDKA 3IE3A 4GSNA 3ME8A 2L59A 3M3MA 1HNAA 4K5SA 2MMOA 1M0UA 3F4SA 1O85A 5GAND 1Z6MA 2A2SA 1AUCA 3TJGA 5EVOA 2V32A 3VFIA 5KN2A 4X0XA 2FWEA 1LJRA 1V9WA 4N0VA 3UAPA 4ZBDA 2PMTA 5COHA 1BQ7A 3ISOA 2YOIA 1SENA 1G6WA 2OE1A 1K3OA 3KXOA 1GSQA 1LBKA 5IMDA 3KMNA 3ZMLA 1M9BA 5INYA 3GRXA 2LRTA 2JACA 1GSUA 1TKDB 4KAEA 2WFCA 4HZ4A 2GGTA 4PNGA 4EIPA 3RAZA 3C1SA 6GSXA 4EC0A 1TK8B 1WE0A 3UVHA 3LXTA 1OE7A 1BJXA 3WT1A 1XBSA 2R0GA 3GIXA 2YWOA 1YF0A 4GXZA 4IP1A 3LXZA 1C72A 1GWCA 2QA1A 1GL8A 1H4OA 3A5IA 4KX4A 3QFAC 1R5AA 4OD7A 3HZ4A 3ZFLA 4QL9A 4USSA 1FB0A 4YQVA 2MYGA 5JCWA 5B8BA 3FYGA 4I97A 5CNWA 1A0FA 3GYKA 2IL3A 2H1DA 4OFNA 19GSA 1WIKA 3NZNA 1Z3EA 1CQGA 3CTFA 5GSTA 5KOXA 4ZBBA 5GSSA 4OO4A 3KM6A 2HZEB 3VWVA 4G19A 4F9ZA 5ECNB 2EIQA 2HLSA 3M9JA 2IMEA 3QDNA 5D8IA 3L0HA 1N2AA 4AF2A 4N11A 1JZOA 2M72A 2GT6A 2QKEA 4FH8A 3VWXA 1EV4A 4L0UA 3GX0A 5LCZA 2HRKA 4XS1A 5CO3A 4DEJA 4EUYA 4AJ8A 3ZFBA 1Z7RA 1A8LA 4MZWA 3FEUA 2PWJA 5ECRB 2CAQA 2KLXA 4K7IA 4TN8A 4TR3A 1K0CA 1F6MC 4KH7A 4OMVA 3HZ8A 3DYRA 3MDKA 5JCUA 1XPVA 1PKWA 1S3DA 1EZKA 4MH2A 2ON5A 1ZOFA 2VCXA 3DIEA 4TR4A 1M2AA 4NV2A 4MDCA 2V6OA 3GSTA 5D9TA 3GKKA 3A5WA 3JCML 2YJHA 4ZBAA 4XS4B 5G5EA 2LTKA 3LYKA 2CAIA 4IGJA 4J56E 1GNEA 1X5DA 5ECSA 2FGXA 3TRPA 1K0DA 4CDOA 5JWOB 4Q5RA 2B5EA 5IIZA 3F6FA 2B3SA 1KBNA 1UN2A 3A2WA 5ECOB 1X9MB 1NHOA 3C1RA 2I1UA 2E2MA 3TJBA 3CSIA 1FOHA 2OADA 1NHYA 2CA8A 2WGRA 5HR2A 4JZQA 2MBSA 3M0FA 2C3NA 5D9WA 5C00A 4BVYA 5HR0A 3CRTA 2M80A 2E0QA 2FWFA 2K18A 2O8VB 4EKZA 1TW9A 5G30A 3ZITA 17GSA 3Q19A 1SL2B 3LG6A 1V98A 2GTUA 1PD21 2OBIA 8GSSA 5L71A 1PL1A 3FZ5A 4JBBA 3UOMA 4K5RA 4IQAA 5J4UA 6GSSA 1HNBA 2OACA 4FQUA 4JR6A 4LMWA 3EVIA 5AIVA 3IRAA 2OE0A 1VF1A 5J9BA 3HA9A 1F37A 22GSA 4NV5A 5EY6A 3VWUA 2AAWA 1O7UA 2HI7A 4ZB8A 5FWGA 1M7TA 1OC8A 3FMWA 4PUAA 1AQVA 5ECKB 4EE0A 2X8HA 1XWAA 1YKCA 4RQRA 1A24A 2MMZA 2H1GA 3VI5A 3L78A 1Z5YE 2L5OA 1SKRB 3PR8A 2M46A 5FHIA 4PGTA 2H71A 1XW5A 5FT3A 1EOGA 3ZL5A 1ERWA 1WPIA 4PUFC 4IJIA 4O5QA 2K8VA 2MZCA 1MTCA 1SYXA 2P5RA 3HD5A 3APQA 2VD1A 4EL1A 3KTLA 4EVMA 5IQYA 5J3RA 2JZTA 1KTEA 5IO2A 2C0EA 2L4QA 3C8EA 4MJEA 3TUEA 3EURA 2DJKA 3VWWA 2H8LA 1XWCA 2O87A 3SWLA 5D9XA 4OWYA 2H70A 1BAYA 4TRXA 2LKUA 1A8YA 6GSUA 3US3A 2H6XA 1U88A 4AGSA 1FVJA 3DGQA 4OFMA 3F4RA 2DJ0A 1DE1A 4PX1A 4PQIA 5F05A 3HCZA 1DE2A 2VCQA 3KH9A 2I4AA 4GCIA 4L5LA 2C8UA 2Z9SA 1FO5A 2IJYA 2V6KA 9GSSA 2VOCA 2VL2C 1W89A 4NHZA 4Z2TA 4HUAA 4O5RA 4HJ2A 1BEDA 1ERVA 3F63A 2AJQB 1G0TA 3KP9A 4BVXB 4G10A 4V2LA 2IMFA 3D22A 2X4AA 3LEFA 4NPBA 1FAAA 4ZIJA 1ERUA 2NBSA 3ZIVA 2WS2A 2FD3A 2IFQA 2MMAA 4O5UA 3ZLPA 3UEMA 4LL1B 1U6TA 3IBHA 3IK7A 3PH9A 4EDYA 5DALA 3DVWA 3IDVA 5D93A 1OC9B 1SD8A 4X4JA 4ACSA 1TU7A 1XCCA 5DVBA 3U6VA 1IYHA 3QCPA 1T4ZA 2DMLA 3IK9A 1ACVA 3FZAA 3KD0A 3GTUA 4YAVA 1OYJA 5DQSA 3EE2A 20GSA 4ECIA 3RDWA 5DJLA 2X99A 3DMLA 1YJ6A 3H1NA 2E7PA 1ZL9A 1LU4A 1BG5A 2LRCA 4POMA 2HFDA 3KP8A 1XZOA 3A2XA 3BBYA 3FRCA 2YZUA 3ZZXA 1HNCA 4MABA 4CW9A 4E8EA 2D2ZA 1HQOA 1PQNA 5B8AA 4MJBA 4IVFA 2FLSA 1AQWA 1SK2A 2VLVA 1JZDA 4ML6A 3FK8A 1DUGA 2G0FA 3D5JA 4IKHA 4BL7B 1HYUA 2PERA 4D73A 4EF0A 2GQMA 2FCHA 4KSMA 5J41A 1GSSA 5HFKA 3Q6OA 3TJJA 5KN3A 4K7NA 4OO5A 4MPGA 4PTSA 2F3MA 4WETA 5JWRB 1PMTA 1V58A 3CSJA 2XHFA 4EDZA 3GNJA 1X9WB 3APOA 3ZIJA 5DCHA 1Z9HA 2DJ1A 4RUVA 1B8XA 1BYEA 3GL3A 3HHVA 4FYBA 1GH2A 5ID2B 1X0RA 3CMIA 2K8SA 2AYTA 4K6XA 5DBQA 1RK4A 4BWSA 11GSA 2GQKA 4OFTA 2EIRA 2R6KA 4IN0A 4JEDA 3UL3A 2RIIA 2CZ2A 2H0HA 4GSTA 5ECMB 3MYDA 7GSSA 2WRTA 2RUEA 3GUSA 4HOJA 4QL7A 2K6VA 4GF0A 2WDUA 1XVWA 2GT5A 3MAKA 3FR3A 1GRXA 3TRXA 2H1BA 1XFLA 2YJ7A 4I5QA 2IMDA 1TP9A 1GSEA 2RUFA 5CRGA 4YAPA 5DAKB 3WD6A 1YDKA 3GA4A 3QAVA 1FHEA 3GH9A 1GTBA 1THOA 2B5YA 4O92A 2R4VA 2PN8A 1ILOA 12GSA 4FYUA 4MF6A 2O7KA 4G0LA 3P90A 2JSYA 1TXXA 2R2JA 3C73A 4IS0A 5A4WA 2VM1A 1M2BA 2L4CA 3IAS2 3QAWA 3TKRA 2DKHA 4K1FA 1URMA 1M9AA 1MD4A 2HSHA 4ML1A 3GX8A 1XW9A 1EEJA 2L57A 3O6TA 1WP0A 3CSHA 3KGKA 1FVKA 1GLPA 3Q74A 2CZ3A 3FZ9A 5G5FA 4POKA 5D96A 5IMCA 1O81A 4F03A 2DJJA 3HJOA 4KDYA 1QQ2A 1TRVA 2PBJA 6GSVA 2C0GA 3FW2A 3CYNA 3IA1A 3I6AA 4O7HA 1X5EA 2GZPA 5GZZB 3C7MA 3V1WA 2VUPA 2FUG2 1K3YA 2TRCP 3GMFA 5ECIB 5J9CA 4CY6A 4Z2RA 4ZL7A 4NXIA 4F82A 3QD9A 4O32A 2X8GA 2DC5A 1PGTA 1ML6A 3LORA 5HQPA 10GSA 4POLA 4F0BA 4MF5A 4MF7A 3QAGA 3BJ5A 2HZEA 1TK5B 3HDCA 1SL1B 3G7YA 4ZB9A 1G7OA 2CV4A 3ZVJA 3KTBA 3LGCA 2H74A 2JZRA 5JWQB 4TXOB 5ECLB 3VPQA 2CT6A 1ZCPA 2PGTA 3APSA 4K9ZA 2GZYA 2CX4A 2YWIA 3DEXA 4MPFA 4TR1A 3TKQA 2G2QA 2JSZA 2HRFA 3RPPA 4MNNA 2H6YA 1YQ1A 1TU8A 3EYTA 4HU7A 5HR3A 3UBKA 3ZREA 5E4WA 2ZCTA 4MJCA 1N8JA 3GN3A 3W8SA 1MEKA 2LV3A 2VL3A 1ABAA 4DSQA 2DIZA 3F3QA 3A2VA 3GL5A 1TI1A 4CHSA 4DSSB 4HDEA 1OKTA 3EMPA 4BVYB 5ECHB 3IXRA 2GVPA 2GS3A 4JR4A 3W6GA 1JHBA 4XS6A 4JRRA 5LD0A 2HE3A 1XOAA 4Q5QA 3J7Yk 3DXBA 3TRQA 3TGZA 2VCZA 5IMAA 2C80A 3TKPA 5CRWA 2I3YA 1TRSA 4V1Ag 2QGVA 3TJKA 2ALBA 2H76A 3DWVA 4WXTA 2H0IA 4ZILA 5CRDA 2MMNA 1A23A 1K0NA 1KNGA 1NSWA 3D0ZA 3ZTLA 2LS5A 3U5RE 6GSYA 3H8QA 1GTIA 3RHBA 4KA0A 1PX7A 1U3IA 1UC7A 1JZRA 4GQFA 1Z7PA 2IMIA 4TOPA 2VD0A 1PL2A 1S3AA 1T7PB 2E2GA 1XWGA 1QUWA 4V1Ap 1PRXA 3LFLA 1F3AA 5H5RA 4KDXA 3D6IA 2HZFA 1WWJA 3UARA 3IC4A 1YEXA 5F07A 2VCVA 1JFUA 5JCGA 5A4UA 3FY7A 3ED3A 3L9VA 2LQOA 3TKSA 2GDRA 2ON7A 1G7EA 1AQXA 1W4VA 3GURA 4Z7XA 3M1GA 3MIXA 1XWKA 3F0IA 3G7IA 1J08A 2F51A 1X9SB 4LMVA 3UIWA 1GUHA 4ISDA 4KDUA 1JLVA 3UJ1A 3QPMA 5KN1A 5HR1A 4XTSA 2NVLA 5ELAA 4MH3A 1MDIA 3DRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KEJ A;  2YZH A;  2JL4 A;  1BX9 A;  6GST A;  3MSZ A;  2LJK A;  5EPF A;  1R5P A;  1YZX A;  1O6J A;  4G9H A;  2N5F A;  3FKF A;  3IV4 A;  3QR6 A;  1QK8 A;  1QMV A;  1OKD A;  1O8X A;  1B9X C;  2P0G A;  3TOT A;  1USB A;  2DSA A;  2LNS A;  3MWH A;  1Y6E A;  3O3T A;  3EWL A;  1I9D A;  1VF2 A;  5IPH A;  2JAD A;  3E3E A;  3F8U A;  3DVX A;  2IFQ B;  1TOF A;  5AN1 A;  4FIW A;  4XRD A;  2HNL A;  1A2J A;  4YQU A;  4HJM A;  14GS A;  2H72 A;  4POB A;  5DAL B;  3BCK A;  1SK1 A;  1XIY A;  2VLT A;  1B9Y C;  2DMM A;  3LYP A;  16GS A;  4X1U A;  2N5B A;  1EP7 A;  4JE1 A;  1GP1 A;  3KCM A;  1DSB A;  1V2A A;  3VK9 A;  4OCE A;  4MJA A;  3A3T A;  1TK0 B;  4TKY A;  3FR6 A;  2LJR A;  3QMX A;  2PUK C;  3ERF A;  1ON4 A;  1GUK A;  2YV7 A;  4BVX A;  4WR4 A;  1YKA A;  4K0G A;  4MMM A;  1EV9 A;  2HRN A;  1F9M A;  3WYW A;  2KP1 A;  4F0C A;  2BTO T;  4I6X A;  4HZ2 A;  3HJM A;  1XVQ A;  2A4V A;  1OC9 A;  1JZW A;  4XHM A;  4Q5N A;  4KGI A;  4GLT A;  2WJU A;  1TI3 A;  3EIN A;  5AGY A;  4ZB6 A;  3NOF A;  5DQY A;  2L5L A;  1WJK A;  1QGV A;  5ELG A;  5KN0 A;  2B7J A;  5DJM A;  1K0A A;  1ST9 A;  4L5O A;  3UMA A;  3HVS A;  4N10 A;  4NWY A;  2AV4 A;  2R3X A;  2EC4 A;  5F06 A;  5A5K A;  1O8W A;  3LSZ A;  1ZZY A;  2R5G A;  5CP1 A;  3GKX A;  3L9S A;  3H93 A;  1M99 A;  3QOU A;  3I9V 2;  3Q18 A;  2YWM A;  3OR5 A;  3QFB C;  3VLN A;  3FZ4 A;  2H66 A;  5ECP B;  4ID0 A;  4PXO A;  3E9J B;  3IAM 2;  2FA4 A;  2L6D A;  5CAX A;  4XCS A;  3TKS E;  1SL0 B;  2FWG A;  4HI7 A;  2B1K A;  3F9U A;  2KOK A;  1B48 A;  3C71 A;  3ERG A;  4GWR A;  1GTU A;  1RW1 A;  4FYC A;  2JU5 A;  4RI7 A;  3RPN A;  4DVC A;  2J23 A;  3PGT A;  4PUR A;  2V2G A;  1Y25 A;  4PNF A;  3E0U A;  3KIJ A;  2WZ9 A;  2R37 A;  1T00 A;  2TRX A;  3ZYW A;  5AIS A;  2MBT A;  5D9V A;  2H0G A;  2I9H A;  5IO0 A;  4N0Z A;  5ID2 A;  1PSQ A;  3L4N A;  1T4Y A;  2B7K A;  3F4T A;  5A4V A;  3UVT A;  4MA9 A;  1TTZ A;  2O85 A;  1R26 A;  1WRY A;  5DDL A;  2VO4 A;  3H79 A;  4NHW A;  4KSO A;  2CVK A;  3AY8 A;  3ZRD A;  1V57 A;  4XIH A;  2HXK A;  1SJ6 A;  4KW6 A;  1H75 A;  5DCG A;  4V2N A;  4BWQ A;  1XOB A;  1GUL A;  1V40 A;  5H5S A;  18GS A;  3G7J A;  5B7C A;  1EOH A;  1PX6 A;  2B1L A;  3WGD A;  1E6B A;  2H30 A;  2IWT A;  1OVN A;  2GSS A;  4NMU A;  4G2E A;  2FHE A;  4PQ1 A;  1Z6N A;  4QQ7 A;  4ULX A;  1GNW A;  1GSD A;  5DAK A;  5CRE A;  2KP2 A;  2XBQ A;  1EWX A;  3TDG A;  2DJ3 A;  1S3C A;  4EO3 A;  3GH6 A;  1T8E B;  4RI6 A;  3TJF A;  2FNO A;  2H6Z A;  4J2F A;  2CQ9 A;  2YPM A;  1MD3 A;  2J9H A;  2ZNM A;  3ME7 A;  2IMK A;  3EC3 A;  4DSR A;  1SYR A;  4GSS A;  1FOV A;  3IHQ A;  4ECC A;  5D73 A;  4MZC A;  5ECQ B;  3TB2 A;  4TXV A;  1R7H A;  1TRU A;  4KE3 A;  5CRH A;  1OC3 A;  3P8W A;  5IMZ A;  1YEP A;  2GST A;  1AIU A;  4KB3 A;  1VF4 A;  5IMV A;  4WKW A;  5HFG A;  6GSW A;  1WOU A;  3HY2 A;  3I69 A;  2LRN A;  3VUR A;  5J5N A;  1E2Y A;  3P2A A;  1EP8 A;  3UBL A;  2XPD A;  4TR1 B;  1SKS B;  2C0F A;  3G9B A;  4YH2 A;  1G6Y A;  2H01 A;  4MLY A;  3PIN A;  1TRW A;  3TCO A;  4K7O A;  2EIO A;  1R4W A;  5B6N A;  4ECB A;  5GAP D;  4I2T A;  4WEY A;  1HD2 A;  3VPT A;  3NIV A;  5G31 A;  4IP6 A;  5F0G A;  2WB9 A;  1ZMA A;  1A2L A;  2H1A A;  4KUN A;  4I8B A;  2F8A A;  2DJ2 A;  4YQM A;  2REM A;  2P5Q A;  4K0N A;  1SKW B;  3M9K A;  4TXO A;  1TDI A;  3CTG A;  1GSY A;  2ES7 A;  4OCF A;  5F8B A;  4N30 A;  2F8F A;  2VL9 A;  1AXD A;  2GZZ A;  2TIR A;  3D21 A;  3TKS C;  4XS4 A;  4ZL8 A;  1B4Q A;  4WBJ A;  2GSQ A;  4BA7 A;  4LL4 B;  1THX A;  5AIX A;  2C4J A;  1NW2 A;  4TVE A;  1EGR A;  5G1K A;  2PVQ A;  1PKZ A;  4ZXG A;  2X64 A;  2B6M A;  3LQ7 A;  2V41 A;  1J0F A;  4DSS A;  2LEG A;  3MNG A;  2BJX A;  2IIY A;  4PQH A;  1TJD A;  5IM9 A;  4GQC A;  4F2I A;  4MZB A;  3LJR A;  3KH7 A;  4MCU A;  3KEB A;  3TOU A;  5IOX A;  1ZYQ B;  2WCI A;  1UVZ A;  3S9F A;  1AW9 A;  2V1M A;  2AB6 A;  2X8C A;  4AJ6 A;  2YN1 A;  2DBC A;  1VGL A;  4FO5 A;  2FWH A;  4L8E A;  1CQH A;  1SJZ A;  2RLI A;  3WGE A;  1J9B A;  4JU5 A;  3GKM A;  2YCD A;  1YY7 A;  1XXU A;  2GQL A;  3BOA A;  4ILF A;  2VIM A;  1F2E A;  1AAZ A;  2QSI A;  1SD9 A;  1OE8 A;  1JLW A;  5IMF A;  3GKN A;  4WF5 A;  4E8H A;  2VAF A;  4H86 A;  3BD2 A;  3SBC A;  4KCE A;  4MK3 A;  2F9S A;  1A2M A;  2I81 A;  2GSR A;  2PPT A;  2IPA A;  3HVV A;  1ZGN A;  3IOS A;  1GSF A;  4NAX A;  5G1L A;  4P3Y B;  1QXH A;  3GHA A;  4GRF A;  1QFN A;  1Q4J A;  2H73 A;  3WGX A;  1K3L A;  3F6D A;  2C1Y A;  4J57 E;  2PVO C;  2YP6 A;  3H4K A;  4IEL A;  2LJA A;  2A2R A;  2JZS A;  3CBU A;  2VLU A;  2N5A A;  5B6M A;  1MDJ A;  2OBK A;  3EU4 A;  1A0R P;  2KHP A;  4IBP A;  1PN9 A;  2HT9 A;  4Q5F A;  5G2Z A;  3IPZ A;  3FR9 A;  2KUC A;  2WUL A;  1X5C A;  2BMX A;  3GFK A;  3KJY A;  1T3B A;  3EMX A;  2VM2 A;  3CXG A;  3J7Y b;  2AHE A;  2OA7 A;  3DD3 A;  1I5G A;  2YV9 A;  1SU9 A;  1VF3 A;  4HQS A;  1VRS D;  2XC2 A;  3HJP A;  1XW6 A;  5E59 A;  3D4T A;  2H19 A;  2HYX A;  5IPG A;  2CX3 A;  1ZYE A;  4GTU A;  2LUS A;  3HKR A;  4ZL9 A;  1K0O A;  4KCA A;  2C0D A;  1RQM A;  2LST A;  2C3Q A;  5H5Q A;  4X43 A;  2HSY A;  1SJI A;  1YF1 A;  1F3B A;  2XPE A;  2NDO A;  3EU3 A;  3KMO A;  4L0W A;  4LA1 A;  1UA5 A;  2L6C A;  3KZQ A;  3P7X A;  1SK0 A;  5CYY A;  1T1V A;  3N9J A;  13GS A;  4K2D A;  4V2M A;  1PA3 A;  1XWB A;  3W8J A;  4AJ7 A;  3HYP A;  1KEB A;  4MP4 A;  2C3T A;  1WMJ A;  2OE3 A;  2RM6 A;  3ZVJ D;  2AUV A;  3CRU A;  1EGO A;  2YAN A;  2CVB A;  3I43 A;  1K0B A;  2K9F A;  3BCI A;  3GTU B;  1K0M A;  2RM5 A;  3GV1 A;  2ZUP A;  5HFI A;  4XRA A;  1Q98 A;  3FHK A;  1ERT A;  2O89 A;  3RBT A;  3RHC A;  2LQQ A;  2DIY A;  4BPY A;  1GUM A;  1IYI A;  1O73 A;  3VI7 A;  3WT2 A;  2NTO A;  3D4M A;  2H75 A;  3O76 A;  5C04 A;  3N5O A;  4EXJ A;  5ABR A;  3DKS A;  1AC1 A;  4WR5 A;  4IJ3 A;  4TR0 A;  2LNT A;  1GLQ A;  1U3A A;  2YWN A;  4RQX A;  4HEA 2;  4HU9 A;  4D73 B;  4WBR D;  2XBI A;  2FA8 A;  2OJL A;  3HXS A;  2B5X A;  2DLX A;  2VCW A;  4TW5 A;  3ERW A;  3GSS A;  1EEM A;  1U87 A;  4HQZ A;  5EL8 A;  1NM3 A;  2VL2 A;  4IQ1 A;  4IW9 A;  5IOW A;  1DBY A;  2YNX A;  2FY6 A;  5ENU A;  1FG4 A;  2VCT A;  3F3R A;  3HVX A;  4ECJ A;  2P31 A;  4IHU A;  1B4P A;  5LNK e;  1FB6 A;  4I2U A;  2NPB A;  3L9U A;  1OAZ A;  4WF4 A;  4K8M A;  3R2Q A;  3IR4 A;  2CVD A;  3K8N A;  2IN3 A;  3ZMK A;  2QC7 A;  2OKA A;  4KND A;  1FW1 A;  2PU9 C;  3M8N A;  1M2D A;  4BL7 A;  4HS1 A;  2GLR A;  3LWA A;  4LLR A;  1GTA A;  1MDK A;  3IE3 A;  4GSN A;  3ME8 A;  2L59 A;  3M3M A;  1HNA A;  2MMO A;  1M0U A;  3F4S A;  1O85 A;  5GAN D;  1Z6M A;  2A2S A;  1AUC A;  3TJG A;  5EVO A;  2V32 A;  3VFI A;  5KN2 A;  4X0X A;  2FWE A;  1LJR A;  1V9W A;  4N0V A;  3UAP A;  4ZBD A;  2PMT A;  5COH A;  1BQ7 A;  3ISO A;  2YOI A;  1SEN A;  1G6W A;  2OE1 A;  1K3O A;  3KXO A;  1GSQ A;  1LBK A;  5IMD A;  3KMN A;  3ZML A;  1M9B A;  5INY A;  3GRX A;  2LRT A;  2JAC A;  1GSU A;  1TKD B;  4KAE A;  2WFC A;  4HZ4 A;  2GGT A;  4PNG A;  3RAZ A;  3C1S A;  6GSX A;  4EC0 A;  1TK8 B;  1WE0 A;  3UVH A;  3LXT A;  1OE7 A;  1BJX A;  3WT1 A;  1XBS A;  3GIX A;  2YWO A;  1YF0 A;  4GXZ A;  4IP1 A;  3LXZ A;  1C72 A;  1GWC A;  1GL8 A;  1H4O A;  4KX4 A;  3QFA C;  1R5A A;  4OD7 A;  3HZ4 A;  3ZFL A;  4QL9 A;  1FB0 A;  4YQV A;  2MYG A;  5JCW A;  5B8B A;  3FYG A;  4I97 A;  5CNW A;  1A0F A;  3GYK A;  2IL3 A;  2H1D A;  4OFN A;  19GS A;  1WIK A;  3NZN A;  1Z3E A;  1CQG A;  3CTF A;  5GST A;  4ZBB A;  5GSS A;  4OO4 A;  3KM6 A;  2HZE B;  3VWV A;  4G19 A;  4F9Z A;  5ECN B;  2EIQ A;  2HLS A;  3M9J A;  2IME A;  3QDN A;  5D8I A;  3L0H A;  1N2A A;  4AF2 A;  4N11 A;  1JZO A;  2M72 A;  2GT6 A;  2QKE A;  4FH8 A;  3VWX A;  1EV4 A;  4L0U A;  3GX0 A;  5LCZ A;  4XS1 A;  5CO3 A;  4DEJ A;  4EUY A;  4AJ8 A;  3ZFB A;  1Z7R A;  1A8L A;  4MZW A;  3FEU A;  2PWJ A;  5ECR B;  2CAQ A;  2KLX A;  4K7I A;  4TN8 A;  4TR3 A;  1K0C A;  1F6M C;  4KH7 A;  4OMV A;  3HZ8 A;  3DYR A;  3MDK A;  5JCU A;  1XPV A;  1PKW A;  1S3D A;  1EZK A;  4MH2 A;  2ON5 A;  1ZOF A;  2VCX A;  3DIE A;  4TR4 A;  1M2A A;  4NV2 A;  4MDC A;  2V6O A;  3GST A;  5D9T A;  3GKK A;  3A5W A;  3JCM L;  2YJH A;  4ZBA A;  4XS4 B;  5G5E A;  2LTK A;  3LYK A;  2CAI A;  4IGJ A;  4J56 E;  1GNE A;  1X5D A;  5ECS A;  2FGX A;  3TRP A;  1K0D A;  4CDO A;  5JWO B;  4Q5R A;  2B5E A;  5IIZ A;  3F6F A;  2B3S A;  1KBN A;  1UN2 A;  3A2W A;  5ECO B;  1X9M B;  1NHO A;  3C1R A;  2I1U A;  2E2M A;  3TJB A;  3CSI A;  2OAD A;  1NHY A;  2CA8 A;  2WGR A;  5HR2 A;  4JZQ A;  2MBS A;  3M0F A;  2C3N A;  5D9W A;  5C00 A;  4BVY A;  5HR0 A;  3CRT A;  2M80 A;  2E0Q A;  2FWF A;  2K18 A;  2O8V B;  4EKZ A;  1TW9 A;  5G30 A;  3ZIT A;  17GS A;  3Q19 A;  1SL2 B;  3LG6 A;  1V98 A;  2GTU A;  1PD2 1;  2OBI A;  8GSS A;  5L71 A;  1PL1 A;  3FZ5 A;  4JBB A;  3UOM A;  4IQA A;  5J4U A;  6GSS A;  1HNB A;  2OAC A;  4JR6 A;  4LMW A;  3EVI A;  5AIV A;  3IRA A;  2OE0 A;  1VF1 A;  5J9B A;  3HA9 A;  1F37 A;  22GS A;  4NV5 A;  5EY6 A;  3VWU A;  2AAW A;  1O7U A;  2HI7 A;  4ZB8 A;  5FWG A;  1M7T A;  1OC8 A;  4PUA A;  1AQV A;  5ECK B;  4EE0 A;  2X8H A;  1XWA A;  1YKC A;  4RQR A;  1A24 A;  2MMZ A;  2H1G A;  3VI5 A;  3L78 A;  1Z5Y E;  2L5O A;  1SKR B;  3PR8 A;  2M46 A;  5FHI A;  4PGT A;  2H71 A;  1XW5 A;  5FT3 A;  1EOG A;  3ZL5 A;  1ERW A;  1WPI A;  4PUF C;  4IJI A;  2K8V A;  2MZC A;  1MTC A;  1SYX A;  2P5R A;  3HD5 A;  3APQ A;  2VD1 A;  4EL1 A;  3KTL A;  4EVM A;  5IQY A;  5J3R A;  2JZT A;  1KTE A;  5IO2 A;  2C0E A;  2L4Q A;  3C8E A;  4MJE A;  3TUE A;  3EUR A;  2DJK A;  3VWW A;  2H8L A;  1XWC A;  2O87 A;  3SWL A;  5D9X A;  4OWY A;  2H70 A;  1BAY A;  4TRX A;  2LKU A;  1A8Y A;  6GSU A;  3US3 A;  2H6X A;  1U88 A;  4AGS A;  1FVJ A;  3DGQ A;  4OFM A;  3F4R A;  2DJ0 A;  1DE1 A;  4PX1 A;  4PQI A;  5F05 A;  3HCZ A;  1DE2 A;  2VCQ A;  3KH9 A;  2I4A A;  4GCI A;  4L5L A;  2C8U A;  2Z9S A;  1FO5 A;  2IJY A;  2V6K A;  9GSS A;  2VOC A;  2VL2 C;  1W89 A;  4NHZ A;  4HUA A;  4O5R A;  4HJ2 A;  1BED A;  1ERV A;  3F63 A;  2AJQ B;  1G0T A;  3KP9 A;  4G10 A;  4V2L A;  2IMF A;  3D22 A;  3LEF A;  4NPB A;  1FAA A;  4ZIJ A;  1ERU A;  2NBS A;  3ZIV A;  2WS2 A;  2FD3 A;  2IFQ A;  2MMA A;  3ZLP A;  3UEM A;  4LL1 B;  1U6T A;  3IBH A;  3IK7 A;  3PH9 A;  4EDY A;  5DAL A;  3DVW A;  3IDV A;  5D93 A;  1OC9 B;  1SD8 A;  4ACS A;  1TU7 A;  1XCC A;  5DVB A;  3U6V A;  1IYH A;  3QCP A;  1T4Z A;  2DML A;  3IK9 A;  1ACV A;  3FZA A;  3KD0 A;  3GTU A;  4YAV A;  1OYJ A;  5DQS A;  3EE2 A;  20GS A;  4ECI A;  3RDW A;  5DJL A;  2X99 A;  3DML A;  1YJ6 A;  3H1N A;  2E7P A;  1ZL9 A;  1LU4 A;  1BG5 A;  2LRC A;  4POM A;  2HFD A;  3KP8 A;  1XZO A;  3A2X A;  3BBY A;  3FRC A;  2YZU A;  3ZZX A;  1HNC A;  4MAB A;  4CW9 A;  4E8E A;  2D2Z A;  1HQO A;  1PQN A;  5B8A A;  4MJB A;  4IVF A;  2FLS A;  1AQW A;  1SK2 A;  2VLV A;  1JZD A;  4ML6 A;  3FK8 A;  1DUG A;  2G0F A;  3D5J A;  4IKH A;  1HYU A;  2PER A;  4D73 A;  4EF0 A;  2GQM A;  2FCH A;  4KSM A;  5J41 A;  1GSS A;  5HFK A;  3Q6O A;  3TJJ A;  5KN3 A;  4K7N A;  4OO5 A;  4MPG A;  4WET A;  2F3M A;  5JWR B;  1PMT A;  1V58 A;  3CSJ A;  2XHF A;  4EDZ A;  3GNJ A;  1X9W B;  3APO A;  3ZIJ A;  5DCH A;  1Z9H A;  2DJ1 A;  4RUV A;  1B8X A;  1BYE A;  3GL3 A;  3HHV A;  4FYB A;  1GH2 A;  5ID2 B;  1X0R A;  3CMI A;  2K8S A;  2AYT A;  4K6X A;  5DBQ A;  1RK4 A;  4BWS A;  11GS A;  2GQK A;  4OFT A;  2EIR A;  2R6K A;  4IN0 A;  4JED A;  3UL3 A;  2RII A;  2CZ2 A;  2H0H A;  4GST A;  5ECM B;  7GSS A;  2WRT A;  2RUE A;  3GUS A;  4HOJ A;  4QL7 A;  2K6V A;  4GF0 A;  2WDU A;  1XVW A;  2GT5 A;  3MAK A;  3FR3 A;  1GRX A;  3TRX A;  2H1B A;  1XFL A;  2YJ7 A;  4I5Q A;  2IMD A;  1TP9 A;  1GSE A;  2RUF A;  5CRG A;  4YAP A;  5DAK B;  3WD6 A;  1YDK A;  3GA4 A;  3QAV A;  1FHE A;  3GH9 A;  1GTB A;  1THO A;  2B5Y A;  4O92 A;  2R4V A;  2PN8 A;  1ILO A;  12GS A;  4FYU A;  4MF6 A;  2O7K A;  3P90 A;  2JSY A;  1TXX A;  2R2J A;  3C73 A;  4IS0 A;  5A4W A;  2VM1 A;  1M2B A;  2L4C A;  3IAS 2;  3QAW A;  3TKR A;  4K1F A;  1URM A;  1M9A A;  1MD4 A;  2HSH A;  4ML1 A;  3GX8 A;  1XW9 A;  1EEJ A;  2L57 A;  3O6T A;  1WP0 A;  3CSH A;  3KGK A;  1FVK A;  1GLP A;  3Q74 A;  2CZ3 A;  3FZ9 A;  5G5F A;  4POK A;  5D96 A;  5IMC A;  1O81 A;  4F03 A;  2DJJ A;  3HJO A;  4KDY A;  1QQ2 A;  1TRV A;  2PBJ A;  6GSV A;  2C0G A;  3FW2 A;  3CYN A;  3IA1 A;  3I6A A;  4O7H A;  1X5E A;  2GZP A;  5GZZ B;  3C7M A;  3V1W A;  2VUP A;  2FUG 2;  1K3Y A;  2TRC P;  3GMF A;  5ECI B;  5J9C A;  4ZL7 A;  4NXI A;  4F82 A;  3QD9 A;  4O32 A;  2X8G A;  2DC5 A;  1PGT A;  1ML6 A;  3LOR A;  5HQP A;  10GS A;  4POL A;  4F0B A;  4MF5 A;  4MF7 A;  3QAG A;  3BJ5 A;  2HZE A;  1TK5 B;  3HDC A;  1SL1 B;  3G7Y A;  4ZB9 A;  1G7O A;  2CV4 A;  3ZVJ A;  3KTB A;  3LGC A;  2H74 A;  2JZR A;  5JWQ B;  4TXO B;  5ECL B;  3VPQ A;  2CT6 A;  1ZCP A;  2PGT A;  3APS A;  4K9Z A;  2GZY A;  2CX4 A;  2YWI A;  3DEX A;  4MPF A;  4TR1 A;  3TKQ A;  2G2Q A;  2JSZ A;  2HRF A;  3RPP A;  2H6Y A;  1YQ1 A;  1TU8 A;  3EYT A;  4HU7 A;  5HR3 A;  3UBK A;  3ZRE A;  5E4W A;  2ZCT A;  4MJC A;  1N8J A;  3GN3 A;  3W8S A;  1MEK A;  2LV3 A;  2VL3 A;  1ABA A;  4DSQ A;  2DIZ A;  3F3Q A;  3A2V A;  3GL5 A;  1TI1 A;  4CHS A;  4DSS B;  4HDE A;  1OKT A;  3EMP A;  5ECH B;  3IXR A;  2GVP A;  2GS3 A;  4JR4 A;  3W6G A;  1JHB A;  4XS6 A;  4JRR A;  5LD0 A;  2HE3 A;  1XOA A;  4Q5Q A;  3J7Y k;  3DXB A;  3TRQ A;  3TGZ A;  2VCZ A;  5IMA A;  2C80 A;  3TKP A;  5CRW A;  2I3Y A;  1TRS A;  4V1A g;  2QGV A;  3TJK A;  2ALB A;  2H76 A;  3DWV A;  4WXT A;  2H0I A;  4ZIL A;  5CRD A;  2MMN A;  1A23 A;  1K0N A;  1KNG A;  1NSW A;  3D0Z A;  3ZTL A;  2LS5 A;  3U5R E;  6GSY A;  3H8Q A;  1GTI A;  3RHB A;  4KA0 A;  1PX7 A;  1U3I A;  1UC7 A;  1JZR A;  4GQF A;  1Z7P A;  2IMI A;  4TOP A;  2VD0 A;  1PL2 A;  1S3A A;  1T7P B;  2E2G A;  1XWG A;  1QUW A;  4V1A p;  1PRX A;  3LFL A;  1F3A A;  5H5R A;  4KDX A;  3D6I A;  2HZF A;  1WWJ A;  3UAR A;  3IC4 A;  1YEX A;  5F07 A;  2VCV A;  1JFU A;  5JCG A;  5A4U A;  3FY7 A;  3ED3 A;  3L9V A;  2LQO A;  3TKS A;  2GDR A;  2ON7 A;  1G7E A;  1AQX A;  1W4V A;  3GUR A;  4Z7X A;  3M1G A;  1XWK A;  3F0I A;  3G7I A;  1J08 A;  2F51 A;  1X9S B;  4LMV A;  3UIW A;  1GUH A;  4ISD A;  4KDU A;  1JLV A;  3UJ1 A;  3QPM A;  5KN1 A;  5HR1 A;  4XTS A;  2NVL A;  5ELA A;  4MH3 A;  1MDI A;  3DRN A; 
#chains in the Genus database with same CATH topology
 5KEJ A;  2YZH A;  2JL4 A;  1BX9 A;  6GST A;  3MSZ A;  2LJK A;  5EPF A;  1R5P A;  1YZX A;  2QA2 A;  1O6J A;  4G9H A;  2N5F A;  3FKF A;  3IV4 A;  3QR6 A;  1QK8 A;  1QMV A;  1OKD A;  4HSC X;  1O8X A;  1B9X C;  2P0G A;  3TOT A;  1USB A;  2DSA A;  2LNS A;  3MWH A;  1Y6E A;  3O3T A;  3EWL A;  1I9D A;  1VF2 A;  5IPH A;  2JAD A;  3E3E A;  3F8U A;  3DVX A;  2IFQ B;  1TOF A;  5AN1 A;  4FIW A;  4XRD A;  2HNL A;  1A2J A;  4YQU A;  4HJM A;  14GS A;  2H72 A;  4POB A;  5DAL B;  3BCK A;  1SK1 A;  1XIY A;  2VLT A;  1B9Y C;  4CY8 A;  2DMM A;  3LYP A;  16GS A;  4X1U A;  2N5B A;  1EP7 A;  4JE1 A;  1GP1 A;  3KCM A;  1DSB A;  1V2A A;  3VK9 A;  4OCE A;  4MJA A;  3A3T A;  1TK0 B;  4TKY A;  3FR6 A;  2LJR A;  3QMX A;  2PUK C;  3ERF A;  1ON4 A;  1GUK A;  2YV7 A;  4BVX A;  4WR4 A;  1YKA A;  4K0G A;  4MMM A;  1EV9 A;  2HRN A;  1F9M A;  3WYW A;  2KP1 A;  4F0C A;  2BTO T;  4I6X A;  4HZ2 A;  3HJM A;  1XVQ A;  2A4V A;  1OC9 A;  1JZW A;  4XHM A;  4Q5N A;  4KGI A;  4GLT A;  2WJU A;  1TI3 A;  3EIN A;  5AGY A;  4ZB6 A;  3NOF A;  5DQY A;  2L5L A;  1WJK A;  1QGV A;  5ELG A;  5KN0 A;  2B7J A;  5DJM A;  1K0A A;  1ST9 A;  4L5O A;  3UMA A;  3HVS A;  4N10 A;  4NWY A;  2AV4 A;  2R3X A;  2EC4 A;  5F06 A;  5A5K A;  1O8W A;  2R0P A;  3LSZ A;  1ZZY A;  2R5G A;  5CP1 A;  3GKX A;  3L9S A;  3H93 A;  1M99 A;  3QOU A;  3I9V 2;  3Q18 A;  2YWM A;  2HRA A;  3OR5 A;  4Z2U A;  3QFB C;  3VLN A;  3FZ4 A;  2H66 A;  5ECP B;  4ID0 A;  4PXO A;  3E9J B;  3IAM 2;  2FA4 A;  2L6D A;  5CAX A;  4XCS A;  4G0K A;  3TKS E;  1SL0 B;  2FWG A;  4HI7 A;  2B1K A;  2A2P A;  3F9U A;  2KOK A;  1B48 A;  3C71 A;  3ERG A;  4GWR A;  1GTU A;  1RW1 A;  4FYC A;  2JU5 A;  4RI7 A;  3RPN A;  4DVC A;  2UZ8 A;  2J23 A;  3PGT A;  4PUR A;  2V2G A;  1Y25 A;  4PNF A;  3E0U A;  3KIJ A;  2WZ9 A;  2R37 A;  1T00 A;  2TRX A;  3ZYW A;  5AIS A;  2MBT A;  4A5P A;  5D9V A;  2H0G A;  2I9H A;  5IO0 A;  4N0Z A;  5ID2 A;  1PSQ A;  3L4N A;  1T4Y A;  2B7K A;  3F4T A;  5A4V A;  3UVT A;  4MA9 A;  1TTZ A;  2O85 A;  1R26 A;  1WRY A;  5DDL A;  2VO4 A;  3H79 A;  4NHW A;  4KSO A;  2CVK A;  3AY8 A;  3ZRD A;  1V57 A;  4XIH A;  2HXK A;  1SJ6 A;  4KW6 A;  1H75 A;  5DCG A;  4V2N A;  4BWQ A;  1XOB A;  1GUL A;  1V40 A;  5H5S A;  18GS A;  3G7J A;  5B7C A;  1EOH A;  1PX6 A;  2B1L A;  3WGD A;  1E6B A;  2H30 A;  2IWT A;  1OVN A;  2GSS A;  4NMU A;  4G2E A;  2FHE A;  4PQ1 A;  1Z6N A;  4QQ7 A;  4ULX A;  1GNW A;  1GSD A;  5DAK A;  5CRE A;  2KP2 A;  4G0I A;  2XBQ A;  1EWX A;  3TDG A;  2DJ3 A;  1S3C A;  4EO3 A;  3GH6 A;  1T8E B;  4RI6 A;  3TJF A;  2FNO A;  2H6Z A;  4J2F A;  2CQ9 A;  2YPM A;  1MD3 A;  2J9H A;  2ZNM A;  3ME7 A;  2IMK A;  3EC3 A;  4DSR A;  1SYR A;  4GSS A;  1FOV A;  3IHQ A;  4ECC A;  1PN0 A;  5D73 A;  4MZC A;  5ECQ B;  3TB2 A;  4TXV A;  1R7H A;  1TRU A;  4KE3 A;  5CRH A;  1OC3 A;  3P8W A;  5IMZ A;  1YEP A;  2GST A;  1AIU A;  4YKF A;  4KB3 A;  1VF4 A;  5IMV A;  4WKW A;  5HFG A;  6GSW A;  1WOU A;  3HY2 A;  3I69 A;  2LRN A;  3VUR A;  5J5N A;  1E2Y A;  3P2A A;  1EP8 A;  3UBL A;  2XPD A;  4TR1 B;  1SKS B;  2C0F A;  3G9B A;  4YH2 A;  1G6Y A;  2H01 A;  4MLY A;  3PIN A;  1TRW A;  3TCO A;  4K7O A;  2EIO A;  1R4W A;  5B6N A;  4ECB A;  5GAP D;  2HSM A;  4I2T A;  4WEY A;  1HD2 A;  2A4H A;  3VPT A;  3NIV A;  5G31 A;  4IP6 A;  5F0G A;  2WB9 A;  1ZMA A;  3EPT A;  1A2L A;  2H1A A;  4KUN A;  4I8B A;  2F8A A;  2DJ2 A;  4YQM A;  2REM A;  2P5Q A;  4K0N A;  1SKW B;  3M9K A;  4TXO A;  1TDI A;  3CTG A;  1GSY A;  2ES7 A;  4OCF A;  5F8B A;  4N30 A;  2F8F A;  2VL9 A;  1AXD A;  2GZZ A;  2TIR A;  3D21 A;  3TKS C;  4XS4 A;  4ZL8 A;  1B4Q A;  4WBJ A;  2GSQ A;  4BA7 A;  4LL4 B;  1THX A;  5AIX A;  2C4J A;  1NW2 A;  4TVE A;  1EGR A;  5G1K A;  2PVQ A;  1PKZ A;  4ZXG A;  2X64 A;  2B6M A;  3LQ7 A;  2V41 A;  1J0F A;  4DSS A;  2LEG A;  3MNG A;  2BJX A;  2IIY A;  2R0C A;  4PQH A;  1TJD A;  5IM9 A;  4GQC A;  4F2I A;  4MZB A;  3LJR A;  3KH7 A;  4MCU A;  3KEB A;  3TOU A;  5IOX A;  5KOW A;  1ZYQ B;  2WCI A;  1UVZ A;  3S9F A;  1AW9 A;  2V1M A;  2AB6 A;  2X8C A;  4AJ6 A;  2YN1 A;  2DBC A;  1VGL A;  4FO5 A;  2FWH A;  4KF9 A;  4L8E A;  1CQH A;  1SJZ A;  2RLI A;  3WGE A;  1J9B A;  4JU5 A;  4K2X A;  3GKM A;  2YCD A;  1YY7 A;  1XXU A;  2GQL A;  3BOA A;  4ILF A;  2VIM A;  1F2E A;  1M3J A;  1AAZ A;  2QSI A;  1SD9 A;  1OE8 A;  1JLW A;  5IMF A;  3GKN A;  4WF5 A;  4E8H A;  2VAF A;  4H86 A;  3BD2 A;  5BMU A;  3SBC A;  4KCE A;  4MK3 A;  2F9S A;  1A2M A;  2I81 A;  2GSR A;  2PPT A;  2IPA A;  3HVV A;  1ZGN A;  3IOS A;  1GSF A;  4NAX A;  5G1L A;  4P3Y B;  1QXH A;  3GHA A;  4GRF A;  1QFN A;  4EIQ A;  1Q4J A;  2H73 A;  3WGX A;  1K3L A;  3F6D A;  2C1Y A;  4J57 E;  2PVO C;  2YP6 A;  3H4K A;  4IEL A;  2LJA A;  2A2R A;  2JZS A;  3CBU A;  2VLU A;  2N5A A;  5B6M A;  1MDJ A;  2OBK A;  3EU4 A;  1A0R P;  2KHP A;  2X49 A;  4IBP A;  1PN9 A;  2HT9 A;  4Q5F A;  5G2Z A;  3IPZ A;  3FR9 A;  2KUC A;  2WUL A;  1X5C A;  2BMX A;  3GFK A;  3KJY A;  1T3B A;  5BRT A;  3EMX A;  2VM2 A;  3CXG A;  3J7Y b;  2AHE A;  2OA7 A;  3DD3 A;  1I5G A;  2YV9 A;  1SU9 A;  1VF3 A;  4HQS A;  1ZYP A;  1VRS D;  2XC2 A;  3HJP A;  1XW6 A;  5E59 A;  3D4T A;  2H19 A;  2HYX A;  5IPG A;  2CX3 A;  1ZYE A;  4GTU A;  2LUS A;  3HKR A;  4ZL9 A;  1K0O A;  4KCA A;  2C0D A;  1RQM A;  2LST A;  2C3Q A;  5H5Q A;  4X43 A;  2HSY A;  1SJI A;  1YF1 A;  1F3B A;  2XPE A;  2NDO A;  3EU3 A;  3KMO A;  4L0W A;  4LA1 A;  1UA5 A;  2L6C A;  3KZQ A;  1ZYN A;  3P7X A;  1SK0 A;  5CYY A;  1T1V A;  3N9J A;  13GS A;  4K2D A;  4V2M A;  1PA3 A;  1XWB A;  3W8J A;  4AJ7 A;  3HYP A;  1KEB A;  4MP4 A;  2C3T A;  1WMJ A;  2OE3 A;  2RM6 A;  3ZVJ D;  3R3E A;  2AUV A;  3CRU A;  1EGO A;  2YAN A;  2CVB A;  3I43 A;  1K0B A;  2K9F A;  3BCI A;  3GTU B;  1K0M A;  2RM5 A;  3GV1 A;  3IHG A;  2ZUP A;  5HFI A;  4XRA A;  1Q98 A;  3FHK A;  1ERT A;  3PPU A;  2O89 A;  3RBT A;  3RHC A;  2LQQ A;  2DIY A;  4BPY A;  1GUM A;  1IYI A;  1O73 A;  3VI7 A;  3WT2 A;  2NTO A;  3D4M A;  2H75 A;  3O76 A;  5C04 A;  3N5O A;  4EXJ A;  5ABR A;  3DKS A;  1AC1 A;  4WR5 A;  4IJ3 A;  4TR0 A;  2DKI A;  3LW9 A;  2LNT A;  1GLQ A;  1U3A A;  2YWN A;  3IC8 A;  4RQX A;  4HEA 2;  4HU9 A;  4D73 B;  4WBR D;  2XBI A;  2FA8 A;  2OJL A;  3HXS A;  2B5X A;  2DLX A;  2VCW A;  4TW5 A;  3ERW A;  3GSS A;  1EEM A;  1U87 A;  4HQZ A;  5EL8 A;  1NM3 A;  2VL2 A;  4IQ1 A;  4IW9 A;  5IOW A;  1DBY A;  2YNX A;  2FY6 A;  5ENU A;  1FG4 A;  2VCT A;  3F3R A;  3HVX A;  4ECJ A;  2P31 A;  4IHU A;  1B4P A;  5LNK e;  1FB6 A;  4I2U A;  2NPB A;  3L9U A;  1OAZ A;  4WF4 A;  4K8M A;  3R2Q A;  3IR4 A;  2CVD A;  3K8N A;  2IN3 A;  3ZMK A;  2QC7 A;  2OKA A;  4ICY A;  4KND A;  1FW1 A;  2PU9 C;  3M8N A;  1M2D A;  4BL7 A;  4HS1 A;  2GLR A;  3LWA A;  4YKG A;  4LLR A;  1GTA A;  1MDK A;  3IE3 A;  4GSN A;  3ME8 A;  2L59 A;  3M3M A;  1HNA A;  4K5S A;  2MMO A;  1M0U A;  3F4S A;  1O85 A;  5GAN D;  1Z6M A;  2A2S A;  1AUC A;  3TJG A;  5EVO A;  2V32 A;  3VFI A;  5KN2 A;  4X0X A;  2FWE A;  1LJR A;  1V9W A;  4N0V A;  3UAP A;  4ZBD A;  2PMT A;  5COH A;  1BQ7 A;  3ISO A;  2YOI A;  1SEN A;  1G6W A;  2OE1 A;  1K3O A;  3KXO A;  1GSQ A;  1LBK A;  5IMD A;  3KMN A;  3ZML A;  1M9B A;  5INY A;  3GRX A;  2LRT A;  2JAC A;  1GSU A;  1TKD B;  4KAE A;  2WFC A;  4HZ4 A;  2GGT A;  4PNG A;  4EIP A;  3RAZ A;  3C1S A;  6GSX A;  4EC0 A;  1TK8 B;  1WE0 A;  3UVH A;  3LXT A;  1OE7 A;  1BJX A;  3WT1 A;  1XBS A;  2R0G A;  3GIX A;  2YWO A;  1YF0 A;  4GXZ A;  4IP1 A;  3LXZ A;  1C72 A;  1GWC A;  2QA1 A;  1GL8 A;  1H4O A;  3A5I A;  4KX4 A;  3QFA C;  1R5A A;  4OD7 A;  3HZ4 A;  3ZFL A;  4QL9 A;  4USS A;  1FB0 A;  4YQV A;  2MYG A;  5JCW A;  5B8B A;  3FYG A;  4I97 A;  5CNW A;  1A0F A;  3GYK A;  2IL3 A;  2H1D A;  4OFN A;  19GS A;  1WIK A;  3NZN A;  1Z3E A;  1CQG A;  3CTF A;  5GST A;  5KOX A;  4ZBB A;  5GSS A;  4OO4 A;  3KM6 A;  2HZE B;  3VWV A;  4G19 A;  4F9Z A;  5ECN B;  2EIQ A;  2HLS A;  3M9J A;  2IME A;  3QDN A;  5D8I A;  3L0H A;  1N2A A;  4AF2 A;  4N11 A;  1JZO A;  2M72 A;  2GT6 A;  2QKE A;  4FH8 A;  3VWX A;  1EV4 A;  4L0U A;  3GX0 A;  5LCZ A;  2HRK A;  4XS1 A;  5CO3 A;  4DEJ A;  4EUY A;  4AJ8 A;  3ZFB A;  1Z7R A;  1A8L A;  4MZW A;  3FEU A;  2PWJ A;  5ECR B;  2CAQ A;  2KLX A;  4K7I A;  4TN8 A;  4TR3 A;  1K0C A;  1F6M C;  4KH7 A;  4OMV A;  3HZ8 A;  3DYR A;  3MDK A;  5JCU A;  1XPV A;  1PKW A;  1S3D A;  1EZK A;  4MH2 A;  2ON5 A;  1ZOF A;  2VCX A;  3DIE A;  4TR4 A;  1M2A A;  4NV2 A;  4MDC A;  2V6O A;  3GST A;  5D9T A;  3GKK A;  3A5W A;  3JCM L;  2YJH A;  4ZBA A;  4XS4 B;  5G5E A;  2LTK A;  3LYK A;  2CAI A;  4IGJ A;  4J56 E;  1GNE A;  1X5D A;  5ECS A;  2FGX A;  3TRP A;  1K0D A;  4CDO A;  5JWO B;  4Q5R A;  2B5E A;  5IIZ A;  3F6F A;  2B3S A;  1KBN A;  1UN2 A;  3A2W A;  5ECO B;  1X9M B;  1NHO A;  3C1R A;  2I1U A;  2E2M A;  3TJB A;  3CSI A;  1FOH A;  2OAD A;  1NHY A;  2CA8 A;  2WGR A;  5HR2 A;  4JZQ A;  2MBS A;  3M0F A;  2C3N A;  5D9W A;  5C00 A;  4BVY A;  5HR0 A;  3CRT A;  2M80 A;  2E0Q A;  2FWF A;  2K18 A;  2O8V B;  4EKZ A;  1TW9 A;  5G30 A;  3ZIT A;  17GS A;  3Q19 A;  1SL2 B;  3LG6 A;  1V98 A;  2GTU A;  1PD2 1;  2OBI A;  8GSS A;  5L71 A;  1PL1 A;  3FZ5 A;  4JBB A;  3UOM A;  4K5R A;  4IQA A;  5J4U A;  1PFO A;  6GSS A;  1HNB A;  2OAC A;  4FQU A;  4JR6 A;  4LMW A;  3EVI A;  5AIV A;  3IRA A;  2OE0 A;  1VF1 A;  5J9B A;  3HA9 A;  1F37 A;  22GS A;  4NV5 A;  5EY6 A;  3VWU A;  2AAW A;  1O7U A;  2HI7 A;  4ZB8 A;  5FWG A;  1M7T A;  1OC8 A;  3FMW A;  4PUA A;  1AQV A;  5ECK B;  4EE0 A;  2X8H A;  1XWA A;  1YKC A;  4RQR A;  1A24 A;  2MMZ A;  2H1G A;  3VI5 A;  3L78 A;  1Z5Y E;  2L5O A;  1SKR B;  3PR8 A;  2M46 A;  5FHI A;  4PGT A;  2H71 A;  1XW5 A;  5FT3 A;  1EOG A;  3ZL5 A;  1ERW A;  1WPI A;  4PUF C;  4IJI A;  4O5Q A;  2K8V A;  2MZC A;  1MTC A;  1SYX A;  2P5R A;  3HD5 A;  3APQ A;  2VD1 A;  4EL1 A;  3KTL A;  4EVM A;  5IQY A;  5J3R A;  2JZT A;  1KTE A;  5IO2 A;  2C0E A;  2L4Q A;  3C8E A;  4MJE A;  3TUE A;  3EUR A;  2DJK A;  3VWW A;  2H8L A;  1XWC A;  2O87 A;  3SWL A;  5D9X A;  4OWY A;  2H70 A;  1BAY A;  4TRX A;  2LKU A;  1A8Y A;  6GSU A;  3US3 A;  2H6X A;  1U88 A;  4AGS A;  1FVJ A;  3DGQ A;  4OFM A;  3F4R A;  2DJ0 A;  1DE1 A;  4PX1 A;  4PQI A;  5F05 A;  3HCZ A;  1DE2 A;  2VCQ A;  3KH9 A;  2I4A A;  4GCI A;  4L5L A;  2C8U A;  2Z9S A;  1FO5 A;  2IJY A;  2V6K A;  9GSS A;  2VOC A;  2VL2 C;  1W89 A;  4NHZ A;  4Z2T A;  4HUA A;  4O5R A;  4HJ2 A;  1BED A;  1ERV A;  3F63 A;  2AJQ B;  1G0T A;  3KP9 A;  4BVX B;  4G10 A;  4V2L A;  2IMF A;  3D22 A;  2X4A A;  3LEF A;  4NPB A;  1FAA A;  4ZIJ A;  1ERU A;  2NBS A;  3ZIV A;  2WS2 A;  2FD3 A;  2IFQ A;  2MMA A;  4O5U A;  3ZLP A;  3UEM A;  4LL1 B;  1U6T A;  3IBH A;  3IK7 A;  3PH9 A;  4EDY A;  5DAL A;  3DVW A;  3IDV A;  5D93 A;  1OC9 B;  1SD8 A;  4X4J A;  4ACS A;  1TU7 A;  1XCC A;  5DVB A;  3U6V A;  1IYH A;  3QCP A;  1T4Z A;  2DML A;  3IK9 A;  1ACV A;  3FZA A;  3KD0 A;  3GTU A;  4YAV A;  1OYJ A;  5DQS A;  3EE2 A;  20GS A;  4ECI A;  3RDW A;  5DJL A;  2X99 A;  3DML A;  1YJ6 A;  3H1N A;  2E7P A;  3CQF A;  1ZL9 A;  1LU4 A;  1BG5 A;  2LRC A;  4POM A;  2HFD A;  3KP8 A;  1XZO A;  3A2X A;  3BBY A;  3FRC A;  2YZU A;  3ZZX A;  1HNC A;  4MAB A;  4CW9 A;  4E8E A;  2D2Z A;  1HQO A;  1PQN A;  5B8A A;  4MJB A;  4IVF A;  2FLS A;  1AQW A;  1SK2 A;  2VLV A;  1JZD A;  4ML6 A;  3FK8 A;  1DUG A;  2G0F A;  3D5J A;  4IKH A;  4BL7 B;  1HYU A;  2PER A;  4D73 A;  4EF0 A;  2GQM A;  2FCH A;  4KSM A;  5J41 A;  1GSS A;  5HFK A;  3Q6O A;  3TJJ A;  5KN3 A;  4K7N A;  4OO5 A;  4MPG A;  4PTS A;  2F3M A;  4WET A;  5JWR B;  1PMT A;  1V58 A;  3CSJ A;  2XHF A;  4EDZ A;  3GNJ A;  1X9W B;  3APO A;  3ZIJ A;  5DCH A;  1Z9H A;  2DJ1 A;  4RUV A;  1B8X A;  1BYE A;  3GL3 A;  3HHV A;  3HVN A;  4FYB A;  1GH2 A;  5ID2 B;  1X0R A;  3CMI A;  2K8S A;  2AYT A;  4K6X A;  5DBQ A;  1RK4 A;  4BWS A;  11GS A;  2GQK A;  4OFT A;  2EIR A;  2R6K A;  4IN0 A;  4JED A;  3UL3 A;  2RII A;  2CZ2 A;  2H0H A;  4GST A;  5ECM B;  3MYD A;  7GSS A;  2WRT A;  2RUE A;  3GUS A;  4HOJ A;  4QL7 A;  2K6V A;  4GF0 A;  2WDU A;  1XVW A;  2GT5 A;  3MAK A;  3FR3 A;  1GRX A;  3TRX A;  2H1B A;  1XFL A;  2YJ7 A;  1S3R A;  4I5Q A;  2IMD A;  1TP9 A;  1GSE A;  2RUF A;  5CRG A;  4YAP A;  5DAK B;  3WD6 A;  1YDK A;  3GA4 A;  3QAV A;  1FHE A;  3GH9 A;  1GTB A;  1THO A;  2B5Y A;  4O92 A;  2R4V A;  2PN8 A;  1ILO A;  12GS A;  4FYU A;  4MF6 A;  2O7K A;  4G0L A;  3P90 A;  2JSY A;  1TXX A;  2R2J A;  3C73 A;  4IS0 A;  5A4W A;  2VM1 A;  1M2B A;  2L4C A;  3IAS 2;  3QAW A;  3TKR A;  2DKH A;  4K1F A;  1URM A;  1M9A A;  1MD4 A;  2HSH A;  4ML1 A;  3GX8 A;  1XW9 A;  1EEJ A;  2L57 A;  3O6T A;  1WP0 A;  3CSH A;  3KGK A;  1FVK A;  1GLP A;  3Q74 A;  2CZ3 A;  3FZ9 A;  5G5F A;  4POK A;  5D96 A;  5IMC A;  1O81 A;  4F03 A;  2DJJ A;  3HJO A;  4KDY A;  1M3I A;  1QQ2 A;  1TRV A;  2PBJ A;  6GSV A;  2C0G A;  3FW2 A;  3CYN A;  3IA1 A;  3I6A A;  4O7H A;  1X5E A;  2GZP A;  5GZZ B;  3C7M A;  3V1W A;  2VUP A;  2FUG 2;  1K3Y A;  2TRC P;  3GMF A;  5ECI B;  5J9C A;  4CY6 A;  4Z2R A;  4ZL7 A;  4NXI A;  4F82 A;  3QD9 A;  4O32 A;  2X8G A;  2DC5 A;  1PGT A;  1ML6 A;  3LOR A;  5HQP A;  10GS A;  4POL A;  4F0B A;  4MF5 A;  4MF7 A;  3QAG A;  3BJ5 A;  2HZE A;  1TK5 B;  3HDC A;  1SL1 B;  3G7Y A;  4BIK A;  4ZB9 A;  1G7O A;  2CV4 A;  3ZVJ A;  3KTB A;  3LGC A;  2H74 A;  2JZR A;  5JWQ B;  4TXO B;  5ECL B;  3VPQ A;  2CT6 A;  1ZCP A;  2PGT A;  3APS A;  4K9Z A;  2GZY A;  2CX4 A;  2YWI A;  3DEX A;  4MPF A;  4TR1 A;  3TKQ A;  2G2Q A;  2JSZ A;  2HRF A;  3RPP A;  4MNN A;  2H6Y A;  1YQ1 A;  1TU8 A;  3EYT A;  4HU7 A;  5HR3 A;  3UBK A;  3ZRE A;  5E4W A;  2ZCT A;  4MJC A;  1N8J A;  3GN3 A;  3W8S A;  1MEK A;  2LV3 A;  2VL3 A;  1ABA A;  4DSQ A;  2DIZ A;  3F3Q A;  3A2V A;  3GL5 A;  1TI1 A;  4CHS A;  4DSS B;  4HDE A;  1OKT A;  3EMP A;  4BVY B;  5ECH B;  3IXR A;  2GVP A;  2GS3 A;  4JR4 A;  3W6G A;  1JHB A;  4XS6 A;  4JRR A;  5LD0 A;  2HE3 A;  1XOA A;  4Q5Q A;  3J7Y k;  3DXB A;  3TRQ A;  3TGZ A;  2VCZ A;  5IMA A;  2C80 A;  3TKP A;  5CRW A;  2I3Y A;  1TRS A;  4V1A g;  2QGV A;  3TJK A;  2ALB A;  2H76 A;  3DWV A;  4WXT A;  2H0I A;  4ZIL A;  5CRD A;  2MMN A;  1A23 A;  1K0N A;  1KNG A;  1NSW A;  3D0Z A;  3ZTL A;  2LS5 A;  3U5R E;  6GSY A;  3H8Q A;  1GTI A;  3RHB A;  4KA0 A;  1PX7 A;  1U3I A;  1UC7 A;  1JZR A;  4GQF A;  1Z7P A;  2IMI A;  4TOP A;  2VD0 A;  1PL2 A;  1S3A A;  1T7P B;  2E2G A;  1XWG A;  1QUW A;  4V1A p;  1PRX A;  3LFL A;  1F3A A;  5H5R A;  4KDX A;  3D6I A;  2HZF A;  1WWJ A;  3UAR A;  3IC4 A;  1YEX A;  5F07 A;  2VCV A;  1JFU A;  5JCG A;  5A4U A;  3FY7 A;  3ED3 A;  3L9V A;  2LQO A;  3TKS A;  2GDR A;  2ON7 A;  1G7E A;  1AQX A;  1W4V A;  3GUR A;  4Z7X A;  3M1G A;  3MIX A;  1XWK A;  3F0I A;  3G7I A;  1J08 A;  2F51 A;  1X9S B;  1XG8 A;  4LMV A;  1GUH A;  3UIW A;  4ISD A;  4KDU A;  1JLV A;  3UJ1 A;  3QPM A;  5KN1 A;  5HR1 A;  4XTS A;  2NVL A;  5ELA A;  4MH3 A;  1MDI A;  3DRN A; 
#chains in the Genus database with same CATH homology
 5KEJ A;  2YZH A;  2JL4 A;  1BX9 A;  6GST A;  3MSZ A;  2LJK A;  5EPF A;  1R5P A;  1YZX A;  2QA2 A;  1O6J A;  4G9H A;  2N5F A;  3FKF A;  3IV4 A;  3QR6 A;  1QK8 A;  1QMV A;  1OKD A;  1O8X A;  1B9X C;  2P0G A;  3TOT A;  1USB A;  2DSA A;  2LNS A;  3MWH A;  1Y6E A;  3O3T A;  3EWL A;  1I9D A;  1VF2 A;  5IPH A;  2JAD A;  3E3E A;  3F8U A;  3DVX A;  2IFQ B;  1TOF A;  5AN1 A;  4FIW A;  4XRD A;  2HNL A;  1A2J A;  4YQU A;  4HJM A;  14GS A;  2H72 A;  4POB A;  5DAL B;  3BCK A;  1SK1 A;  1XIY A;  2VLT A;  1B9Y C;  4CY8 A;  2DMM A;  3LYP A;  16GS A;  4X1U A;  2N5B A;  1EP7 A;  4JE1 A;  1GP1 A;  3KCM A;  1DSB A;  1V2A A;  3VK9 A;  4OCE A;  4MJA A;  3A3T A;  1TK0 B;  4TKY A;  3FR6 A;  2LJR A;  3QMX A;  2PUK C;  3ERF A;  1ON4 A;  1GUK A;  2YV7 A;  4BVX A;  4WR4 A;  1YKA A;  4K0G A;  4MMM A;  1EV9 A;  2HRN A;  1F9M A;  3WYW A;  2KP1 A;  4F0C A;  2BTO T;  4I6X A;  4HZ2 A;  3HJM A;  1XVQ A;  2A4V A;  1OC9 A;  1JZW A;  4XHM A;  4Q5N A;  4KGI A;  4GLT A;  2WJU A;  1TI3 A;  3EIN A;  5AGY A;  4ZB6 A;  3NOF A;  5DQY A;  2L5L A;  1WJK A;  1QGV A;  5ELG A;  5KN0 A;  2B7J A;  5DJM A;  1K0A A;  1ST9 A;  4L5O A;  3UMA A;  3HVS A;  4N10 A;  4NWY A;  2AV4 A;  2R3X A;  2EC4 A;  5F06 A;  5A5K A;  1O8W A;  2R0P A;  3LSZ A;  1ZZY A;  2R5G A;  5CP1 A;  3GKX A;  3L9S A;  3H93 A;  1M99 A;  3QOU A;  3I9V 2;  3Q18 A;  2YWM A;  2HRA A;  3OR5 A;  4Z2U A;  3QFB C;  3VLN A;  3FZ4 A;  2H66 A;  5ECP B;  4ID0 A;  4PXO A;  3E9J B;  3IAM 2;  2FA4 A;  2L6D A;  5CAX A;  4XCS A;  4G0K A;  3TKS E;  1SL0 B;  2FWG A;  4HI7 A;  2B1K A;  2A2P A;  3F9U A;  2KOK A;  1B48 A;  3C71 A;  3ERG A;  4GWR A;  1GTU A;  1RW1 A;  4FYC A;  2JU5 A;  4RI7 A;  3RPN A;  4DVC A;  2UZ8 A;  2J23 A;  3PGT A;  4PUR A;  2V2G A;  1Y25 A;  4PNF A;  3E0U A;  3KIJ A;  2WZ9 A;  2R37 A;  1T00 A;  2TRX A;  3ZYW A;  5AIS A;  2MBT A;  4A5P A;  5D9V A;  2H0G A;  2I9H A;  5IO0 A;  4N0Z A;  5ID2 A;  1PSQ A;  3L4N A;  1T4Y A;  2B7K A;  3F4T A;  5A4V A;  3UVT A;  4MA9 A;  1TTZ A;  2O85 A;  1R26 A;  1WRY A;  5DDL A;  2VO4 A;  3H79 A;  4NHW A;  4KSO A;  2CVK A;  3AY8 A;  3ZRD A;  1V57 A;  4XIH A;  2HXK A;  1SJ6 A;  4KW6 A;  1H75 A;  5DCG A;  4V2N A;  4BWQ A;  1XOB A;  1GUL A;  1V40 A;  5H5S A;  18GS A;  3G7J A;  5B7C A;  1EOH A;  1PX6 A;  2B1L A;  3WGD A;  1E6B A;  2H30 A;  2IWT A;  1OVN A;  2GSS A;  4NMU A;  4G2E A;  2FHE A;  4PQ1 A;  1Z6N A;  4QQ7 A;  4ULX A;  1GNW A;  1GSD A;  5DAK A;  5CRE A;  2KP2 A;  4G0I A;  2XBQ A;  1EWX A;  3TDG A;  2DJ3 A;  1S3C A;  4EO3 A;  3GH6 A;  1T8E B;  4RI6 A;  3TJF A;  2FNO A;  2H6Z A;  4J2F A;  2CQ9 A;  2YPM A;  1MD3 A;  2J9H A;  2ZNM A;  3ME7 A;  2IMK A;  3EC3 A;  4DSR A;  1SYR A;  4GSS A;  1FOV A;  3IHQ A;  4ECC A;  1PN0 A;  5D73 A;  4MZC A;  5ECQ B;  3TB2 A;  4TXV A;  1R7H A;  1TRU A;  4KE3 A;  5CRH A;  1OC3 A;  3P8W A;  5IMZ A;  1YEP A;  2GST A;  1AIU A;  4YKF A;  4KB3 A;  1VF4 A;  5IMV A;  4WKW A;  5HFG A;  6GSW A;  1WOU A;  3HY2 A;  3I69 A;  2LRN A;  3VUR A;  5J5N A;  1E2Y A;  3P2A A;  1EP8 A;  3UBL A;  2XPD A;  4TR1 B;  1SKS B;  2C0F A;  3G9B A;  4YH2 A;  1G6Y A;  2H01 A;  4MLY A;  3PIN A;  1TRW A;  3TCO A;  4K7O A;  2EIO A;  1R4W A;  5B6N A;  4ECB A;  5GAP D;  2HSM A;  4I2T A;  4WEY A;  1HD2 A;  2A4H A;  3VPT A;  3NIV A;  5G31 A;  4IP6 A;  5F0G A;  2WB9 A;  1ZMA A;  3EPT A;  1A2L A;  2H1A A;  4KUN A;  4I8B A;  2F8A A;  2DJ2 A;  4YQM A;  2REM A;  2P5Q A;  4K0N A;  1SKW B;  3M9K A;  4TXO A;  1TDI A;  3CTG A;  1GSY A;  2ES7 A;  4OCF A;  5F8B A;  4N30 A;  2F8F A;  2VL9 A;  1AXD A;  2GZZ A;  2TIR A;  3D21 A;  3TKS C;  4XS4 A;  4ZL8 A;  1B4Q A;  4WBJ A;  2GSQ A;  4BA7 A;  4LL4 B;  1THX A;  5AIX A;  2C4J A;  1NW2 A;  4TVE A;  1EGR A;  5G1K A;  2PVQ A;  1PKZ A;  4ZXG A;  2X64 A;  2B6M A;  3LQ7 A;  2V41 A;  1J0F A;  4DSS A;  2LEG A;  3MNG A;  2BJX A;  2IIY A;  2R0C A;  4PQH A;  1TJD A;  5IM9 A;  4GQC A;  4F2I A;  4MZB A;  3LJR A;  3KH7 A;  4MCU A;  3KEB A;  3TOU A;  5IOX A;  5KOW A;  1ZYQ B;  2WCI A;  1UVZ A;  3S9F A;  1AW9 A;  2V1M A;  2AB6 A;  2X8C A;  4AJ6 A;  2YN1 A;  2DBC A;  1VGL A;  4FO5 A;  2FWH A;  4KF9 A;  4L8E A;  1CQH A;  1SJZ A;  2RLI A;  3WGE A;  1J9B A;  4JU5 A;  4K2X A;  3GKM A;  2YCD A;  1YY7 A;  1XXU A;  2GQL A;  3BOA A;  4ILF A;  2VIM A;  1F2E A;  1AAZ A;  2QSI A;  1SD9 A;  1OE8 A;  1JLW A;  5IMF A;  3GKN A;  4WF5 A;  4E8H A;  2VAF A;  4H86 A;  3BD2 A;  5BMU A;  3SBC A;  4KCE A;  4MK3 A;  2F9S A;  1A2M A;  2I81 A;  2GSR A;  2PPT A;  2IPA A;  3HVV A;  1ZGN A;  3IOS A;  1GSF A;  4NAX A;  5G1L A;  4P3Y B;  1QXH A;  3GHA A;  4GRF A;  1QFN A;  4EIQ A;  1Q4J A;  2H73 A;  3WGX A;  1K3L A;  3F6D A;  2C1Y A;  4J57 E;  2PVO C;  2YP6 A;  3H4K A;  4IEL A;  2LJA A;  2A2R A;  2JZS A;  3CBU A;  2VLU A;  2N5A A;  5B6M A;  1MDJ A;  2OBK A;  3EU4 A;  1A0R P;  2KHP A;  2X49 A;  4IBP A;  1PN9 A;  2HT9 A;  4Q5F A;  5G2Z A;  3IPZ A;  3FR9 A;  2KUC A;  2WUL A;  1X5C A;  2BMX A;  3GFK A;  3KJY A;  1T3B A;  5BRT A;  3EMX A;  2VM2 A;  3CXG A;  3J7Y b;  2AHE A;  2OA7 A;  3DD3 A;  1I5G A;  2YV9 A;  1SU9 A;  1VF3 A;  4HQS A;  1ZYP A;  1VRS D;  2XC2 A;  3HJP A;  1XW6 A;  5E59 A;  3D4T A;  2H19 A;  2HYX A;  5IPG A;  2CX3 A;  1ZYE A;  4GTU A;  2LUS A;  3HKR A;  4ZL9 A;  1K0O A;  4KCA A;  2C0D A;  1RQM A;  2LST A;  2C3Q A;  5H5Q A;  4X43 A;  2HSY A;  1SJI A;  1YF1 A;  1F3B A;  2XPE A;  2NDO A;  3EU3 A;  3KMO A;  4L0W A;  4LA1 A;  1UA5 A;  2L6C A;  3KZQ A;  1ZYN A;  3P7X A;  1SK0 A;  5CYY A;  1T1V A;  3N9J A;  13GS A;  4K2D A;  4V2M A;  1PA3 A;  1XWB A;  3W8J A;  4AJ7 A;  3HYP A;  1KEB A;  4MP4 A;  2C3T A;  1WMJ A;  2OE3 A;  2RM6 A;  3ZVJ D;  3R3E A;  2AUV A;  3CRU A;  1EGO A;  2YAN A;  2CVB A;  3I43 A;  1K0B A;  2K9F A;  3BCI A;  3GTU B;  1K0M A;  2RM5 A;  3GV1 A;  3IHG A;  2ZUP A;  5HFI A;  4XRA A;  1Q98 A;  3FHK A;  1ERT A;  3PPU A;  2O89 A;  3RBT A;  3RHC A;  2LQQ A;  2DIY A;  4BPY A;  1GUM A;  1IYI A;  1O73 A;  3VI7 A;  3WT2 A;  2NTO A;  3D4M A;  2H75 A;  3O76 A;  5C04 A;  3N5O A;  4EXJ A;  5ABR A;  3DKS A;  1AC1 A;  4WR5 A;  4IJ3 A;  4TR0 A;  2DKI A;  3LW9 A;  2LNT A;  1GLQ A;  1U3A A;  2YWN A;  3IC8 A;  4RQX A;  4HEA 2;  4HU9 A;  4D73 B;  4WBR D;  2XBI A;  2FA8 A;  2OJL A;  3HXS A;  2B5X A;  2DLX A;  2VCW A;  4TW5 A;  3ERW A;  3GSS A;  1EEM A;  1U87 A;  4HQZ A;  5EL8 A;  1NM3 A;  2VL2 A;  4IQ1 A;  4IW9 A;  5IOW A;  1DBY A;  2YNX A;  2FY6 A;  5ENU A;  1FG4 A;  2VCT A;  3F3R A;  3HVX A;  4ECJ A;  2P31 A;  4IHU A;  1B4P A;  5LNK e;  1FB6 A;  4I2U A;  2NPB A;  3L9U A;  1OAZ A;  4WF4 A;  4K8M A;  3R2Q A;  3IR4 A;  2CVD A;  3K8N A;  2IN3 A;  3ZMK A;  2QC7 A;  2OKA A;  4ICY A;  4KND A;  1FW1 A;  2PU9 C;  3M8N A;  1M2D A;  4BL7 A;  4HS1 A;  2GLR A;  3LWA A;  4YKG A;  4LLR A;  1GTA A;  1MDK A;  3IE3 A;  4GSN A;  3ME8 A;  2L59 A;  3M3M A;  1HNA A;  4K5S A;  2MMO A;  1M0U A;  3F4S A;  1O85 A;  5GAN D;  1Z6M A;  2A2S A;  1AUC A;  3TJG A;  5EVO A;  2V32 A;  3VFI A;  5KN2 A;  4X0X A;  2FWE A;  1LJR A;  1V9W A;  4N0V A;  3UAP A;  4ZBD A;  2PMT A;  5COH A;  1BQ7 A;  3ISO A;  2YOI A;  1SEN A;  1G6W A;  2OE1 A;  1K3O A;  3KXO A;  1GSQ A;  1LBK A;  5IMD A;  3KMN A;  3ZML A;  1M9B A;  5INY A;  3GRX A;  2LRT A;  2JAC A;  1GSU A;  1TKD B;  4KAE A;  2WFC A;  4HZ4 A;  2GGT A;  4PNG A;  4EIP A;  3RAZ A;  3C1S A;  6GSX A;  4EC0 A;  1TK8 B;  1WE0 A;  3UVH A;  3LXT A;  1OE7 A;  1BJX A;  3WT1 A;  1XBS A;  2R0G A;  3GIX A;  2YWO A;  1YF0 A;  4GXZ A;  4IP1 A;  3LXZ A;  1C72 A;  1GWC A;  2QA1 A;  1GL8 A;  1H4O A;  3A5I A;  4KX4 A;  3QFA C;  1R5A A;  4OD7 A;  3HZ4 A;  3ZFL A;  4QL9 A;  4USS A;  1FB0 A;  4YQV A;  2MYG A;  5JCW A;  5B8B A;  3FYG A;  4I97 A;  5CNW A;  1A0F A;  3GYK A;  2IL3 A;  2H1D A;  4OFN A;  19GS A;  1WIK A;  3NZN A;  1Z3E A;  1CQG A;  3CTF A;  5GST A;  5KOX A;  4ZBB A;  5GSS A;  4OO4 A;  3KM6 A;  2HZE B;  3VWV A;  4G19 A;  4F9Z A;  5ECN B;  2EIQ A;  2HLS A;  3M9J A;  2IME A;  3QDN A;  5D8I A;  3L0H A;  1N2A A;  4AF2 A;  4N11 A;  1JZO A;  2M72 A;  2GT6 A;  2QKE A;  4FH8 A;  3VWX A;  1EV4 A;  4L0U A;  3GX0 A;  5LCZ A;  2HRK A;  4XS1 A;  5CO3 A;  4DEJ A;  4EUY A;  4AJ8 A;  3ZFB A;  1Z7R A;  1A8L A;  4MZW A;  3FEU A;  2PWJ A;  5ECR B;  2CAQ A;  2KLX A;  4K7I A;  4TN8 A;  4TR3 A;  1K0C A;  1F6M C;  4KH7 A;  4OMV A;  3HZ8 A;  3DYR A;  3MDK A;  5JCU A;  1XPV A;  1PKW A;  1S3D A;  1EZK A;  4MH2 A;  2ON5 A;  1ZOF A;  2VCX A;  3DIE A;  4TR4 A;  1M2A A;  4NV2 A;  4MDC A;  2V6O A;  3GST A;  5D9T A;  3GKK A;  3A5W A;  3JCM L;  2YJH A;  4ZBA A;  4XS4 B;  5G5E A;  2LTK A;  3LYK A;  2CAI A;  4IGJ A;  4J56 E;  1GNE A;  1X5D A;  5ECS A;  2FGX A;  3TRP A;  1K0D A;  4CDO A;  5JWO B;  4Q5R A;  2B5E A;  5IIZ A;  3F6F A;  2B3S A;  1KBN A;  1UN2 A;  3A2W A;  5ECO B;  1X9M B;  1NHO A;  3C1R A;  2I1U A;  2E2M A;  3TJB A;  3CSI A;  1FOH A;  2OAD A;  1NHY A;  2CA8 A;  2WGR A;  5HR2 A;  4JZQ A;  2MBS A;  3M0F A;  2C3N A;  5D9W A;  5C00 A;  4BVY A;  5HR0 A;  3CRT A;  2M80 A;  2E0Q A;  2FWF A;  2K18 A;  2O8V B;  4EKZ A;  1TW9 A;  5G30 A;  3ZIT A;  17GS A;  3Q19 A;  1SL2 B;  3LG6 A;  1V98 A;  2GTU A;  1PD2 1;  2OBI A;  8GSS A;  5L71 A;  1PL1 A;  3FZ5 A;  4JBB A;  3UOM A;  4K5R A;  4IQA A;  5J4U A;  6GSS A;  1HNB A;  2OAC A;  4FQU A;  4JR6 A;  4LMW A;  3EVI A;  5AIV A;  3IRA A;  2OE0 A;  1VF1 A;  5J9B A;  3HA9 A;  1F37 A;  22GS A;  4NV5 A;  5EY6 A;  3VWU A;  2AAW A;  1O7U A;  2HI7 A;  4ZB8 A;  5FWG A;  1M7T A;  1OC8 A;  3FMW A;  4PUA A;  1AQV A;  5ECK B;  4EE0 A;  2X8H A;  1XWA A;  1YKC A;  4RQR A;  1A24 A;  2MMZ A;  2H1G A;  3VI5 A;  3L78 A;  1Z5Y E;  2L5O A;  1SKR B;  3PR8 A;  2M46 A;  5FHI A;  4PGT A;  2H71 A;  1XW5 A;  5FT3 A;  1EOG A;  3ZL5 A;  1ERW A;  1WPI A;  4PUF C;  4IJI A;  4O5Q A;  2K8V A;  2MZC A;  1MTC A;  1SYX A;  2P5R A;  3HD5 A;  3APQ A;  2VD1 A;  4EL1 A;  3KTL A;  4EVM A;  5IQY A;  5J3R A;  2JZT A;  1KTE A;  5IO2 A;  2C0E A;  2L4Q A;  3C8E A;  4MJE A;  3TUE A;  3EUR A;  2DJK A;  3VWW A;  2H8L A;  1XWC A;  2O87 A;  3SWL A;  5D9X A;  4OWY A;  2H70 A;  1BAY A;  4TRX A;  2LKU A;  1A8Y A;  6GSU A;  3US3 A;  2H6X A;  1U88 A;  4AGS A;  1FVJ A;  3DGQ A;  4OFM A;  3F4R A;  2DJ0 A;  1DE1 A;  4PX1 A;  4PQI A;  5F05 A;  3HCZ A;  1DE2 A;  2VCQ A;  3KH9 A;  2I4A A;  4GCI A;  4L5L A;  2C8U A;  2Z9S A;  1FO5 A;  2IJY A;  2V6K A;  9GSS A;  2VOC A;  2VL2 C;  1W89 A;  4NHZ A;  4Z2T A;  4HUA A;  4O5R A;  4HJ2 A;  1BED A;  1ERV A;  3F63 A;  2AJQ B;  1G0T A;  3KP9 A;  4BVX B;  4G10 A;  4V2L A;  2IMF A;  3D22 A;  2X4A A;  3LEF A;  4NPB A;  1FAA A;  4ZIJ A;  1ERU A;  2NBS A;  3ZIV A;  2WS2 A;  2FD3 A;  2IFQ A;  2MMA A;  4O5U A;  3ZLP A;  3UEM A;  4LL1 B;  1U6T A;  3IBH A;  3IK7 A;  3PH9 A;  4EDY A;  5DAL A;  3DVW A;  3IDV A;  5D93 A;  1OC9 B;  1SD8 A;  4X4J A;  4ACS A;  1TU7 A;  1XCC A;  5DVB A;  3U6V A;  1IYH A;  3QCP A;  1T4Z A;  2DML A;  3IK9 A;  1ACV A;  3FZA A;  3KD0 A;  3GTU A;  4YAV A;  1OYJ A;  5DQS A;  3EE2 A;  20GS A;  4ECI A;  3RDW A;  5DJL A;  2X99 A;  3DML A;  1YJ6 A;  3H1N A;  2E7P A;  1ZL9 A;  1LU4 A;  1BG5 A;  2LRC A;  4POM A;  2HFD A;  3KP8 A;  1XZO A;  3A2X A;  3BBY A;  3FRC A;  2YZU A;  3ZZX A;  1HNC A;  4MAB A;  4CW9 A;  4E8E A;  2D2Z A;  1HQO A;  1PQN A;  5B8A A;  4MJB A;  4IVF A;  2FLS A;  1AQW A;  1SK2 A;  2VLV A;  1JZD A;  4ML6 A;  3FK8 A;  1DUG A;  2G0F A;  3D5J A;  4IKH A;  4BL7 B;  1HYU A;  2PER A;  4D73 A;  4EF0 A;  2GQM A;  2FCH A;  4KSM A;  5J41 A;  1GSS A;  5HFK A;  3Q6O A;  3TJJ A;  5KN3 A;  4K7N A;  4OO5 A;  4MPG A;  4PTS A;  2F3M A;  4WET A;  5JWR B;  1PMT A;  1V58 A;  3CSJ A;  2XHF A;  4EDZ A;  3GNJ A;  1X9W B;  3APO A;  3ZIJ A;  5DCH A;  1Z9H A;  2DJ1 A;  4RUV A;  1B8X A;  1BYE A;  3GL3 A;  3HHV A;  4FYB A;  1GH2 A;  5ID2 B;  1X0R A;  3CMI A;  2K8S A;  2AYT A;  4K6X A;  5DBQ A;  1RK4 A;  4BWS A;  11GS A;  2GQK A;  4OFT A;  2EIR A;  2R6K A;  4IN0 A;  4JED A;  3UL3 A;  2RII A;  2CZ2 A;  2H0H A;  4GST A;  5ECM B;  3MYD A;  7GSS A;  2WRT A;  2RUE A;  3GUS A;  4HOJ A;  4QL7 A;  2K6V A;  4GF0 A;  2WDU A;  1XVW A;  2GT5 A;  3MAK A;  3FR3 A;  1GRX A;  3TRX A;  2H1B A;  1XFL A;  2YJ7 A;  4I5Q A;  2IMD A;  1TP9 A;  1GSE A;  2RUF A;  5CRG A;  4YAP A;  5DAK B;  3WD6 A;  1YDK A;  3GA4 A;  3QAV A;  1FHE A;  3GH9 A;  1GTB A;  1THO A;  2B5Y A;  4O92 A;  2R4V A;  2PN8 A;  1ILO A;  12GS A;  4FYU A;  4MF6 A;  2O7K A;  4G0L A;  3P90 A;  2JSY A;  1TXX A;  2R2J A;  3C73 A;  4IS0 A;  5A4W A;  2VM1 A;  1M2B A;  2L4C A;  3IAS 2;  3QAW A;  3TKR A;  2DKH A;  4K1F A;  1URM A;  1M9A A;  1MD4 A;  2HSH A;  4ML1 A;  3GX8 A;  1XW9 A;  1EEJ A;  2L57 A;  3O6T A;  1WP0 A;  3CSH A;  3KGK A;  1FVK A;  1GLP A;  3Q74 A;  2CZ3 A;  3FZ9 A;  5G5F A;  4POK A;  5D96 A;  5IMC A;  1O81 A;  4F03 A;  2DJJ A;  3HJO A;  4KDY A;  1QQ2 A;  1TRV A;  2PBJ A;  6GSV A;  2C0G A;  3FW2 A;  3CYN A;  3IA1 A;  3I6A A;  4O7H A;  1X5E A;  2GZP A;  5GZZ B;  3C7M A;  3V1W A;  2VUP A;  2FUG 2;  1K3Y A;  2TRC P;  3GMF A;  5ECI B;  5J9C A;  4CY6 A;  4Z2R A;  4ZL7 A;  4NXI A;  4F82 A;  3QD9 A;  4O32 A;  2X8G A;  2DC5 A;  1PGT A;  1ML6 A;  3LOR A;  5HQP A;  10GS A;  4POL A;  4F0B A;  4MF5 A;  4MF7 A;  3QAG A;  3BJ5 A;  2HZE A;  1TK5 B;  3HDC A;  1SL1 B;  3G7Y A;  4ZB9 A;  1G7O A;  2CV4 A;  3ZVJ A;  3KTB A;  3LGC A;  2H74 A;  2JZR A;  5JWQ B;  4TXO B;  5ECL B;  3VPQ A;  2CT6 A;  1ZCP A;  2PGT A;  3APS A;  4K9Z A;  2GZY A;  2CX4 A;  2YWI A;  3DEX A;  4MPF A;  4TR1 A;  3TKQ A;  2G2Q A;  2JSZ A;  2HRF A;  3RPP A;  4MNN A;  2H6Y A;  1YQ1 A;  1TU8 A;  3EYT A;  4HU7 A;  5HR3 A;  3UBK A;  3ZRE A;  5E4W A;  2ZCT A;  4MJC A;  1N8J A;  3GN3 A;  3W8S A;  1MEK A;  2LV3 A;  2VL3 A;  1ABA A;  4DSQ A;  2DIZ A;  3F3Q A;  3A2V A;  3GL5 A;  1TI1 A;  4CHS A;  4DSS B;  4HDE A;  1OKT A;  3EMP A;  4BVY B;  5ECH B;  3IXR A;  2GVP A;  2GS3 A;  4JR4 A;  3W6G A;  1JHB A;  4XS6 A;  4JRR A;  5LD0 A;  2HE3 A;  1XOA A;  4Q5Q A;  3J7Y k;  3DXB A;  3TRQ A;  3TGZ A;  2VCZ A;  5IMA A;  2C80 A;  3TKP A;  5CRW A;  2I3Y A;  1TRS A;  4V1A g;  2QGV A;  3TJK A;  2ALB A;  2H76 A;  3DWV A;  4WXT A;  2H0I A;  4ZIL A;  5CRD A;  2MMN A;  1A23 A;  1K0N A;  1KNG A;  1NSW A;  3D0Z A;  3ZTL A;  2LS5 A;  3U5R E;  6GSY A;  3H8Q A;  1GTI A;  3RHB A;  4KA0 A;  1PX7 A;  1U3I A;  1UC7 A;  1JZR A;  4GQF A;  1Z7P A;  2IMI A;  4TOP A;  2VD0 A;  1PL2 A;  1S3A A;  1T7P B;  2E2G A;  1XWG A;  1QUW A;  4V1A p;  1PRX A;  3LFL A;  1F3A A;  5H5R A;  4KDX A;  3D6I A;  2HZF A;  1WWJ A;  3UAR A;  3IC4 A;  1YEX A;  5F07 A;  2VCV A;  1JFU A;  5JCG A;  5A4U A;  3FY7 A;  3ED3 A;  3L9V A;  2LQO A;  3TKS A;  2GDR A;  2ON7 A;  1G7E A;  1AQX A;  1W4V A;  3GUR A;  4Z7X A;  3M1G A;  3MIX A;  1XWK A;  3F0I A;  3G7I A;  1J08 A;  2F51 A;  1X9S B;  4LMV A;  3UIW A;  1GUH A;  4ISD A;  4KDU A;  1JLV A;  3UJ1 A;  3QPM A;  5KN1 A;  5HR1 A;  4XTS A;  2NVL A;  5ELA A;  4MH3 A;  1MDI A;  3DRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...