2IWVA

Structure of the monomeric outer membrane porin ompg in the open and closed conformation
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
277
structure length
277
Chain Sequence
NDWHFNIGAMYEIENVEGYGEDMDGLAEPSVYFNAANGPWRIALAYYQEGPVDYSAGKRGTWFDRPELEVHYQFLENDDFSFGLTGGFRNYGYHYVDEPGKDTANMQRWKIAPDWDVKLTDDLRFNGWLSMYKFANDLNTTGYADTRVETETGLQYTFNETVALRVNYYLERGFNMDDSRNNGEFSTQEIRAYLPLTLGNHSVTPYTRIGLDRWSNWDWQDDIEREGHDFNRVGLFYGYDFQNGLSVSLEYAFEWQDHDEGDSDKFHYAGVGVNYSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Monomeric Outer-Membrane Porin Ompg in the Open and Closed Conformation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ion channel
molecule keywords OUTER MEMBRANE PROTEIN G
total genus 72
structure length 277
sequence length 277
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09381 Porin_OmpG Outer membrane protein G (OmpG)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.40 Mainly Beta Beta Barrel Porin monomeric porin ompg 2iwvA00
2JQYA 2WVPA 2WJQA 4PR7A 4FQEA 2F1CX 2WJRA 2IWVA 4CTDA 2IWWA 2X9KA
chains in the Genus database with same CATH superfamily
3HOLA 1ORMA 2O4VA 5KAIO 1GFNA 3C5OA 1ZHTA 5GV0A 5FVNA 4C69X 3NSGA 4PUXA 3T24A 3UPGA 3LK3A 2KDYA 5KAFO 2K0LA 2R4NA 3QRCA 4N59A 2QTKA 4RLCA 1E54A 3PQUA 4FMSA 3WI5A 4AKRA 4C00A 3DA4A 5GTIO 3POQA 2F1CX 2WJRA 2M06A 2R88A 3K19A 5DL7A 3VE1A 2ODJA 1GFQA 4O3WA 4N75A 4JCHA 5G26A 5AFUL 3DA3A 4G75A 1IZNB 4C4VA 3DWNA 4O4XA 4U9CA 5D5DA 2FGQX 4AKMA 4FRTA 3V8UA 4AUIA 4FOZA 4JFBA 3KZIO 4UB8O 4E1SA 4FSPA 2KXPA 2JQYA 3LK42 2W81C 4LSHA 3G7GA 1Q9FA 3PGSA 4AKRB 3LK2A 2IWVA 3AA7B 2F1VA 4FZLA 3SZDA 3T0SA 4AYDC 4AZLA 4FUVA 1OPFA 4RLBA 2XTQA 1Q9GA 5H2FO 3PRNA 4O49A 1QJPA 3PGUA 2Y0HA 5ADXK 4N74A 4CTDA 4KRAA 4BUMX 3VZTX 3A2SX 3HWBA 1MPFA 3AAAB 2XE2A 4FSOA 1YS5A 2J4UP 3POXA 3SY7A 4Z3TA 5DL5A 3VZUX 4AFKA 3GP6A 2KXPB 1ZHZA 2YPVA 5DL8A 4E1TA 4FZNA 1QJ8A 1T1LA 5AFUK 4GCQA 2XE1A 3AA7A 3JCUO 4PR7A 4RJWA 2R4LA 4UB6O 3AA1B 2XE5A 4QQ1A 1THQA 2X27X 3UU2A 2YNKA 3JTYA 5TISO 4D65A 5B5EO 1PRNA 1ZHXA 3AA0A 3WU2O 4RJXA 3DZMA 4FT6A 1GFPA 4FQEA 5T5FA 1T16A 2ZLDA 3VZWX 3AAAA 2KZ7A 2X9KA 3HW9A 3SZVA 4F4BA 2Y0KA 3SY9A 1BT9A 4N58A 4AYID 2ZFGA 5PRNA 4KR8A 2OMFA 3VY9X 2KZ7B 2KC0A 2PRNA 3PF1A 3WI4A 2J1NA 3O0EA 4GHBA 2GE4A 7PRNA 2N2MA 4AYEC 4C4VB 5JDPA 4FZMA 4IL6O 3BRZA 4GF4A 2N2LA 4O3YA 3UAQA 1PHOA 5DL6A 2R8AA 4FRXA 1P4TA 3DWOX 3LK41 4LSEA 2XTRA 4D64A 2JMMA 5G38A 1HXUA 3BRYA 1BXWA 4RL9A 1S5LO 1ZHWA 5G3AA 2M07A 1HXXA 1GFMA 4LSFA 2R89A 3PQSA 5E79O 2ERVA 4O3XB 2MHLA 5ADXL 4XNLA 3A0BO 1QJ9A 1MM4A 2IWWA 3KVDD 2Y0LA 2Y2XA 3FYXA 2WJQA 3LK2B 4K3CA 4LSIA 1H6S1 4D5UA 5GTHO 3TZGA 2R4OA 1G90A 3PGRA 4PJ0O 5G39A 4K3BA 3RBHA 4GCPA 2LHFA 2PORA 3HOEA 3POUA 4G76A 2WVPA 4FESA 3AA6A 4XNKA 6PRNA 1BH3A 1OSMA 3SYBA 4AYMC 3VE2A 2F1TA 2XMXA 1MM5A 2K4TA 2Y7SA 3AA1A 3AAEA 3NJTA 4B61A 2W80C 3PORA 2XG6A 3AA6B 3QRAA 4GCSA 4AYNA 1HXTA 2R4PA 3AA0B 4KR4A 3T20A 4O4UA 5IYUA 1GFOA 5B66O 8PRNA 3A0HO 2XE3A 3EMNX 3BS0A 3AAEB 3VY8X 3LK3B 3SYSA 2MNHA 1IZNA 1ZHYA 4O3ZA 2AXTO 2FGRA 5EE2A 2LFUA
chains in the Genus database with same CATH topology
2JQYA 2WVPA 2WJQA 4PR7A 4FQEA 2F1CX 2WJRA 2IWVA 4CTDA 2IWWA 2X9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JQY A;  2WVP A;  2WJQ A;  4PR7 A;  4FQE A;  2F1C X;  2WJR A;  2IWV A;  4CTD A;  2IWW A;  2X9K A; 
#chains in the Genus database with same CATH topology
 3HOL A;  1ORM A;  2O4V A;  5KAI O;  1GFN A;  3C5O A;  1ZHT A;  5GV0 A;  5FVN A;  4C69 X;  3NSG A;  4PUX A;  3T24 A;  3UPG A;  3LK3 A;  2KDY A;  5KAF O;  2K0L A;  2R4N A;  3QRC A;  4N59 A;  2QTK A;  4RLC A;  1E54 A;  3PQU A;  4FMS A;  3WI5 A;  4AKR A;  4C00 A;  3DA4 A;  5GTI O;  3POQ A;  2F1C X;  2WJR A;  2M06 A;  2R88 A;  3K19 A;  5DL7 A;  3VE1 A;  2ODJ A;  1GFQ A;  4O3W A;  4N75 A;  4JCH A;  5G26 A;  5AFU L;  3DA3 A;  4G75 A;  1IZN B;  4C4V A;  3DWN A;  4O4X A;  4U9C A;  5D5D A;  2FGQ X;  4AKM A;  4FRT A;  3V8U A;  4AUI A;  4FOZ A;  4JFB A;  3KZI O;  4UB8 O;  4E1S A;  4FSP A;  2KXP A;  2JQY A;  3LK4 2;  2W81 C;  4LSH A;  3G7G A;  1Q9F A;  3PGS A;  4AKR B;  3LK2 A;  2IWV A;  3AA7 B;  2F1V A;  4FZL A;  3SZD A;  3T0S A;  4AYD C;  4AZL A;  4FUV A;  1OPF A;  4RLB A;  2XTQ A;  1Q9G A;  5H2F O;  3PRN A;  4O49 A;  1QJP A;  3PGU A;  2Y0H A;  5ADX K;  4N74 A;  4CTD A;  4KRA A;  4BUM X;  3VZT X;  3A2S X;  3HWB A;  1MPF A;  3AAA B;  2XE2 A;  4FSO A;  1YS5 A;  2J4U P;  3POX A;  3SY7 A;  4Z3T A;  5DL5 A;  3VZU X;  4AFK A;  3GP6 A;  2KXP B;  1ZHZ A;  2YPV A;  5DL8 A;  4E1T A;  4FZN A;  1QJ8 A;  1T1L A;  5AFU K;  4GCQ A;  2XE1 A;  3AA7 A;  3JCU O;  4PR7 A;  4RJW A;  2R4L A;  4UB6 O;  3AA1 B;  2XE5 A;  4QQ1 A;  1THQ A;  2X27 X;  3UU2 A;  2YNK A;  3JTY A;  5TIS O;  4D65 A;  5B5E O;  1PRN A;  1ZHX A;  3AA0 A;  3WU2 O;  4RJX A;  3DZM A;  4FT6 A;  1GFP A;  4FQE A;  5T5F A;  1T16 A;  2ZLD A;  3VZW X;  3AAA A;  2KZ7 A;  2X9K A;  3HW9 A;  3SZV A;  4F4B A;  2Y0K A;  3SY9 A;  1BT9 A;  4N58 A;  4AYI D;  2ZFG A;  5PRN A;  4KR8 A;  2OMF A;  3VY9 X;  2KZ7 B;  2KC0 A;  2PRN A;  3PF1 A;  3WI4 A;  2J1N A;  3O0E A;  4GHB A;  2GE4 A;  7PRN A;  2N2M A;  4AYE C;  4C4V B;  5JDP A;  4FZM A;  4IL6 O;  3BRZ A;  4GF4 A;  2N2L A;  4O3Y A;  3UAQ A;  1PHO A;  5DL6 A;  2R8A A;  4FRX A;  1P4T A;  3DWO X;  3LK4 1;  4LSE A;  2XTR A;  4D64 A;  2JMM A;  5G38 A;  1HXU A;  3BRY A;  1BXW A;  4RL9 A;  1S5L O;  1ZHW A;  5G3A A;  2M07 A;  1HXX A;  1GFM A;  4LSF A;  2R89 A;  3PQS A;  5E79 O;  2ERV A;  4O3X B;  2MHL A;  5ADX L;  4XNL A;  3A0B O;  1QJ9 A;  1MM4 A;  2IWW A;  3KVD D;  2Y0L A;  2Y2X A;  3FYX A;  2WJQ A;  3LK2 B;  4K3C A;  4LSI A;  1H6S 1;  4D5U A;  5GTH O;  3TZG A;  2R4O A;  1G90 A;  3PGR A;  4PJ0 O;  5G39 A;  4K3B A;  3RBH A;  4GCP A;  2LHF A;  2POR A;  3HOE A;  3POU A;  4G76 A;  2WVP A;  4FES A;  3AA6 A;  4XNK A;  6PRN A;  1BH3 A;  1OSM A;  3SYB A;  4AYM C;  3VE2 A;  2F1T A;  2XMX A;  1MM5 A;  2K4T A;  2Y7S A;  3AA1 A;  3AAE A;  3NJT A;  4B61 A;  2W80 C;  3POR A;  2XG6 A;  3AA6 B;  3QRA A;  4GCS A;  4AYN A;  1HXT A;  2R4P A;  3AA0 B;  4KR4 A;  3T20 A;  4O4U A;  5IYU A;  1GFO A;  5B66 O;  8PRN A;  3A0H O;  2XE3 A;  3EMN X;  3BS0 A;  3AAE B;  3VY8 X;  3LK3 B;  3SYS A;  2MNH A;  1IZN A;  1ZHY A;  4O3Z A;  2AXT O;  2FGR A;  5EE2 A;  2LFU A; 
#chains in the Genus database with same CATH homology
 2JQY A;  2WVP A;  2WJQ A;  4PR7 A;  4FQE A;  2F1C X;  2WJR A;  2IWV A;  4CTD A;  2IWW A;  2X9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...