2IWWA

Structure of the monomeric outer membrane porin ompg in the open and closed conformation
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
277
structure length
277
Chain Sequence
NDWHFNIGAMYEIENVEGYGEDMDGLAEPSVYFNAANGPWRIALAYYQEGPVDYSAGKRGTWFDRPELEVHYQFLENDDFSFGLTGGFRNYGYHYVDEPGKDTANMQRWKIAPDWDVKLTDDLRFNGWLSMYKFANDLNTTGYADTRVETETGLQYTFNETVALRVNYYLERGFNMDDSRNNGEFSTQEIRAYLPLTLGNHSVTPYTRIGLDRWSNWDWQDDIEREGHDFNRVGLFYGYDFQNGLSVSLEYAFEWQDHDEGDSDKFHYAGVGVNYSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN G
publication title Structure of the Monomeric Outer-Membrane Porin Ompg in the Open and Closed Conformation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ion channel
total genus 60
structure length 277
sequence length 277
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09381 Porin_OmpG Outer membrane protein G (OmpG)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.40 Mainly Beta Beta Barrel Porin monomeric porin ompg 2iwwA00
4FQEA 2F1CX 4CTDA 2WJQA 2IWWA 2IWVA 2WJRA 2JQYA 4PR7A 2WVPA 2X9KA
chains in the Genus database with same CATH superfamily
5DL5A 1GFOA 2JMMA 3VZUX 4UB6O 2XE2A 4GCSA 5AFUK 4AKRB 1MM5A 2OMFA 3KZIO 2K4TA 4N58A 1YS5A 1BT9A 2YPVA 3AA7B 3TZGA 2KXPA 2J1NA 4PJ0O 3FYXA 4AYNA 2FGQX 4XNLA 4O3ZA 5GTHO 3PGSA 4G75A 4KRAA 4RL9A 3KVDD 3PQUA 4LSFA 5T5FA 3SZDA 2R4LA 3QRCA 2Y0KA 5EE2A 3PF1A 2QTKA 3A0BO 3AA1B 1BXWA 3PGRA 2Y2XA 4FZLA 3VY8X 4CTDA 5ADXK 1MPFA 4C4VB 2Y0HA 3T20A 1IZNB 2X9KA 4JCHA 4RJWA 1T16A 2MNHA 2F1CX 2XMXA 3WI4A 1S5LO 1E54A 3BRZA 2X27X 3POXA 4AYMC 3AA0A 4U9CA 1Q9GA 4D64A 3AA6A 4GCQA 4AYDC 3SYSA 5AFUL 5GV0A 4AFKA 1GFQA 2ZFGA 2K0LA 1ORMA 3AAEB 2JQYA 2R89A 4F4BA 2XE1A 2Y7SA 4KR4A 4RLBA 5G38A 3QRAA 2ZLDA 2KZ7B 2XG6A 3PQSA 5E79O 3HOLA 3AAAB 3PGUA 5FVNA 3SZVA 3VZTX 2M06A 2LHFA 2R8AA 2WJQA 2N2LA 2GE4A 4FMSA 4LSHA 2R4OA 4LSIA 4Z3TA 4FUVA 5B5EO 4FSOA 4FT6A 3NJTA 4GF4A 1THQA 2F1TA 4FESA 2KXPB 4N75A 3NSGA 4O49A 4D65A 3VZWX 2WVPA 2W81C 4KR8A 1ZHZA 2AXTO 2LFUA 4GCPA 1QJPA 2ERVA 3LK2B 2M07A 2O4VA 4AKRA 1HXTA 1P4TA 2R88A 4O4UA 1OSMA 3WU2O 4FZMA 2YNKA 4O3WA 3T24A 4AYEC 4LSEA 4FRXA 3POQA 5G39A 4JFBA 2IWWA 2Y0LA 3HW9A 3BS0A 3VY9X 5B66O 3LK3B 3SY9A 2W80C 3DA3A 6PRNA 2PRNA 1ZHYA 7PRNA 4RLCA 1ZHXA 4AKMA 2ODJA 3UAQA 1ZHTA 3UPGA 1PHOA 5DL6A 4C4VA 5DL8A 2R4NA 1IZNA 3JCUO 5D5DA 5TISO 2XTRA 3RBHA 1GFMA 2KDYA 3G7GA 3LK42 4FOZA 1QJ9A 3BRYA 3DZMA 3SY7A 3T0SA 3PORA 3VE2A 1Q9FA 4E1TA 2IWVA 1G90A 5ADXL 2F1VA 4K3BA 3O0EA 1HXXA 4E1SA 2XE3A 4FRTA 4GHBA 8PRNA 5H2FO 1BH3A 4O4XA 2XTQA 4AZLA 4N74A 3WI5A 1QJ8A 3LK41 3UU2A 2PORA 1OPFA 2KZ7A 3DA4A 4O3YA 3AAAA 4AYID 3VE1A 5G3AA 1MM4A 4QQ1A 3AA7A 3DWNA 4IL6O 4BUMX 3GP6A 5GTIO 4FZNA 4D5UA 3JTYA 2XE5A 4C69X 3AA0B 3DWOX 3C5OA 4FQEA 3AA6B 1GFNA 3A2SX 3AA1A 2J4UP 1T1LA 3EMNX 5PRNA 5KAFO 4C00A 4N59A 3SYBA 2FGRA 4FSPA 4PR7A 5DL7A 3A0HO 3LK2A 4G76A 1GFPA 4XNKA 2KC0A 1H6S1 3POUA 4AUIA 3V8UA 4K3CA 4PUXA 5G26A 3K19A 4O3XB 4B61A 2R4PA 4UB8O 1HXUA 5IYUA 1ZHWA 5JDPA 3LK3A 2WJRA 3AAEA 4RJXA 3HOEA 3HWBA 2MHLA 2N2MA 1PRNA 3PRNA 5KAIO
chains in the Genus database with same CATH topology
4FQEA 2F1CX 4CTDA 2WJQA 2IWWA 2IWVA 2WJRA 2JQYA 4PR7A 2WVPA 2X9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FQE A;  2F1C X;  4CTD A;  2WJQ A;  2IWW A;  2IWV A;  2WJR A;  2JQY A;  4PR7 A;  2WVP A;  2X9K A; 
#chains in the Genus database with same CATH topology
 5DL5 A;  1GFO A;  2JMM A;  3VZU X;  4UB6 O;  2XE2 A;  4GCS A;  5AFU K;  4AKR B;  1MM5 A;  2OMF A;  3KZI O;  2K4T A;  4N58 A;  1YS5 A;  1BT9 A;  2YPV A;  3AA7 B;  3TZG A;  2KXP A;  2J1N A;  4PJ0 O;  3FYX A;  4AYN A;  2FGQ X;  4XNL A;  4O3Z A;  5GTH O;  3PGS A;  4G75 A;  4KRA A;  4RL9 A;  3KVD D;  3PQU A;  4LSF A;  5T5F A;  3SZD A;  2R4L A;  3QRC A;  2Y0K A;  5EE2 A;  3PF1 A;  2QTK A;  3A0B O;  3AA1 B;  1BXW A;  3PGR A;  2Y2X A;  4FZL A;  3VY8 X;  4CTD A;  5ADX K;  1MPF A;  4C4V B;  2Y0H A;  3T20 A;  1IZN B;  2X9K A;  4JCH A;  4RJW A;  1T16 A;  2MNH A;  2F1C X;  2XMX A;  3WI4 A;  1S5L O;  1E54 A;  3BRZ A;  2X27 X;  3POX A;  4AYM C;  3AA0 A;  4U9C A;  1Q9G A;  4D64 A;  3AA6 A;  4GCQ A;  4AYD C;  3SYS A;  5AFU L;  5GV0 A;  4AFK A;  1GFQ A;  2ZFG A;  2K0L A;  1ORM A;  3AAE B;  2JQY A;  2R89 A;  4F4B A;  2XE1 A;  2Y7S A;  4KR4 A;  4RLB A;  5G38 A;  3QRA A;  2ZLD A;  2KZ7 B;  2XG6 A;  3PQS A;  5E79 O;  3HOL A;  3AAA B;  3PGU A;  5FVN A;  3SZV A;  3VZT X;  2M06 A;  2LHF A;  2R8A A;  2WJQ A;  2N2L A;  2GE4 A;  4FMS A;  4LSH A;  2R4O A;  4LSI A;  4Z3T A;  4FUV A;  5B5E O;  4FSO A;  4FT6 A;  3NJT A;  4GF4 A;  1THQ A;  2F1T A;  4FES A;  2KXP B;  4N75 A;  3NSG A;  4O49 A;  4D65 A;  3VZW X;  2WVP A;  2W81 C;  4KR8 A;  1ZHZ A;  2AXT O;  2LFU A;  4GCP A;  1QJP A;  2ERV A;  3LK2 B;  2M07 A;  2O4V A;  4AKR A;  1HXT A;  1P4T A;  2R88 A;  4O4U A;  1OSM A;  3WU2 O;  4FZM A;  2YNK A;  4O3W A;  3T24 A;  4AYE C;  4LSE A;  4FRX A;  3POQ A;  5G39 A;  4JFB A;  2IWW A;  2Y0L A;  3HW9 A;  3BS0 A;  3VY9 X;  5B66 O;  3LK3 B;  3SY9 A;  2W80 C;  3DA3 A;  6PRN A;  2PRN A;  1ZHY A;  7PRN A;  4RLC A;  1ZHX A;  4AKM A;  2ODJ A;  3UAQ A;  1ZHT A;  3UPG A;  1PHO A;  5DL6 A;  4C4V A;  5DL8 A;  2R4N A;  1IZN A;  3JCU O;  5D5D A;  5TIS O;  2XTR A;  3RBH A;  1GFM A;  2KDY A;  3G7G A;  3LK4 2;  4FOZ A;  1QJ9 A;  3BRY A;  3DZM A;  3SY7 A;  3T0S A;  3POR A;  3VE2 A;  1Q9F A;  4E1T A;  2IWV A;  1G90 A;  5ADX L;  2F1V A;  4K3B A;  3O0E A;  1HXX A;  4E1S A;  2XE3 A;  4FRT A;  4GHB A;  8PRN A;  5H2F O;  1BH3 A;  4O4X A;  2XTQ A;  4AZL A;  4N74 A;  3WI5 A;  1QJ8 A;  3LK4 1;  3UU2 A;  2POR A;  1OPF A;  2KZ7 A;  3DA4 A;  4O3Y A;  3AAA A;  4AYI D;  3VE1 A;  5G3A A;  1MM4 A;  4QQ1 A;  3AA7 A;  3DWN A;  4IL6 O;  4BUM X;  3GP6 A;  5GTI O;  4FZN A;  4D5U A;  3JTY A;  2XE5 A;  4C69 X;  3AA0 B;  3DWO X;  3C5O A;  4FQE A;  3AA6 B;  1GFN A;  3A2S X;  3AA1 A;  2J4U P;  1T1L A;  3EMN X;  5PRN A;  5KAF O;  4C00 A;  4N59 A;  3SYB A;  2FGR A;  4FSP A;  4PR7 A;  5DL7 A;  3A0H O;  3LK2 A;  4G76 A;  1GFP A;  4XNK A;  2KC0 A;  1H6S 1;  3POU A;  4AUI A;  3V8U A;  4K3C A;  4PUX A;  5G26 A;  3K19 A;  4O3X B;  4B61 A;  2R4P A;  4UB8 O;  1HXU A;  5IYU A;  1ZHW A;  5JDP A;  3LK3 A;  2WJR A;  3AAE A;  4RJX A;  3HOE A;  3HWB A;  2MHL A;  2N2M A;  1PRN A;  3PRN A;  5KAI O; 
#chains in the Genus database with same CATH homology
 4FQE A;  2F1C X;  4CTD A;  2WJQ A;  2IWW A;  2IWV A;  2WJR A;  2JQY A;  4PR7 A;  2WVP A;  2X9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...