2IWWA

Structure of the monomeric outer membrane porin ompg in the open and closed conformation
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
277
structure length
277
Chain Sequence
b'NDWHFNIGAMYEIENVEGYGEDMDGLAEPSVYFNAANGPWRIALAYYQEGPVDYSAGKRGTWFDRPELEVHYQFLENDDFSFGLTGGFRNYGYHYVDEPGKDTANMQRWKIAPDWDVKLTDDLRFNGWLSMYKFANDLNTTGYADTRVETETGLQYTFNETVALRVNYYLERGFNMDDSRNNGEFSTQEIRAYLPLTLGNHSVTPYTRIGLDRWSNWDWQDDIEREGHDFNRVGLFYGYDFQNGLSVSLEYAFEWQDHDEGDSDKFHYAGVGVNYSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN G
publication title Structure of the Monomeric Outer-Membrane Porin Ompg in the Open and Closed Conformation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ion channel
total genus 60
structure length 277
sequence length 277
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09381 Porin_OmpG Outer membrane protein G (OmpG)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.40 Mainly Beta Beta Barrel Porin monomeric porin ompg 2iwwA00
4CTDA 2WJRA 4PR7A 2WVPA 4FQEA 2JQYA 2IWWA 2X9KA 2F1CX 2IWVA 2WJQA
chains in the Genus database with same CATH superfamily
3QRCA 1GFQA 1THQA 2W81C 4RJWA 3K19A 2K0LA 3AA7A 3DWOX 2K4TA 3HOLA 5G38A 2R8AA 3TZGA 2AXTO 5DL8A 3DWNA 4UB6O 5DL6A 3VE1A 3VY9X 1QJ9A 1T1LA 4RL9A 1HXTA 4XNLA 3WU2O 3A0BO 4N58A 4XNKA 5PRNA 2KC0A 2KZ7B 4LSHA 4FESA 4O3ZA 6PRNA 4KR8A 3LK41 2ODJA 3PGRA 2XTRA 3V8UA 4E1SA 5G26A 5B5EO 2KDYA 3AA1A 4FZNA 2Y0HA 3UU2A 4GHBA 3T0SA 1BXWA 1GFNA 2PRNA 4LSFA 2F1VA 2X27X 2Y0LA 3A2SX 3DA4A 2GE4A 1QJ8A 2R4LA 3KVDD 3T24A 4B61A 4D5UA 3PGUA 2JMMA 1GFPA 2XG6A 4N59A 2XTQA 3AA6B 4FSOA 3O0EA 2JQYA 4CTDA 5IYUA 4LSIA 4AFKA 3FYXA 3DA3A 4O3WA 1G90A 4K3BA 1HXXA 2ERVA 4BUMX 2WJQA 2XE3A 2ZLDA 3AA0A 3SYBA 4C69X 2KZ7A 2LHFA 4LSEA 4RJXA 3AA0B 2MHLA 1IZNB 5G39A 5H2FO 2F1TA 3PQUA 3BS0A 3VE2A 1HXUA 4PR7A 5AFUL 2YNKA 4G75A 2N2LA 3NJTA 4FMSA 1QJPA 7PRNA 2N2MA 4AYMC 4C00A 4JCHA 3VY8X 3SYSA 3EMNX 4FOZA 4KR4A 5E79O 2IWWA 1T16A 1ZHZA 3DZMA 3AAAB 3HW9A 4FZLA 3BRZA 4FZMA 2R4OA 4PJ0O 3AA6A 3RBHA 4C4VB 3UAQA 2XE2A 1ZHYA 2XE5A 3VZUX 2R4PA 3LK3A 1OSMA 5JDPA 3POUA 3G7GA 2J4UP 1GFOA 2QTKA 4PUXA 1ZHTA 2IWVA 1BT9A 1Q9GA 3LK3B 4GCQA 3JCUO 4RLBA 5ADXL 2O4VA 3KZIO 4FSPA 3LK2A 4QQ1A 4AUIA 3WI5A 1IZNA 4AZLA 3A0HO 2M06A 4AKRB 3SY7A 3LK2B 3BRYA 3PGSA 1PHOA 4O4XA 3VZTX 4E1TA 5GTIO 3PF1A 2XE1A 5KAFO 8PRNA 3JTYA 4GCPA 5DL7A 1ORMA 1PRNA 4O3YA 3PRNA 3UPGA 1YS5A 2WJRA 3WI4A 3VZWX 4AYDC 3HOEA 2KXPB 3AAAA 4G76A 4KRAA 1MM4A 5FVNA 4C4VA 5ADXK 5TISO 3PQSA 3AAEB 4O4UA 4D65A 4O3XB 4FRXA 4AYEC 2LFUA 2R4NA 2ZFGA 3T20A 4RLCA 1E54A 4D64A 4FQEA 1OPFA 1ZHXA 1S5LO 2OMFA 4GF4A 1MM5A 4IL6O 4K3CA 4UB8O 4AKMA 2Y0KA 3AA7B 2F1CX 4GCSA 4Z3TA 3HWBA 3QRAA 5AFUK 1BH3A 5B66O 4F4BA 1MPFA 5EE2A 2FGQX 4AKRA 1Q9FA 2X9KA 5G3AA 3C5OA 2PORA 2W80C 4FRTA 2YPVA 4O49A 2J1NA 3SY9A 1ZHWA 2M07A 2Y7SA 3PORA 4N75A 2WVPA 4FT6A 2R88A 2MNHA 3POXA 5KAIO 5GV0A 4FUVA 2FGRA 5T5FA 1GFMA 1H6S1 5GTHO 4N74A 3SZVA 4AYNA 2XMXA 1P4TA 3AA1B 2KXPA 3NSGA 4JFBA 4U9CA 2R89A 3POQA 5DL5A 3AAEA 4AYID 5D5DA 3GP6A 3LK42 3SZDA 2Y2XA
chains in the Genus database with same CATH topology
4CTDA 2WJRA 4PR7A 2WVPA 4FQEA 2JQYA 2IWWA 2X9KA 2F1CX 2IWVA 2WJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CTD A;  2WJR A;  4PR7 A;  2WVP A;  4FQE A;  2JQY A;  2IWW A;  2X9K A;  2F1C X;  2IWV A;  2WJQ A; 
#chains in the Genus database with same CATH topology
 3QRC A;  1GFQ A;  1THQ A;  2W81 C;  4RJW A;  3K19 A;  2K0L A;  3AA7 A;  3DWO X;  2K4T A;  3HOL A;  5G38 A;  2R8A A;  3TZG A;  2AXT O;  5DL8 A;  3DWN A;  4UB6 O;  5DL6 A;  3VE1 A;  3VY9 X;  1QJ9 A;  1T1L A;  4RL9 A;  1HXT A;  4XNL A;  3WU2 O;  3A0B O;  4N58 A;  4XNK A;  5PRN A;  2KC0 A;  2KZ7 B;  4LSH A;  4FES A;  4O3Z A;  6PRN A;  4KR8 A;  3LK4 1;  2ODJ A;  3PGR A;  2XTR A;  3V8U A;  4E1S A;  5G26 A;  5B5E O;  2KDY A;  3AA1 A;  4FZN A;  2Y0H A;  3UU2 A;  4GHB A;  3T0S A;  1BXW A;  1GFN A;  2PRN A;  4LSF A;  2F1V A;  2X27 X;  2Y0L A;  3A2S X;  3DA4 A;  2GE4 A;  1QJ8 A;  2R4L A;  3KVD D;  3T24 A;  4B61 A;  4D5U A;  3PGU A;  2JMM A;  1GFP A;  2XG6 A;  4N59 A;  2XTQ A;  3AA6 B;  4FSO A;  3O0E A;  2JQY A;  4CTD A;  5IYU A;  4LSI A;  4AFK A;  3FYX A;  3DA3 A;  4O3W A;  1G90 A;  4K3B A;  1HXX A;  2ERV A;  4BUM X;  2WJQ A;  2XE3 A;  2ZLD A;  3AA0 A;  3SYB A;  4C69 X;  2KZ7 A;  2LHF A;  4LSE A;  4RJX A;  3AA0 B;  2MHL A;  1IZN B;  5G39 A;  5H2F O;  2F1T A;  3PQU A;  3BS0 A;  3VE2 A;  1HXU A;  4PR7 A;  5AFU L;  2YNK A;  4G75 A;  2N2L A;  3NJT A;  4FMS A;  1QJP A;  7PRN A;  2N2M A;  4AYM C;  4C00 A;  4JCH A;  3VY8 X;  3SYS A;  3EMN X;  4FOZ A;  4KR4 A;  5E79 O;  2IWW A;  1T16 A;  1ZHZ A;  3DZM A;  3AAA B;  3HW9 A;  4FZL A;  3BRZ A;  4FZM A;  2R4O A;  4PJ0 O;  3AA6 A;  3RBH A;  4C4V B;  3UAQ A;  2XE2 A;  1ZHY A;  2XE5 A;  3VZU X;  2R4P A;  3LK3 A;  1OSM A;  5JDP A;  3POU A;  3G7G A;  2J4U P;  1GFO A;  2QTK A;  4PUX A;  1ZHT A;  2IWV A;  1BT9 A;  1Q9G A;  3LK3 B;  4GCQ A;  3JCU O;  4RLB A;  5ADX L;  2O4V A;  3KZI O;  4FSP A;  3LK2 A;  4QQ1 A;  4AUI A;  3WI5 A;  1IZN A;  4AZL A;  3A0H O;  2M06 A;  4AKR B;  3SY7 A;  3LK2 B;  3BRY A;  3PGS A;  1PHO A;  4O4X A;  3VZT X;  4E1T A;  5GTI O;  3PF1 A;  2XE1 A;  5KAF O;  8PRN A;  3JTY A;  4GCP A;  5DL7 A;  1ORM A;  1PRN A;  4O3Y A;  3PRN A;  3UPG A;  1YS5 A;  2WJR A;  3WI4 A;  3VZW X;  4AYD C;  3HOE A;  2KXP B;  3AAA A;  4G76 A;  4KRA A;  1MM4 A;  5FVN A;  4C4V A;  5ADX K;  5TIS O;  3PQS A;  3AAE B;  4O4U A;  4D65 A;  4O3X B;  4FRX A;  4AYE C;  2LFU A;  2R4N A;  2ZFG A;  3T20 A;  4RLC A;  1E54 A;  4D64 A;  4FQE A;  1OPF A;  1ZHX A;  1S5L O;  2OMF A;  4GF4 A;  1MM5 A;  4IL6 O;  4K3C A;  4UB8 O;  4AKM A;  2Y0K A;  3AA7 B;  2F1C X;  4GCS A;  4Z3T A;  3HWB A;  3QRA A;  5AFU K;  1BH3 A;  5B66 O;  4F4B A;  1MPF A;  5EE2 A;  2FGQ X;  4AKR A;  1Q9F A;  2X9K A;  5G3A A;  3C5O A;  2POR A;  2W80 C;  4FRT A;  2YPV A;  4O49 A;  2J1N A;  3SY9 A;  1ZHW A;  2M07 A;  2Y7S A;  3POR A;  4N75 A;  2WVP A;  4FT6 A;  2R88 A;  2MNH A;  3POX A;  5KAI O;  5GV0 A;  4FUV A;  2FGR A;  5T5F A;  1GFM A;  1H6S 1;  5GTH O;  4N74 A;  3SZV A;  4AYN A;  2XMX A;  1P4T A;  3AA1 B;  2KXP A;  3NSG A;  4JFB A;  4U9C A;  2R89 A;  3POQ A;  5DL5 A;  3AAE A;  4AYI D;  5D5D A;  3GP6 A;  3LK4 2;  3SZD A;  2Y2X A; 
#chains in the Genus database with same CATH homology
 4CTD A;  2WJR A;  4PR7 A;  2WVP A;  4FQE A;  2JQY A;  2IWW A;  2X9K A;  2F1C X;  2IWV A;  2WJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...