2IX9A

Respective role of protein folding and glycosylation in the thermal stability of recombinant feruloyl esterase a
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
260
structure length
260
Chain Sequence
b'ASTQGISEDLYNRLVEMATISQAAYADLCNIPSTIIKGEKIYNAQTDINGWILRDDTSKEIITVFRGTGSDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISVQDQVESLVKQQASQYPDYALTVTGHSLGASMAALTAAQLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPAEQGYAHGGVEYWSVDPYSAQNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTSGACTW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERULOYL ESTERASE A
publication title Respective Importance of Protein Folding and Glycosylation in the Thermal Stability of Recombinant Feruloyl Esterase A.
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
total genus 97
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 3.1.1.73: Feruloyl esterase.
pdb deposition date 2006-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ix9A00
1R88A 4UBNA 3WKBA 1VLQA 5ALGA 3D3NA 2OCIA 2RIPA 3B12A 4MWSA 3WLAA 5JAPA 1W75A 1W52X 2GZRA 4HXGA 1T2NA 3WIOA 1O6GA 5AP9A 5LYYA 3UUFA 4EY7A 1JU3A 4BCBA 5EHNA 3DLTA 4X3CA 2BAGA 1C7JA 4UBIA 4XIIA 3RARA 1AKNA 4X6UA 4AO6A 3TGLA 3I6MA 3R40A 3HABA 1UK6A 3O9MA 1DWOA 1IZ7A 4MJ3A 3VJMA 4BAGA 4Y2VA 3LIPA 3G0CA 1E3QA 3O0DA 4PO3X 2BUCA 3V1LA 1A8UA 4KJXA 1HDEA 4FLEA 4W1RA 2G4LA 4CI9A 3IUQA 3AIMA 3V9AA 3BDVA 4HZGA 3W9BA 4BTVA 3WKAA 1C7IA 4Y2PA 5AK3A 2HA7A 3Q8WA 4UHEA 3B5EA 4Y9SA 2WIKA 3M3DA 1TAHA 1JKMA 4HRYA 3FSGD 2X76A 1HBJA 2DQYA 5C81A 4B9AA 4E14A 2O2GA 1NU6A 5CH5A 4C89A 5JAHA 2W6CX 3HSSA 3KWFA 5AI6A 4KAJA 5K3FA 5HZGA 4XJVA 2WIJA 1WHSA 2ZSHA 5JD4A 1IUNA 3I1YA 1XZAA 1AMNA 3EBLA 5CT9A 4AN1A 2WHPB 2HFJA 2PPLA 4LHEA 5LZ4A 4QDOA 3C6ZA 1BEZA 4EY6A 2XUIA 1NX9A 1G4HA 3LIIA 3V48A 2O2HA 4X95A 4WDQA 3IUNA 5IVDA 1YS2X 1CLEA 3QMVA 1CUZA 5AJHA 3DL4A 5BOVA 4FFVA 4WY8A 4AZ3A 4X6XA 3OC0A 1VE6A 5CXUA 4BVKA 3WWPA 4CIBA 4U2CA 1H23A 1XQYA 5IVIA 1OXMA 1UKAA 1VZ3A 1UK7A 3G0IA 4AB1A 4DMHA 4MEAA 4N5IX 3GA7A 1DINA 2ZYIA 3WL5A 2ACKA 1FFAA 3T4UA 1MNAA 3H1BA 3V1KA 1FSSA 3PI6A 3KWJA 1JU4A 4A5SA 4DM7A 3WWOA 1WHTA 2AXEA 3AZPA 1CUVA 1XFDA 2XUAA 1JT2A 4G1FA 2C5GA 3U1TA 3O95A 1J2EA 1ZD3A 5AI0A 1BRTA 4S0XA 2BFNA 5CT4A 1NU8A 5ALXA 1BN6A 1QTRA 1U2EA 3C8DA 1ORVA 1XZIA 3IIIA 2OLEA 4B0PA 4BE4A 3FYUA 4BDTA 1KU6A 4Y2TA 1P0QA 4G4GA 4UFPA 3W2TA 4BB0A 5AKZA 2GBFA 5T4EA 1ODSA 4B7ZA 2VEOA 4RNCA 4X94A 3WK8A 2C58A 2PU5A 5FV4A 3CCBA 5K5EA 3W06A 4K2AA 5EI5A 3E0XA 1YS1X 4RPCA 4RGYA 4RE6A 5ALJA 3OG9A 5DLPA 3D2AA 2ONCA 2J3QA 3OM8A 3R3XA 3MUNA 4P92A 1YB7A 1AUOA 3R3ZA 3DNMA 2VF2A 2XMGA 2OG1A 3D2CA 1YB6A 1CUDA 5D6OA 1WB4A 1YAJA 1AC5A 5JZ9A 5AHXA 5CH8A 1MT3A 5AK4A 4C6HA 2WG0A 2I3ZA 3BE8A 1GPLA 1DT3A 2QXUA 3P2MA 1DX6A 1YSCA 3MUOA 1QZ3A 3QYJA 2FJPA 2B61A 1BN7A 2BKLA 4GDMA 4N8SA 3EIOA 1LZKA 2C7BA 4GLBA 4J3JA 4WCVA 3C5VA 3A2MA 5AO9A 3WL7A 1GZ7A 1ZIXA 1VZ2A 3I2GA 4Y2JA 3ANSA 1YASA 1XLWA 1IUOA 1QJ4A 2QR5A 4XWGA 2XUQA 1XROA 3AINA 4Y2XA 1XZBA 1QFSA 2WJ3A 3D0KA 1K5PA 3G9XA 2IITA 5DNVA 4DIUA 4IHAA 1CUXA 3R3YA 2XLBA 3WK9A 4DNQA 3VVLA 2XE4A 3WI7A 1VJ5A 5K3DA 1D07A 5ALTA 1VA5A 2XMBA 2HA5A 5K3FB 1F8UA 2AJLI 4PSCA 1L7RA 3HYSA 3T52A 3QMWA 3BF8A 3D4LA 5LKAA 5T4FA 4LKOA 1GQSA 3R41A 2WSLA 1W1IA 2Q0XA 4Q3LA 5T4BA 1IUPA 1OCEA 1UT6A 4WY5A 4BDSA 5FPQA 5I9IA 5ALIA 3ESAA 3OOSA 4W63A 2O7VA 2HU5A 1S8OA 2V97A 4PSUA 1ZGBA 3WZMA 3I2IA 3KDAA 2JGEA 3R3VA 1FFDA 3H04A 5AM5A 5A2GA 4E11A 2BUBA 5J3JA 3O9VA 3QPCA 5CW2A 3DYIA 3MVEA 2PUJA 3G02A 1DWPA 3STVA 2YYSA 5JALA 2CKMA 3ZWQA 4B83A 2CEKA 1R1DA 1R9NA 4TVKA 3WIBA 2CJPA 1IVYA 2XUJA 2XUDA 2C0PA 1TIBA 4MQMA 3FLBA 2HU8A 2XQIA 3TRDA 4BRZA 3FVTA 3SWWA 5A7GA 2FUKA 3NOXA 3R0VA 4CG3A 4KAFA 4PW0A 4X92A 3AJAA 2WJ6A 3R3WA 4CCWA 2AJ8A 4DNOA 3WA6A 4J0HA 3WJ1A 4M0EA 1LBTA 1CUYA 3A6ZA 1XRMA 2UZ0A 2VJAA 2GBIA 2HU7A 1EI9A 3F67A 4DYHA 1QIFA 4WFIA 1UOOA 3FYUB 5AI5A 2WFMA 5K3EA 1ZD4A 5AKHA 1EINA 4G4JA 5DYYA 2J4CA 3VDXA 2YASA 2WUEA 4HXEB 4UUQA 4X97A 5IH7A 4U2GA 2FJ0A 1XQWA 1LLFA 1ZD5A 1XQVA 1XLUA 3BIWA 3IB3A 1B41A 3C5WP 2GBGA 1J06A 3FLAA 1E66A 7YASA 1BS9A 1CFJA 2C5FA 4BAUA 5KWIA 1N5RA 4G9GA 1XKLA 4G8BA 2Z3ZA 5CH3A 1ACJA 4B81A 1MX9A 1XRNA 4B84A 1R4ZA 4OSEA 1AQLA 1WB6A 3O4IA 4B82A 1MAHA 2K2QB 3QH4A 5A7FA 1SC9A 1W4LA 5ALHA 2OXEA 1QO7A 3F97A 3TEJA 1HQDA 1QLWA 1UFOA 3CN9A 4AO8A 3WL8A 4FHZA 5CMLA 2HFKA 3WQHA 3PE6A 1E5TA 3E4DA 4AMZA 4PF1A 4H0CA 4J0JA 2CUTA 3EF3A 1LPSA 1R50A 1G66A 3EQ9A 3RKSA 1IZ8A 3BDIA 3W9UA 2HHAA 1SCIA 3AZQA 4C4ZA 4OU4A 3IBTA 4UHCA 4ZXFA 5ALYA 3VJLA 3STXA 1Q0RA 1QE3A 4IQ4A 5AM4A 5FLKA 4A23A 4FOLA 5JASA 3E1GA 3OURA 2JGIA 5LP1A 4AZ0A 1H22A 1WB5A 4GBGA 3ILSA 4EBBA 5AOCA 3IDAA 1GQRA 4U2FA 1XQXA 5ALPA 1Y37A 1TQHA 4GW3A 4AO7A 3DKKA 3STYA 5IVKA 2WM2A 1CUAA 2BGRA 4M0FA 2QS9A 2JGLA 3OTQA 4P08A 2VJDA 3HJUA 3M82A 1ZOIA 3C6YA 4BCCA 3L1JA 1B6GA 1MN6A 1UOQA 1XRPA 4ZWNA 2J4FA 3SK0A 4HS9A 3I6YA 5JIBA 4FLMA 4IH9A 5CTAA 3SX4A 2ACEA 5DWDA 4DSZA 4AX4A 1EVQA 1JMKC 4MYDA 3O4JA 1BEEA 3DQZA 1MX5A 4K5QA 4UBLA 1TCAA 2PKYX 3DJYA 1XZGA 3IUMA 4D9JA 4UFNA 4KEAA 4FNGA 4IO0A 2V98A 3WKCA 3PFBA 4F5ZA 1BROA 1DQYA 1F6WA 5IVHA 3D5EA 1BCSA 2O2IA 5K3AA 4L72A 3FCYA 2P8SA 1YCDA 3H18A 2XUGA 5H3HA 1JFRA 1QO9A 1QIHA 3GZJA 1EK2A 2GBCA 4DMFA 4DMKA 1CUJA 4GXNA 2RHWA 3PF9A 3GBSA 5AIAA 4G9EA 2B4KA 1U65A 4LXGA 4B85A 1DWQA 4NZZA 4J0KA 1MAAA 4QZVA 2RHTA 2X5XA 1LGYA 5AM2A 1QOZA 3K9BA 1XZLA 1RYYA 5EHQA 2OGSA 2ZYSA 2PSJA 4UBMA 1LPBB 4GI1A 4OB6A 1DQZA 4QA9A 2HRQA 2WIGA 4BYMA 3CXUA 4ARAA 5CT6A 4EHBA 2WUDA 3QM1A 5AKKA 5BWBA 5AK5A 3M83A 3PICA 4DLNA 1K63A 1AZWA 2HIHA 1A7UA 5DTIA 1CRLA 2E3JA 5E4TA 5FDFA 4AQDA 5ALFA 3DS8A 4CG1A 1JI3A 5CXXA 2XQKA 3H0CA 1TRHA 2ZVDA 4BC0A 1QIJA 1JJFA 2DHCA 2VJCA 1SOMA 5A7HA 5LZ2A 1CUCA 2ECFA 4EZIA 5CBKA 4Y2QA 2H7YA 1P0PA 4ZV7A 5JZSA 1FFBA 3ZPXA 4BBZA 3PDCA 3G9UA 5ALDA 1YAHA 4MWTA 2PM8A 3MGAA 1M33A 5AOBA 2ZJ7A 2R11A 3WWCA 3ESDA 1XRQA 1U8EA 3HXKA 2QOEA 3EQ7A 3IULA 1CQWA 1SCQA 3IA2A 4H7JA 4JYPA 4IH4A 4NVRA 5JD5A 4MEBA 1ACLA 5CT8A 3LP5A 4K6GA 3W05A 3H1AA 4P93A 2ZSIA 2VSQA 4ZRDA 4N8DA 4Z49A 1UK8A 2C0QA 4H77A 5DJ5A 3JWEA 3C6XA 5AIBA 1T4MA 1WPRA 3FNBA 3WK5A 3AILA 2ZYRA 3F96A 3KD2A 4NMWA 2XQJA 3ANTA 5D7BA 3ED1A 5SYMA 1H2ZA 4UHBA 5LKRA 2WUGA 5ESRA 5AOAA 1RWQA 2WJ4A 4KR0A 1EHYA 1CUEA 4EUSA 3QZUA 2BJHA 4FTWA 5E4JA 1ZIYA 3F98A 2WTMA 4L9AA 4H7KA 5HF5A 1P0IA 1VOTA 2ORYA 3C6BA 2JIDA 3L1HA 4OUKX 2OCGA 2JEZA 3BIXA 3H2JA 5LLSA 1X2BA 4QDTA 5AKIA 5HF6A 2VT6A 3FAKA 4FWBA 4BZWA 1E89A 4QDZA 5AI4A 4WJLA 2QVBA 2HDWA 1E8NA 2XUPA 2C4HA 4J0CA 3G0BA 1ZJ4A 2VAXA 3FOBA 1XZKA 4G4IA 3STWA 2OCKA 1OILA 1XRRA 3KOOA 2WFZA 4BRSA 2QMQA 2RONA 1H2WA 1E8DA 1UKBA 1EDEA 3STTA 3GUUA 2NW6A 2WHQA 2VA9A 2Y2UA 3DDUA 1FFEA 4Y7DA 3HACA 4DSAA 1Y7HA 4W9RA 4QWMA 4H7HA 2WILA 4K6HA 3WKDA 2AJCA 5I7UA 4B6GA 1HL7A 1ETHA 3PFCA 4X00A 3V1NA 5HKAA 2FX5A 2HA6A 2WKWA 4OU5A 4K6KA 4AN0A 1A8SA 5K3BA 5EIEA 5AM0A 1N1MA 3FLEA 5C8XA 1QIKA 2BGNA 1BU8A 2OCLA 5ALUA 4P9NA 4KRYA 1RP1A 1Y7IA 5LZ9A 3CN7A 1VA4A 3G0DA 4O08A 5HF9A 4ARBA 2QUBA 3QPAA 3FYUC 3O4GA 1J1IA 1QIMA 4U2EA 5HK9A 2IIVA 1EB8A 4YX9A 3AIKA 4FLFA 1MTZA 2YXPX 5AM3A 1EDDA 1CVLA 2VQ6A 3DOHA 1E8MA 4V2IA 1SCKA 4H18A 1XZJA 5K3CA 2WTNA 1TCBA 3M81A 1QFMA 3FVRA 4KE7A 4QEKA 3PF8A 4ETWA 5HCUA 5JARA 5A6VA 3GELA 1GXSA 3GROA 4X85A 4B0OA 5FXMA 1ODTC 1QIGA 3FBWA 4WDRA 1H2YA 1DTEA 3WYDA 4EY4A 5C7YA 2IX9A 2DHDA 4X90A 1K4YA 2G5PA 4N8EA 5LIPA 3I1IA 1VKHA 2HADA 4I4CA 3H2GA 4Q3OA 3WJ2A 2ZJFA 4UHFA 2XDWA 2XI4A 1Z68A 4YK7A 3S2ZA 3G8YA 3GFFA 2ROQA 2VJBA 1QGED 2HM7A 5DYTA 2J3DA 2WIFA 1XZCA 5JADA 3BJRA 4KAAA 1ZI8A 1QIEA 1X2EA 1UK9A 3G9TA 2G5TA 4BTLA 1CIJA 1JJBA 2LIPA 4H7FA 1LNSA 3I6ZA 5JAUA 2VT7A 3HZOA 2ZYHA 1AURA 4J7AA 3QMMA 1YR2A 5AK6A 5JATA 5ALLA 5ALMA 3NGMA 2OPHA 2CZQA 4U2BA 5JANA 1LPAB 2R8BA 4BE9A 4CFSA 1CQZA 3A2LA 2JGJA 1CUSA 5ALRA 2HL6A 4ZREA 5KBYA 2YH2A 3N2ZB 5BV7A 5EIHA 4C87A 1DU4A 5SYNA 4LYDA 4BP9A 2XUKA 3ICVA 5T4HA 1UWCA 1VE7A 2WLSA 1ORWA 5LZ5A 2OAGA 5AI9A 5EIAA 2PSFA 4BVJA 1MU0A 1XZMA 4PSDA 4QLOA 5D3KA 2GYWA 1ZICA 4WFKA 5LZ8A 2AJDA 3I2FA 4KE8A 5HFNA 2QRUA 1I6WA 5AKLA 1QTIA 1P0MA 2H1IA 1QIIA 2WQZA 3IURA 5HQ3A 2CBGA 1TK3A 4QE3A 4F21A 1R3DA 1HLGA 2PSEA 5ALSA 3HEAA 3KXPA 4X91A 4OD0A 3PUHA 1QIDA 4UBJA 3VVMA 5AKXA 2XQFA 2XUOA 1CUUA 4CCYA 1CUHA 1C4XA 2QXTA 4QWWA 3WWDA 3VKFA 3JW8A 4GECA 4HTAA 2DFPA 2XMRA 2QZPA 3WYNA 2XUFA 4LIPD 2AJBA 6YASA 1WOMA 2DCMA 4OB8A 1XZHA 4HAIA 4DTCA 4FBLA 4W1QA 4Y2UA 4HRXA 3CCCA 2H9YA 3KSRA 3ZI7A 4Q34A 3WKEA 1YA4A 4W1SA 3WK4A 2QUAA 5EFZA 1THTA 4UPDA 1Q84A 3A70A 3ZV7A 1FFCA 3I2JA 2DSNA 3D59A 4I3FA 3VJKA 1AGYA 3H17A 2B9VA 1EVEA 5A71A 1EDBA 2B20A 3C45A 3C87A 4H7IA 2I78A 5IKXA 2EDAA 5E4YA 5HF8A 4OCZA 4X6YA 4EY8A 4KE6A 4QLAA 5LZ7A 1PJAA 1F0PA 2QTBA 4N5HX 4BP8A 4PV7A 3BL8A 5KREA 1LPPA 3AZOA 3NWOA 4H35A 3F8SA 4AMYA 1XZEA 1Q83A 5EHZA 2HA2A 1ODCA 2WG1A 1MO2A 2Z8XA 5CT5A 4PNZA 4FKBA 2JBWA 3JYHA 2PX6A 2PVSA 4F60A 2HA0A 1MJ5A 5A62A 1K8QA 3DD5A 3WL6A 5FOQA 3U0VA 5DNUA 2WHRA 1MX1A 1O6FA 3DEAA 5JZBA 4C4XA 2H7XA 1LPMA 4C01A 4MXDA 1TCCA 1ZD2P 4UBOA 1N5MA 4WFJA 5AICA 3F9CA 4FDMA 1F0NA 3WMRA 4Q05A 5FUMA 3PUIA 2JF0A 5AKYA 3C70A 1LZLA 2OGZA 1KU0A 3ZLTA 4BAZA 1G5FA 1ZI6A 3VXKA 4OPMA 5EHXA 2QJWA 2VATA 5HKBA 4DNFA 1K6EA 3VISA 1BCRA 1N8SA 2DQZA 1CUGA 3STUA 5CRIA 5DTJA 4BCDA 3WK7A 4DNPA 3K6KA 2RAUA 3AIOA 4A16A 3A2NA 5AKEA 1JMYA 2WIDA 1ISPA 4FBMA 1WM1A 4Y2YA 5ALKA 1LPOA 3RK4A 5ALWA 4JH0A 3OPMA 2Y1KA 3C8HA 4UHHA 4UBKA 4IH1A 1WPXA 5I8PA 3X3HA 3V1MA 1ZJ5A 3DKRA 4E15A 1MPXA 2GYVA 2X8BA 3H2HA 4L0CA 1UZAA 5FRDA 1ZI9A 3HC7A 4HXFB 2PL5A 4BATA 1A8QA 1TKRA 4BC1A 4UHDA 4UFOA 4PQEA 4EY5A 2OGTA 3RM3A 3ICWA 2DHEA 2WFLA 2RI6A 1CEXA 4ZGBA 4CG2A 4ROTA 2JGFA 2XQGA 4ZV9A 4QDXA 2D0DA 4INZA 1KEZA 4OB7A 4LYEA 5HQ3B 2CMFA 5AKJA 2WU4A 3ZLUA 4B9EA 3NUZA 4JNCA 5BWCA 2XMCA 1VXOA 3H2IA 2WUFA 3K2IA 4LXHA 4DMCA 4Q3KA 4X7BA 5FKJA 3IUJA 4W1PA 1W6RA 4C88A 2VAVA 2EDCA 3SC2A 1PFQA 1EK1A 3ESBA 5ALQA 1UXOA 4KE9A 5JYCA 4G8DA 1EB9A 4CCYB 2QT9A 1CV2A 4BZZA 2XMQA 2G63A 2I03A 1ZGCA 3D7RA 1L7QA 4JYMA 1CR6A 4CIAA 2D5LA 4FFWA 5AKGA 3DYVA 1JJIA 1HPLA 1XLVA 5EGNA 3UUEA 4H7DA 2HA3A 4TPKA 5DNWA 1YA8A 1A88A 1VXRA 4XVCA 2PU7A 5CURA 3S8YA 2OQIA 2PBLA 5ALNA 5AM1A 4MYSA 3D2BA 1Q0ZA 4X71A 4YPVA 1GGVA 2ZJ6A 3LLCA 1H2XA 3DOIA 1EXWA 4LXIA 4G5XA 2HA4A 4QNNA 2Z3WA 3QBJA 2Y6VA 4FNMA 1EX9A 4JEIA 2PUHA 4U2DA 2ES4A 3WZLA 3E3AA 4TGLA 1XZDA 1J07A 3WK6A 4L3WA 2BCEA 5ALOA 2H7CA 4EA6A 3FYTA 4EB0A 1EA5A 5YASA 2WG2A 3ZLVA 5ALVA 1CUFA 5KWJA 2XMDA 1DX4A 2XT0A 3WA7A 3Q0TA 3UMJA 1X70A 2Y2VA 3BF7A 3HRHA 1EH5A 3FCXA 2JGMA 4NS4A 2WHPA 5HFAA 4DGQA 4X93A 5C8VA 1U4NA 1WCYA 2JEYA 5ALEA 2Y6UA 2O7RA 2V96A 4E46A 4Y2SA 1GKKA 1CUWA 2GZSA 1IMJA 3AUKA 5DYWA 4OYLA 3BWXA 4ITVA 4F0JA 4GEGA 2W22A 3TJMA 4GHWA 4Q82A 1LBSA 3EQ8A 4M0MA 2HRRA 3I2HA 1GPKA 4H7EA 4J0IA 3FSGA 5C8ZA 3B3QA 3I2KA 3W04A 3DCNA 1L7AA 4Q1VA 4G8CA 5AI8A 1QONA 1LPNA 3O4HA 5F4ZA 3ESCA 4GWLA 4ZI5A 5ISMA 2XB6A 2DR0A 5FPPA 2Z5GA 4YASA 4AXBA 2XUHA 2JGKA 3G0GA 2PSDA 3YASA 3HLKA 2I3DA 1USWA 3LCRA 1FJ2A 4KACA 1XZFA 4Y2RA 3QPDA 2BUAA 4KYVA 1SFRA 3QITA 3G9ZA 5AH0A 1BE0A 1MNQA 1G42A 4B80A 1THGA 3QVMA 1GKLA 4RE5A 3BJMA 2QJRA 1DT5A 5HK8A 4J0DA 5E2IA 3BXPA 4OYYA 1GT6A 2GYUA 2WU3A 4I19A 3FWHA 4J03A 5ALZA 5FP0A 2V9ZA 3IVMA 4BVLA 2XLCA 4FMPA 1R9MA 3R3UA 1CUIA 3G7NA 1XKTA 2XMZA 2PSHA 3N0TA 4QDUA 3AFIA 2CB9A 3I28A 3WWEA 4JUIA 5D3ZA 3H19A 2OAEA 2QM0A 1UOPA 3L1IA 3RLIA 2RGUA 2OQVA 5JAOA 1UKCA 4MQLA 3C43A 1GPNA 2EEPA 2QKYA 2WFLB 4J0GA 3DL7A 3LS2A 3H2KA 4HVTA 1AX9A 4KRXA 2Z8ZA 4C4YA 3HI4A 1PV1A 1W76A 4XX1A 2XMSA 5JD6A 1CUBA 1XRLA 1CPYA 1HKHA 2VTVA
chains in the Genus database with same CATH superfamily
1SCBA 5ALGA 3MPUA 1CP2A 2IDMA 3BXFA 4I5GA 1UQRA 1S2LA 4TZ0A 2OCIA 3REGA 4GXRA 2ENWA 3DR5A 1QH8B 1ZA1A 2OHXA 1RMYA 4QELA 4MR8A 4XPIA 5FUVA 4NG4A 3NBZC 4DYDA 3WLAA 4FQ7A 3RGWS 1I0IA 1C8VB 3LFTA 4YJHA 3SC2B 4YJFA 1HV8A 2FXIA 1JWBB 4K9OA 1AHIA 1T2NA 2O1XA 2GUWA 2OBMA 4R5HA 4DA0A 3VR5A 1JKJA 3BMNB 2NT4A 5A4IS 3F6YA 1GN9A 2GAFA 3BD7A 1JU3A 3I61A 1NUUA 4WGFA 1NAHA 2Y1GA 4TXLA 1Z4JA 2H0AA 5FOXA 4Q21A 4QC2A 4REQB 1MAUA 121PA 3AB7A 1WSBA 3M6XA 5E0OA 1C7JA 4FPXA 1EXVA 4J6FA 1AKNA 1IU9A 2Z56A 5F9MA 1SC1A 2QP9X 3ITKA 3SDSA 3CU5A 3U09A 3TNLA 3ETGA 4WD3A 3U5TA 1BW9A 1TFUA 3MXTA 1Q7RA 3NUQA 3O9MA 4OXKA 4AMUA 1DWOA 1GYPA 5K9ZA 3KE8A 2M1XA 4MJ3A 4AKHA 4PO8A 3SVZA 5HIKA 1MEEA 3HJAA 3G0CA 4HQ6A 1I4EB 1DP4A 3LH5A 1O5OA 1E3QA 2I76A 3WFZA 3VDRA 2ORVA 2B8EA 3O0DA 2DAPA 2REXB 5KQRA 3C3JA 1UFVA 2IHUA 2ODBA 5A05A 4WPGA 1H1DA 3QJYA 4KJXA 3L01A 1ZMOA 4XRGA 3GMIA 4QPJC 1K0FA 2B92A 4NHOA 2PO5A 4R69A 1G8AA 4FLEA 4FEGA 4CI9A 4DPKA 4YJGB 3V9AA 1AS2A 1NN1A 1TX4B 2YMMA 3RHTA 2IYSA 2CXHA 2KI5A 1P3JA 1C7IA 5TDHA 2GILA 2OMEA 5AK3A 2HA7A 4XX0B 3VVBA 3T3NA 1M7HA 4NHEA 4Y9SA 4JK3A 2OP1A 2IS1A 4BB6A 4F96A 1QFJA 4PICA 1HDYA 1NMSA 1KOLA 3FSGD 3UANA 4F85A 4M37A 1RHUA 3KS9A 4QGGA 5C81A 4LZLA 4JB0A 4GVXA 1WMAA 1LJLA 4DMMA 5K45A 2AFHA 2QYSA 1GRNA 1Q57A 4J4BA 3RSQA 1B76A 4COKA 2W6CX 3HSSA 3ZHRA 4G5RA 4KAJA 1AOXA 5AVRA 4F4HA 3LLVA 3VYSB 5JE8A 2Q45A 1G8MA 1XZNA 3P71T 1USVA 3FR7A 3LECA 1E1QA 2CDNA 2WIJA 4XJVA 7GPBA 3PC8C 4O4LA 4BZXA 4GSYA 3TIVA 1IBLB 1TD1A 2VK2A 1Z0KA 3EBOA 4LJ9A 4D9GA 4ZN6A 1KI2A 2OHGA 4EHIA 4UM9B 3ZGOA 5CIQA 4ZCTA 5IJ9B 1QVRA 1AGXA 4TTIA 1Y3HA 1D6NA 3EBLA 1G291 1P7PA 5GGXA 4F7WA 4XVHA 3IHLA 4UVHA 4RLQA 5CT9A 1XOIA 3JQ9A 4ZPJA 5HE8A 3P97A 4MUFA 2ATIA 4PZEA 4X9XA 2P41A 4G97A 2AC2A 4LHEA 5EIWA 4NH4A 1MO6A 1A27A 4WV3A 1XHFA 2NSLA 1QP7A 1PZFA 4GIBA 2A78A 2ICAA 3CNLA 3HCBA 5DSXA 3A9WA 3V3TA 3TMAA 4EGCB 4UUMA 2IYFA 1BEZA 1MW9X 1Z8DA 1B3BA 2XA1A 4EY6A 1SVNA 2AI3A 2D5IA 3BMOA 3W3AH 1JQBA 3LIIA 1ECCA 4X1OA 4WDQA 3QX9A 2JLXA 4MP3A 1U7XA 1F60A 1YS2X 4C07A 2B1RA 2G9ZA 4ZVNA 4M7PA 3JARA 4KIUA 4DABA 1FU7A 2V7WA 2FWPA 4IV0A 4QT0A 2IDKA 2ZIUB 2ZRNA 3RS8A 2GETA 4RZUA 1ZBDA 4QO7A 1YRQA 4CPDA 2IP4A 4F1KA 3EW9A 1SBNE 5BOVA 4IYJA 2WD7A 5EIFA 3LBHA 1AKWA 5EPUA 3OOHA 1HT2E 1M76A 5F1PA 2GARA 3LW8A 2F1IA 3O8OA 3A2KA 1D09A 1PJSA 3I5XA 3OLYA 1ULAA 4U2CA 2AFIA 2XMPA 1T13A 1E9RA 2AXQA 3VO9A 3SBXA 4GOMD 1YKFA 4R68A 2R6DA 4OHKA 4XW2A 1HQKA 1X3SA 3Q87B 5FTNA 1HYQA 3WY9A 4HMPA 4G0NA 3WIDA 2FW0A 1UKAA 2I6SA 4XB2A 3ZXYA 1CKEA 5C5DA 2NXEA 1VZ3A 2PKQO 2Z58A 3K6RA 2P6NA 4DB4A 3NXSA 4CQNA 3SD7A 3K2EA 2AOTA 3VFDA 2NO0A 2YWXA 3THSA 1DEAA 4BN4A 3IHWA 4DMHA 3DPUA 4P81A 1XMOB 2HSDA 4M0LA 1FX0A 1GGNA 2VHWA 1MT0A 2QG4A 3OA2A 4M88A 4MEAA 5CIWA 1N2CB 3UK2A 3VH4A 1J2YA 2I54A 2IEGA 4E7PA 1FUYB 3V00A 5EJ5A 3GA7A 1DINA 2IKSA 1GNLA 3WL5A 2JFGA 2PFKA 4JLMA 2QTNA 4X7MA 1M0SA 3B3AA 2J67A 1PEYA 1MNAA 1XLTA 3W5DA 2OAQ1 5K1ZA 3KQKA 2ZJOA 3TYXA 3LCMA 221PA 5BMVA 2BE7A 3AEUB 5BUCA 1UBUS 3TGPA 3A9TA 2HSJA 3CJQA 4RY8A 1UC4B 4DM7A 4A5SA 2I1LA 5U9CA 2ZWPA 5TARA 4URHA 1WHTA 5KDDA 3CLTD 2AKYA 1X8KA 3AZPA 4ZYXA 3UNXA 1LF0A 2XUAA 3T3EA 4P84A 4I0WB 1J33A 1TMOA 3E8SA 4TKLA 4B1FA 3L8ZA 3U1TA 4OHMA 4RIEA 1YXMA 1T43A 2OSBA 1S3IA 4P4UA 2A30A 2ZUVA 3HKBA 3Q9SA 1GPDG 1GEGA 1RHKA 3WGTA 5ES3A 1QQ5A 2O7QA 1KFEB 1G0NA 1PEKE 2VCYA 4MUXA 3C8DA 1V71A 4IWYA 1WO8A 1FPMA 2TRSB 3HKCB 1ZX1A 5HKKA 1HT1E 5IXYA 1AKVA 1DCMA 2M9MA 1XTJA 2OLEA 3JD2A 1EFCA 2ZYAA 4U8GA 3ZD8A 1TZ2A 1FYDA 5I7HA 1K7XB 5DASA 1MO3A 4BNIA 2CNLA 3ME5A 3ONNA 3FRHA 2RHMA 3HMQA 2XADA 4G4GA 4B5LA 3S6JA 1BHSA 3UJCA 1PU2A 3IA7A 5IBCA 4V0OA 2XT6A 4CGZA 3W2TA 3GEIA 5BORA 1KQOA 2V5VA 4JT9A 2G9NA 2VLIA 4ARVA 4BB0A 1AK2A 1QUEA 3ZDRA 10MHA 5AHOA 4FYPA 4CLOA 3HDGA 2BONA 3P9IA 5G4KB 2GBFA 1UXJA 2N75A 3CZCA 3VYUB 4OG2A 4RD3A 1HDIA 1ODSA 3BHNA 3RBZA 1NUQA 2YMQA 4HNHA 4IMJB 5A04A 5A6SA 1JTVA 5AVTA 2RE8A 2RI1A 2VEOA 3CLKA 3O26A 4X94A 4XGRA 4R1MA 2C58A 2IEIA 3WK8A 4EDFA 2F8SA 3LWDA 4DBLC 3HRKA 5K5EA 4O4JA 3PP8A 5CIYA 2RD2A 4H15A 4HDSB 4BKPA 3W06A 2R8XA 3QPUA 4K2AA 4LA4A 1OMOA 4M2LA 4YHHB 1EEXB 2ZIWB 1A71A 2Z95A 2UUBB 2DBZA 3KKZA 2BFPA 1HE8B 4ZU6X 1M2HA 4EJSB 3D2AA 2V7TA 3CR3C 4NONA 3MGGA 2J3QA 1RLOA 3SXUB 5LMCA 2H4XA 2BR5A 1PYDA 3EGOA 2B2NA 4MNTA 4XFKA 4ZJYA 2IE8A 4OXQA 1G21E 3GFRA 3R09A 5T57A 1OWOA 1P2GA 4XIGS 4DUPA 2O0KA 3O0TA 3HUEA 1OF1A 4S1NA 1T4GA 3AEKB 5TJ9A 5DI3B 1CC1S 2MIIA 2A9KA 1CE8B 4X24A 4DMKA 1AUOA 3R3ZA 4YJ2A 4FFNA 4W5JA 3CH7A 1F2TB 3F2VA 4EF4A 1ANKA 2G1UA 3MS7A 4FR5A 5T6MA 1KJNA 3LYAA 5LXTA 3LKDA 1E7MA 2VJQA 5B7NA 3USCS 5L3QB 4M4SA 2Q3MA 3NHFA 5CK4A 4ESHA 4UVGA 2OG1A 4OQPA 5PNTA 1CUDA 5D6OA 2ZIXB 1E4YA 3WIUA 4XVUA 2Z2YA 5LUAA 3MJRA 5EQDA 2IBMA 4WBNB 1YBHA 4HNAA 4WACA 4MP6A 1V1MB 5JZ9A 1ICEA 3CZPA 4WUVA 1XDGA 4QYIB 5E2BA 2Z09A 2GK3A 3E27A 2VO1A 2DFDA 2I3ZA 1ZONA 5J63A 4LI3X 3AY7A 2D0OB 3MFYA 3WNCA 2V8OA 4JAVC 4B46A 3AKDA 3P2MA 2OLKA 5H4HA 1DX6A 4IRMA 5DB4A 1T5IA 3MUOA 5AK0A 2FMXA 1A8HA 1QZ3A 2I8CA 5EY5B 5KSPA 1RU3A 3QYJA 4C08A 3I9KA 1BN7A 1OYWA 4UZSA 1SQ5A 2PZ8A 3R77A 4GDMA 4IDBA 5JJCA 1PWXA 1P2SA 2QX8A 3GGPA 4LYHA 2WINI 5BVHA 3K0SA 1I1NA 4M9QA 2HT6A 3BKWA 4BN5A 3KLMX 4PPQA 5IHPA 5TR9A 2DFNA 2EGHA 4J3JA 3A9VA 4TTSA 3IQHX 1HEIA 2WLTA 1SB8A 4RMGA 5ENZA 5B58C 5F3WB 1K7SN 3LGAA 3B2EA 3NYQA 5ULLA 4TVOA 1ABEA 4Q9JA 5EZ6B 3V97A 3ZWXA 2QX7A 1R0BA 3HVJA 1U5AA 2DG2A 3OTIA 1X8XA 3PRKE 3A3OA 4NMXB 1ADGA 5AO9A 4D3YA 2PMBA 1HSZA 2EAUA 3EGEA 1EFKA 2ZETA 1IQUA 3FPLA 1ZIXA 4LCEA 3RYFA 3DZGA 3OF2A 3U19A 1W88B 3OO1A 4ARZA 4G5OA 3C3BA 1BVYF 1YASA 1OZFA 5D00A 1IUOA 2R00A 2WVGA 3R7NA 2XZOA 3SEFA 1E1RA 2O59A 5MN4A 1C0LA 2QR5A 4WFQA 1DC8A 3E7XA 1H0KA 4DLLA 3AINA 3E9NA 4Y2XA 1T9KA 1XZBA 2EFJA 1QFSA 2V9CA 2D62A 1PX2A 3V6MA 4RM2A 3GLVA 2HF7A 2WYVA 3MSCA 1NR1A 3G9XA 4REQA 3MJHA 4PYIA 3TXYA 5BQPA 1JU9A 4DIUA 1G9XA 1N92A 1OFTA 1IQ0A 1KMCA 2YFYA 3E8XA 1GVHA 4QASA 1DPFA 3KIPA 3TW0A 1QM5A 2HSEA 2NYRA 3LQ4A 4FGSA 2JFWA 4DNQA 4W5WA 4QYSA 3C3KA 4ZKEA 5FPTA 4A3SA 3EEFA 3DTVB 1N4AA 4QJIA 3UK6A 1ONNA 1XTBA 3KYJB 1J56A 2YX1A 4E5UA 1OU4A 3ZWWA 3L1UA 2CFSA 3DGEC 4YY3B 1JQ5A 3HCRA 3RS9A 2KB0A 5F5NA 3FTFA 2CDCA 5BNIA 3GRPA 1GPWB 3G13A 3ZWYA 5FPYA 4CCAA 3NNDA 2O54A 2X2PA 3AL3A 4CKCA 2HA5A 2GGSA 3LF1A 2OPBA 4Z9AA 1VHQA 1PI3A 4HS4A 4V3CA 1AY0A 1C3LA 3C8ZA 4R2KA 3K6JA 3LDAA 1J8YF 3RTGA 1GEEA 2YFQA 3ICOA 3T52A 3W2EA 4TMKA 1HUQA 4YJGA 3I04A 1Y42X 4F4DA 5KTRA 3LBIA 3TZBA 5IG2A 3T0IA 2OD9A 2UXBB 4KPGA 4K26A 4C4TA 5FUBA 1GCOA 1RLJA 3OY7A 1E7WA 1PR5A 1W1IA 4ZVUA 4JUFA 3UMBA 1VRWA 2Q3LA 3BC1A 4PSKA 1TM5E 4KWCA 1P77A 1IUPA 1OCEA 2DZDA 1QHFA 2H2AA 2RB4A 2V6JA 1PL0A 4H4DA 1SCDA 1M1YE 2FVXA 3PC7A 4HQOA 4LS3A 4OHBA 4U0JA 1FUUA 2AN4A 4QM7A 3BSSA 3HA5A 1DBIA 1FP4B 5E8RA 1YNSA 3GFOA 1Y7PA 1GKIA 1S3GA 5E7MA 3L8MA 3HVRA 1FMJA 4YDRA 1L5LA 1LVHA 3RFUA 2HCTA 1H6CA 2P2ZA 2F9LA 2CV2A 3EWNA 2F8TA 1ABBA 2OECA 3GEHA 4L4YA 2GZMA 4NU6A 4YMIA 1WNFA 3KVVA 5DWQA 3ZXUB 2V97A 3WLFA 521PA 4G01B 4PSUA 3QA3E 1FTYA 3NC4A 1IN8A 1U11A 3R3VA 3BXOA 2FK7A 1KGDA 3H04A 2PT9A 3AIIA 4YRJA 4CUKA 4ZDWA 4AZ3B 1XEXA 1T1IA 2O14A 1ZJYA 2VNJA 2X13A 5A2GA 3UWSA 3ZHYA 1FZQA 3FNIA 3G02A 4U7TB 2IYRA 1V7PC 2R85A 3AVQA 1NMEA 2PD3A 4WN9B 3AERA 5ER6A 2PUGA 2GZDA 4V03A 3DM5A 4B83A 4QXMA 3WGLA 3PJRA 2XRYA 3SJUA 1R1DA 1NZFA 3EXIB 4LF7B 2PUVA 3ZUPA 1JDJA 5PGMA 2CNDA 3VZSA 3EMDA 3ZU3A 3O21A 2BELA 4TYPA 4C1BA 5KYYB 3ENKA 4MKXA 1C9DB 4OP3A 4U6NA 1IVYA 3X1XA 5D8DA 3KUCA 2R7NA 3JYQA 2XUDA 1KWKA 1L7XA 1R00A 3IKLA 5FJIA 3E4CA 3IBCA 3QXHA 1XQ1A 5BN5A 1WLSA 4WKGA 3EVCA 3V4OA 4DSOA 1E5XA 1H2RS 2GZAA 2RC5A 3AWIA 4DXDA 2RKBA 2Z2ZA 3HCOA 1R6DA 2RBGA 2Y8EA 3TRDA 4US1R 2BEKA 1WA5A 4CKZA 1PNVA 2HTFA 4TMWA 3TLAA 4BRZA 2ZJ4A 4H08A 3PUYA 4I81A 5B6JA 2WJPA 5EE9A 2BGIA 3R20A 1SKBA 2I55A 1KI8A 2YZNA 3G2PA 4EI2A 3SWWA 5A7GA 1BDMA 2FUKA 3R0VA 4XSHA 1UKZA 5HP4A 1E6MA 1EWYA 4PW0A 3AJAA 3GXBA 1GPAA 2DT8A 3HDHA 2N46A 3QVKA 4CCWA 2I6XA 2RKWA 1I7LA 3G6KA 3WA6A 2OZVA 1MB9A 2YNMC 4D26A 1NW7A 5CBPB 4OREX 3ETDA 1IXSB 4PHGA 5K8JB 2EZUA 3PJDA 3AR3A 4MWCA 3SXPA 5CM2Z 3L8YA 1Z36A 3WMEA 3A1UA 2ZBRA 5ESXA 1SIWA 2ZBDA 3TIFA 3ZW7A 5F98A 2H0RA 2NO4A 3O9ZA 3A6ZA 3MW8A 4ZOLA 2ATXA 1NQOA 3OPYB 4DCJA 1R8QA 2JGDA 3F67A 1VSTA 1QIFA 2Y0DA 2HRCA 4WFIA 4XA8A 4RF2A 1EJBA 3T5AA 1KHTA 2I2AA 2AOUA 2GD2A 3TTYA 1LS1A 1Q1BA 1U04A 5JPDA 4MK4A 4WZAA 1ZD4A 2BISA 5DU2A 5AW7A 3U3OA 4F92B 5KPJA 3FBTA 4GUAA 5CPFA 2FOXA 5JMTA 4G4JA 2ZM5A 1BMQA 5DYYA 5TGZA 5BUQA 2G1KA 2BI7A 4HATA 2PLAA 3PFNA 2Q5HA 1FIUA 3ONVA 2JHGA 2FSHA 1L5HA 1GGHA 1OFVA 5GV8A 5K3SA 5F7XA 3BK7A 1GTVA 2D54A 1KEVA 4NF2A 3O1IC 4D8WA 4DL9A 2IP1A 1R0RE 3DLIA 4LDNA 3RTCA 1NJGA 4J16C 4TWBA 4WBSA 3LKZA 2QD2A 4ZU3A 1XMIA 1UADA 2BDUA 1TKBA 2H85A 5TC4A 4TLMB 4YCMA 1LLFA 3QUCA 3EIHA 4MDYA 2A57A 1DARA 4UNIA 1XQVA 4C7XA 2OAP1 3OQ1A 4TSFD 1XLUA 2QGFA 3IC5A 3WLQA 1VLJA 3UGTA 5BWOA 1UM9B 3IESA 2DM6A 1QWOA 3C5WP 2GBGA 3ASYA 4KXXA 2CNOA 1TEHA 4IHKA 1PCXA 3CX3A 1E66A 1XMJA 3ABRB 1IJEA 4EHHA 1MB4A 1XEWY 1A8PA 3TUZC 1CFJA 1VL1A 2IVFA 4ZZ1A 1N5RA 4G9GA 2JIZD 1Q5PA 3FJ1A 2WM9B 4R40A 1ACJA 2Q4DA 3DE7X 1HDXA 1XRNA 3PVCA 3JQCA 5G4KA 4N0EA 2DPHA 2JFHA 5KYKA 1Y1TA 5CA1B 3HJFA 2WICA 5HKLA 3V8BA 1KMHB 4J4HA 4N3BA 3KUKA 1FQWA 2A5JA 3MJDA 1FBNA 4RVSA 4XJSA 4JJ6A 2IXEA 2FKAA 3OF5A 3ZW9A 3S1AB 4LWOA 3UJ3X 3QH4A 4Z4EA 2GK6A 2X8WA 3IILA 2J9YB 4MO2A 5H3LA 5K6AA 1YJBA 2ZI3A 5KOHA 1KVTA 4ZVLA 1VG8A 4AL4A 4D5GA 1YQQA 3COZA 4ND5A 1AZSC 1KYYA 3HBJA 4I9HA 5HUJA 2YKGA 5MGNA 4CMHA 1QLWA 1GO2A 3CN9A 1GA1A 4N18A 3DZHA 3K70C 1SC3A 4FHZA 5CMLA 1Y6GA 4DLTA 5CW1A 3B13B 3OLXA 4R6XA 4PF1A 4ILKA 3Q0IA 1VI2A 1CE8A 2ECPA 1Z5PA 4B4DA 1RYNA 4LCJA 3HXMA 1TI7A 1LPSA 1LFAA 4BGDA 1OD6A 1SNYA 3H8JA 4HH4A 1WXFA 1YB2A 4XQGA 1NATA 4HQKA 4MHOA 1X80B 1RWBA 5EXPA 5JT1A 5DXJA 2C29D 4NYIQ 3JTMA 3NBAA 1WWKA 2MSEB 3FNRA 3GUYA 1TEZA 2OHVA 3K5IA 1X8JA 3H11B 4N0QA 5L3VA 2JZCA 3AW8A 1SCIA 4LG1A 1RJEA 1V37A 3K1JA 2EGUA 3OX2A 5J43A 3DBVO 3NBMA 3WNBA 1OV6A 5ALYA 2LWIA 2ID4A 1N7GA 3SR4A 2PZJA 1KY5A 3FJOA 2IIPA 2QX6A 3GLHA 3LUBA 3HWSA 4IL5A 3LQQA 2NVUB 4CJXA 4C7KA 1LDNA 4DC0A 2GCPA 1T8YA 5JASA 1TZKA 2CNNA 4DC9A 1O03A 1PJ3A 2GBLC 3RVSA 1VJRA 4RZ2A 1EP9A 2QTTA 4AZ0A 4BJHB 3F3KA 2VQ3A 3JQFA 4FGZA 4DLSA 3L6DA 2EG5A 1WMEA 3B3FA 4QQKA 4RSRA 3TLGA 2C7OA 3LSTA 1FTSA 3L3BA 2P68A 4W82A 2V55B 1JHXA 3LFHA 3LT4A 1Y8RB 2PV7A 4DMLA 1TZCA 3GUHA 2C00A 2EV9A 3NEYA 5ALPA 1Y37A 1CNFA 1UMKA 1GLGA 2VEDA 3AU8A 4YRZA 1L4YA 4HLNA 1RIFA 4ODIA 3NKFA 3WWYA 1OXXK 3DKKA 1EM8B 3HL4A 1ZOOA 3STYA 3SVLA 1RJGA 1Y6ZA 1RYDA 2DWOA 4LWZA 3RV3A 3TW8A 4AK9A 2VWQA 5IVKA 5BSGA 2NNWB 1KR2A 4Q9AA 5H4GA 1T10A 2QENA 2JAOA 2W6NA 1SXPA 2BFEB 3ZDXB 1G1AA 1ZOIA 2DH5A 5K0ZA 1RAIA 1Z6AA 4RTMA 5LMNB 3C6YA 4RD1A 2P30A 1PVOA 2ODPA 1YJCA 2H51A 2YQ5A 3EGWA 5KNDA 1B6GA 3G2LA 4D9IA 1U2QA 1ZM3A 2OORA 3IRVA 2HREA 4FFMA 5D1NA 5ECYA 1KMMA 4ZWNA 7MHTA 5ILGA 2QM8A 3ROEA 1VYHA 2BSQA 1ESDA 2IP2A 3BGSA 3BCRA 4JUDX 3ZQUA 4D4JA 1TM4E 2N47A 2NVOA 2VFAA 2VA8A 3INTA 3HB0A 4Z9BA 3GJSA 2O2ZA 3GVHA 2VDJA 4EUEA 4HOYA 5T67A 1FA9A 3DONA 4EYGA 4OHXA 3BEOA 3QX8A 4HI0E 5DWDA 4AZWA 1V1RA 3CKYA 4RXUA 4AS3A 3WRYC 4DSZA 4RX1A 4AX4A 4E3ZA 5LA6A 1JMKC 3GLGB 1QTQA 1XU7A 4MYDA 4NESA 3TE6A 4B74A 1XF9A 2GWHA 3E23A 5FNVA 4KFTA 2OFFA 3W6UA 1VJ0A 3A36A 3D1VA 3DXFA 3OJ0A 4HGOA 4B45A 2FMFA 2BN4A 1BQ3A 2D0PB 3AFMA 4JIMA 4ATNA 4CDMA 4UBLA 4A8JA 4CM4A 1QGYA 2FUG6 2PKYX 3KB2A 4CLDA 5C51B 4YRBA 1QR6A 1XZGA 3HKEA 1S2NA 3Q85A 1FRQA 2W2QA 4ZT2A 3ZTTA 5MHTA 4D9JA 4DV5B 4YCBA 4DDWA 2PT6A 5KSOA 4UFNA 1V8DA 1A1SA 2Q1WA 4B7AA 5CX1B 1KI3A 2JGRA 1BROA 4R9UC 1DQYA 1J2JA 1X3LA 3IGFA 4O2AA 4ZCRA 3H9UA 5SV2A 5AQ1A 5IVHA 3V4ZA 1N2XA 4I4TB 4YDQA 1SUWA 3P9KA 2EJWA 1FDTA 2OUIA 1PK8A 4HN4B 2CLHB 1BCSA 1JYEA 2V8BA 2UZ4A 4C7OA 3EZGA 3K15A 4MCHA 3EIFA 1W5FA 3GJ6A 1G8JA 1LSUA 1Z7EA 3D6JA 3ZNQA 3FUUA 4D9HA 3K0BA 3FCYA 1G9TA 1DC7A 2OTCA 2FQYA 3LQFA 3K9QO 3H18A 2XUGA 1XC7A 1BVUA 3NDRA 3NAMA 4JUAA 2JPDA 4D97A 4DIDA 4QKQA 1JFRA 1Q6YA 2BF4A 2C2MA 2LVBA 5CITA 3CC8A 3B85A 1FSPA 4GOJA 3VDQA 2QEQA 2H17A 2ETXA 4EG0A 3JWHA 4DMFA 1XFAA 2PMFA 1Q7CA 3N07A 3DHYA 3PNLA 2POQX 3PENA 5BN3B 5KQLA 3SZGA 5K0CA 4XASA 5EWMA 2H1RA 2F3PA 2VP5A 3CR8A 4MP8A 3ZE7A 3VPSA 2J30A 2XGMA 3TMYA 1TU4A 1CB7A 1CDEA 1ZC3A 2DOKA 3G0HA 4HG2A 2ZSAA 5FAXA 2B4KA 5FEMA 3UYKA 2UYHA 1CJTC 1CIPA 2IOQA 3E1KA 4WN9A 4BJ1A 2VYVD 5AVUA 2VF5X 2ZEJA 3WTBA 1RZRA 1AD2A 3L43A 4NZZA 4AUKA 3OECA 1R16A 4PC2A 3A37A 1MAAA 1NUPA 2G08A 2HWYA 3PE4A 1GWNA 5JJBA 5JY1A 1XYYA 2XXJA 5KYYA 3PTAA 1U0BB 1ZK2A 1J9GA 1K66A 1LGYA 2CHQA 4R8VA 3LV8A 1USGA 3ZI4A 5BMOA 3QG5A 3KZKA 2HQRA 3W9YA 1P18A 1XD2B 3UWOA 4NBLA 1AM4D 2PAFA 2Y05A 3K9BA 5BN4B 2YS6A 3RHFA 2ZQYA 1U28C 3MM4A 5BR4A 3WRVA 1H3EA 5INTA 3FWKA 4LJ4A 4EG4A 1IEWA 1XDSA 2IPXA 2OGSA 5IUKC 4I1OA 1Z6ZA 1UBJS 3WAJA 4E2FA 2P3LA 3H8WA 4WXEA 3ASVA 4OB6A 3DBRA 3LY9A 3MTGA 2I4RA 1NGSA 4R8SA 1UFKA 4BO4A 5D86A 3NHLA 2ZJZA 3BGVA 5FWNA 1T1EA 3A6KA 1EJ6A 4C22A 5JWHA 3TE7A 2FE1A 3N8NA 4QUEA 1P62B 3KSZO 4IVPA 3N6VA 1N57A 1PGNA 4MS4B 4MQ5A 4MHSA 3GEPA 4M1MA 1P4AA 4G1UC 3MD9A 4M21A 2RGWA 1WR8A 4AG6A 4BBPA 2OGWA 3K0AB 4O4JF 1U9CA 1YUBA 5JCZA 1YRHA 2QTCA 1Z6GA 3ZXSA 4ADSG 1RHQA 4QGHA 2HNKA 4DR4B 3UKOA 2GDJA 1F4PA 2I1WA 4DBVO 1ZA2A 1U0GA 3PICA 1K63A 3K1YA 4R41A 1VG0B 4X1KA 1RAHA 3PS9A 1A7UA 1MFZA 4C7JA 3RIHA 4A0SA 5B2EA 3ZDCA 1C81A 2E3JA 2DBYA 4RABA 4Y6RA 5GIOE 1QBKC 4AQDA 3N1UA 1KJ8A 4LJ7A 5J9FA 1FZTA 3L8DA 3PDWA 2BIFA 1JI3A 5B7PA 2RARA 5IT4A 3C1TA 3JD3A 2P11A 2Q5EA 2XQKA 4YJ2F 5CB8A 2IRWA 3H0CA 1N6PA 5H7XA 2GX6A 2Q6IA 2JAXA 3CLTC 5LXTF 2ZVDA 3GLSA 3DO8A 2EKDA 5B3LA 1E3EA 5ES4B 4JLVA 2ODTX 4URVR 4FMCF 2HSZA 1U0NA 2VQFB 1FRFS 3L7YA 1M1ZA 2VJCA 2XH8A 3JSXA 3IQEA 2O8CA 5LDDC 3MTEA 3NTQA 1QHYA 5FHQA 3R7WA 4Y2QA 3Q1KA 3AX6A 1NZJA 3M1IA 3SYKA 2FRDA 2JIPA 1LWNA 4G3XA 1FFBA 5JZSA 5TT1A 3G9UA 3UJ8A 3CTPA 5ALDA 3TQIA 5LDHA 3KALA 3HZRA 4MWTA 4D0SA 1NVFA 5DDIP 3VR6D 3NCHA 3OZDA 1PBNA 1C0EA 1CK4A 5EA2A 2BFCA 1Z26A 5AHKA 3QWHA 1UM9A 2G7ZA 2R1TA 1NJ6A 3I05A 2NP6A 1NURA 4D0GA 1C3OA 1W4RA 3KBBA 4UAJA 3HL0A 4YUWA 4FT2A 4B2YA 5DYIA 3PCXA 1XRQA 1J0BA 1OREA 2CE2X 3WHIA 1D7OA 5HPYB 3EQ7A 4PLPA 1PWZA 3PXAA 5G02A 1PNQA 3FZQA 4PXYA 4NJEA 2O7SA 3I5AA 1VHLA 3LP5A 4YONB 4NLLA 4JXKA 1UC8A 3W05A 5CB6A 2X9LA 4N6NA 5IEJA 4AW9A 2WWXA 2VSQA 2M6KA 1U7WA 5JLJA 1S1CA 1T8WA 4K87A 2XWPA 1J8FA 2WKPA 4CL8A 5FI1B 3AOEA 2FN7A 4IIEA 3CNNA 1UK8A 4BVBA 2YHSA 4G8JA 4H77A 3O94A 1SBIA 4GOKA 1GU1A 1KJJA 1COWD 3JWEA 3SYNA 1RLTA 4PFSA 3EYAA 3KVYA 2YIMA 3IEVA 1TTTA 3VNBA 3Q7EA 4ICIA 4XM2A 5AIBA 3MTAA 1FYXA 1ZC4A 4O4IA 3T5MA 2HLDD 3FNBA 4FMDF 3AILA 1AKQA 1FYEA 1RM4A 3ASUA 5D3MB 2P91A 2X8AA 2ZYRA 3SR0A 4RW0A 2G36A 1Q20A 4NMWA 4QULA 4BMSA 3GPIA 4FCCA 1T2EA 3WQBA 1ELOA 2WA1A 3VOSA 2GTHA 3ANTA 4ESVA 3CQ9A 3T9AA 5D5PA 3G2JA 4IDHA 4UU1A 4AC9A 2WUGA 4WMLA 3B1VA 4D44A 4PZ9A 2HC9A 5JBQA 4DQVA 1KC3A 5DV9A 2IYZA 2VJMA 2IPLA 1RWQA 3B20A 3DR3A 3WOVA 3SQDA 3EXHC 1WULS 4YJ3A 3CH5A 3OZEA 1JR4A 1SBQA 2EKZA 4V0NA 3T35A 4EUSA 1K3TA 3N7TA 3UBTA 1U80A 1GZUA 3F7NA 4EPRA 5ICMA 3RRNA 5CXQA 5F3RA 1ZIYA 4NFLA 2MMCA 2F3QA 3Q3IA 1XTKA 2OFPA 2Q5IA 5GONA 1TUEA 3GFQA 2I6GA 3MWJA 4L73A 1U7TA 5D3QA 4UARA 5K0SA 2NP7A 1Z82A 2ZTSA 3EA0A 3WBFA 4OGFA 2Q8QA 5E4FA 1SKYB 4NZYA 3OTHA 5DN6A 4E03A 5E1MA 2JIDA 5FD8A 3O75A 2J9GA 3CX6A 3FNFA 4JKOA 4RD2A 3TBFA 2NTYC 2OCGA 4EA8A 1NMQA 3H9CA 2ZRLA 4RCYA 1SVMA 3MJ4A 3K8YA 5H9VA 2H5EA 1DBQA 1SAYA 1N6OA 4RDCA 3U39A 4F91B 4F93B 2VSYA 1PVDA 1YF3A 3AP2A 1L9KA 1X1EA 3TLZA 4TMFA 5HF6A 1JEOA 2VT6A 3H2BA 1VMIA 1LF5A 1D5CA 1NOJA 2Q5CA 2ZFUA 3JYPA 4GLJA 5CVJA 2I1QA 2CUKA 4LF4B 3JXEA 3KWMA 3FZYA 3GD7A 2CLFB 3O2QB 4YUVA 1E2LA 1X1BA 1JH9A 1RWKA 4BWFB 5K0FA 3GJ3A 2HNBA 3EVGA 3QXJA 4CGYA 1HURA 3OD5A 2RH9B 2CF5A 2ZRGA 5E7JA 4R7TA 3K0CC 1ZU4A 4MRRA 4PS0A 3SBEA 2OGUA 1DG9A 2FRVA 1O9HA 1QZXA 2FZCA 2NZUG 3WYFA 3NEPX 3T7KA 3N74A 1GM5A 1SPXA 1RYHA 4HTFB 3EPJA 2P9BA 4HRVA 1QXSA 4Q02A 1XRRA 2JI6A 4QXRA 4RHFA 4JODA 3N0XA 4NIMA 2ZJ3A 4FNAA 4L07A 4RZIA 2P78A 1KVQA 2RONA 2LCIA 3EXEB 1E8DA 2YQZA 1U3FA 3H99A 4QHSA 1TYDE 1EK5A 3RRYA 1X0VA 2APJA 4B3SB 4EEKA 2ZE7A 1Q1GA 1QKJA 4O5AA 1LNZA 3GFSA 3QXGA 5EE0A 5D6NA 3DL2A 1XCJA 4CTJA 2XY4A 3TQCA 2V7VA 3KP1A 3M4JA 3I39X 2Y2UA 3AVPA 3PUWA 2C9MA 3ANYB 1GRCA 3DDUA 1Z0ZA 3ZJYA 1KMNA 2FUEA 5GOTA 1PWEA 5C0OE 3GLGA 1P6XA 3D6TB 3DFZA 4O3MA 2X3YA 4MQ6A 1A98A 2I2FA 3M6FA 3R24A 3PNKA 3U62A 4Q6BA 3AFOA 2NO5A 1JIIA 1Y7HA 2JFUA 1ZRSA 4KVAA 2CYBA 4AZSA 3AOGA 4AT1A 1CYEA 2J7KA 2B1GA 4F1JA 4CIDA 2UYCA 3DAPA 3F4LA 2HMVA 2YOHA 3RK1A 1QV7A 3AF3A 5KAMA 4GPEA 1W4AA 3ON5A 4PZCA 1JDNA 3BBPA 1A5ZA 2AQIA 3HP1A 1U1FA 2DCUA 5KCMA 2J9XB 4E6EA 1FFXA 2Z4SA 3D1JA 4V24A 3E2MA 5IH3A 2OVBA 4MKZA 4XJTA 4HQFA 3V2UA 3WKDA 2BKUA 3ROZA 1JR3A 2VBIA 4YEDA 5C8DA 5I7UA 1ZJWA 1HL7A 2YOGA 4I3GA 1X1RA 5DI9A 3CWCA 4FZ5A 4I4TA 5JJ5A 3E2PA 1NYLA 3IQFA 4FEEA 1DBVO 2FQWA 1V4NA 4F6LA 2OBBA 4ZOLF 3MWKA 3COJA 4IQFA 1P2FA 4XYEA 1KFCB 3FROA 3TWOA 3V8VA 3VNQA 3TSZA 2PUDA 3FCUB 1BU8A 3H3XA 4M8SA 2OCLA 4BVHA 5ALUA 4N39A 5I01A 1YS4A 5JMPA 1MA3A 3R6DA 1LDBA 4Y8VA 1OFUX 3LHIA 3RJTA 1Z25A 2O2CA 2PEZA 1Y7IA 4B4UA 1SCNE 2RAPA 2X4GA 1A9RA 2O8VA 5T7BA 1TMGE 2V5AA 3LRXA 3F7TA 5JMWA 1W35A 4KKXB 5HF9A 1YZLA 4JBNA 2YIJA 3B1FA 4R2JA 4BLVA 2FSPA 2Q0SA 3QPAA 1JPJA 4RHCA 4DYVA 4DDHA 1DL5A 2EQAA 3HJCA 2QTMA 2WPNA 3CPJB 3FYUC 4GOLD 4EW6A 5A4AA 3WBBA 3PC8A 1QPZA 3TPZA 3CNEA 1J1IA 3DKPA 4JQZA 4U2EA 4XPZA 3EULA 4BBAA 4B6PA 4U7HA 2QE7A 1P4SA 2C7RA 1R15A 5IP5A 2PA0A 3F5SA 4HGNA 1HZJA 2W11A 3K8QA 3RFVA 1SOWA 2QIPA 3OEWA 4HBGA 4GO1A 2CEAA 1T0JB 3HDVA 4FLFA 4B6EA 1T2DA 1MTZA 1XD2A 1MMFB 2UVQA 2VRWA 4RV9A 2R86A 3EDCA 1W4CA 3OFND 2X6QA 5JZMA 2QIOA 4IUYA 5DK6A 2YZGA 2VPIA 4JI1B 3FDZB 3ADBA 4RESA 4YYEA 1N25A 4L0QA 1I30A 3LHFA 2F7SA 4FHDA 4V2IA 5FLXA 1SCKA 1OBOA 5KJ1A 1L4KA 4H18A 1O1YA 1XZJA 1CJVC 1C3XA 3UF0A 5EZYB 3T12A 3FUCA 2ZYVX 1XI2A 5D2CA 3RYCB 1H6AA 2JLUA 3G2IA 1THMA 1U8YA 4CQMA 3HJGA 3DZIA 3GJRA 2WUWE 1JUDA 3KDPA 4BO3A 4QQFA 3ZD6A 4YBZA 3QKIA 4ND4A 4BO5A 3LAWA 1D2GA 2O4CA 4F06A 4YP0A 4X85A 3T9BA 1BJRE 4LGYA 3MCAA 5FXMA 4B0OA 1NXXA 1ODTC 2DUUA 3GGGA 4ENPA 1DTEA 1OIWA 1E3WA 4IS3A 4ZOBA 4EY4A 1N33B 2C2GA 4UXHA 3ZCSA 1RXIA 1QG6A 2DHDA 3GO4A 4RELA 4CXMA 2CSXA 2XZLA 5AUPB 3P9PA 4L8FA 1DG3A 4LGVA 3VNUA 5LIPA 2XAAA 3I1IA 2FG6C 3CKMA 5BWMA 2PZMA 1MQSA 4RPGA 3RO7A 3S29A 4TLAA 1XNHA 3EZNA 4DIMA 1IK6A 4KH1A 3TUJC 1BOFA 2JGAA 3DKIA 3UK7A 4B8ZA 2DX7A 5B58T 2X2FA 2AQ8A 1Z68A 1BXGA 2HK6A 4YK7A 3S2ZA 3GLTA 5C5EA 2QZ4A 2NN3C 4QT4A 2XIQA 3QBEA 1G7RA 2QAGA 2H92A 3PRJA 3ND5A 1L6RA 1E79D 1NY5A 2G88A 3ZX5A 2UZAA 2HM7A 1Q0PA 4G5FA 1OBCA 5DYTA 3WGQA 3M70A 4PC7A 2WIFA 1XZCA 3BRWD 2BLNA 2C4VA 4AROA 4N3CA 5JADA 1LLQA 2JKVA 3LD9A 3MILA 1IEVA 1W4BA 2OD2A 3AO0B 3O5AA 4L4ZA 1F7VA 1P1CA 1USUA 3WJ7A 3LL4A 1M6HA 3WX0A 3K9LA 4QTYA 3AHHA 3SZOA 2CHVA 5HJ2A 2Q3HA 5K2OA 1E5QA 2ZUFA 4EG5A 1I1HA 4RQUA 1G20B 4JQCA 2QR2A 2CCJA 1K88A 1T24A 2FEMA 3IP6A 4S12A 1QIEA 2EZ9A 3QBVA 1GQFA 1TF2A 2MU1A 2H31A 3TAHA 2RGNA 2BT4A 1IQRA 4C78A 1VMEA 3FX2A 1OA0A 1WDTA 3PUZA 1D2EA 1IHXA 5CLIA 4KITB 1KAQA 1N2HA 4JSRA 4AN4A 4MV1A 1DJOA 4G0WA 1NDQA 3PEYA 3I37X 2CFTA 1CY1A 3B53X 2HCBA 3VMMA 2QK4A 5B3KA 2X0EA 4PG5A 4K2HA 1SBHA 3THOA 2Q1YA 3LUCA 2B94A 3QMMA 2CXNA 2F62A 4J7AA 4KK4A 5EEHA 5H83A 3TXXA 1I80A 4R8KA 1RAFA 2OO3A 4LDPA 3L06A 2O2DA 2X7XA 4OV6B 5JSUA 2WWHA 3KJHA 2OXTA 3ZV3A 1ZCFA 4KXYA 4ESOA 1ZQ9A 1BO6A 2V9PA 3LUKA 1Y1RA 1L0BA 4JVLA 3AUTA 1YGYA 3ZE8A 3PC4A 4Y2HA 2ZJ0A 4PLCA 3U3DA 1EUCA 2PWYA 3NGMA 1UMBB 2ZB8A 1JHPA 4FFSA 2FSUA 3MMXA 3WLPA 2XVZA 1O9BA 2D1QA 5JANA 3AUYA 5L45A 3ZCRA 3KKEA 4CFSA 4R71A 2B34A 2UYQA 3V1TC 4BO0A 2RHDA 1JE0A 1V8PA 1L5YA 1LI4A 3QE0A 3NT5A 2QTGA 2YHUA 3PKJA 3KEOA 3G1WA 2XDQB 4MROA 3P2IA 3BWYA 3RODA 3W3ZB 4XARA 3CVVA 3A1SA 1IAQA 3S0JA 3JQDA 3QFSA 1UAYA 4C87A 4F2GA 5DK4A 3P96A 2ISCA 4JC5A 4DCVA 3EPKA 5EJ4A 5T4HA 5KU1A 3IS3A 4Q9DA 3TLMA 1VKRA 2MINA 4ECEA 5JNVA 1CERA 1VE7A 2WLSA 3WADA 2J85A 1GP2A 4KMOA 3B8EA 5FTWA 5LZ5A 4B2PA 4BNVA 2OAGA 5AI9A 1JLSA 2PSFA 5LA6F 2GJSA 1G8GA 2ZCJA 3JTEA 1QANA 4PN7A 4IDDA 3K70B 5EINA 1Q0UA 3IELA 2JVIA 4ZZ2A 1QGUB 5FNVF 1Z28A 3Q8KA 2V7UA 4FM9A 2P0EA 4WFKA 5FO0A 4YQZA 1RQRA 1VSUA 2HO4A 2W2LD 3GUCA 4MICA 2FP4B 2UYGA 2I34A 1EFPB 3U7QA 3OQPA 3N0RA 5H82A 5HFNA 2H1OA 1C50A 5DWVA 4EQ6B 5IBRA 3R1IA 1WCV1 4FDAA 2D2IA 5HUHA 3OCXA 4RTPA 2CHFA 1N7IA 1TADA 2JH3A 5GWXA 5HEKA 1FMCA 1K75A 1M75A 2VLBA 3HWX1 5TPZA 1OLSA 5F78A 2XCLA 2ECKA 1J6UA 1SQ0A 1TK3A 13PKA 3KNZA 2A9FA 3EFHA 3W3AD 4O2AF 3LQ2A 3VU8A 1G5TA 1Y4SA 4PCUA 4UVEA 5I9TA 5EQTA 3WJAA 8GPBA 1H5QA 4N7MA 3LVRE 2PSEA 3C1OA 5ALSA 4J4TA 1QOPB 2FOIA 3NH9A 2CNKA 1C1DB 5FQOA 2OFOA 2J1LA 3L07A 3QW2A 4WE3A 1E0JA 5DZSA 5JISA 4N5LA 4JFAA 4OD0A 2VJLA 4HZUA 2E37A 3PQ3A 1E32A 3R8CA 1CR0A 2XB9A 5CVCA 3PUHA 1K2WA 2BD0A 3AFNA 5T8KA 4ZA2A 1E2BA 2A1TS 3L6RA 1QDEA 1A9PA 3LKBA 5JAIA 1DZIA 1FCJA 2Q0HA 3C16C 1RXUA 5JI2E 1SA0B 1YCGA 4EITA 2Q6TA 4ZHQB 2XUOA 4KK3A 2FDXA 5DGCA 4CCYA 3SHOA 3WRWA 4DDTA 2QXTA 2QTAA 3H5NA 1EJ2A 3AUJB 2XVAA 3CZMA 3PQ6A 4I5FA 3KKPA 1HG1A 4QWWA 3VKFA 4JI7B 4JKIA 3L49A 4RJ2A 1W0CA 4FFLA 4GE0A 4MVXA 3UJ9A 4BNDB 1M2VA 2GLXA 2ODWA 2ZT7A 4J0FA 5L9AA 2YVQA 4K6FA 3VVCA 4GX2A 1CYDA 1TJ3A 2JLYA 2VYNA 4D9NA 5E6UB 2B8TA 4HTAA 5J5CA 3QU2A 4I1YA 1IEQA 1MV8A 4ZAFA 3LU1A 3B9RA 4FSDA 2IV7A 4EW3A 2Z9DA 2BGTA 2FNAA 2HLNA 4K1XA 4LIPD 3Q8LA 1JILA 4O6VA 2AJBA 6YASA 2AZ4A 1OASA 1GSOA 3SQWA 5TMPA 1M73E 3SOZA 4FJ2A 1DV1A 3QGMA 1V5IA 3E61A 4OB8A 2I71A 2HHHB 1XZHA 1JEQA 2CNWD 2G0AA 2XDYA 4CU2A 1L5MA 4G1BA 3HKDB 3HDTA 2E6UX 1Z5NA 1WX1A 1XTTA 3CCCA 4ZEWA 3WLSA 3K2BA 3U7GA 2ZM6B 4XWKA 1IBKB 2XNSA 3AETB 3RSCA 5JCPA 2V4UA 1P33A 4EUHA 1NTOA 1UKEA 1YA4A 3WKEA 3OCCA 1C7FA 3SYMA 5KKCA 4EL5A 3AHGA 2R68A 4DV4B 3EFBA 5EFZA 1L5RA 1A4RA 1G2IA 1WIWA 2WF7A 2VDOB 2OYSA 3SF0A 4QLBA 5H8WA 3DPSA 3EMVA 1HORA 3WQSB 2HMSA 4M1WA 4K7JA 4E13A 4ER5A 4DLBA 1CETA 1VIAA 1K92A 4I6EA 1YUMA 2AWNA 3AG5A 3MAAC 4HNRA 1KOGA 2QWXA 1WQ3A 2RGXA 3WBJA 4RULA 4GF5A 1NQTA 3KEMA 1J2TA 2B9VA 3NALA 3BWDD 3QIVA 3UXHA 4OJMX 1J5PA 2GH1A 1LQ2A 2AEEA 4M8KA 1L4HA 1RYFA 2B20A 3B78A 2VBCA 4FYXA 3Q7PA 3BWBA 4MI9A 4BUZA 5FYDA 5AVWA 2EDAA 1RS0A 2CW5A 3DBLB 2QXYA 4IF6A 1ZJZA 2C7PA 1IHUA 1Z15A 4N5MA 1WUJS 3GAFA 2FN4A 3KPYA 4JVSB 4YAWA 5DOZA 5HILA 2O23A 5CLJA 2A0WA 2B2CA 4KE6A 2DWUA 3ZDFA 1FW8A 4D99A 3JRNA 1XZ8A 2QTBA 4XSGA 3CT4A 2QL9A 3BL8A 4R2MA 4L0MA 1LPPA 2I7CA 3IT0A 2ZI4A 4FU0A 1X6VA 4Q3NA 3W2IA 5KREA 1BE6A 2VC2B 4I2VA 3KU1A 2X1VA 3A4MA 3PXXA 4LPKA 3ZBTA 1QV6A 2IW1A 4UDXX 4TM7A 5DXFA 1DJLA 1T6NA 2JNWA 4E5PA 3F8SA 4JQOA 2PKRA 4TS3A 4GMXA 1T0HB 5JWOA 1I2ZA 3UB4A 2QPTA 5L3SA 3V55A 2PGXA 5B5SA 2ZRHA 4QOGA 2AYZA 1AK9A 3KUUA 1MJFA 2EP7A 4BFYA 4PR0A 5HIIA 1GUZA 4XCQA 1E2HA 2EKPA 1MO2A 2JGNA 4YLYA 4IUBS 5AW0A 4MYUA 3B2NA 3GJQA 5KZMB 1JF8A 1YGPA 3TZLA 3KSBC 2JIRA 1TAUA 1XR3A 2X2EA 1M1NA 1U5CA 1ZD8A 4JVMA 5K7SA 4IW3B 2ILVA 5K8TA 4GMFA 1IXZA 2XCQA 4ERXA 1UDBA 1ZKDA 3GPDG 4RHTA 5KAPA 2PD6A 1XA4A 3EEBA 4NZMA 3PEFA 1B6TA 5GAJA 4C2BA 5DNUA 4XLZA 3L0CA 1O6FA 1PIWA 5KO2A 4WZBE 4MXDA 1EX1A 3I4LA 1TCCA 2FFRA 1Q7EA 1SVLA 1Y9ZA 2JCBA 2JJ2D 2OZKA 3LE8A 2Y1CA 3NLLA 4L4XA 5I9LA 5EZYA 1RQNA 3GLIB 1KZ6A 4AJIA 5EXDA 3TG2A 1L5QA 2YR0A 4Y1RA 1NT2A 1EJ0A 1AB6A 1UDXA 5CLQA 1N5MA 4RH0A 2IX3A 4WFJA 4TQGA 3IVGA 4PZLA 2GZ1A 2J08A 1HOXA 3WMRA 2O8EA 5IAJA 1IEXA 1ZM4A 5A5FA 1UWKA 1JDBC 2JF0A 3MTDA 3PHBE 1MEJA 1AB5A 2WYUA 2CMDA 2VN8A 4M22A 4HQLA 5KOJB 2GMWA 5ICEA 1A0OA 3U31A 5EKSA 3O90A 3DAOA 3L02A 1Z5ZA 3RVPA 3OOJA 1TPYA 4NZNA 3C70A 4R2XA 4BO2A 4KIWA 5JU6A 1MP0A 3PQEA 1U7OA 4O4IF 1O7JA 3L7BA 5EP1A 4BAZA 1G5FA 2CXQA 4Y0NA 5AXAA 2Q7OE 5KMGA 4OF4A 3OAAD 2PS3A 1H9CA 4D8YA 2O8NA 2R62A 3VXKA 3PX7A 5BYJA 1X1AA 1BGVA 1OWMA 2V58A 1WCWA 3NW9A 4G4SO 3KLPX 3V1UA 1YQWA 3EQ2A 4MRNA 2YNMA 1XPRA 4DNFA 1FRZA 1Y4DE 2ENUA 3NV7A 2A1UB 3LDGA 1HFWA 2CVPA 4XOIA 2VRCD 3THXA 1ADCA 2W6MA 3WHLA 3B7WA 3ZUGA 4HAUA 3QFFA 3T3OA 1YMVA 3L4JA 1U2PA 4OJTA 2VIIA 3LA6A 3PPYA 3QUAA 5B6IA 4YJ3F 4Y98A 4BNJA 1O3YA 2XCUA 4P7KA 3UFBA 4AJHA 4IWXA 2QJTA 4B40A 1A9YA 1DAMA 2Y71A 5F3DA 3AIOA 4KYTA 2B3DA 3MSXA 3FKSA 4MWZA 3IRUA 4BXOB 1P5HA 5JO9A 1H42A 3KD3A 3MAGA 3OLWA 1QS0B 1E3MA 2PX8A 5GONF 4L6AA 5AKEA 1PT7A 1QX4A 3GL9A 4M0DA 2WIDA 1IC6A 2IQIA 1ISPA 5GTDA 1UBGA 5ALKA 1O89A 4Y2YA 3RK4A 2ZYDA 5A06A 2B7BA 3KV3O 2KHZA 3OPMA 1U1IA 2AG6A 1W96A 3BQNB 4YACA 4QGAA 2RGBA 4XTCS 3ONEA 4TROA 1E4EA 4UBKA 3DNFA 4IH1A 4MRMB 2J3MA 3EJ6A 4IWNA 3BXHA 5I8PA 1LNQA 1US8B 5DHQA 2FB9A 2H11A 3UICA 3FFWA 4RLSA 1JIVA 4CF6A 4J16A 4L0CA 1CS4C 4AJLA 1SOAA 1UZAA 2C9ZA 4QBGB 1PL7A 3PRYA 5FRDA 2ZBGA 3NRJA 4RYDA 5EL0A 4BX0A 1WXXA 1A8QA 2COKA 1ZYUA 1JSCA 4CLRA 1ZH2A 2BKAA 1TIPA 3GW8A 5CB4B 2OGTA 4INPA 4EPVA 1WSAA 4NX2A 5AHWA 3CW8X 4I4LA 3KVOA 1OLUA 3KXDA 4MPJA 4XI9A 1UMDB 2TMGA 3MQ4A 1K5DA 4RADA 2UVPA 2PCJA 4GR4A 4A8TA 3TJZA 5DTMA 3RVDA 1P17A 2QB5A 2AS0A 4RD6A 1RRGA 2GJ8A 3CV3A 3RRJA 4CYMA 1L5FA 3OQMA 2FPUA 1ESEA 2IYTA 1FUIA 4P36A 4QXOA 4QDXA 1QDLB 4FHGA 4HAXA 2D0DA 5DRYA 2CE7A 4GI3A 3QF7A 5LN1A 1KEZA 1L8OA 1SBCA 5HQ3B 1VL6A 3H6KA 5G1PA 5KIAA 3TH5A 3ILVA 4UOZA 2ZXUA 1B2LA 4FDVA 3DPIA 3NUZA 4XWTA 4KLRA 3KQQA 4F2HA 4ZICA 4HAYA 5BWCA 2XMCA 1GOTA 1VXOA 3CXRA 5BW4A 1M0EA 2ZCUA 4ON9A 2IPNA 4BFWA 3T1OA 4H9GA 1DKUA 3CWQA 1VMDA 4QVIA 5AJWA 4DMCA 1T4CB 5IHXA 1O5IA 2XBMA 1YTUA 1Q44A 5FKJA 3RF7A 5IULC 1SR8A 1W6RA 1NF8A 1K6IA 2VAVA 3HFJA 5TX7A 2CKDA 3UCEA 2EDCA 3DA8A 2NSDA 1SCUB 3UUGA 3W7VA 4B79A 1EFPA 4DE5A 3RC8A 3C7TA 3R0QA 4HDMA 4K9KA 5ALQA 3T4PA 2W8BB 5I51A 1X1QA 1B74A 4OMCA 2XMQA 4QUGA 3O91A 2HGZA 4O2BA 3SS9X 4RPJA 1XP5A 1P7CA 1L8AA 4DJDC 3B6IA 4IKOA 4GM4A 4MH0R 5AR1A 1GARA 5B2ZA 2GN6A 5AKGA 2DJ5A 3N2LA 3QLUA 4Z99A 1PS9A 5I9SA 2BGGA 1GADO 2WNHA 4H7DA 5J2UB 4GYJA 5SICE 4AX8A 5DNWA 1YR1A 2X3UA 1E59A 4HJRA 4XVCA 2NU6B 3VMFA 2GD6A 5CAEA 4ALIA 5BV0A 2D13A 4F38A 3BL5A 2GDZA 1NA5A 4UE2A 4MTCA 1FF9A 1ZPDA 1PS0A 1DAPA 2Z5FA 3L5OA 3S8YA 3D5QA 2CLCX 2GBLA 3O31A 2PBLA 3QNUA 4LMBA 3CVUA 2CMHA 1PZEA 4MW0A 4WZ6A 1E0SA 3UV7A 4ZCIA 2FN8A 3U2QA 5C37A 3ZGVA 3D2BA 1WVGA 4LWQA 1Q0ZA 4R1QA 1YR7A 2WJZB 1ZHHA 3MCWA 4YPVA 4JJAA 1YVUA 4KBFA 5FR2A 4Z3KA 3DOIA 2VNIA 3EFOB 3JAWB 5JXWA 2FPLA 5KTSA 1ILWA 1EXWA 3KOZA 5K6RA 5DE3A 3U13A 4R9VA 5J5VA 5E6UA 1HY3A 3AF6A 5TF0A 1Z0JA 2Z3WA 5CR9A 4OQNA 2X9NA 3LCJA 3QBJA 1J1UA 2J9ZB 1F5NA 1EX9A 1IDN1 4FNMA 4BP3A 4WJKB 5JCJD 3A1DA 2GT1A 2ZSFA 2V65A 4U2DA 2AE1A 3KFXA 5ERXA 3VC7A 1R5JA 3Q11A 4HH3C 4MKFA 1OFIA 2ZZNA 2HMWA 1R9GA 1KSJA 1QH1B 1M2OB 4Q18A 3N59A 1PJZA 2FDCA 1XWFA 1Z63A 2ZT5A 3JASA 3GLFB 2AFIE 2GCIA 3KOUA 4PS1A 1YBFA 3FYTA 4LE0A 4AS2A 4RANA 1HL3A 2PIAA 1Q50A 4U63A 4TXMA 4F4FA 1SXHA 4P0TA 4RSGA 1C4OA 2AUMA 1PV2A 1L7VC 4UVIA 2FPRA 2DXIA 1PN3A 4Q4LA 2C5LA 3HCAA 4I99A 3LC0A 3VU9B 1OUMA 2FW9A 2LP4Y 4H3SA 3V4SA 4AYTA 4NSNA 3UMJA 3VX4A 4EUFA 3IAS6 4ZI2A 2P4EA 3RRBA 3DWIA 4XLTA 3GVXA 5F5XA 3Q72A 1EH5A 3AI1A 5BQOA 4NS4A 2OV8A 4AUMA 1T0PA 4LTNA 1HLDA 3WRYA 5JUWA 1XDUA 2MHCA 3NIWA 2CLOB 1U4NA 2IYOA 4IDPA 4PG4A 3USZA 2H3EA 1RAAA 3IP5A 4YO8A 3L4BC 3SMVA 1E1LA 4YGXB 2ZCVA 1QRRA 2V03A 1V95A 2V96A 3CVWA 4Y2SA 2B5WA 1GKKA 4IMRA 2AMVA 3DUFB 3HK2A 3IJ5A 1CQXA 1K27A 5THQA 1OJ7A 1K97A 1YDHA 2FMHA 2IEZA 4NPHA 1LTQA 2IW3A 2Q50A 3ELDA 3FTDA 4TOIA 5DBHX 2GK7A 4E88A 5ITVA 1ZN8A 2W22A 3N7AA 4HLQB 4N3GA 1BS2A 3BAZA 4PFJA 3K1TA 5H5JA 1LBSA 3LHSA 5HIJA 3CH6A 3TR5A 2ESRA 3DE4X 2ANBA 3GDHA 3M5PA 4ASUD 5KQGA 2ID8A 4H7EA 3FSGA 1R18A 4KC0A 5C8ZA 4IIBA 3RB8A 2C88A 3LJKA 4WINA 1AGNA 1HOTA 2EZTA 3E03A 4GDFA 1P4JA 5L8VA 5J1TB 2IC5A 3IDOA 4NBKA 4B8WA 4K9QA 3ZJTA 1D2MA 3KQPA 3HYRA 5DM70 5GZ6A 2P27A 4D9FA 5GVRA 4RFVA 5B7GA 3NHRA 5F4ZA 3H5RA 3TOSA 3U4IA 3SQLA 5JTUA 4YP7A 3G88A 3PR3A 4MLCA 3QSYA 1GCAA 4RF3A 4CETA 3K30A 2BHTA 1PR2A 5L4SA 1LBIA 1Z06A 2AYXA 4E4RA 2R47A 3PHGA 4AXBA 1JNXX 4QVGA 1B1CA 1KJYA 2JLWA 4YUZA 3JV7A 1T3SA 3Q7IA 2VHYA 2XUZA 1C4WA 2NAPA 3IQDB 4W7SA 3QEJA 2FR8C 1Z33A 3HLKA 2HK8A 2MT9A 3FHJA 4BQEA 3L2OB 1Q11A 4KLNA 3OUZA 3VUFA 3F5QA 5JAZA 5IM4A 5IEBA 1XZFA 2EZ4A 2MYNA 1FUEA 4DM3A 5FBVB 1K4KA 1COZA 4QOHA 1STOA 5EZSA 4BNMA 3D8HA 4RWEA 5IZ4A 1IY2A 1PEAA 1Z3IX 2C8JA 2A86A 2MOKA 2XGOA 2YRXA 4IIYA 5LBTA 1PLLA 3A1CA 4H4CA 1ZY2A 4XDGA 6ABPA 5AH0A 1BE0A 1E92A 4MW1A 5FOSA 3QVMA 1VKZA 1GKLA 5A0VA 4RE5A 4J3NA 1UBOS 3BJMA 2A6PA 2GBPA 3M89A 4MS1A 3D3EA 1OI2A 2QJRA 1U28A 1NN0A 4KWIA 3B48A 4XSVA 3VNRA 4PLYA 4EPYA 1T5SA 3C14C 1VI5A 2HNAA 3BXPA 2CD7A 3OZWA 4MWBA 3A1WA 2HF2A 2NUAB 4JLAA 3CH4B 4BMCA 1ZVJA 1LVUA 2DWCA 1N0HA 1UBLS 3LLMA 1JMVA 4H4EA 5C1BA 2GERA 2FA9A 3O82A 5ALZA 1NBAA 4PX2A 3DV2A 1M83A 3GNQA 1ID8A 2ZBFA 5E7QA 3ZKWA 1K5GA 1RJWA 4BEJA 1Y80A 4IFIA 3RS2A 2O6LA 3O8QB 2X9QA 5FWXB 2GCNA 3GLQA 5K0NA 3GA5A 3DD1A 1N7JA 4M38A 1I4OA 4DG9A 2VZ8A 3PUXA 4BVLA 1KEPA 2YUIA 5JSQA 3ETEA 3RV4A 1RHMA 1O0CA 4BLWA 1YZQA 4PE5B 1VYVA 1B8UA 1I10A 2FGKA 4PM4A 1Q2UA 1RYBA 3NVAA 3SBDA 2EEZA 3N05A 5ENVA 5LNK6 1Q0LA 4AM8A 3G7NA 3K8OE 1XKTA 2XMZA 2Y77A 2B82A 1PEDA 1TF7A 3HA7A 3UTDA 1E3JA 3N0TA 3N8IA 4QDUA 1CZUA 4W5OA 2AE2A 1VI6A 3IV9A 3WWEA 4JUIA 1XNRB 4MR9A 3OSZA 3MIIA 4IV5A 4DRZA 3G79A 3O8LA 2VL7A 3H19A 4F5YA 1Z7YA 5JH7A 2XXBA 3GHHA 3QVVA 1ACMA 4C7BA 1E1RD 4HCJA 3UAXA 1TXGA 3W7BA 3AK4A 5ITSA 2QM0A 4UNSA 1JTEA 1QORA 5HQJA 3RF6A 3VX3A 1UOPA 1KK2A 4JYAB 1KZ4A 1OAAA 1X7YA 2P2YA 4NE2A 4J2TA 2RGUA 4RKFA 1QS0A 1ENZA 5DM60 3H7IA 4UD6A 2UXDB 2JFFA 1XGKA 1GILA 2YHBA 2FEXA 4CTMA 1GNTA 1ADJA 4R4JA 3ZDEA 3ZW8A 1GPNA 2RHRA 2LUOA 2QKYA 1EGQA 1PNRA 2FMIA 1ONOA 3LS2A 4AVYA 3H2KA 3MMZA 4L51A 1DS6A 3L0BA 4LOLA 4HVTA 4R3WA 1PYOA 3EK2A 1TVEA 4OOEA 2CXRA 3PSHA 4GOXA 3T5GA 4B87A 5B6PA 4JU8A 2R6AA 5SZKB 1VPTA 3DOJA 2XXAA 1N9ZA 2E21A 2QSYA 2A2ZA 2VK4A 3ZOKA 1ZRNA 2XGGA 3HI4A 4XX1A 5GGYA 3AM5A 1TTQB 1CPYA 1O87A 3GT0A <