2IX9A

Respective role of protein folding and glycosylation in the thermal stability of recombinant feruloyl esterase a
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
260
structure length
260
Chain Sequence
ASTQGISEDLYNRLVEMATISQAAYADLCNIPSTIIKGEKIYNAQTDINGWILRDDTSKEIITVFRGTGSDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISVQDQVESLVKQQASQYPDYALTVTGHSLGASMAALTAAQLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPAEQGYAHGGVEYWSVDPYSAQNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTSGACTW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERULOYL ESTERASE A
publication title Respective Importance of Protein Folding and Glycosylation in the Thermal Stability of Recombinant Feruloyl Esterase A.
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
total genus 97
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 3.1.1.73: Feruloyl esterase.
pdb deposition date 2006-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ix9A00
2XQKA 4HXEB 3W04A 1NX9A 4DLNA 4TGLA 1LLFA 1W1IA 1QIGA 5HQ3A 1LPOA 3W9BA 3WKEA 1C7JA 3E0XA 4J0JA 5HK9A 4OB8A 1QFMA 5SYMA 2W6CX 3WL5A 5IVKA 2OLEA 3ZPXA 3IVMA 3FBWA 1WHTA 5ALYA 2WFZA 4JYPA 2O2IA 2ZJFA 3NGMA 4UHFA 3UUFA 4FWBA 3I1IA 3WYNA 2HA5A 4DMCA 3U1TA 5KWJA 4BAGA 2PBLA 1D07A 2G5TA 3W2TA 1H2ZA 4DYHA 2XE4A 1ZJ5A 4LHEA 2HU5A 1E5TA 4LYDA 4QEKA 1K63A 5ALXA 3A2NA 4EY8A 4X90A 3C5WP 1THTA 1MNAA 5ALSA 1KU6A 1O6FA 3WWCA 2GYVA 3OG9A 2JEYA 4W1QA 3W9UA 3V1MA 4OUKX 4BCBA 5LIPA 5LKAA 4QWMA 2Y6VA 2YASA 5EI5A 1IUOA 1VJ5A 4N5HX 5AKJA 5HQ3B 4JEIA 1VA4A 4HS9A 2XUKA 3KXPA 1GKLA 3IB3A 2VT7A 3ICVA 4BB0A 3DOIA 1LBTA 2OAGA 1CEXA 2I3DA 4H35A 1WOMA 1JKMA 4G1FA 4X94A 5BWBA 4KR0A 1MU0A 1NU8A 3WK6A 1YR2A 4OYLA 4QDUA 2WU4A 3FNBA 1JI3A 2JGIA 1YCDA 2D0DA 4NZZA 4FLEA 1MT3A 2QVBA 2WSLA 1NU6A 2ZJ7A 4FBMA 4BDTA 2C4HA 3FVRA 5AKIA 4RGYA 3I2FA 3A6ZA 1EHYA 1X2BA 5LZ5A 1TRHA 2H7CA 1DTEA 3QMWA 4AX4A 2XI4A 5EGNA 2BKLA 4Z49A 4C01A 1EINA 1YSCA 1XZHA 3D4LA 1UZAA 3D2AA 5AO9A 1CUCA 3R3YA 4MYSA 2PX6A 4H7KA 5T4FA 4PV7A 4J3JA 4BVKA 1TKRA 2HFJA 2QS9A 4ZGBA 5LYYA 1ISPA 2PL5A 5DLPA 5LZ9A 1MPXA 2WIDA 4A16A 1C4XA 1ZD2P 3BE8A 1DT5A 5SYNA 4PW0A 2RGUA 2QXTA 5DNWA 3G9TA 2WG2A 2YH2A 2H7YA 1QIHA 4GHWA 4BVLA 5ALGA 4L0CA 1SC9A 1ODCA 3JYHA 4Q34A 1LBSA 5AICA 3STYA 1LPBB 2FJPA 1R1DA 3QZUA 2Y2VA 5C8VA 1LGYA 1Q0RA 2DR0A 3EQ8A 3IBTA 1G42A 1XQVA 3QPDA 4F21A 5DJ5A 1BEZA 2VQ6A 1EVEA 5CRIA 1QFSA 3PI6A 5AI4A 5ISMA 5HF8A 5FRDA 5D3ZA 3W05A 3WKCA 1ZGBA 3ANTA 4ROTA 3AZOA 2RAUA 2X8BA 1W76A 1HKHA 4S0XA 3H1AA 3X3HA 5ALNA 1XRMA 1IVYA 2G63A 1WB4A 4JYMA 4FDMA 5T4EA 1XRPA 2JBWA 2R8BA 5E2IA 3WIOA 3M81A 4J03A 4DNFA 4B80A 4BP9A 1XQYA 4BDSA 3PDCA 1R3DA 4HRYA 2ZYRA 1TCCA 3PF8A 5I7UA 5AI5A 2LIPA 2WUEA 2WJ6A 4X92A 3WKBA 2GBFA 3V1LA 1BRTA 2OGTA 3G8YA 3QITA 4FLMA 2V96A 4C88A 1A7UA 3K9BA 4IQ4A 1RYYA 3Q8WA 3RM3A 1EDBA 2PU5A 5AM2A 2WHPA 4WDRA 4FKBA 3DL4A 4AZ3A 2HM7A 5CMLA 3WWEA 1QTIA 2XMZA 1JU4A 4UHBA 2ZJ6A 1F0NA 4EZIA 4OYYA 1CVLA 1K6EA 1UOOA 4HXGA 1U4NA 4LKOA 3O9VA 4P92A 2OAEA 1U2EA 5CT9A 3LS2A 4BCCA 2VAVA 1QIKA 2ZYIA 1A8QA 1T2NA 4BYMA 1OILA 1QO9A 2WHRA 4Y2XA 1GXSA 4P93A 3WJ2A 3DNMA 3WZLA 1CRLA 1EA5A 4QA9A 1CPYA 1VZ3A 1SCIA 2XMSA 1ZJ4A 2FJ0A 3CXUA 1P0MA 1SOMA 4Y2PA 4B83A 4RPCA 3O4GA 2PKYX 3G0GA 3C5VA 2RHWA 4FBLA 4Y9SA 1XRLA 3BF8A 2I03A 5HCUA 4UPDA 3D0KA 1RWQA 4IH4A 3AIKA 5K3DA 3LCRA 4L72A 4C4YA 4UHCA 5CTAA 4X93A 5K3BA 4U2GA 2YYSA 3O95A 2XLCA 3N2ZB 5EFZA 2OPHA 1CUDA 3AUKA 3BF7A 3VJLA 1BCSA 4M0EA 3RARA 3WWDA 2ZSIA 1JJFA 4X3CA 1EVQA 1VZ2A 4BRZA 2BJHA 2DHDA 1P0PA 2RI6A 2JGJA 1XLWA 3F96A 4J0IA 3IA2A 1WHSA 1X2EA 2WUDA 3B5EA 2ZYHA 3P2MA 1F0PA 4C89A 3FAKA 3HACA 3V1KA 1Q0ZA 4EY4A 2OG1A 1R9MA 1UXOA 2RONA 4MJ3A 1VE6A 3QH4A 3F98A 5HZGA 1EDDA 3STVA 4MQMA 4B85A 4PSDA 1CUBA 1DQZA 1XQWA 3STUA 2DHEA 4Q1VA 3HZOA 3SK0A 5AI6A 5JAOA 1DX4A 3S2ZA 2WFMA 1WPXA 1C7IA 5EIHA 3C6BA 5ALHA 3PICA 2Q0XA 3WK5A 1ZD5A 2BCEA 1W75A 2HRRA 3KOOA 4EY5A 5AM3A 3DOHA 2Z8ZA 2WG0A 2BGRA 1LNSA 2EDAA 4KE8A 2CB9A 2O2GA 4IH9A 6YASA 1WPRA 5YASA 3H1BA 4ZRDA 2RHTA 5HFAA 5ALKA 3B3QA 5AKYA 2OCLA 2HA6A 5AKGA 1EK1A 3C43A 5H3HA 3FLEA 5D7BA 5K3AA 5JZBA 3RKSA 4C6HA 5I8PA 2JGMA 2PSDA 1H2XA 5EHQA 5AOCA 5I9IA 3C70A 5CURA 2XQFA 1BN7A 1JMYA 5A7HA 4HZGA 5A7GA 4OB7A 2JIDA 5AK3A 4LXIA 4C87A 4H7HA 1KU0A 1QOZA 3H19A 4MYDA 1WM1A 5DTJA 3WIBA 1MN6A 1TIBA 1XRRA 4QDOA 1CUZA 1IMJA 2HA3A 3GUUA 4DMFA 4W63A 1L7QA 1M33A 2JF0A 5LZ8A 5E4JA 3O0DA 3IULA 1I6WA 4AO8A 4PO3X 1EXWA 4WFJA 3ED1A 2B20A 4X6YA 4FFVA 4GLBA 2H1IA 1XZMA 3HC7A 3DLTA 5JZ9A 1W52X 2C7BA 5ALJA 5A6VA 1IZ7A 4J0GA 4LIPD 1ZGCA 3WI7A 2XT0A 5JASA 3E4DA 1ODTC 2QJWA 1MX9A 4QE3A 1DQYA 1ZD3A 2O7VA 4UFPA 1EK2A 1SCQA 4NVRA 2ROQA 4K6HA 3LIIA 2VAXA 3AIOA 2JGKA 1JT2A 1VXOA 1UT6A 4DTCA 2CZQA 3C6YA 4FMPA 1XQXA 5ALUA 5T4HA 1Q84A 2XQGA 4G4IA 3EQ7A 3STWA 5HKAA 3FVTA 5CH3A 2VA9A 4FNGA 1CUHA 4OD0A 4E14A 5JYCA 1QZ3A 4UUQA 4XWGA 5ALVA 5AKLA 3O4IA 1XKLA 3AJAA 1ZD4A 1R9NA 4BAUA 5AKXA 4NMWA 3HI4A 5D3KA 5CW2A 1BEEA 3RK4A 1W4LA 5JANA 5HFNA 1MAAA 5LKRA 3ZLTA 1AURA 3FLAA 5A2GA 3VJMA 3AIMA 3I2IA 1XZJA 1ETHA 2VJCA 5AM5A 3M3DA 1EH5A 3WK9A 4E46A 4CG2A 2QMQA 4FOLA 2D5LA 2XMBA 1HL7A 3ESAA 4BC1A 3WZMA 5ALOA 2ZSHA 5J3JA 1HLGA 5JIBA 2ZYSA 4D9JA 1FSSA 2AJLI 3UUEA 4QDZA 4Q05A 4V2IA 4H7EA 3T4UA 2BUBA 4H7DA 1VE7A 3DJYA 2WQZA 3LLCA 4GDMA 5F4ZA 2VT6A 3TJMA 3GELA 3IIIA 1H23A 5IVIA 5DYYA 5CH5A 5FKJA 4EB0A 4W1SA 1LPMA 4AN0A 1UK7A 1CUUA 4DMKA 3N0TA 3I1YA 1J2EA 1AGYA 2CJPA 1FJ2A 1EB9A 1QIIA 3R3ZA 5EIAA 1WB6A 4XJVA 2XUQA 4BAZA 1FFEA 1WCYA 2WU3A 4X71A 3DL7A 1CUGA 1VA5A 3C8DA 2C5GA 3YASA 5AI0A 5C81A 1XFDA 3F8SA 3WA6A 4M0FA 1UFOA 1USWA 1Z68A 2GBGA 4K2AA 5ALLA 3NOXA 3FLBA 4Q3KA 5KBYA 1LPPA 2WIGA 4MEAA 3C87A 1Q83A 3STTA 1DINA 2NW6A 4BZZA 3R3WA 3IUJA 4A5SA 1UK8A 3DDUA 1FFCA 2VEOA 2CMFA 3QMMA 2XMQA 1MNQA 5CT4A 3QPCA 1U8EA 3HYSA 2BGNA 3I2GA 4UFOA 1Y7HA 5CXXA 4Q82A 1E3QA 4BE4A 2XMCA 4Y2JA 2QT9A 1F6WA 2DCMA 2PM8A 3QMVA 2QXUA 5CT5A 2H7XA 2VTVA 4HAIA 3QPAA 5CT8A 2HFKA 5DNVA 1HDEA 2VJBA 5C8XA 4L9AA 3BIWA 1YS1X 1R4ZA 1OCEA 3AZQA 3H2HA 3MUNA 3O4JA 4X85A 1YA4A 3QM1A 4KAFA 2WILA 3OOSA 1ZI8A 2VATA 1GQSA 2QUAA 1YB6A 3MVEA 2HA4A 1UK6A 3QVMA 5E4YA 3SX4A 4HTAA 3BDIA 2B9VA 1AC5A 5AK4A 3I6ZA 1HQDA 1ORVA 4AO6A 3BJMA 4DSZA 2DQYA 5A7FA 1W6RA 1K8QA 3G7NA 5AI8A 4A23A 2QKYA 2HU7A 4ZREA 2XUGA 3AZPA 3S8YA 2CKMA 3ESBA 4X6XA 1QIJA 1YB7A 4CCWA 4KRXA 4ZXFA 4L3WA 2IITA 2QOEA 4DNOA 1GPNA 3C8HA 4C4XA 1N5RA 1VLQA 4B82A 2JGEA 4X97A 4C4ZA 5FOQA 2I3ZA 4M0MA 4BTVA 5ALQA 2HA7A 4UBIA 4AQDA 3M82A 2G5PA 3I28A 2YXPX 3KDAA 3GFFA 4OPMA 3H17A 2WFLA 3FOBA 4F0JA 4B9EA 4JUIA 1TQHA 3I2KA 3KWJA 1H2WA 1VXRA 4CIAA 3SWWA 5JZSA 1P0IA 3FWHA 4I19A 3R41A 2XUDA 1G5FA 1XZKA 2WHQA 5K3FA 4HXFB 4G9GA 1FFBA 3VDXA 4GXNA 5CH8A 2VF2A 3PUIA 1EI9A 3C45A 3PFCA 4YK7A 4MXDA 1B6GA 1CUIA 2Y1KA 2OGSA 1LPNA 4OU4A 3H2GA 3OPMA 2WIKA 4EUSA 5EIEA 2CEKA 3I6YA 4AMYA 1N5MA 4AMZA 5AP9A 1CUSA 5ALTA 1VOTA 3WL8A 1GZ7A 1JJBA 3WK8A 2AJ8A 1HPLA 4B7ZA 2IIVA 3H2JA 2HIHA 4ARBA 3H2IA 1ZI6A 3DD5A 4Y2UA 1KEZA 5ALWA 1QONA 2PSFA 4UBMA 4KE9A 1XROA 4KEAA 1K5PA 1ACJA 2V98A 2ACKA 4ETWA 4PSUA 1HBJA 2P8SA 4Y7DA 2WFLB 4BATA 1E8DA 1CUVA 4UFNA 3C6ZA 2OCKA 4XIIA 1THGA 2HADA 3GBSA 5ESRA 1E8MA 4RE5A 5IVDA 5KWIA 5T4BA 3AFIA 5AJHA 2VJDA 3FSGA 3WJ1A 4AXBA 5K3FB 1CUXA 5JD5A 5HF9A 1AX9A 4CG3A 2XB6A 5JAUA 1BCRA 4AB1A 4DMHA 4BVJA 1IZ8A 3K6KA 5K5EA 3G0DA 5LZ4A 2J3DA 5JALA 2WJ3A 4FHZA 2HRQA 2VJAA 1Y7IA 4GW3A 1DWQA 1TCBA 2QRUA 2ZVDA 3G0BA 5K3EA 3HXKA 1QE3A 5ALPA 5JARA 2CBGA 4J0CA 4H7IA 2CUTA 3DQZA 2BFNA 1CUYA 5AHXA 1GT6A 4Y2YA 2WKWA 1MO2A 3WKDA 2ONCA 1R88A 3D5EA 3IUMA 3OM8A 4TPKA 2QJRA 3IUQA 2HDWA 1JFRA 2V97A 3LP5A 1IUNA 4Y2VA 3D2CA 1BU8A 2PUJA 4W1RA 2PSJA 1J07A 5A71A 2XUHA 1LZKA 3WK4A 4F5ZA 2DFPA 2J4CA 5EHNA 3TGLA 3T52A 5FP0A 1UWCA 4UHEA 4ARAA 3ESDA 3WWPA 4G4GA 4CCYA 2ES4A 2OQVA 3KD2A 5DNUA 4WJLA 1ODSA 4I4CA 5A62A 4Y2RA 2J4FA 5BOVA 4KAAA 4OU5A 2QUBA 3EF3A 3D59A 4F60A 5AM0A 4DSAA 3CCBA 5AKHA 5FLKA 2X76A 3JW8A 4LYEA 2Z8XA 5ALFA 1YA8A 3PF9A 3GA7A 4BBZA 4U2DA 1MTZA 3WKAA 4JNCA 2AJBA 2BUAA 3HLKA 3TRDA 7YASA 1BROA 4WFIA 1T4MA 4RNCA 1G66A 4Q3OA 1CQWA 3OTQA 3VVMA 1L7RA 3F9CA 3U0VA 4B9AA 5LZ7A 5AKZA 3H0CA 4BTLA 5JADA 3MGAA 3WK7A 4EA6A 4WDQA 3WL6A 2XMDA 5ALRA 4LXHA 5AK6A 2XUJA 1X70A 3FYTA 2GZRA 1B41A 4CCYB 1H2YA 4XX1A 3PFBA 2B4KA 3HRHA 2DSNA 1BS9A 4RE6A 4KACA 1ORWA 4B84A 4G4JA 2HA0A 4J7AA 5E4TA 5DYWA 3GZJA 4HVTA 3F97A 3UMJA 3JWEA 4KE6A 1QIFA 4ITVA 4IO0A 5CXUA 2RIPA 3FSGD 1CFJA 3L1HA 4QDXA 3R3XA 3QYJA 4ZI5A 3WA7A 4EBBA 5FPQA 5HF6A 4PQEA 3AILA 2OGZA 1YS2X 1AUOA 1TAHA 2WIJA 1N8SA 4MWTA 1QO7A 3CN9A 4W9RA 1XRQA 1U65A 3R0VA 3D7RA 3V1NA 1JMKC 3FCYA 2JEZA 3BDVA 1UKAA 4B6GA 1GPLA 4K5QA 3BJRA 3M83A 1ACLA 4MQLA 1A8UA 1ZICA 3ICWA 1GGVA 1ZIXA 2Z3ZA 3IDAA 4G8DA 3DEAA 2E3JA 2J3QA 1MJ5A 1CUFA 4J0HA 3D2BA 2C58A 2W22A 4OB6A 1CLEA 2WJ4A 4PSCA 1YAJA 1XKTA 1DT3A 1BE0A 1S8OA 2HA2A 5EHXA 4H77A 3I6MA 2C0PA 3L1JA 1EX9A 3G9ZA 1XRNA 2WIFA 2HL6A 1XLVA 5JD4A 5AOBA 3RLIA 3G9XA 3DYIA 4GWLA 5FUMA 1XZAA 1N1MA 5ALMA 3B12A 4AO7A 1P0QA 5ALIA 3HABA 3G0CA 3O4HA 3DKKA 4CIBA 1XZLA 2OQIA 2X5XA 2ECFA 4UHHA 1PJAA 3VXKA 3IURA 4E11A 2UZ0A 2QM0A 3ANSA 1XZEA 4QNNA 3I2HA 5C8ZA 5AM1A 1UOQA 3O9MA 5BV7A 2Y6UA 3I2JA 4PF1A 4PNZA 5K3CA 3HJUA 4B0PA 1CUWA 3Q0TA 2PVSA 2XUAA 3C6XA 4Q3LA 4UBOA 4EY7A 3LIPA 1XZFA 4BC0A 4LXGA 5IH7A 3FYUC 5CBKA 4KJXA 3ESCA 4GEGA 4OCZA 3MUOA 4U2CA 4X7BA 3WL7A 3K2IA 4H0CA 5HK8A 3KSRA 1FFAA 3OURA 1ZOIA 5BWCA 3R3UA 4B81A 3V9AA 4K6GA 2PU7A 2I78A 4DM7A 3VISA 3CN7A 3SC2A 1QLWA 2PSEA 1MX1A 2B61A 2OCGA 2OXEA 3A70A 2C0QA 4UBJA 1E8NA 1CUEA 2R11A 1A8SA 3VJKA 2WG1A 3H18A 1XZDA 3F67A 2XLBA 1PV1A 2JGFA 4FLFA 2PSHA 4NS4A 1LZLA 4BCDA 3R3VA 2O7RA 1K4YA 3H04A 5DYTA 1IUPA 4GBGA 4UHDA 1XZBA 4H18A 2GYWA 2H9YA 3ZLVA 1H22A 2DQZA 1WB5A 3CCCA 2K2QB 1OXMA 1AQLA 1CV2A 1DWOA 2AJDA 4DNPA 5JD6A 4K6KA 4P08A 4ZWNA 3GROA 4AN1A 5AKKA 1CUAA 2QR5A 2O2HA 5LZ2A 1R50A 2IX9A 2XDWA 2XMRA 2Y2UA 4AZ0A 3BWXA 4ZV9A 1EB8A 1PFQA 4GECA 1O6GA 3WYDA 1ZI9A 4OSEA 5AIAA 3KWFA 1E89A 1QIEA 2XUIA 2AXEA 1CQZA 2ACEA 1XLUA 3WQHA 3A2MA 3WLAA 4CI9A 3DKRA 3FYUA 2V9ZA 2Z5GA 5KREA 5AI9A 5AK5A 3W06A 4DGQA 4MWSA 1RP1A 1UKBA 3OC0A 4DIUA 4TVKA 1QGED 3ZWQA 5IVHA 1GKKA 4EHBA 4KAJA 4J0KA 4E15A 5JAHA 1BN6A 2XUOA 3V48A 4I3FA 2WUGA 2GBCA 3WMRA 3PE6A 3EBLA 3DCNA 1DU4A 1QIDA 1AKNA 1DWPA 1DX6A 2XQJA 3NWOA 1FFDA 3STXA 5AOAA 4W1PA 2JGLA 2BUCA 2QZPA 1A88A 4KYVA 2GZSA 5AH0A 2DHCA 5DWDA 4GI1A 3G02A 2OCIA 2HHAA 1QIMA 2G4LA 2WHPB 2WTNA 3L1IA 2FUKA 3EQ9A 2PPLA 3ZI7A 2BAGA 1UKCA 1JU3A 1UOPA 2ORYA 2WM2A 4N8DA 1YAHA 4N8SA 4IHAA 4N5IX 2QTBA 3TEJA 1J1IA 4H7FA 5JATA 2EEPA 5ALEA 2XUPA 2EDCA 3QBJA 3FYUB 5HKBA 1GQRA 4P9NA 4BP8A 4N8EA 1UK9A 4XVCA 2WLSA 3R40A 5AKEA 5AIBA 4INZA 5LP1A 1CR6A 3ZV7A 1CUJA 2XMGA 4UBLA 4BE9A 1MAHA 4FTWA 4WY8A 1MX5A 1G4HA 4QDTA 1ZIYA 1SFRA 3PUHA 2VSQA 1XZGA 5AM4A 5FV4A 1TCAA 4X6UA 3FCXA 4FFWA 1YASA 4FNMA 5FXMA 1SCKA 1J06A 1LPAB 2XUFA 2XQIA 4WFKA 2WUFA 2GBIA 5CT6A 3HEAA 3G9UA 2FX5A 4B0OA 2GYUA 4QZVA 4X95A 1L7AA 1Y37A 4WCVA 4CFSA 2HU8A 3E3AA 1TK3A 4BZWA 4QWWA 4U2BA 5HF5A 4WY5A 3D3NA 5FPPA 3ILSA 3BXPA 1QTRA 1CIJA 4UBKA 5LLSA 4X91A 4U2EA 1GPKA 3WWOA 3EIOA 3BL8A 5JAPA 4KRYA 4H7JA 4G9EA 4Y2QA 4G8CA 5C7YA 3HSSA 3E1GA 5ALDA 1VKHA 1JJIA 2WTMA 1LPSA 1EDEA 4EY6A 4X00A 5EHZA 4BRSA 5ALZA 3BIXA 1XZCA 2PUHA 4HRXA 4YPVA 1E66A 4G8BA 4UBNA 1XZIA 3DYVA 1AMNA 4Y2SA 4O08A 4QLAA 3AINA 3DS8A 2C5FA 3VVLA 4KE7A 1F8UA 3H2KA 3ZLUA 4YX9A 4CG1A 4J0DA 2Z3WA 1QJ4A 3NUZA 5DTIA 3G0IA 4MEBA 5D6OA 4QLOA 5IKXA 4JH0A 4Y2TA 4DNQA 2AJCA 4G5XA 4YASA 3VKFA 4IH1A 1AZWA 3A2LA 4ZV7A 5FDFA 3IUNA 4U2FA
chains in the Genus database with same CATH superfamily
2R5WA 2XQKA 2AFIB 2BEWB 1XTSA 3QEJA 2J5QA 1BX0A 4HXEB 3I30X 3JARB 4A0HA 4M38A 1XD2B 5MFZA 4FFDA 4YECA 1C30A 2HRZA 1X9GA 2SKCA 3OZSA 5LC1A 5JVDA 1UADA 2VHUA 1CE8A 3PJFA 2Q8QA 3VYVA 3H2SA 1QIGA 1NYRA 2IODA 1T3GA 3HDYA 2FSGA 3QKIA 4B7CA 3K9NA 3U3KA 4GLJA 4HQ6A 1E3JA 1DLIA 1ZAKA 2XXJA 3R5XA 2R7KA 5HK9A 3MSXA 1V3UA 2VPWA 3A26A 5SYMA 3T3HA 1SC6A 2G83A 5CDFA 5JR3A 3GVXA 4KN9S 3EC2A 4HCJA 1VIDA 2D8AA 4B6SA 1I8TA 5B4VA 5HUQA 1EG7A 5IRCD 3JQ9A 5JS2A 3GRRA 1HT2E 4XPIA 2XAAA 4PTLA 3PGXA 1NY5A 2ZJFA 3PA6A 1W46A 2P75A 5DCUA 3ICOA 4H3HB 3UUFA 3GIWA 4FWBA 5CCEA 1XCLA 2WF8A 1HDCA 4ZJUA 3IAM1 4OGFA 3M4XA 1E6LA 5KWJA 4KDCA 3AKCA 3RO7A 4BAGA 1D5WA 1Z29A 5JTUA 2R47A 3AHHA 3EIUA 1KIAA 2XE4A 1YR6A 4TN1A 1ZZEA 4JBYA 3QE9Y 4LEIA 5DP2A 2OILA 2BFMA 1QS0A 3TTYA 3VX3A 3WMWA 1E5TA 3BH7A 1RJGA 5ENDA 5BYAA 2JFZA 1ZMXA 1K63A 4NK5A 3OZRA 1TPYA 1VSQA 4IS3A 4EY8A 3PGLA 4QYSA 1R6TA 2RHOA 3EVZA 4MKHA 3BX1A 1V9SA 2Q0QA 3O47A 4D81A 3D1VA 1CZHA 2HSEA 4J1NA 1THTA 4ZQCB 4JFAA 1QP8A 1T5TA 5GQSA 3RJ9A 1Q14A 1RKBA 1T24A 5ALSA 2O57A 1RAFA 1T2AA 4LJ8A 3P97A 1U0NA 1XA0A 2BFBA 1L7MA 3KQTA 1V4BA 1ISGA 1C1XB 1VHDA 1PL6A 1I7SB 5LP6B 2YQ5A 1P1CA 1U0LA 4O1HA 5ILOA 1Z0SA 3I5UA 1C9MA 1L5KA 1XCJA 3HKCA 4EBFA 5CG2A 5F2OA 3CPJB 4KODA 3OOHA 2QN2A 4KC0A 1RSZA 1WMFA 1CFZA 4HK4A 4IOMA 2E1RA 4YGXB 1KO7A 3EK2A 1WMAA 3I9KA 3H1GA 3PC4A 3V1MA 3K0SA 1VCOA 2B8JA 5K3SA 4ALIA 5KOJA 1NXSA 2GHQA 4MJLA 3HR7A 4FBGA 5LIPA 3VYUB 3GVIA 5KYUB 1BAPA 3GZNB 2CJWB 1RWOA 4X9XA 4C2UA 3FMVA 2YASA 3OQBA 3AVOA 5BMVB 1FYEA 1GU7A 4H1TA 5KHOC 1E9CA 4DQXA 3LFUA 2VUSA 4FYJA 3U48A 2J5XA 1N2SA 1A7KA 1RYNA 3MTAA 2K5UA 3O8OB 3QEOA 5I01A 1V6SA 2A6PA 1BH2A 3OJCA 5AKJA 3UFBA 3GF4A 3GI1A 4BJ1A 5D5QA 1GNLA 2JPDA 5DX1A 5HQ3B 4B8WA 1VA4A 1UFQA 2ZAMA 5KX5A 4QQRA 4KCGA 1WWKA 4LZJA 3EUAA 1FS4A 1QV9A 1GKLA 2R8EA 1ZOLA 1G20A 1YRBA 3HCNA 4MR8A 4N65A 3GEEA 4BB0A 4EITA 1VCMA 1GTVA 3U7GA 3OLXA 4MWOA 2OAGA 3BTOA 4WLEA 3IE1A 1GARA 1JLKA 5FBKA 2Z56A 1WOMA 4TL6A 4ZTBA 4OF4A 1SBQA 2QD5A 1U3WA 1S7CA 3D1JA 3IP6A 1DQNA 4IDFA 5J2UF 2HMWA 2G1KA 2ADMA 4KR7A 3ZWPA 1OC4A 3WK6A 2OM2A 5JXJA 3PUZA 4QDUA 2ZAGA 2Q5EA 1E9DA 2WU4A 2HRCA 3HKEA 4P7FA 5TPWA 3U7RA 1NKVA 2FSHA 4J4HA 3EGOA 3HGTA 1LRKA 2ZRJA 1AY0A 1ZDMA 4L0MA 2BKUA 4RPJA 3HVRA 4NWIA 1G6OA 1NXTA 3TR6A 5PNTA 2QVBA 4M1WA 1NU6A 5IAEA 4J2HA 3GWGA 3FMFA 3H75A 2OHXA 3LL4A 1QF6A 1YTUA 2H52A 2J3EA 3NH9A 4BDTA 3WMEA 4DSTA 3KYBA 4JNKA 2HWKA 3KKZA 1LVUA 5BOSA 3N5KA 1URPA 2I8CA 3IPRA 1JQEA 5DNAA 1EHYA 2H18A 1EWRA 4I4IA 5TVGA 4MKXA 2H7CA 2VHWA 4MQEB 3RYHB 2ZIFA 2XI4A 2P69A 3HTXA 1J90A 4B3IA 5A4DA 1MFPA 4RX1A 1VJ0A 2ZSJA 3U3XA 1OTHA 5KYYB 1XPUA 4B3XA 1MG5A 2YJ6A 5B1IA 3B6KA 4QXOA 4P4SA 2C20A 1YS9A 1YVDA 5E6SB 3K2QA 1NBMD 4UOQA 4WSOA 5DK6A 3HCWA 1PU2A 4LFCB 3DTYA 4D9HA 2FPGB 4D57A 4JI7B 4J2TA 1UZAA 4IO1A 1EJ2A 3IO3A 2JI9A 5L7YA 2IYFA 5KQMA 2MR5A 3RAGA 4BZQA 1Y4ZA 3OWOA 5IYZF 1N8TA 5I3CA 2PX6A 4H7KA 3TLEA 5IXJA 2J0SA 4IXDA 2D5AA 3PDIA 1ABFA 2PL5A 4F12A 2OZLA 4O2RA 2Y77A 5EEHA 4CG0A 4OJTA 1Q2UA 1JLRA 3D6FA 4XLLA 1EBBA 3W4JA 1A77A 4OHKA 4X44A 4A16A 3NUGA 3S29A 3L7LA 4BWGA 5KYNA 1BDJA 2NZVG 2X13A 4E4YA 4MIYA 1OQAA 1MJFA 1GV1A 2JFQA 4UTOA 4ZFNA 1K0UA 5EJ8A 5JRDS 4RTOA 2VP0A 1Y8ZA 3HO1A 2OBYA 3QSYA 4TKLA 1JIQA 5SYNA 2RGUA 1QVWA 4ZT6A 1JG7A 1MGPA 3EUEA 3NHUA 5DXFA 5C53B 3G5UA 3DFIA 1EGMB 1C0PA 1JJ7A 3HVUA 4P7GA 2FA9A 5DNWA 5HEKA 2JDIA 1OIWA 3DOJA 2YXEA 1X1CA 1EPUA 2DQ4A 4P84A 4XASA 3H5OA 4BQRA 2Q1SA 1MJHA 1LX7A 4JLUA 5DIFA 3VSDA 3UC5A 3QFSA 2H7YA 2ZTMA 3N28A 4LJAA 3G17A 4BVLA 1D6NA 4MVJE 4QBFA 4OAQA 4AZVA 1U0GA 1M73E 3IVGA 5ALGA 1R74A 4BNZA 1B0PA 4AS1A 1GFWA 1ODCA 3LDGA 3TQHA 2OHJA 4UM9B 3C3PA 4IIJF 4Z1OA 5C8VA 1O95C 4JU8A 4JITA 1I2BA 4ZRNA 3SBXA 3WMGA 4GBJA 3LAWA 3D4OA 5AUNB 4QBHA 4AG6A 5CFZA 5IN5A 1GZDA 2Y68A 4FX2A 1T0PA 4IJ5A 1UQRA 2PN1A 1NDHA 1XQVA 3LUDA 4MCHA 4P3NA 4WX2B 4ZT7A 5DJ5A 1TQ8A 1BGVA 5EJIA 2F43A 1E61A 4CMCA 2IZ5A 1MB3A 1NF8A 4F91B 3KUUA 4HX5A 2IY7A 5FLEX 4M46A 4BKRA 3IR6A 5K2OA 1T6BY 1JHDA 1XO1A 1Z5ZA 3U3OA 4HN4B 5D3ZA 2J3HA 4PAMA 4R1SA 2C4KA 3RK0A 1Y6QA 3CX7A 4ROTA 4C04A 1QCZA 4TTTS 1JG1A 1ZA2A 5DCLA 3SSOA 3ZXIA 1C9DB 3MCWA 5J1TB 4ZZ3A 1ATZA 1N0HA 5B57C 2E2WA 3W8FA 2GEUA 3EGDA 4XUCA 1E0JA 3X3HA 4M7PA 1ZVQA 1KS2A 5HIIA 2D2EA 4U2KA 3IV7A 4DDHA 1M0WA 1EAYA 1MOSA 2A14A 1CDZA 4TTQA 3AHFA 1YS4A 1EE2A 1WB4A 4WTOA 3V7UA 3VRHA 3NKFA 4P33A 4Z51A 2JLAA 2W58A 2YXDA 5IFLA 4FDMA 3U16A 1H6AA 3L0DA 3UFXB 3RBXA 1X8XA 3R9XB 3B1FA 4F9EA 1JDBC 1Y5IA 4UZSA 4Y7CA 3D43A 3JQ7B 4DNFA 2QM7A 2H08A 3BSFA 4GX2A 4KKXB 2XNCA 1U9JA 3ENQA 4BP9A 4FEAA 5A05A 2IHZA 3DB2A 3PLRA 3AWDA 3L1UA 3LPAA 1HO3A 2FKNA 5GP1A 1A4UA 3NNSA 3U9LA 4F2GA 3H1EA 5EJ9A 1JEYB 2BY4A 2ECKA 2GAJA 2QL7A 1R3DA 1N2IA 1KSJA 2Y4NA 3DUFA 1ZP6A 2ZYRA 1SZDA 3EXG2 3LYLA 4UJ5A 1KEEA 1VMDA 5EE0A 2Z8YM 3U4AA 1H9CA 1IJBA 4OXXA 4DABA 4GRIA 3VU0A 5L53A 2WUEA 5F33A 2P11A 1NFFA 2W71A 1VDZA 4MROA 2WJ6A 4UTNA 3OPYI 2BEJA 4F4JA 3O3CA 3V1LA 1PYGA 4HNSA 1BW9A 1FNMA 1ECPA 3DCYA 1CY2A 1RMQA 1AKUA 1YQDA 1ZK1A 1NYLA 2V96A 3DBOB 2ZVJA 3EA4A 3GARA 3PYXA 3HR8A 3QVGB 4IW3B 1A7UA 4LXTA 4UQPA 4IDPA 4WH0A 3VGJA 3K9BA 1T3ZA 3R1IA 4BVBA 4CLHA 2I0FA 2EX4A 2XD9A 3EIQA 3V7YA 1UMDA 1RYYA 1M76A 1FYVA 3A4VA 3GFQA 4ICIA 5SY4A 4ZDKA 2Q6TA 4PBTA 3AM5A 4N12A 2JAOA 4BVGA 4LJYA 2OHIA 4Q15A 1OKKA 3VSEA 4CT5A 1PDOA 1EDBA 3SYMA 4UNRA 3F47A 3VPXA 5AM2A 5M29A 4C7MA 2OCPA 2WHPA 3ROXA 1ESMA 3I8XA 2FE1A 2JIMA 5D6NA 4AZ3A 2H9AA 4KUGA 1NVVQ 1BXGB 3WWEA 3ZIAD 4F46A 1NSYA 1I0IA 4BVHA 2X5KO 1Q44A 3ONNA 2ZJ6A 4EYOA 4OMFG 4NLLA 1R6DA 3CF4G 1O94C 5HUJA 5K51A 4PNHA 3IELA 2ZI4A 2IEZA 3FDZB 2VNHA 3QIAA 4LPSA 3AUFA 3FYSA 4MQBA 3MUEA 3TNLA 2BTQB 1HK7A 4TTVA 1IK6A 4LKOA 2A5FA 2XZOA 3L4JA 3L4BC 1ANKA 3CNHA 1T29A 2GK3A 4YFYA 4MP6A 1Z4IA 2RJOA 1YVEI 4LSGA 4M76B 2RGRA 2JH9A 3AF3A 1O95A 3A25A 1FTWA 3GEBA 3OE7A 3GDHA 3TBKA 4BCCA 1UKZA 2PUVA 3K4HA 2Z43A 1C9KA 2VAVA 1QIKA 4LMBA 4PLVA 1OREA 3NVAA 3FWYA 1PEYA 3Q4GA 3WHPA 4ZAFA 4FP9A 1MF7A 5JO0A 2CL0X 4B3BA 3NOVA 6AT1A 1JFLA 1FSPA 2IV3A 4Y2XA 5HJEA 3PKIA 3H6KA 3RS7A 4DR6B 3NC0C 3B6IA 2AKAB 1DRJA 5IBQA 1K98A 3DT6A 1ENOA 5HIKA 3LQQA 5E9WA 4NMLA 3KYDA 1KA9H 3S2GA 4P34A 1ZCJA 2BP7A 2CDAA 4HL6A 4WGFA 3CZQA 4R8SA 4UM9D 4PYQA 4AS2A 1UAYA 1E60A 1VZ3A 1CPYA 1HEIA 4FNAA 4JR1A 4N0DA 2C2OA 4ZMRA 4FT4A 3F46A 1P0MA 1GQQA 3QE2A 1G8AA 3PJGA 2B5WA 2YCLA 3MWEB 4P4LA 2I4NA 1NUTA 1UT5A 4JCOA 5TARA 1EUZA 4O8ZA 2OESA 4D92A 1V35A 4K7JA 4NEGA 1FUKA 1LC3A 3IOEA 2B4AA 2NTVA 4BGVA 2PLWA 2RHWA 2ZT8A 3HCRA 4CN8A 4DLTA 3BTVA 4IV0A 1Y1KE 3NRBA 1XRLA 1P4SA 3BF8A 3K8OE 2UUOA 4OLHA 1FFYA 4GVXA 3GY0A 3TQFA 3MQ2A 1LBEA 3D0KA 1RWQA 3MCTA 4IH4A 3AIKA 5IJXA 4L08A 3UJPA 4W8OA 3Q2KA 1F06A 1CIVA 4UHCA 3MJRA 4X93A 1XTUA 2ZM6B 4EVIA 3BAFA 4L4XA 1ESZA 4R1MA 3EEQA 1NJ2A 1YE3A 2N47A 4IFBA 4DUGD 1VI5A 3PEEA 2ZJ2A 2HQOA 2XLCA 1HE1C 2LR0A 4LDAA 1JHOA 4R05A 4JA2A 3VU3A 3AUKA 1X0XA 2E5WA 2ZYDA 3MTIA 1F3LA 3LXMA 1RXIA 3CVOA 3QWHA 3V2GA 1MC8A 1ZM4A 4P3YA 2C2MA 3DSRA 5CFOA 1JJFA 1OI7A 5A3JA 4X3CA 1R12A 2GGSA 2X6QA 4RQBA 2A5DA 2Q2WA 4DRYA 1E1DA 1LDYA 4QYWA 4Y98A 4DXHA 2HHHB 4ITUA 4ESOA 2HC9A 2OBFA 3LUGA 3NASA 1SBNE 4G1MB 2Z6QA 2H11A 4DLXA 3MMPA 2RK4A 2FLKA 3BEDA 3CH6A 3QKUA 1P0PA 2V6BA 2JGJA 3A1SA 4KLNA 3FSJX 1Y9JA 3TINA 4D4MA 4R0MA 5B3LA 3AL0C 2OGUA 4P7JA 1X2EA 1V8ZA 1K6MA 3H8WA 3IV9A 3NGLA 5FOUA 3WIVA 1LI5A 4CM5A 4JJ8A 4ER5A 1BSVA 2WUDA 2FQYA 3ER6A 1U7WA 4XZ3A 3NT4A 3VKHA 4MQ6A 1PG0A 1Q19A 4RD2A 2PWPA 5KJCA 3P2MA 4UD6A 2J67A 1T3LA 4NPHA 4C89A 4YMLA 1NI4A 4Q4LA 1E2FA 1JKJA 1Z5UA 2PTHA 3P8ZA 4GVPA 4CEJB 1T6NA 1O94A 3MS2A 2VUUA 2WWGA 2OG1A 4MUNA 4UTZA 1TEVA 1R9MA 1NVGA 2JVJA 3TFOA 1PW7A 4D0LB 3AM4A 4AYWA 5F7JA 3FPGA 4NMMA 3L4BA 4YLEA 1H69A 1S3SA 3HWRA 3DHEA 2PZKA 4Y3UA 5HZGA 1K7CA 2PWYA 3ESXA 3NYQA 1RZRD 1Y4SA 1YDMA 5DOVA 3WYFA 1UC4B 5FFFA 4I4TF 2C2GA 3H5AA 1DQZA 1G8MA 2YC4C 3QX9A 4FU0A 3WLPA 1W93A 1QH0A 5DT2A 5FD8A 5TLSA 4KKVA 3STUA 4M0CA 1OT3A 2X42A 3T7EA 4DCMA 3IP5A 2ZIWB 4Q1VA 4K9DA 4TT3A 1HFEL 2HO4A 3RWBA 5AI6A 3QLUC 3QNWA 3U40A 4A0GA 1WPXA 1SXQA 2VDQB 5FULA 1Z38A 4IJVA 4MEJA 1DAPA 2MSWA 4B6PA 3IQXA 3FVVA 4YXFA 3C6BA 3S0JA 3ZHOA 4RQTA 3PICA 3PXXA 1QK5A 1XDWA 3W5HA 4MV5A 1L2TA 4ZVLA 4ER3A 4HBZA 1ZD5A 2BISA 2BCEA 2OPBA 1MVOA 1PGNA 3JQ8A 4LX8A 4Q00A 1LNZA 2JJYA 4ZYTA 3VPSA 4KOEC 4CTJA 5CNJA 1TMYA 4D0NA 5LU9A 4R1UA 2XY4A 4D3XA 1Y3AA 2DU8A 2Q8PA 1UR5A 1V6CA 3T06B 2GR9A 4ITRC 1EXMA 3SMVA 3M4NA 3UWKA 5EIFA 5K0JA 5IM4A 3DONA 1X9IA 4MUJA 3I9MA 3S2YA 4EI2A 4E2YA 1WD5A 2O2GA 2H0AA 2YN0A 1TZJA 4NEQA 2GB4A 4GOXA 3OPYB 3QKRA 1ZU4A 1TADA 4BX0A 3TL6A 2FR1A 3PDUA 1Z62A 2GO1A 4Q3DA 3B2EA 4UAGA 3NTOA 5DK4A 1JPNA 2VDUE 4IZHA 4C7OA 3I9NA 1AT1A 4GPD1 4LG1A 4RA9B 4BYGA 2QBYA 1GDHA 2XXAB 2HHJA 4QGAA 3QXHA 3L0ZA 3HH8A 2QW0X 4PZ9A 4A82A 3I2YX 2PX4A 5AKYA 1ORDA 3T1HB 8ATCA 2R6ZA 4PIVA 4JQSA 2OB2A 3DAHA 3EXHB 4LCBA 5HKKD 4DG9A 4DJAA 1W9HA 1P74A 3AXSA 3CU5A 3LPDA 3RBVA 5IYZB 2ZIAA 4UEJA 1T3HA 3UAWA 1V1MA 5H3HA 1Q12A 2X19A 4DA6A 3QIVA 3D5TA 4JB2A 5D7BA 1RQRA 4C4TA 3G79A 4P4UA 2RKBA 1FFHA 2BR5A 5K3AA 4TTSA 2HMSA 3M9LA 4OXKA 2BTEA 1XL1A 1IXZA 4ND8A 5ESXA 1NIJA 3NWPA 2PSDA 2PZJA 1B15A 3KYJB 1OWLA 3WB1A 2JAWA 1J8FA 3E9YA 3VDQA 2TMDA 1FE8A 4L3VA 4KQGA 2AK3A 2D2XA 2E37A 1U02A 1QRSA 4LHSA 3V4LA 4C1NA 3D3QA 1P1KA 4PLHA 2ODAA 3C6QA 3ZCXA 2OP1A 5HSGA 5A7GA 2ATCA 5CHEA 4POOA 4GM1A 5A4IS 3HY6A 3THYB 3FBGA 1NLZA 1QHXA 3UKJA 5FNVF 4A8JA 3T34A 3FFWA 4ZT4A 5BQOA 3WXBA 1LU9A 1QOZA 3B2NA 3J81A 4MITA 4S12A 3U1VA 4MAFA 3ELWA 3O1HB 4UKDA 1MN6A 4PONA 5DN6D 4BECA 1G5QA 4URVR 1BVUA 2HA3A 3A8TA 5BNTA 2OM6A 1KI6B 3SEZA 5IJZA 1XUOA 1M54A 1I3MA 2JIRA 3H1PA 3MWDA 3OSUA 5FPHA 4IIJB 5ANRB 3SKYA 4AM8A 5KKCA 5DHSA 4W63A 4CEHB 2AYYA 1A1VA 2V3WA 4B48A 3MERA 2Z4SA 4WZBA 4Q01A 3RFCA 3K96A 4FKMA 5MN5A 1FY2A 2QVXX 4LAFA 4BEWA 1CB7A 3NANA 4GU5A 3RSCA 1GKYA 1UMCA 2QTGA 4PO3X 1M6VA 1NKSA 3LMKA 3MGGA 4RK7A 1TMGE 3OLVA 3ZK7A 3SFZA 2YUIA 5FA6A 1NZFA 1VECA 3KQUA 2AF3C 4X6YA 4BIMA 2F62A 2E4WA 1D2HA 2V4UA 3QLUA 4WIAA 5E6RB 4DS3A 2P35A 4DB4A 1QAOA 1W52X 2B82A 1NW3A 2C7BA 2YQZA 2ZANA 3ELYA 1ZC4A 4L6CA 5TJ9A 4BO3A 5A6VA 3BWYA 1WXGA 1RCFA 1TIKA 2ZCUA 2ZBDA 1UJBA 1YBAA 2VF4X 4JIMA 4LIPD 5K05A 1TMOA 1RM0A 1DMSA 5T57A 1L5LA 5FTWA 2BELA 3EW9A 3P2JA 1U0SY 1AQUA 5GV8A 1XJWA 1E2DA 2KSQA 3RRFA 4KTTE 4YRNA 3NALA 2C7QA 4RLSA 4X1IA 3UAYA 2BFFA 2CXPA 1G9TA 1YZYA 1V8DA 3DHVA 2TSYB 1HDRA 4UFPA 4Q5IA 2CNWA 1EUCA 4HB3A 1OX4A 2E21A 3RUHA 2Y1DA 2F59A 1PL8A 5TMEA 5HWSA 2ZSFA 5IKMA 3AYZB 4IM7A 2XCRB 3ZDQA 4K6HA 4EO9A 1Q15A 5SY6A 4EECA 5EJMA 4CNBA 3FVQA 4HNAB 3OX1A 1CYEA 3Q9LA 1FMFA 1ZJZA 3ONEA 1SC3A 1E4EA 3ZGVA 2GN0A 3RI3A 2QTNA 2FQ1A 1A7AA 2J9YB 3ADDA 2QN3A 4FEEA 1R8JA 2AV6A 4TSKA 6REQA 2VSOA 5ICEA 2DERA 3X44A 4QTZA 4R5MA 2J7PD 2F1RA 3FKSA 1W5FA 1XQXA 1UIMA 1RYDA 4K9MA 1P7CA 4X63A 5T4HA 121PA 1Q84A 4HWTA 1D8TA 5LD2C 3RVDA 1FIUA 3EQ7A 2X0KA 1OIVA 4R9UC 2NUPA 1MV5A 1Y1PA 5KSPA 1WKCA 3E3OA 4JROA 4CRWB 2W2KB 4FNGA 1CUHA 1BFKA 1OFUX 4OD0A 2C8VA 3JWGA 3ZWNA 4E5MA 5FBVB 5IARA 1O3YA 1OW3B 3MTQA 3O93A 4KRFA 1HYGA 1YWGO 3IAEA 3OT1B 4QG7A 4RPHA 1U0JA 3ROGA 4DCCA 5B1YA 2EVWX 1QZ3A 1Z36A 2GRAA 4CMBA 2NSJA 2Q99A 5AKLA 1VG0B 2P5TB 2OBMA 1XKLA 1C8BA 1PR5A 4AULA 1OH7A 2C31A 4EHLA 1CEYA 4KIUA 4D3DA 1UBCA 3AJAA 4J16C 1ZD4A 1R9NA 2VOJA 3X2FA 3LBFA 3CGWA 5KSYA 1RYBA 1LB1B 4BAUA 3SMQA 2CK3A 3TOZA 1E2IA 3QLJA 4PC6A 1CX9B 4U7GA 4TWZA 4Z54A 1EYZA 4K0RA 4KLZA 3M4YA 3KSMA 1ISHA 1SVUA 1W4LA 2H48A 3BWCA 2HK9A 5JANA 1MAAA 2DWQA 3E53A 4IDQA 3UBMA 3ZLTA 1AURA 1PQUA 2BJWA 3FXAA 3PFKA 4ZEOA 3AIMA 1WRBA 4TLBA 2X8JA 2JZCA 3I09A 2ZI3A 2XPCA 3F9RA 3GDOA 3LUFA 3K16A 2RB4A 4WW0A 3DOOA 4ZAZA 2IFTA 3WNBA 3WB9A 1MOQA 1IHUA 3RS0A 4EF4A 3DW3X 1DKPA 4MPTA 2D5LA 2XMBA 5LN1A 1E2MA 4B44A 4BMCA 2QN9A 3CKLA 2EGUA 3EGXB 3W9SA 1JQDA 1HKUA 3WZMA 5HDQA 3WGVA 4JQYA 3LQKA 3WP0A 5KNDH 3Q5DA 5J3JA 3U4QB 5JQGF 3REGA 1GUYA 1RD4A 1VFNA 3K0HA 2YIDA 1KZGB 3WLJA 1L7EA 4Q3AA 2J09A 3C39A 3FR8A 5GZ1A 5KNDD 2D8MA 1DO0A 3LVBA 3DMHA 3M1LA 3OVMA 1LS1A 3VDMA 2AJLI 8OHMA 5CD9A 3HJFA 1UWLA 2HO5A 5HVNA 5G1NA 3H9CA 5BP7A 5K0ZA 1KHHA 4V39A 3UMCA 3GLGE 4V2IA 3RVPA 1Z6AA 1QPBA 2WWRA 4H7EA 1P8JA 3UK1A 4RJTA 4ZEVA 4EW6A 2NO9A 5JMPA 2CV1A 5L7WA 4F3KA 2PFKA 5IZCC 2ZSDA 4ASUD 1W36B 5GVRA 2WQZA 4GDMA 4DIFA 1U7XA 2WVJA 1CS0B 5FTNA 4AY2A 1TZ2A 3IIIA 1FYFA 1E2NA 4BZPA 4DBVO 5IVIA 1YGYA 3BFPA 4ZC8A 1XK7A 1B00A 1O08A 3E03A 3G5AA 4FOPA 2AZDA 3SIWA 3LY5A 3DAPA 4LVNA 5T7BA 2BM0A 5CH5A 2NP7A 2ORWA 1Q1AA 5K1ZA 3BSYA 3ZV6A 2V45A 4XX0B 2DVMA 3TXXA 2YW2A 2DTXA 1QDEA 4N0QA 1UH5A 5BUCA 2NUAB 2EATA 4W1SA 2R8OA 1MJNA 3F3MA 2GBLC 3JYOA 3AF4A 3K1AA 4RPKA 3FTPA 4NBTA 4Y9TA 4OLFA 2F3PA 4R8MA 4XSHA 2C9BA 4TSFA 5IWAB 2X9LA 3QW4B 4A92A 1W85B 5JBQA 4YO8A 3CNLA 4UTVA 2FPPB 2C99A 1J1UA 1HMPA 3UPUA 1AGYA 1ND6A 3AUTA 1WA5A 1YC2A 3CW9A 1SN7A 2QQ5A 3VNQA 1N8KA 3D7NA 2R66A 5IFKA 4YJFB 4G63A 1EB9A 2A7XA 1Q0HA 2P78A 1QIIA 3I34X 1XOIA 1RLIA 2V6JA 3QKSB 3R3ZA 3GGCA 4I55F 4IHKA 4YI3A 4XJVA 4F85A 4DZTA 5CDFE 4BAZA 1MAWA 1GQFA 4Q1FA 1B6RA 3S3TA 3HO6A 2WU3A 4NEHB 3A37A 3HB5X 4AROA 3OEWA 3QUQA 5CP8A 4D4IA 4XVQA 1WW2A 2RJNA 2R7LA 1VA5A 3OQPA 1QU2A 3T94A 4K87A 4F5EA 4D9KA 1RXCA 4Z86A 1JQKA 2IEIA 3FBTA 2VP6A 3FGOA 3L6DA 3TIIA 1GNQA 3EXFA 5JSFA 3ZE9A 1KFEB 1II8A 4B7XA 3WA6A 1DRVA 1WCXA 3K73O 4M0FA 3EZLA 1CK4A 1GPWB 2GZDA 1UFOA 3RYIB 3KXIA 1N0WA 4K2AA 3R09A 4HDMB 1JPUA 1VQ1A 1L7NA 1FP4B 2ZRQA 3KZOA 3L04A 3NBKA 4LSWA 4W8GA 5ALLA 4Q3KA 1Z5PA 4J16A 4LOLA 2PEYA 3TVDA 3KXLA 2HF2A 4Y1RA 3RVLA 2DYKA 1KAQA 3FJ1A 4MEAA 3KQOA 3P9YA 1W0JD 2BH9A 1QR6A 3HR4A 4EB6B 1T1JA 2IHKA 2XTZA 3DO5A 5EQDA 3WSVA 4CMIA 1OB5A 3V6LA 4X7PA 1B6TA 1H5UA 3H8VA 1II0A 1Z5WA 1WP4A 3LX5A 4C0SA 3V5NA 4DB2A 3RRJA 2XZLA 1XAHA 3S4YA 3SXUA 3LKZA 3QVVA 2O2YA 4TTIA 4FYWA 1SOUA 1IPHA 4XEHA 5A4MS 2E6UX 1VMAA 1NMYA 1DDGA 3KG2A 3UGJA 1H1DA 1RIIA 2W83A 5A9RA 4KDEA 5KNBA 1H0SA 2B8WA 4Q48A 2O48X 3VZPA 1NVBA 2QX6A 1V5WA 4XSGA 1MNQA 3FGPA 4H1VA 1Y4DE 1WUYA 3HV2A 4U5XA 4YH1A 1U8EA 1XVAA 1O6BA 4G01B 4KAXA 4ZQHA 3UB2A 1YR8A 4EG3A 1VIYA 1N1DA 1N6RA 2Q5LA 4RSHA 1YJ5A 4DBLE 5BQFA 3DOUA 2IKSA 2QEQA 2IYAA 5EIBD 2HRBA 2Q45A 4I4TB 3WDMA 5EJ2A 3PITA 4FJ2A 1BDIA 4UFOA 1Y7HA 2OWEA 2F1IA 3I0MA 4HXYA 5CXXA 4DFDA 3O1IC 2Q3DA 2QRVA 1E3QA 2ZUCA 4LISA 3RJ5A 3V3TA 1UJ5A 5B30A 5K0FA 1OXUA 2WMDA 2QT9A 2BMEA 4RD0A 4XI9A 3QVWA 4PYNA 3ST7A 4TYPA 3ZDBA 3LOUA 1L1FA 4F72A 4YALA 2PM8A 1R5JA 2W2LA 3QMVA 2ZWIA 1J8YF 2H7XA 3D4PA 1VGQA 4HAOA 4HAWA 4RYDA 5CJJA 4E2FA 1LEHA 4JI8B 1Z7EA 1QFJA 2NXJA 5IZCA 3LO5A 5IULC 1RDFA 4YP9A 3ZQ6A 4MRNA 2LV8A 4MULA 3O21A 4WXYB 2VJBA 6ADHA 2VHQA 4JLVA 4LYGA 3GBPA 1G20E 3O38A 1R4ZA 3GDFA 4FSHA 2V6MA 3E7FA 3MUNA 5KWVA 2O3JA 4M7RA 5J43A 1KGSA 4KAFA 3Q6IA 3CNQS 3TTSA 1RBZA 4I8XA 3THWA 1X7HA 3OOSA 1XMQB 3WQRA 2VATA 3B9QA 5ITVA 7REQA 1KH1A 3M3HA 2ZIVB 2GBLA 3P1JA 4IVPA 4URFA 4F84A 2Y67A 4W9NC 4YCSA 1W36D 1ULTA 2QYSA 4I8DA 2QUAA 1O5TA 3UCXA 2I55A 4A8PA 3OA2A 2FPIB 4PXSA 5LA6A 5LQMA 3PHHA 4ILEA 2YTZA 4AUEA 2B7LA 4Z3DA 2X1VA 4MUKA 4Y9UA 3EPPA 2QLMA 1T9DA 1XYGA 5E4YA 2HF7A 4CIDA 1WKBA 5HM6A 3IEVA 4HTAA 2JAPA 2WQ7A 4XGIA 1P7ZA 1HQDA 2P9EA 4AO6A 4DSZA 1ORHA 3VA7A 2PMFA 1PJ2A 4U1RA 3AP3A 3VR2A 5BV2P 3G7NA 1JA1A 2GVZC 2HU7A 1W9MA 5EJ5A 1U80A 1ZUNB 1AGNA 3OESA 2CKMA 4ENSA 2D13A 4X41A 4MP3A 4C21A 5U9CA 1YB7A 4QQNA 2E89A 3P5SA 1WXXA 1LTKA 2IYOA 3W3AA 3RIGA 2RHGB 4JQCA 1YJXA 1Q17A 2RIRA 2Y1LA 3DWGA 4ZO9A 4OX9B 1YIAA 2QOEA 1NGSA 3RLFA 4HDRB 3GAMA 4HFNA 2XCOA 1P7WA 4G26A 2FDRA 3FWZA 3A9SA 4UJ3A 3UK7A 2VPQA 3EBPA 4COOA 4Z4HA 1N5RA 3JD1A 4WEOA 3LY9A 1K6JA 5CVVA 4BMOB 8ABPA 1OD6A 4FINA 1VLQA 1E3SA 4B82A 3RC3A 4HDKA 4R3WA 3K4PA 1R66A 1KRWA 5CM9C 2JGEA 5HKOA 4YAOA 5FNVB 1RE1A 2WAOA 5CW1A 1ZBDA 2P77A 3CWZA 1ILWA 2OO5C 7MDHA 2AC2A 1N6OA 2IELA 5JD3A 1JZSA 2I6QA 5ALQA 4AQDA 2KW5A 3NOOA 4IP0A 4YLGA 5IEBA 3AJEA 4NY1A 4Q3CA 2G5PA 3GHYA 3I28A 2FN7A 3LCJA 1D1SA 4PS1A 4RXUA 3VDNB 1KJIA 1S2MA 4TL8A 4FGUA 1T36A 3BXXA 3LFHA 1OY1A 4B34A 4DLKA 4AXXA 2PS3A 1KJNA 5BRJA 3W9YA 2A4KA 2UZ1B 4JUIA 2NQTA 4I9FA 2GLTA 3ZZUA 5F52A 1DC4A 3UJHA 4C4OA 1A9TA 3KWJA 1IBRA 3T9EA 3ZY5A 5IJ0B 1PNRA 1OH5A 3KPWA 1PR1A 2WIBA 1V16A 2EJCA 2L19A 2HREA 1DPGA 2VXOA 3L4KA 1T13A 2APJA 1SXPA 1SVSA 3GV0A 4MW7A 4UC0A 3KUCA 3ZXUB 4I19A 1J2TA 4QODA 4QGHA 1KHTA 3DZGA 1G5FA 1Y81A 3AP1A 5E2AA 3CZ5A 5IEJA 1N7HA 4HXFB 4KJZA 4OEHA 4QYMA 1B8NA 3DMTA 3OC6A 1BHSA 4RVHA 2G0AA 3VDXA 3F5SA 1MXHA 1ZSYA 2W8BB 2XCUA 2PH1A 3DCJA 3LGXA 1E2UA 3WYEA 4PZLA 3ZU2A 3LKDA 3KTAA 4R1TA 4RFVA 3O5AA 4OQDA 2G77B 2J0QA 3IPAA 5DHAA 8MHTA 1Y3HA 1YHZA 2DPMA 4GGOA 4PVDA 4YK7A 1OPRA 2V7XA 3VSBA 2VF8A 5IAOA 1MLDA 1LQ2A 3MOSA 2ZULA 4G56A 4CMEC 1CQIA 1RCUA 1Y98A 3I9V6 1ZCAA 2DZDA 4P0TA 3PNVA 5TT0A 3B3AA 3AY7A 5DW3A 5JY6A 2FV8A 3S2EA 5A5FA 3HWWA 4Q9JA 2K7ZA 2Y1FA 5EINA 4C22A 4LYFA 2WIKA 3ACBA 3DLHA 4L9RA 3NWBA 1OYWA 3R5HA 3GA5A 4NHEA 3I6YA 3MWLA 2C1ZA 2X4DA 1FFGA 5KSWB 1RXEA 4AMYA 4W9NA 1DQRA 1SBTA 5CVUA 4TSRA 1E7RA 4BLUA 4YGYA 4DY4A 4FB4A 5AP9A 3MRTA 2WYOA 4WBNF 2UUCB 1PKEA 3WL8A 5JROA 4OGKA 1OHHD 4BLRA 1GPBA 1T34A 1HPLA 4B7ZA 1MA0A 2IIVA 4TWRA 5LIRA 1V45E 2O5RA 3CLTD 4RVNA 1GZSA 2IYXA 1R16A 2VJLA 4G0PA 1HV8A 4MQFB 4WUVA 4EF5A 4EQ6A 3MHTA 4Z9XA 3EZFA 3H2IA 2LBPA 1MRZA 1ENPA 4B3GA 1GQ2A 4GMHA 4Y2UA 1Z22A 1HDOA 4XQCA 5K3OA 1JWAB 3O83A 2I4MA 4TL9A 3U4HA 3WGUA 3AY0A 1TA0A 1Y4UA 5DV9A 4YMGA 4KE9A 5LMZA 3AL2A 1L4EA 4ND2A 1CU1A 2JFUA 4KEAA 2R8PA 1IOVA 4NBWA 3GWZA 2BR3A 3ZHQA 4BUZA 1ZEJA 5FL7A 4XH9B 1TW3A 5EHZA 4MI1A 3ANMA 1WY7A 1I33A 2GM9A 2IE0A 1J0XO 2HV9A 1KEKA 1HBJA 2N42A 2QUKA 1YIDA 2P8SA 1G4UR 4CGZA 2WFLB 2MYPA 5TF0A 5HZHA 3HA3A 4PRZA 4YYEA 1CUVA 1GL9B 2H4YA 4OQYA 3BICA 4UFNA 1PR2A 3RVQA 3ZDCA 2ORED 2OCKA 3ZN2A 1ST3A 2Y3IA 1QE5A 3PSHA 4U6QA 1JHVA 4JI1B 4U7DA 4LF9B 3EZNA 3PXEA 4B4UA 3GBSA 2CD9A 1R9JA 3R5KA 1YMUA 2RHCA 3MA0A 4JASB 1B8PA 5T4BA 4PLZA 3PPYA 2MJLA 3S2IA 1ETUA 4LV8B 3OMXA 1YJ8A 1M8JA 3C7AA 2NU7B 3T41A 3GNLA 4KQCA 1Q1BA 2P3OA 1IEXA 2P9HA 1C7RA 3LVRE 3GFTA 3IUSA 1YQXA 1OLUA 1T4DA 1H3NA 5HF9A 1AUQA 3DZHA 4QOJA 2FDCA 1PFGA 1I7LA 1U9YA 2WJAA 3OO0A 4IINA 3ONVA 4NONA 3ZHSA 1PX0A 1F4LA 1SVKA 1YGPA 2POCA 1BCRA 3JYPA 5JQGB 1C3VA 1LDMA 3QWBA 4BVJA 2XWJI 5B2EA 2QQFA 3IILA 1J2YA 1MIHA 3F90A 2GEDA 4ONEA 5EAIA 5AVQA 3M1YA 2YMQA 1ZD9A 13PKA 3F5MA 5FBQB 1EQAA 3ECCA 1EM8B 4LC1A 1RVV1 2AC7A 2UU9B 2CC2A 3G0DA 2FX3A 3P9CA 5DBGA 5DX8A 5EHGA 4DMUB 2QL9A 1ULSA 3D0QA 5TQ2A 1EP2B 3G23A 3R3HA 2IXEA 4M0KA 4PX9A 3SICE 2GDZA 3K70C 3MINA 3G2KA 4EG4A 1RRCA 5KMGA 3VM6A 1AZTA 4MVJM 1KOFA 1QLJA 1ZM3A 1X42A 2HRQA 2VJAA 3RV3A 1Y7IA 5BW5A 1XAIA 3GJ6A 3K0CC 3ND6A 4EELA 1YKFA 4DJEC 4GW3A 1DWQA 1TCBA 1YR9A 2UVPB 2HSZA 3EA5A 1G8HA 2Z04A 1O58A 4JKIA 5K3EA 2QDXA 2V5AA 3IPXA 4CMEA 5BWMA 2W37A 4OH1A 1DBRA 1OAOC 2IZ0A 4UAJA 3SM3A 5BRNA 1U0HC 2WPDA 3RKUA 3T7JA 2CBGA 2X41A 3AI2A 4TRJA 4YRIA 5JARA 4EWLA 5JYEA 3DQZA 3I9LA 4JDUA 2QIOA 3P27A 1E18A 2VNSA 2XDQA 3NIBA 4QPPA 3RSGA 5HRUA 4KTVE 1GT6A 1TJ5A 3ABIA 4J1TC 4UU1A 2IDKA 2XB9A 3KTFA 2NU9A 3GN1A 1N3YA 3GLIA 1JZQA 1YR3A 3CZ4A 4DIOA 5JNWA 4QUBA 2HPVA 1Q6ZA 1BGXT 3H5RA 3HB0A 3IRVA 3IUMA 1M2HA 3OM8A 4LZNA 4TPKA 4D9FA 1DC7A 1MIOB 4I55B 3R7AA 2CFCA 5AESA 1NJGA 1T1GA 3ONFA 5A9SB 4CLRA 1F3OA 2HDWA 1L8XA 3IUPA 4OJKA 2OAQ1 3LK7A 3TN7A 3VR5H 3COSA 2JZNA 2SNIE 3GUVA 3L46A 4AUMA 3TI7A 2GF2A 1IUNA 2PAAA 4FE4A 1OXKB 3GVHA 2ZBPA 1E0AA 4IVQA 1X8LA 1QFZA 2G1PA 1TYEB 3ZY2A 3JWJA 4RKWA 1J56A 1Q16A 2PSJA 1L5VA 4RF4A 5AJYA 2CL5A 4PG8A 1XKQA 2B94A 2PRZA 4XPZA 1FTYA 4INAA 4QTXA 2ZE5A 4GI2A 4M0LA 1MH1A 4YC7A 2AFHA 1A3CA 4H4CA 4QVIA 3CVXA 4RYLA 3FPCA 3R5TA 4QX6A 4GT1A 2JJ2A 3UHAA 1E1NA 1TO6A 3I6QA 5EZ6B 5CJ2A 9LDTA 1C80A 1FSFA 3HMKA 1NBHA 4KXWA 4Q7MB 4U00A 2X0JA 4NFLA 1UZMA 3LHSA 5AD1A 3ZIDA 5C4MA 4OP2A 2EHDA 3HDJA 2I4IA 1U3UA 3ZGOA 3T52A 1I4EB 4J3FA 1QC5A 4LI3X 2VLBA 4DPLA 5GY7A 3BD8A 3DO8A 2FOIA 3PNBA 3OIDA 1R4MB 2FPOA 4JL5A 4JYBA 3WWPA 1WDTA 3ZD7A 1TKAA 3S1AB 1L4MA 4KQ2A 1GUFA 2FLWA 4D8UA 1CJKC 2WJWA 4KIFA 5FO0A 2OQVA 4UU7A 4W5HA 4PY2A 1V25A 2XCTB 1NQAO 1U04A 3JY6A 4I4CA 1SXJC 3M9XA 3T38A 1EFPA 1QCCA 4KQHA 2DX7A 3L6RA 3L8FA 3F3SA 1KIFA 5C1BA 3TW8A 4B6OA 3PVZA 1T5DX 1DAEA 4RL6A 2GN6A 2J4FA 1CNFA 1G19A 1W29A 2G17A 2ICAA 2IOHA 2O14A 1ULUA 2QRQA 5BOVA 4BNDB 4JT2A 1SG9A 4KAAA 3ETLA 2ID9A 2A9OA 2QUBA 4ZC1A 1KZ4A 3E8MA 3VR0A 3WICA 4RVGA 1Y8RB 1DWUA 3AWIA 3BD6A 5EMMA 1QHYA 1E2GA 2JI6A 1N33B 5AM0A 2YOGA 2RG1A 3EX7C 2OO7A 1BFUA 2GN9A 4DZZA 4IIUA 4ESHA 5EJ6A 4GUDA 1XMVA 1QZUA 1FMLA 4HDSB 5CLIA 5BYKA 4GZ3A 1L9XA 2EW8A 3C1OA 3D6NB 4WVFA 4IEEA 3NRCA 4PZEA 4ZPXA 3VR1A 2JIPA 1L3CA 2VDWB 1MKYA 3UWOA 1WBDA 1CP3A 3WGYA 5FBWB 4MUIA 3RRXA 4RACA 4BBZA 2D3TA 2VN8A 1T4BA 3IUEA 1MTZA 4JP3A 4K3VA 4N6GA 3W79A 1VYUA 3K0CA 2HXYA 4N0EA 4ZAWA 4AG3A 4ENRA 3KSBC 3UTDA 3LRPA 1WXEA 4P80A 1P4HA 1E5DA 1M72A 3T3DA 2O0HA 3JYNA 4EPRA 3M4ZA 3TRDA 3DE7X 1DBPA 4WGGA 2PVCA 2PZLA 4EL0A 2QM8A 3QBEA 1T4MA 4RNCA 1TGVA 4FOOA 1PO7A 1RAIA 3JATA 4FYXA 1OAOA 4OFZA 4Z8YA 3GEDA 3T3PB 3OCJA 3ZWAA 2GHIA 3NM5A 1ZSVA 1C3EA 2F4NA 1NT4A 3Q41A 3TF5A 1JU9A 2QMYA 3OQOA 2O3QA 3HDHA 4J1TA 5MN4A 1D9ZA 3CLSC 4ZVPA 3TIFA 1Z7BA 3H0CA 4CETA 1CF4A 1II9A 4HG2A 3UHPA 2GCGA 3S27A 3WLNA 4EM6A 5LMCA 4NCHA 4YVFA 3ODGA 4RQUA 4C30A 5KCZA 5DHRA 1TEHA 4GZLA 3DO6A 5JAIA 5A4JA 1CZOA 3O7MA 4YRGA 1PBTA 2VRWA 4MV9A 4BTLA 1FTQA 1YFLA 3MGAA 4K9LA 2RH8A 1AK1A 2I87A 2PDAA 1QORA 3AETB 5EY5B 3TZBA 3QMPA 1JLLA 4C4PA 2QU7A 1J2RA 1H5NA 3WL6A 4PZDA 1VSVA 2VJYA 3TNJA 1C0KA 2ZJOA 4JI5B 4HEJA 5EKXA 2F3SA 4LXHA 3JQPA 3OCCA 2XUJA 1X70A 3TLGB 4ZK6A 3WGHA 2YXLA 2GZRA 1B41A 3PS9A 1JXMA 4CCYB 1HZZC 5DM0A 5KVSA 3COYA 4D4LA 4EIWA 4K40A 4X1YA 1Z82A 3ASVA 1G8KA 4CNQA 2OD7A 4RZHA 1UEJA 4QT0A 2FZVA 1NW9B 4RE6A 2ECQA 3R8CA 4J49A 4D8YA 1IHYA 3R0ZA 5ERXA 1TT7A 4IQ8A 1NJSA 1GYRA 1RWKA 3OEYA 5E4TA 1P77A 3X1MA 2VCHA 3F7MA 4PRYA 3F97A 5JNSA 3JWEA 4WECA 4TZTA 5ELMA 3OJLA 2ZBRA 3U44A 1X6VA 2SBTA 4LHYA 3K9HA 1UCFA 3SJUA 1XAJA 1GAWA 5FLXA 1LDEA 5EJGA 3UK6A 1S9DA 3L0YA 1XP5A 3V4PB 1PNOA 2VDJA 3RVSA 3H2YA 4OTZA 4QBKA 1ISRA 4ZI5A 5CX1A 3L0CA 4JSTA 3B78A 1ZHFA 4XM0A 1F2TB 2GLXA 2W9XA 1D7OA 3PYMA 2XJ4A 4EBBA 2VBIA 2XF2A 5FPQA 1M0EA 1KVUA 3WYGA 1SXJA 2DC1A 5CNIA 3C6MA 4N5LA 1G8YA 1B73A 2I9PA 3QUBA 4RK1A 5F7OA 2ZIXB 3GCWA 5KJ6A 4ZIRA 4UUMA 1BVYF 4DBZA 1NZJA 4KXQA 1N77A 1K8ZB 5H68A 5AUPB 3CN9A 2B1QA 4EFDA 2AX4A 3VR4H 3PI7A 1U65A 9ABPA 4Q16A 3PQ8A 3M9WA 2Z09A 4TS9A 1QB7A 1JMKC 4FD2A 1SIBE 3GGOA 4R2XA 1Z0IA 4BFLA 2UZIR 1USGA 4U63A 3MIIA 1KTVA 3TVYA 2JVKA 1WW3A 3OCVA 1REQA 2ISCA 5HXAA 1OXTA 1A8UA 1O0SA 3V2IA 4AJ1A 1RRPA 1ZICA 2KYRA 2IDJA 1SVNA 3A6HA 3CT4A 5DEOA 4E13A 4CMGA 1C0IA 3DAYA 1ZL2A 2JLUA 3IDAA 2Q4DA 4G8DA 3K31A 2FN4A 4WZBE 1ODIA 4Q1DA 1X1RA 1YA6A 2A0XA 1Z75A 2I80A 2J3QA 4I81A 1LK7A 5CLFA 1CNMA 3OEEA 2W22A 2BFWA 4ZV4A 4ZEXA 2QTLA 5K2MA 4DCGA 5A04A 3BHMA 2NP6A 1V2GA 1S8OA 1JG2A 1YR7A 2NO0A 5D87A 8AT1A 2YMPA 4NAHA 4RVSA 2ZJ4A 2IUYA 1Z39A 1JMVA 4FHGA 3NYWA 2ZDQA 2JATA 1VYHA 4OAPA 1EX9A 1J39A 1UM9A 1J8MF 1DRWA 1LKZA 1XT6A 2GDJA 3SYLA 2AQHA 4YNBA 1G1AA 3I58A 2OHVA 1KIMA 3ADOA 1XLVA 4DR1B 2IYRA 2OXRA 1GZ6A 3RLIA 5GADl 1DKQA 2WUWE 3CV3A 3DYIA 4OP3A 2EYUA 1J0AA 2Z6VA 3PV0A 4GWLA 3NKVA 4NBNA 1N1MA 5HHTA 3PEWA 2AHRA 2P5SA 3B12A 3EODA 1YZVA 2FW9A 2G28A 3HBLA 3WJAA 4UNPA 1DE0A 2W48A 4DLAA 1D8AA 2P41A 5ALIA 3BILA 1M6HA 4CV1A 4X1OA 2FAXA 3H16A 4D5EA 4HUQA 4PHCA 3D6HA 4KITB 5FBLB 1FK8A 1TPZA 3G8AA 3SFTA 4D79A 2PUFA 2KE5A 4LECA 4CIBA 2QLJA 2P2NA 2YJZA 4FHCA 1IWBB 4RJKA 2OQIA 2H5JA 3O6VA 1JBQA 2H29A 3FOAA 3K7EA 3L7IA 2X5XA 4I9GA 3QEAZ 3FUVA 2CLFB 3SDBA 1L1RA 4KQFA 1PJAA 1Z8HA 1KI7A 3GJXC 1EFRA 3H42B 3VXKA 1SU4A 2BFCB 2TMGA 3IURA 3WQSB 4E11A 4C14A 1OBOA 2FEAA 1JHUA 2HZ7A 2PGXA 2FE4A 2REQB 4KMOA 3G68A 1Z15A 2WSSD 4KXYA 1J70A 2PJUA 1C81A 2CCKA 2B6HA 3C1TA 2EFJA 3GJ5A 4YV7A 1VPLA 1Y42X 4BZXA 4QG3A 1YJBA 1X3LA 3EWSA 1BA3A 1KZHA 1XXHA 2IBTA 2MINA 3I2JA 3WBFA 5EP4A 1DEOA 2BI8A 4PX2A 4YJHB 1QAQA 2G80A 3HJUA 1B23P 2XIQA 4L16A 2BF4A 2Q5QA 2VJMA 3Q0TA 4W5WA 3HG7A 1VGRA 2QMZA 3TNFA 1W88A 1V5FA 2QD2A 1ZMTA 3QYFA 4G86A 4YCMA 3E2IA 1RT9A 2ZDGA 1CWUA 2BZGA 5IASA 3ABOB 1W0KA 3FHCB 1UMBA 4EPTA 2P91A 5FIUA 1GCIA 5GM2A 5CUQA 5F7ZA 5EFOA 5L51A 3ETHA 1L7BA 4O5AA 1D2AA 2JFPA 1XZFA 4HRVA 4BC0A 5TPWB 5TQVA 1ISMA 2SECE 4REQB 2B9EA 1IEWA 1UANA 3R24A 1QWOA 2YY7A 4JA0A 3BC1A 4I2VA 3HRKA 4WKGA 3LNCA 3TPFA 1D3AA 3BHIA 3OM9A 3Q0EA 3ONWA 2L69A 3MJDA 1ODLA 3F2IA 4JY7A 3T0GA 5LQRA 2R60A 3IMFA 1N1EA 4G2NA 1JHXA 2UZ4A 4Y1EA 1H66A 3H05A 3C24A 1M1UA 1I5OA 3K2IA 1VIAA 4BX8A 3KBOA 4C7XA 4M9RA 5LQCA 1Z28A 4JYAB 5E7JA 2MSLA 2CXRA 1A8IA 1UJNA 3U9TA 4TQUS 4C9BA 5JPCA 5B3JC 2AN4A 1NHWA 2DTDA 2Z9DA 3ABRB 3R3UA 4FEYA 3DXYA 3CTPA 2GPTA 4N9QA 4R84A 1SUBA 521PA 4B81A 1DIOB 1RC8A 4M22A 4BGDA 2AIRA 4MW4A 1DFHA 4LBZA 2LUOA 3CN7A 3SC2A 5IAAA 2PSEA 3QUSA 3ET4A 5BUQA 1SUPA 1I5RA 4HAZA 4DG8A 3RVKA 1P4AA 1KC1A 4NPCA 3VC2A 3SPXA 3P2IA 1M2KA 1NJ6A 4BNVA 1Z73A 4ED9A 3DMYA 1HDYA 1KK3A 4E21A 1IOZA 3A70A 2LKDA 2DP4E 4IGKA 3D7LA 3SQDA 4UBJA 4B43A 4C4SA 5AUOB 5JO9A 3TCNA 3LG2A 1FCJA 1VJRA 3AV0B 4YMWA 1CUEA 4A6EA 4YJ3A 4BU0A 3VJKA 3C4VA 3NHFA 1RQ2A 1ZH8A 1Z4JA 3LDHA 3F67A 5BWOA 2FQWA 2XLBA 3EC1A 2F7SA 1SCDA 3MJ4A 4UW9A 3KOYA 4CN9A 4IF6A 2AN5A 2XE8A 5EZYF 4FLFA 3MJCA 5I9TA 2C8LA 1CR0A 1QKIA 2PSHA 1EGAA 2VYNA 5K0NA 1P33A 1LZLA 4BCDA 1WQ3A 1XMOB 3PDIB 1O6ZA 2ZR7A 3ZHYA 1JHYA 1H2BA 4J2OA 3IDQA 1M1ZA 1KNXA 3A6KA 4UHDA 1UPFA 1JEQA 1DC3A 1XZBA 1Q0LA 3FHLA 2R0QC 1EJ0A 3IOCA 2PZ8A 5HDBB 3K6SA 3T5MA 4CKBB 3K3PA 3CCCA 4NIMA 5H59A 1OXMA 4P7BA 2NTNA 5F1PA 4Y6LA 1CV2A 1YQGA 1DWOA 4PYJA 3E8SA 2ZITA 3C3YA 3ANLA 3VUFA 1FRFS 4E08A 3HCBA 3OKFA 4DNPA 5DM70 4HKTA 4RH0A 5ER9A 1PG2A 3GPCA 3OT4A 3OY2A 5L3VA 3TJRA 1J9EA 4P08A 4ZWNA 4NNOA 2IS2A 5D3MA 3F6CA 1XJCA 1GVHA 1KERA 1FVXA 5FFMA 2XBMA 1PL7A 1N6IA 4AN1A 1KVSA 4V0RA 4IOJA 2QY6A 4U4AA 3SHFA 5M34A 2VQEB 4BGUA 4JJFA 3DM5A 1TCUA 3JZFA 4NDZA 1R50A 2IX9A 5D5PA 2AD5A 4G24A 3E7DA 3NDJA 2IZ6A 4WN9B 1P3DA 4LNUB 3NB0A 5K8JB 2CF5A 1Z12A 3VTAA 1CQPA 4MLPA 4AZ0A 1H2EA 1L5MA 3I32A 4AJ4A 2CLOB 1YIOA 1Y1RA 2RB5A 3DMPA 2OCDA 3GQBA 3KB2A 5EMJA 3AFGA 3BWDD 3GUZA 3KO8A 1AGXA 3QEMA 1FA9A 1QE0A 3M6IA 5HE8A 2AMFA 3CEAA 3P9NA 3UWPA 1QSGA 1VE3A 4C0BA 5I7AA 2CLSA 1X94A 2F43B 2XE6A 3OTIA 4JQZA 3EG9A 2JLXA 1J9ZA 3OM1A 1U3VA 2DRIA 4OSEA 2PUEA 2UXDB 3KETA 1H42A 5AIAA 4JN6B 4HDQB 3GLFA 1NIPA 1OAKA 1SPXA 3AC0A 3KWFA 1QIEA 1SAYA 4UUBA 4Y9DA 4HZUB 3T3MB 4CLDA 3ZOKA 1B14A 4I08A 1XVLA 1OZGA 2QDKA 4RFSA 2LWIA 2D3WA 4CI9A 4JK3A 5JC1A 4RWZA 3DKRA 1RJWA 1XEXA 2FHSA 2V9ZA 3CUWA 3L9WA 3MJHA 5A3QA 2W6JD 3EGDB 3OJ0A 3IDFA 2QI9F 5KREA 2HBYA 5I48A 1RQ7A 2YZNA 3U2QA 4BNNA 4MWSA 3H5IA 1N5LA 9LDBA 4P3PA 1YDGA 4UQOA 5IAKA 3MSCA 2WWVD 2OFFA 2I2XB 1KMQA 1IWOA 3LQYA 4BFSA 1GKKA 1JLMA 4DQVA 3TGPA 1WCIB 3C5CA 4MUFA 2EU8A 1YO6A 4HDNB 5B3JA 4EHBA 4CMHA 2R4UA 4M6WA 3GUYA 3TZHA 1KMHA 1I4OA 5DW0A 4CU5A 4QD3A 2J6CA 1R0ZA 1JE1A 1W5TA 2OCAA 3L8CA 4FFSA 3WLKX 5DCWA 1HOTA 1ZONA 3W3ZB 1NKTA 4I3FA 1T5IA 4NYMR 3D02A 4GOND 1R0XA 3CM0A 3UHFA 4XTRA 4QHTA 4MMYB 4PCUA 4OSOA 1JE0A 3KZKA 3L9XA 5SZHB 2NTYC 1HZJA 1AQ6A 1J49A 2IHJA 4QJ3A 3R7NA 5ITZA 4UCQA 4GWGA 2NV2B 2PNFA 3ZDFA 4KPEC 1ENZA 4WZAA 5I7FA 1QIDA 2X6RA 5KAMA 1E92A 3GFGA 5JXGA 5IPFA 4LYJA 2H2IA 4O4LA 1G8GA 2XVMA 5IT5A 1CF2O 3KLMX 2IU3A 3A04A 5TQ0A 1OF1A 3H83A 4MUYA 4MYRA 3TUZC 4PPNA 3F3KA 1AKEA 4KHPB 2VUTA 1FFDA 4KGZA 4E5VA 3ZVRA 3IT2A 5I4KA 1Y33E 3RTEA 2JGLA 3OMWA 4JL6A 3SLKA 2DT8A 5BORA 2GZSA 3AHIA 4ATNA 5DWDA 3C7DB 4JX8A 4DQKA 3TECE 2FZGA 2PIAA 1KQNA 2P67A 2BZ1A 3SS7X 3RRZA 3ZWKA 4GR5A 2WHPB 5JS1A 1WF6A 4RIEA 2A84A 1DTSA 2WTNA 4GD3Q 3GEGA 2DMRA 1KJJA 2WYWA 3QGMA 2P9JA 4PTYA 5H83A 1X77A 3EQ9A 2QVCA 2Z6UA 2PPLA 3T3OA 3TG2A 3RSLA 3ZVMA 1PHPA 5I9NA 3MHPA 2W2TA 1X1TA 2YNMD 3SLRA 4EJMA 4EFMA 4F9TA 4YRAA 2JLWA 4X84A 4URYR 2FW7A 2ZUBA 3MEQA 4IHAA 3ZKWB 3CNOA 1S2DA 2FRVA 3PC3A 3TRHA 2C9MA 1QGZA 5CEFA 1OFUA 2BYTA 1J1IA 1GL6A 1R9GA 2F4VB 3ORFA 5ALEA 4KI0A 5ED0A 4DEXA 2RGNC 4WT7A 2IYYA 4D6PA 4GX5A 4EHNA 2QNIA 4LJ4A 2CLCX 3QXXA 1WTAA 3I6BA 1GG9A 3ZH9B 1V5IA 4KQXA 5E3JA 4R0NA 3DGEC 3F4LA 4AMUA 1KVTA 3OZIA 4KQWA 5CNMA 2M1ZA 3H1TA 3RASA 3UOWA 2QPAA 1EVYA 1GKIA 2HNBA 2C94A 3JYLA 2CYAA 1M2OA 3TW6A 4UVEA 4JCCA 5DI3A 1TQ6A 4HOYA 4MUAA 5DBEX 3ZV7A 1UAAA 3SSMA 1Q0TA 3LUBA 2AKYA 3OCZA 3JR7A 1C5KA 5C3UA 1E9AA 4ZPJA 3U37A 4KW7A 1QMPA 1RHJA 2Z2KA 5FB3A 1D4FA 2HHCA 2I66A 1VE1A 4FTWA 1VLJA 4WY8A 3ME5A 1MX5A 4DXDA 3U7QB 1G4HA 4CBVA 1TTQB 1A82A 5EE9A 1AV7A 3IBCA 1JHQA 3BXZA 4N18A 5E8RA 1RP7A 2G1AA 3MUFA 1XZGA 2G9ZA 4GYJA 1H4SA 3WJ7A 1RZUA 5AM4A 4YMUA 1UQTA 5EKTA 2JKVA 3R6GA 4KR3A 2CFOA 2YBEA 1RIFA 2BEVB 3SZMA 3FCXA 3SDSA 4DPKA 1MB0A 2CHVA 4FFWA 4YA6A 1TZKA 4KXNA 5FXMA 3CO0S 2VWGA 1CY1A 3I04A 4O25A 1P2SA 3IMEA 1TVKA 3KWLA 2BGWA 4CV0A 4DRXA 2AOUB 3UAGA 1Z34A 3HNRA 3C3BA 2OCYC 4ZZIA 5EESA 3M8KA 3SJBA 1TLTA 2X22A 2QYTA 3PGA1 3O2QB 3VO1A 1C7FA 3ZTWA 2JFFA 4I9UA 4AVYA 4OY3A 2GCOA 3EZYA 1JR3D 5J40A 3VC1A 2XCSB 4LTMA 2QF7A 3AKZA 5FOSA 5IANA 3FIUA 3EGWA 1CXZA 5E9AA 3FCUB 5JISA 2C95A 4S3MA 4WCVA 4CFSA 3OFND 1ICEA 2GSWA 3M6WA 4M9XA 1NJ1A 1SJ9A 4RM2A 3W5VA 2H5EA 1B6SA 1VI2A 3W6PA 3E3AA 1PR4A 3ZE7A 4LVUA 4EGAA 1CZLA 4DDWA 1MA3A 3NXSA 4WY5A 2D62A 5JG7A 4YCBA 2AFIA 2BEWA 5JPIA 2WE7A 1XTKA 2DFLA 1U8AA 1L6RA 1OA0A 3QHAA 4GQIA 3JARA 4CTNA 5C5DA 3OFSA 5L3SB 2B5OA 1XD2A 3V4ZA 3ILSA 3BXPA 3KJEA 2O06A 3TOXA 2X14A 3FTCA 2W2VA 1QTRA 1ZQ1A 2GASA 3WBKA 5FUWA 1CIJA 1N2OA 4QOEA 4YP0A 3F3YA 2V58A 1QF7A 1GIAA 4UBKA 3WS7A 2OUKA 4CHTA 4V0OA 4YP7A 3P52A 1GAJA 4ZYVA 1S2GA 3SZUA 2R25B 3FOCA 3HB1A 1I4TD 1NBMA 1LW6E 2FRXA 1E98A 2P27A 4O6VA 3KP1A 4JOSA 1WW8A 3SZRA 2C7PA 4QGSA 3EAQA 3D8UA 3ZUGA 2AVNA 4Y2QA 5G0TA 4E1VA 4B2YA 4PFKA 1IN7A 3SC3A 3OE5A 1VKHA 4RHYA 4GXTA 1HXHA 1LNQA 3UUWA 3V2UA 3W4IA 3W5CA 1LPSA 5BR7A 1G8S