2IX9A

Respective role of protein folding and glycosylation in the thermal stability of recombinant feruloyl esterase a
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
260
structure length
260
Chain Sequence
ASTQGISEDLYNRLVEMATISQAAYADLCNIPSTIIKGEKIYNAQTDINGWILRDDTSKEIITVFRGTGSDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISVQDQVESLVKQQASQYPDYALTVTGHSLGASMAALTAAQLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPAEQGYAHGGVEYWSVDPYSAQNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTSGACTW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Respective Importance of Protein Folding and Glycosylation in the Thermal Stability of Recombinant Feruloyl Esterase A.
pubmed doi rcsb
molecule keywords FERULOYL ESTERASE A
molecule tags Hydrolase
source organism Aspergillus niger
total genus 97
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 3.1.1.73: Feruloyl esterase.
pdb deposition date 2006-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ix9A00
3WKCA 4W9RA 4GI1A 4TPKA 3NWOA 1UKCA 5AKYA 3WJ2A 4BAZA 1E8MA 2O2HA 1CV2A 3I2HA 4AQDA 1GPLA 2NW6A 2GZRA 4NVRA 5JATA 4YK7A 4BE9A 4BAUA 3O4HA 1L7RA 2OCLA 2HL6A 1W75A 2C4HA 5E4YA 1BEZA 3D7RA 3F8SA 5ALWA 2I03A 3OM8A 1IZ7A 1G66A 4LKOA 1XRLA 1LNSA 4UUQA 1QIHA 4AO6A 2HHAA 3WYDA 1DT3A 1FFEA 5LYYA 1YCDA 3OURA 2OCGA 2BGRA 1LPMA 1H2WA 5IVIA 4Y2SA 1N8SA 2HA2A 2ONCA 1ZD5A 5AK4A 3OTQA 5C81A 3M81A 2CBGA 5AK6A 2XI4A 3F67A 2ACEA 1ORVA 3FAKA 4ROTA 2D0DA 2B9VA 2WKWA 1E8DA 3ZWQA 1XZIA 3C5VA 3H19A 1PV1A 4FBLA 3H1BA 1QLWA 2X8BA 4MQLA 3I6ZA 1BROA 2QUBA 3I1IA 3V1NA 5JZ9A 2XLCA 5ALDA 3WKAA 1WB6A 1Y7HA 3K9BA 1KU0A 5ALFA 1EK1A 2WG1A 3QITA 2RGUA 3OC0A 4BC0A 4CCWA 1OXMA 3O4GA 1MNAA 2GYUA 1UKAA 4IH4A 3FCXA 2WHPA 3PF9A 3WA7A 1GPKA 1ZD2P 4H7KA 2Y2UA 1C7JA 3ICVA 2PSJA 2I3ZA 3PF8A 3STXA 1SC9A 2QRUA 3AFIA 2BUAA 2HRQA 2WSLA 5ALSA 4BVKA 2LIPA 1CUVA 3FVRA 1EK2A 3KOOA 1QIKA 2AJBA 3D3NA 1G4HA 1NX9A 3BIWA 2VAXA 2XUHA 5E4TA 5ALHA 2XMSA 1XZKA 3HXKA 2WIGA 1P0MA 3VVLA 1UOQA 1CPYA 4DMFA 5C8VA 4OU4A 2R11A 4EB0A 4JYPA 2XQGA 3GUUA 1CUEA 3R3VA 3T4UA 2RHWA 2OAGA 3WMRA 1EDBA 2QOEA 4KAAA 1XLWA 4AZ0A 4B0OA 3K6KA 4DNFA 1MX9A 3ZI7A 1H2XA 5JAUA 3H18A 4K6KA 4OB7A 1YASA 1DU4A 4HTAA 4AN1A 3U0VA 1QIMA 2UZ0A 1AGYA 1XZCA 4ZGBA 1X2BA 2QS9A 4WCVA 2C0QA 3C8HA 3M82A 5EI5A 1OILA 3R0VA 4ZWNA 2WHQA 4G8CA 2WILA 4RGYA 1USWA 3L1HA 4TGLA 1CUBA 4BDSA 2QJRA 5I7UA 4KR0A 3BF7A 1U4NA 5JIBA 3PFCA 4Q1VA 3O95A 3D4LA 2WFMA 2JGJA 4X93A 5CRIA 5AIAA 3W06A 3MUOA 4GXNA 5ALPA 2PU5A 3EIOA 1ZGCA 3FYUA 1WOMA 1VZ3A 2VATA 5K3DA 7YASA 4ZXFA 4LHEA 3E0XA 4F21A 5J3JA 3IB3A 1ZI9A 2OPHA 3M83A 1EB9A 3W2TA 3AINA 4BZZA 3RM3A 1K8QA 3VKFA 3WIOA 4DYHA 3DNMA 5FPQA 3R3YA 2HM7A 1O6FA 2X76A 3JW8A 3G9TA 3WI7A 4EUSA 2GBGA 4W1RA 4QWMA 4Q3OA 3LIIA 4HAIA 4BRSA 5JYCA 1JU4A 3IUMA 4FNMA 4AX4A 1XZAA 1RP1A 1VJ5A 4B9EA 2JGMA 4NS4A 3H2HA 3DDUA 3C43A 2WUGA 3ZPXA 3W9UA 5DTIA 4BVLA 1XRNA 1ZD3A 4H7DA 3DOHA 4OUKX 5CXXA 4QA9A 2AJ8A 4C4XA 2YXPX 4G4GA 4BTVA 4CG3A 5AKIA 2XUGA 3ZLVA 2XMQA 1XQWA 3WL6A 3R3XA 1QIGA 3X3HA 2WFLB 3T52A 3ANTA 4Q3LA 1IZ8A 4C4YA 1BU8A 1GT6A 4TVKA 1LBSA 1SOMA 3W05A 3C8DA 5FKJA 4J0IA 5JZSA 3M3DA 2XMBA 1QONA 4BC1A 1SCIA 1AKNA 5EHNA 1VA4A 2DHEA 2AJLI 3DYIA 4Y2JA 4FTWA 2I3DA 4UBOA 4GBGA 3N0TA 4G9GA 1UWCA 5ISMA 4PSDA 2VJBA 5FLKA 5H3HA 1CR6A 4MEBA 4KE8A 1Q84A 1JT2A 5LZ9A 5AKZA 4ETWA 3KWFA 4J0CA 1E66A 5CT6A 3WIBA 4Y7DA 4GLBA 1HKHA 1CUCA 1XKTA 5T4HA 4H0CA 5A7HA 4XX1A 2OGTA 3EF3A 4UBMA 4FFVA 4RNCA 5HFAA 1C4XA 2RIPA 3BDIA 4DNQA 2P8SA 5DYWA 3GA7A 4IO0A 3RK4A 3AZQA 2IX9A 5AKEA 4Q3KA 3BE8A 1N5MA 2FJPA 1A7UA 1ZOIA 5CH8A 1IMJA 4JNCA 4H18A 2WG0A 1P0QA 2RONA 2J4CA 3WWDA 5AO9A 1EINA 5HQ3B 1E3QA 2ZSHA 4FKBA 2O2GA 1HL7A 1JU3A 3STTA 2ZYSA 4JUIA 5CXUA 2ZYRA 1JJBA 1VZ2A 3HSSA 5HKBA 4GECA 1LZLA 2RAUA 3SX4A 1CUWA 2QXTA 3DD5A 2YYSA 5CW2A 4I3FA 1LPAB 1HQDA 2RHTA 1AZWA 1J07A 4W1PA 1XRRA 3H2KA 2H7YA 4NMWA 1WHSA 5C7YA 1JMYA 1DWQA 4WY8A 1P0IA 2VJDA 1R1DA 1EVEA 2WJ4A 2Y6UA 5ALTA 4J03A 1ORWA 1CEXA 5CT4A 5JZBA 3CXUA 4I4CA 5DNVA 1ZGBA 1ZI8A 2PUJA 3D2BA 1Y7IA 3DCNA 5ALRA 2JGEA 3ESCA 4UHCA 3I28A 2ZSIA 1R50A 4BP8A 4X85A 5IH7A 4M0MA 1AC5A 5IVKA 1WPRA 3H2JA 2K2QB 4H7FA 1YB6A 4YASA 1ODCA 3ESDA 3WWOA 5FXMA 3QYJA 1R9MA 4AB1A 1UXOA 3A2LA 4Y2XA 1XZEA 1EB8A 5A7FA 1JKMA 4IH9A 3ICWA 1XKLA 4OU5A 3VVMA 4X71A 3CN7A 4U2BA 3STUA 5LIPA 1L7QA 4B85A 3CCBA 4DMHA 1QFSA 2AXEA 3F97A 5LZ4A 3KDAA 4RPCA 1SCKA 4INZA 1GXSA 4BATA 2WU3A 4BVJA 5ALYA 4PQEA 5ALOA 1Y37A 5HZGA 1QJ4A 4MYDA 5FV4A 4P08A 1IUNA 4O08A 3V1LA 3H17A 1Q0ZA 2ZYIA 4F60A 3VJMA 3AIMA 4X95A 2XQIA 1NU6A 3BWXA 1HLGA 2QZPA 4XIIA 5ESRA 4Q82A 1YAJA 4K6GA 3HACA 5DJ5A 3EQ8A 1BEEA 2GYWA 4UBJA 1IUOA 3QVMA 1MX5A 4FLFA 5KWIA 4UBLA 3C6ZA 3SK0A 3L1IA 3BJRA 2GZSA 4P92A 5ALKA 1LLFA 5HF8A 3V1KA 1MTZA 4QDTA 1DQYA 1E8NA 1L7AA 1YS1X 2WFLA 2XUAA 1YR2A 5C8XA 1MNQA 4EY8A 1YA4A 5IVDA 3MVEA 4FHZA 1EI9A 2VJCA 1ZIXA 4LXIA 5AK3A 1CQWA 4HRYA 4GDMA 2XB6A 4EZIA 4KYVA 5FOQA 4BYMA 2ZJ6A 3TJMA 5JAHA 1PJAA 5ALQA 3BDVA 3HI4A 3CCCA 3G7NA 4DM7A 1LPOA 2G63A 1J1IA 4K6HA 4HRXA 3FNBA 5C8ZA 1QIIA 4QWWA 4QEKA 1QIJA 3G02A 4CCYB 3I2IA 5K3AA 1XZJA 2XUPA 2B20A 2AJDA 1DINA 5D3KA 5EIAA 2PM8A 3FYUC 5AI9A 2VT6A 2QMQA 5AICA 4DIUA 2B4KA 1GQRA 1J06A 3VDXA 1X2EA 4UFPA 3QMMA 5JD6A 4AZ3A 4CIBA 4WFIA 2GYVA 1SCQA 2WUEA 1GKLA 2ZJ7A 2PU7A 4G1FA 5HK8A 1CUFA 4X7BA 2PVSA 2XUKA 5A62A 1A8QA 1CUJA 3ZV7A 2WJ3A 2XMRA 1Z68A 5IKXA 2YH2A 1ZIYA 2HU7A 5AKJA 4BCBA 5D3ZA 5HQ3A 5CURA 1WPXA 3G0BA 3IURA 5T4EA 4C88A 5AKGA 4WY5A 3PI6A 5CH5A 4CG2A 4WDRA 4CFSA 5BOVA 1J2EA 2QKYA 1XZMA 4N8EA 3G9ZA 2FUKA 3F9CA 1UK6A 4LIPD 4KE9A 2Y1KA 4QNNA 2HU8A 3H1AA 4H35A 3BL8A 4JYMA 1XLUA 4OSEA 3V1MA 4X3CA 2CZQA 4BZWA 1TCAA 2HFKA 3O4JA 2J3DA 5JAPA 2V96A 4B0PA 2JEYA 4PNZA 4E14A 2VQ6A 1I6WA 4DSAA 3ZLUA 2PSHA 1F0PA 1UOPA 2H7CA 3IIIA 5HF9A 1BN6A 5AI8A 3IVMA 5CH3A 3G9UA 2BGNA 2HDWA 2DHDA 1QE3A 2EDCA 3WZLA 3FSGA 5EHXA 2H7XA 3HYSA 1AURA 3WK4A 1EHYA 1H2ZA 4ARAA 4KACA 1EXWA 3I6YA 5A2GA 1XQXA 1S8OA 1EX9A 4QDOA 3GELA 1FFDA 4G8BA 4LXGA 4HZGA 3PICA 3QZUA 2OXEA 4HXGA 1YB7A 3AUKA 1W76A 2PX6A 5ALNA 3EQ9A 4K5QA 3FLAA 1CUXA 4EY5A 4CIAA 4W63A 1Q0RA 5SYNA 4U2CA 1XZGA 3AZOA 1UOOA 4CI9A 2OAEA 5DNUA 1F0NA 5KWJA 2XDWA 5JALA 1BCRA 3A2NA 1CRLA 4BCCA 3B5EA 3I2FA 3Q8WA 4Y2YA 2V97A 5AOAA 4K2AA 4LYDA 2Q0XA 4OB8A 5AIBA 1TRHA 2HU5A 3DQZA 4X00A 4X6YA 1ZJ5A 5LZ7A 4UBKA 3FVTA 5CMLA 3B12A 3CN9A 4EA6A 2QVBA 4AMZA 4UBNA 3EQ7A 1VXRA 5AM3A 2WUFA 2Y6VA 3UMJA 2JBWA 1K5PA 1UT6A 1KEZA 1E89A 5IVHA 1CLEA 5FP0A 2QM0A 1GZ7A 1W52X 4DGQA 1HBJA 4BDTA 4DNOA 1CVLA 4UHDA 3SWWA 3IUQA 3LP5A 4UHEA 3H2IA 3PUIA 1BRTA 1GKKA 3IBTA 1CUHA 3L1JA 2WHRA 3HZOA 4KE7A 2XUFA 4FOLA 4E46A 1XZBA 4J7AA 4W1SA 1UZAA 1ZD4A 3RARA 3PFBA 2OGZA 1XQVA 5ALMA 4EY7A 3G0GA 2WUDA 1CUSA 2BCEA 5K3BA 3V48A 1CUIA 1XZLA 1UK7A 4MWTA 4G9EA 1JJFA 2HA7A 4OD0A 3WWPA 4AO8A 4FWBA 2DSNA 4J0GA 5ALEA 4Y2QA 4M0FA 3OG9A 5CT9A 2HA4A 4CCYA 3K2IA 5A71A 5ALXA 3W9BA 4BRZA 3GFFA 5AK5A 3A2MA 4BTLA 5A7GA 2C5FA 2OG1A 3TRDA 5LZ8A 1EDEA 2O7RA 2WHPB 4GWLA 4H7EA 5JANA 4ZRDA 3YASA 2XUJA 4FDMA 3O9MA 5AOCA 2JGFA 4KAFA 1AUOA 2VAVA 1ZJ4A 1JFRA 3GZJA 4KAJA 4UBIA 2D5LA 3QMWA 4B83A 2OCIA 4IQ4A 5JD4A 3HJUA 1ISPA 3GROA 4IHAA 3FBWA 4ZV7A 5F4ZA 1R4ZA 1F8UA 5LZ5A 1MPXA 4C87A 2WIFA 4HS9A 5LP1A 4GW3A 4YX9A 3C6XA 3DYVA 4N8DA 1T4MA 4B7ZA 5DLPA 4IH1A 1LPBB 3RKSA 2DQZA 1CFJA 5AKXA 4EY4A 2XQKA 1BE0A 3FYTA 1XZFA 3WK8A 1W6RA 4F0JA 1WB4A 3O9VA 4FBMA 1IUPA 2HRRA 4M0EA 3BIXA 2H9YA 2Z3WA 3E4DA 2XUIA 5ALIA 3I1YA 1DWOA 4ZREA 3FYUB 3KD2A 1QIEA 4H77A 3WK9A 4BAGA 4BE4A 4WDQA 1H22A 2FX5A 4D9JA 3G8YA 1VA5A 3AIOA 4MXDA 2QTBA 4X6UA 4N5HX 5EHQA 2HIHA 3DKRA 2G4LA 1X70A 3WL5A 2X5XA 2J4FA 4X92A 2VF2A 1CUDA 1G5FA 1W1IA 4DTCA 1EVQA 5AM2A 3SC2A 5ALGA 3U1TA 1R88A 1O6GA 5FUMA 5LKAA 1THTA 4E11A 2QR5A 4FLEA 4FLMA 1QIDA 1XRPA 4Z49A 2AJCA 5K3CA 3NOXA 4Y2PA 4Y2RA 4A23A 1JI3A 2QUAA 1BCSA 4I19A 3B3QA 2EEPA 3WK7A 1DQZA 2WIJA 3LIPA 1F6WA 4PV7A 3WLAA 1XLVA 2OQVA 2XT0A 1VXOA 3WK5A 4Y2VA 4H7HA 2HADA 1A8UA 1YA8A 1WHTA 4QDXA 1DWPA 2GBCA 1DT5A 4J0DA 2I78A 4C4ZA 2DCMA 5I9IA 4MYSA 3BJMA 5BV7A 2WJ6A 4XVCA 5AM1A 3C45A 1UK8A 4PSCA 1T2NA 1FFBA 4UFOA 1A88A 3NUZA 4B81A 4B6GA 4B80A 3OOSA 4B84A 1BN7A 4PF1A 5KREA 3MGAA 2FJ0A 3V9AA 4L9AA 4EY6A 4H7JA 2OLEA 1LZKA 4J0JA 1QFMA 2XMGA 5T4FA 5D6OA 1EA5A 4RE6A 4H7IA 3C5WP 4QDZA 1C7IA 1FFAA 2CEKA 2WU4A 5AM5A 4WFKA 2VT7A 1M33A 1IVYA 4L3WA 2BFNA 2BAGA 2Z8XA 3ILSA 2WTNA 2XMDA 2JGIA 3IULA 3H2GA 1CUZA 5FPPA 3E1GA 1VE7A 2PKYX 5BWBA 1ODTC 2XMCA 5EGNA 4B82A 1THGA 2G5PA 1WM1A 3JYHA 3DL4A 4BB0A 5A6VA 1QO7A 2PL5A 1DTEA 5AKKA 1LPPA 3UUFA 2ECFA 1JJIA 2PUHA 4NZZA 2XQJA 1AX9A 1Q83A 5AI4A 4PO3X 2GBIA 3VJKA 1TK3A 5EHZA 2O7VA 4G8DA 4FMPA 1W4LA 5DNWA 3I2GA 5DWDA 3TGLA 4G4IA 1TCBA 3A6ZA 2E3JA 5K3EA 3R40A 4BP9A 1TKRA 1DX6A 1K6EA 4KE6A 1H2YA 2WM2A 4U2EA 2WG2A 4DLNA 2JGKA 4ARBA 4N5IX 2BUCA 2V98A 3R41A 3OPMA 3BXPA 3AZPA 2IITA 2VJAA 1LPNA 3DJYA 1EDDA 3H0CA 4P93A 5ALVA 1JMKC 2VEOA 5FRDA 1MJ5A 3E3AA 1XRMA 1VOTA 3FOBA 4X91A 5DYTA 2XLBA 2QXUA 4OCZA 5AHXA 5AKHA 3RLIA 4EBBA 5HF6A 3WWCA 1FJ2A 1HDEA 3ED1A 3AJAA 4FFWA 3HLKA 5JD5A 5CT5A 3DS8A 1BS9A 1MT3A 1XFDA 4WJLA 1QGED 3WL8A 4PSUA 5BWCA 1CUYA 4Q05A 1AQLA 1QTIA 2PSFA 1QIFA 2HA3A 1A8SA 1HPLA 3NGMA 1UKBA 5K3FB 4G4JA 1G42A 2B61A 2HFJA 2XUOA 3TEJA 4F5ZA 1B41A 3VISA 3R3WA 4OPMA 5AM4A 4AMYA 4X97A 3ESAA 3LLCA 5E4JA 4DMCA 4ZV9A 4Q34A 1CUUA 2C0PA 3S2ZA 3QBJA 3WKBA 4OYYA 1MX1A 3I2KA 5LKRA 4AO7A 4LYEA 3ANSA 3FLEA 4PW0A 4Y9SA 2JF0A 1U65A 4KRXA 4Y2TA 4Y2UA 4DMKA 4C89A 2ROQA 3VJLA 5JARA 1CUAA 1XQYA 3QMVA 1N5RA 2DHCA 5HKAA 2XUQA 4UHBA 3STWA 1H23A 3DOIA 1ACLA 3UUEA 4A5SA 1XZDA 1WB5A 3I2JA 1MU0A 2W6CX 4XWGA 3STVA 4YPVA 4KJXA 2Z3ZA 3W04A 4FNGA 5JAOA 5CBKA 1QOZA 2ORYA 2C7BA 1B6GA 2Z5GA 2XE4A 3F98A 2J3QA 3LS2A 4MQMA 1TCCA 1K4YA 5AKLA 3C6YA 3DEAA 3WJ1A 1LGYA 1DX4A 1N1MA 2YASA 3C70A 1EH5A 3IDAA 2XQFA 3VXKA 1MAHA 1MN6A 1CIJA 3R3ZA 1FSSA 5KBYA 2QJWA 3HC7A 3FSGD 2EDAA 3ZLTA 1GPNA 3GBSA 4MJ3A 3PDCA 2V9ZA 1GQSA 2IIVA 1XROA 1QTRA 5HK9A 1R9NA 4HVTA 2VSQA 3IA2A 4ZI5A 4BBZA 3DKKA 5DTJA 1PFQA 3AILA 1RYYA 4DSZA 4B9AA 1MAAA 4C6HA 1NU8A 3MUNA 1OCEA 2PPLA 4EHBA 2WFZA 3WZMA 5SYMA 1TQHA 3G0CA 4UHFA 4GHWA 5AP9A 1KU6A 2QT9A 4JH0A 4QE3A 1GGVA 2OCKA 5JADA 5EIEA 5ALZA 3DLTA 3O0DA 2HA0A 5EFZA 1R3DA 4L0CA 5E2IA 2BUBA 3FCYA 2C58A 4U2DA 2ZVDA 4QDUA 1ETHA 2C5GA 3G0IA 1U8EA 2O2IA 5EIHA 2JEZA 3HABA 3EBLA 3QPDA 4XJVA 5LZ2A 4QZVA 3D5EA 4C01A 2R8BA 2VTVA 3QPCA 4LXHA 3O4IA 2BKLA 2WIKA 3C87A 3D2AA 4G5XA 3HRHA 2HA6A 2WQZA 1RWQA 1K63A 5K5EA 2BJHA 2DR0A 2H1IA 3I6MA 3G9XA 5HCUA 3D2CA 4OB6A 1ACJA 1LBTA 3BF8A 2CJPA 5FDFA 4HXFB 2DFPA 2XMZA 3IUNA 2GBFA 3WKEA 1AMNA 3P2MA 4P9NA 4V2IA 4L72A 4OYLA 4X90A 4UPDA 1XZHA 2ACKA 3D0KA 2CB9A 4UFNA 4QLOA 1WCYA 3QH4A 3WQHA 5CTAA 2Z8ZA 4AXBA 1ZICA 3R3UA 2HA5A 5HFNA 1XRQA 5AM0A 1SFRA 4KRYA 3DL7A 2JIDA 3KSRA 5D7BA 4WFJA 2CKMA 2WLSA 5YASA 2ES4A 3Q0TA 1QZ3A 3KXPA 1YS2X 5I8PA 5AOBA 4J0HA 2WIDA 1TIBA 2PSEA 3N2ZB 1VE6A 4UHHA 3AIKA 2PBLA 4X6XA 5DYYA 1UK9A 4U2FA 4J3JA 3KWJA 3IUJA 4KEAA 1E5TA 3QPAA 5ALUA 2JGLA 2DQYA 1VKHA 4RE5A 5AH0A 2W22A 2VA9A 3WL7A 3QM1A 1CUGA 2XUDA 2G5TA 3PUHA 5K3FA 3D59A 3FLBA 4J0KA 4MWSA 5HF5A 3WWEA 4X94A 4BCDA 1D07A 1TAHA 3JWEA 1FFCA 3ESBA 4QLAA 5AI6A 5JASA 1U2EA 4N8SA 5AJHA 4JEIA 2CUTA 1P0PA 1CQZA 1UFOA 3STYA 1VLQA 4GEGA 2ZYHA 4DNPA 2PSDA 3WK6A 6YASA 5ALJA 3S8YA 3WA6A 4AN0A 3WKDA 2RI6A 5T4BA 3A70A 2CMFA 1YAHA 1LPSA 4ITVA 1QO9A 5AI5A 3LCRA 3HEAA 3G0DA 1ZI6A 4E15A 2WTMA 4HXEB 4W1QA 2OGSA 5AI0A 1YSCA 5CT8A 3WYNA 3F96A 3FWHA 4MEAA 1MO2A 4U2GA 2OQIA 3PE6A 5ALLA 4CG1A 1ODSA 3H04A 5LLSA 3C6BA 2Y2VA 4S0XA 4A16A 2ZJFA
chains in the Genus database with same CATH superfamily
3WKCA 4W9RA 4AK9A 4ZAWA 4OK6A 3SFVA 3NWOA 3LAWA 3C5CA 1KDPA 1QC5A 1R0RE 2EL9A 4I1VA 3WJ2A 2YJ6A 2Y76A 3V97A 3F3KA 2O2HA 3OC6A 2W00A 2UYQA 4UTVA 3U4QA 1KP3A 2ERYA 1DIOB 2YX1A 5C1OA 3JXEA 4BGUA 1Y5RA 3EUWA 4HQNA 3TTTA 4K6FA 1WXEA 4RD0A 3OZAA 1HA3A 1T15A 1JUDA 2B92A 2GZRA 1TLFA 3TQTA 4D3FA 2CY0A 3RRFA 4HAVA 2JJ2D 3BK1A 3L7AA 1P31A 4BAUA 1OW3B 4MAFA 5EP2A 3IV9A 2WM3A 3LQRA 3VR2A 3P9XA 1L7RA 2EG5A 3UA4A 4WKBA 4CE6A 1V4BA 2OCLA 3VI4B 1KTVA 4XDGA 4DV5B 4F92B 4GU5A 2R2GA 1BEZA 2NSHA 5DCYA 3VHXA 2V58A 1GHTA 1MQSA 3BM5A 3I1JA 3Q7TA 4Q3DA 1QRSA 3OM8A 3IEXA 1IZ7A 4BJ3A 1JDBC 4ZC8A 5JBIA 2WIBA 3Q6IA 4LKOA 3DBOB 3FPBA 1LNSA 2AZDA 1JR6A 4UUQA 2X9VA 3SVTA 1XK6A 4AO6A 1QZTA 2FF5A 4DILA 1TA9A 2WYIA 1RYMA 4JIMA 4B1FA 1SO8A 3HXMA 3MAGA 5CM8B 4EMBA 5CTJA 5LYYA 3MINB 4UW9A 4DDKA 2C8VA 2AF3C 5SZHB 2BGTA 2W6PA 3E81A 1GPBA 3CCFA 3H1EA 3G2OA 3PYXA 4Q4AA 4I50A 3WNBA 1E3SA 2AD5A 4QUGA 2YUIA 5FTWA 3V3KA 4Y2SA 2PV7A 5K51A 3OLVA 1JF8A 3HKEA 4UKDA 4QEZA 2GCOB 4ZT7A 1ZD5A 5AK4A 1CZKA 1QVAA 4EG8A 5KKCA 3OTQA 2VXCA 4Q3CA 4TRRA 4CT5A 2EKDA 5C81A 1EVKA 1MB2A 1B16A 1X9GA 2ACVA 1GPAA 5IX8A 4NBVA 3WGGA 4MMXB 3OU7A 1W87A 2WUVA 3EMDA 4LJSA 1U6IA 3F6YA 3CC8A 5C80A 1OKKA 3I05A 1Y6ZA 3W5BA 2AL7A 3LPDA 2AEMA 5A1TA 4M8NE 1ZW6A 4WD3A 1HGXA 1U31A 1Y4AE 1NR5A 4B7AA 2ZSDA 3FAKA 3GUYA 4P82A 1C7FA 1P5JA 1LRLA 2WKWA 1E8DA 1PYDA 4PZLA 4PNPA 3LLVA 1BOOA 3C5VA 5DHQA 1XRJA 3O91A 4RHYA 4F8JA 5FI3A 4LXXA 3LBHA 5DP1A 5AVUA 4MVJA 3QKWA 3THXA 1XTTA 2GPAA 1NXOA 2YVKA 4CG0A 5DFAA 1OB5A 1SUSA 4MQLA 5L4NA 1C8LA 5BW8A 3X1ZA 3QIAA 3I1IA 4GWGA 3N2GA 4JKOA 4V02A 3WGUA 3GU3A 5GINE 3FYSA 4UNSA 4DJJA 4JX9A 2YYZA 3JATA 4I8XA 3USZA 2CXOA 3OM9A 3K9BA 1KU0A 3IOBA 5IM4A 2A9VA 2BFWA 4WSOA 2ZAYA 4BJ5A 2WG1A 3H5OA 1WNTA 4P2BA 4BNXA 3BEDA 3IE1A 2RGUA 4P53A 4PFKA 4LRUA 2BTEA 3FPAA 4A73A 1DFIA 1SCNE 3QF4B 2CDBA 2ZWVA 3FCXA 4IH4A 4DLKA 1E1RD 1EFDN 3HHPA 3U26A 4ALJA 3LUJA 3IOCA 4FHCA 3CEAA 3X1JA 5FQNA 3X43A 4A2CA 2REQA 1COWA 3P2JA 2FZLA 5BYKA 3D8NA 1CP3A 4CV0A 4H7KA 1J8QA 4YY3B 1NPTO 1IY2A 3N5KA 3T6KA 2QLBA 4F7WA 3EK2A 1ESCA 2IYOA 2Z8YM 3E05A 5FTJA 3RHFA 1EEHA 3QLJA 4HH4A 4LZLA 1JQAA 3OOWA 1P1CA 3L0SA 2QRUA 3AFIA 2A7XA 3UC9A 1V47A 4KPYA 3W7VA 3EF1A 1ZYUA 2X1HA 2IXTA 1T35A 1UC4B 2Z1NA 1CHDA 4AWBA 2XUZA 1I4WA 1KYVA 2EJVA 4NONA 4HNTA 2P6OA 1U3VA 4J94A 4BO2A 3AUFA 3BRSA 4EG4A 2QMUA 1QIKA 2AMLA 3WISA 2YNMC 3D3NA 1SZCA 4FQ8A 4RMIA 4ALLA 1B1AA 4OA8A 4BQPA 1RCTE 2Y4OA 1UBNA 4EJMA 3QSYA 3A1EA 4Z9FA 3IX7A 1G5TA 3DCIA 1MOPA 1KS2A 3RJ5A 1KSJA 4C1NA 1T34A 4QYIA 3CLSC 4G9BA 4DWOA 2XMSA 4KC0A 1UT8A 5CNMA 1C0PA 4JVMA 5BN1A 1XHEA 1P0MA 2C2KA 3OQ6A 1UOQA 4HNSA 4DMFA 1A2OA 3EWAA 4K7JA 2GDJA 4OU4A 1L5HA 2R11A 2WPNA 1JHYA 2P3QA 2XQGA 2MYTA 3BQ9A 2AI2A 3R3VA 4YRLA 5DHRA 2RHWA 3OZTA 3BXZA 3RUPA 3ADPA 3AHGA 2OAGA 3GARA 3PEUA 2ZBEA 4IX9A 3OZIA 4IOKA 1G63A 4EATA 3EVTA 1NN5A 1O6ZA 2GZHA 1J8YF 3QKIA 4B0OA 2OV4A 4HHEA 4ZHQA 2OBXA 1NXXA 1NIJA 2WT8A 1U04A 3VX4A 3FWZA 2YIJA 1DADA 1Z4LA 3HKDA 1V9SA 1NT2A 1Z6YA 2YFKA 3PFHA 4NJMA 3WLRA 3EXFA 3WP0A 3VDNB 2HQRA 1XU7A 1E3LA 3H18A 2O3QA 4NBUA 2J07A 3CF4G 1DU4A 2R6DA 3M4XA 5J4LA 4ONEA 5LOVB 2D2XA 3GHHA 4FU0A 1YFKA 1SKUA 2ZPAA 4FCCA 4MLCA 1QIMA 1TVKA 4RF5A 3I39X 1IEVA 1FTYA 1FFXA 1Q3KA 1N6HA 1D8TA 3ESQA 3IQDB 3QI7A 4CWAA 1UH5A 1U1FA 4EUEA 1X2BA 2Z2ZA 4FFSA 4UNQA 2ZQZA 4WCVA 5AJZA 3SDSA 2DWOA 1W0KD 3R7SA 5HEKA 3GUCA 1CY8A 2XZDA 2A59A 4CMKA 5L6MB 4X1IB 1A95A 4ZWNA 1MFZA 1BXRA 2Z9CA 3DFMA 3PCXA 1DC4A 2QW8A 5IANA 2Y0DA 3NASA 2C84A 2IKQA 4ZQFA 3S7TA 1VHQA 3LC1O 1USWA 4L2IB 4WK2B 4ZTZB 1A9PA 1MEEA 1PQPA 3CXRA 3MMNA 1AH2A 2G40A 1CUBA 3RHSA 1P2VA 3RT1A 2IXGA 1D4ZA 2QJRA 2C99A 4KR0A 2OAQ1 4O2AF 2JIBA 4RXUA 1ZVMA 3KJXA 4N47A 3ZKAA 4C04A 1OLUA 1SZPA 2CXHA 3O95A 3UGKA 2X19A 5CRIA 2Z04A 3FDFA 4NAVA 3OJWA 4GXNA 5ALPA 1JDNA 2Q8NA 4GSYA 3UXEA 1NWCA 1L7EA 1WOMA 2VKTA 3CIFA 3FYUA 4EG5A 3R3HA 3KRTA 3PB3A 3QBTA 2BGKA 2GN8A 3G13A 4EOGA 1SZJG 2RIRA 5HKLA 4ED9A 4KRFA 4ZOEA 4GKVA 4F21A 3BTVA 3JV7A 3HP1A 4FDLA 3IB3A 1ZI9A 4RK4A 4GPBA 1EP3B 4AP9A 1EXNA 1SUDA 1K97A 3TKLA 1JVNA 5ILGA 1Z5ZA 1OGJA 3H3XA 1IN6A 5AJYA 1NN3A 3WIOA 2GM9A 1N4AA 1DBSA 3LWBA 4U3JB 3NT2A 2ZBUA 4CMEA 1NJGA 1MUUA 1A8IA 2QL7A 4XWAA 3B36A 3MJTA 1MB4A 3MGCA 4FS3A 4ZZ1A 4K9DA 1M0TA 2FFHA 3PK0A 3OQIA 4KUHA 4EJSB 2ZQ5A 1R12A 3BE4A 3VR4H 3UBTA 1YJ5A 3MC1A 5F1OA 1TMKA 3JQQA 5C7LO 4TM8A 1P91A 5IG2A 1HDXA 4LMPA 2HR1A 3P0RA 2BMDA 3THSA 2CVHA 4FNMA 4CQLA 4V1CB 1RP1A 1VJ5A 4LSGA 4XQ9A 1XNGA 1AO3A 2HRDA 2YRXA 1PX2A 3TOZA 1DSSG 1I5EA 3PQEA 4ESHA 2ZRLA 2IC5A 4R2MA 2QX8A 2R1VB 2BFPA 2YIDA 1R16A 4FSHA 2QRNA 4CG1A 4GRIA 1XRNA 2OZEA 3D02A 3VSCA 4M89A 1KSFX 4OUKX 4BV9A 3BFKA 2RAPA 1N6LA 4LJ5A 3CX7A 5CXXA 4AKGA 4B73A 8ATCA 4QA9A 3VPDA 5CLIA 2VNIA 1F48A 1DO8A 2PEZA 5G1NA 4ZIRB 5GV7A 2GCNA 4EHAA 4EQZA 4I9HA 2X4LA 3DV2A 3N0RA 3KTOA 4G4SO 3WQBA 2XUGA 3VR5H 3CPEA 1PIWA 5FNVB 5AVWA 2K6GA 4GE3A 4Q7JB 4K9RA 4XI9A 2XMQA 3L4SO 4WOPA 3J7AC 4B3XA 2C3MA 1NW6A 5ELLA 1JR3D 3MCAA 3WLKX 3E9QA 3HDVA 5BORA 1T29A 2OGWA 1TT7A 4XZ3A 4EL0A 1H6CA 3DBHB 1SIOA 4DQLA 2CCGA 1AF4A 3HKBA 3ANTA 1YS7A 2AUMA 1S4QA 1NVGA 1YBFA 3Q3IA 2ZUEA 1T0UA 4MVJM 1GT6A 4TVKA 1ZISA 4WKGA 5IM5A 3I5YA 1X1BA 5DI3B 3TE7A 3W05A 4TS4A 4NQRA 1KZ1A 4PYRA 4PCUA 3EMBA 4O4IB 1DV2A 1QONA 1B0PA 1YVRA 3D6AA 3DZCA 2IH5A 1L7VC 1YI1A 3GJQA 3IQGX 3VR6A 2X42A 4C2UA 1OZHA 3IO5A 4WBXC 4MOWA 3K92A 2DHEA 1AHHA 2J7KA 4GXQA 4ZRMA 1AKVA 1TMYA 3DYIA 4FTWA 1U9CA 3AYZB 3CPSA 2I3DA 4O0LA 5DO9A 3G0OA 4L9WA 4UBOA 4GBGA 4CDMA 3ANYB 1SC1A 2O57A 4R3NA 3R6TA 4IG9A 2FR8C 3S2SA 4E5NA 5JS8A 4M1YA 5LXTF 4FDAA 5HUJA 1UWCA 3U6KA 1PR4A 2ZIWB 5D51S 1LLDA 3KUUA 1A2QA 2ISSD 3L7LA 1ZU4A 1RAIA 2RHMA 3JQGA 5FLKA 2GKSA 2CLSA 521PA 5BV1A 3GNSA 2OEPA 4WGFA 1QMGA 1YZHA 4ZAFA 3VPSA 1YTUA 3AEZA 4A6PA 3PR3A 4X44A 3O0TA 3KT8A 2G72A 2QNBA 3WNCA 2VSNA 1KMQA 2ZIFA 3VYUB 4PPQA 3NBKA 3CVWA 3KWFA 4CT4B 1XN1A 1GLVA 3CEMA 5CT6A 3T5DA 4GYJA 3F9RA 1PI3A 4LWOA 5IULC 5T4HA 2ZUFA 4H0CA 4TVSA 2IUSA 2Q62A 4XX1A 1QHHB 1R7RA 1XC7A 2NUAB 3H6HA 2DLDA 1W2WB 3HXLA 1QS0A 1DUVG 3NIFB 4G5SA 3FNQA 1FDRA 4AG3A 2Z58A 5E7JA 1J2RA 2ALJA 3H9BA 2VJNA 2P8SA 5P8WA 4BMPB 3GA7A 4QJ5A 3CZRA 2G3YA 3BKWA 3I9V1 1QYVA 4IIHA 3AERB 5ESWA 5HILA 1OAOA 3UT0A 4IO0A 1ECCA 1QBKC 4ARZB 4B6RA 4XX0A 3WDLA 5I4IA 1TVMA 3JQCA 3BL6A 1IWPB 1P2SA 4N12A 4HQFA 3AZQA 4Y30A 2CD9A 4MQ4A 1RLOA 1BE1A 2Q4EA 3KSDO 1M1ZA 1XUOA 3BHNA 4PZ9A 5FEUA 3D6VA 1AHIA 3RSOA 2XCUA 3L7IA 3OPYI 4Q21A 1Q91A 5BYAA 4OQXA 3PEYA 5DF1A 4ACBA 1AS2A 1T6BY 1DARA 1N8NA 2M6LA 4K87A 1N2IA 1HO3A 2B7LA 4DLPA 2DG2A 1V37A 5CH8A 3K1JA 5DK6A 5K8IA 4BX2A 4HMQA 5I7EA 2VYFA 3PUXA 4UUMA 4X8MA 1JT9A 3ADCA 1W88B 2PGAA 2SCUA 5A4KA 4HB0A 3Q3VA 2Y71A 1GGKA 1GTZA 2MYUA 4ENRA 4JEUA 3FHCB 2X0DA 3OMLA 2QX6A 4FEEA 4MNTA 1T1SA 3MWJA 4TSFA 2RH8A 3WWDA 4UVGA 5JTUA 1WWKA 1YMVA 2CXRA 3KJFA 4O4HF 3VV3A 3WICA 4CMIA 2V7PA 4E22A 3BMCA 3GT7A 3L0PA 3OF3A 4YRPA 5FAXA 4B3JA 5JBNA 2ECPA 3LLSA 2IODA 1T3GA 4MWDA 2O2ZA 5DHSA 3RJTA 2QYOA 1VP3A 1Z4NA 5CXUA 2AN3A 3NLLA 2P3SA 4BBPA 2JBAA 3S1SA 1T6ZA 3G17A 5B64A 4YHHB 4DV3B 3OQPA 5JMOA 3ABIA 5H68A 1UJNA 2L82A 1TUBB 4S1OA 2NZ2A 3IUYA 3WX0A 2L0XA 1DIHA 1SCUA 3K0AA 1DHTA 1DIAA 3BXOA 1WUHS 4NBWA 3RFTA 4RHFA 3N2YA 1OC4A 3SSAA 1TC2A 2XE8A 2J0VA 1RAAA 3HU2A 3VPXA 2RGGA 3NRCA 2RCNA 1E60A 4NH4A 1Z0JA 3IBSA 1CUWA 2YXLA 3VDMA 2H00A 3DD5A 1R6AA 3RAEC 2AEFA 3UIEA 4HH0A 3AF0A 1Y6JA 4M1KA 4B2IA 4HLNA 1T9ZA 4XYMA 2RKBA 5AW5A 3L18A 3K4QA 1OIXA 4MS3A 3OCCA 4XUGB 3W8NA 2BM1A 1H2FA 3AVTA 3OJ0A 5D87A 2HNAA 5CVEA 4KL8S 2HREA 1ISMA 1R8YA 1Y1RA 1DPFA 3HN2A 4M6WB 5LBUA 4L02A 2H7YA 1ZBDA 2J5RA 3HVIA 5ESXA 3V3TA 1Z06A 1AGNA 2CL6X 2GEUA 3H5WA 4NMWA 3EIEA 1H3EA 3WGQA 4N0MA 1O0SA 1CS0A 3O4VA 3P0IA 3L6OO 3TIFA 1PG5A 3MQ2A 3TFWA 5C7YA 2BF7A 1E5LA 3KLMX 3QU2A 1M1NA 5B55A 1EFVA 2R00C 4QUEA 4BO1A 1ZINA 5J40A 1KP2A 1W85B 4R0MA 1JAIA 5CVJA 1A76A 5IPFA 4FSDA 1KDRA 1MC5A 1XU4A 3EZLA 4LXQA 4U7GA 5GJCA 4UEJA 3R6DA 1FDWA 4GNKA 1SM4A 2D5CA 2A88A 2WJ4A 3WTBA 3CVUA 3QX3A 1Z7YA 1SUPA 1ORWA 5LQSA 5CT4A 4FIDA 2FN7A 1ABBA 1UBFA 2BMWA 1Y6QA 3AM5A 3CXUA 3N53A 3CZQA 4I4CA 2PT5A 4YBRA 5DNVA 4TUYA 4FFRA 1IVSA 3H9GA 4U8HA 4II3A 2ZRMA 4DSNA 1J39A 1PV2A 2F9MA 3CX4A 3D2BA 2BEWB 2FP4A 3LLUA 4PIMA 1RYHA 3H11A 2J32A 4YNBA 2KM1A 3GFBA 4UHCA 1OXBB 1PVOA 1IBMB 2QT1A 1QAQA 1QQTA 4I9UA 3I28A 3CVJA 1S1MA 3PUZA 4MLZA 4YJHA 3JPYA 4BV8A 3PQCA 1KFKB 3ETDA 2FFBA 5IC5A 4O1IA 5TE9A 2G1JA 3TDNA 1PZMA 2E1PA 2OA0A 4BP8A 5JC8A 5DM4A 2OXIA 4HMPA 1ILEA 3PX2A 4GPTA 3OZ7A 2Q3HA 3IJPA 1F3LA 2ZUWA 3KR2A 5AUQA 1KEEA 1XQ1A 1RXUA 1WPRA 3K0CC 3K7EA 1OXKB 3CLUC 3DHYA 4R6WA 3HCAA 4R9SA 5JAZA 4ALNA 2JZNA 3KSBC 4B40A 2XD9A 4PX2A 3BB3A 4PZAA 2I2FA 4H7FA 5F5NA 2F2TA 3DEHA 1D1TA 3T7KA 1ODCA 4D9FA 2O19A 3ESDA 1NSFA 1NSTA 4HSEA 4C5CA 1UXOA 2FDCA 4FYVA 3A2LA 1FTWA 2IHNA 4TRMA 4D6XA 3EH1A 1JSLA 3P2KA 3B6IA 1CB0A 3OWHA 4HUJA 4K88A 4X60A 1RQNA 3ZJ4A 2QHXA 5ECGC 1VHWA 4KI7A 3QHQA 4L3VA 4OU5A 3OEED 1CJTC 1FNNA 4R0VA 4ZPXA 1VIVA 3IOMA 5DNAA 3ZCUA 1TGYA 5B7PA 3KEFA 1ORIA 4Q7LA 3QXGA 4XQGA 3S68A 5BUCA 1J21A 5IAKA 3EISA 1ZD1A 3CCBA 4DMHA 3JRXA 1FC0A 1M34B 4NFLA 1KSHA 1SOWA 1NUTA 1OWMA 4RBNA 3QEBZ 1B3BA 3RVLA 3EH2A 4DRYA 2RGRA 1KQPA 2QP9X 1P4RA 3EQ2A 3BWBA 3F97A 3LPNA 8GPBA 1N7GA 3LDHA 6ABPA 3VKWA 1M8JA 5DB4A 1KQNA 2LCIA 3CX6A 2FWRA 2IIQA 1H4SA 5LQAA 5CLGA 3J81A 4INZA 1J24A 3GFSA 2QM8A 2YR0A 4BMSA 1AQYA 5ALOA 3AF2A 5HZGA 3C41J 3P5BA 1SQFA 1GGHA 2AI3A 5FV4A 1KEVA 3N8KA 1IL0A 3IRVA 2NZUG 3LCJA 2CXUA 4PC3A 3HCOA 4DXDA 3SSOA 1IUNA 1ULBA 1V11A 4KRGA 3V1LA 1UQTA 1I80A 1IY1A 1SUEA 2D54A 2GNOA 2HCRA 3H17A 3A6EA 2OFPA 1RXEA 2HX1A 2AN5A 1EJ0A 1ODLA 3G88A 4JEMA 2C07A 1PJCA 2QRJA 1AUXA 2Y93A 2Z57A 3ANLA 1JR3E 3C24A 2ZRIA 2QRHA 2CXXA 2LDXA 2IZ6A 3GYBA 1ZSYA 1NATA 3QW4B 1ZNYA 1NU6A 2FW8A 2QPAA 2WIAA 4GMXA 4Y0NA 5CPFA 4AJHA 1NI4A 1SXIA 4XIIA 3VU3A 3IP3A 4F93B 5ESRA 3RSHA 5JR3A 1T1IA 2PUAA 1PGNA 3TVTA 1EUQA 4DDWA 5CVUA 1PZFA 2IPXA 1EM8B 3TD9A 4CGZA 5K0TA 2B6HA 2PN1A 1RAHA 1W94A 3BHJA 2CNNA 3OPNA 3PL1A 3EQ8A 2Y9PB 4XOUA 1XZQA 1BEEA 1DXOA 3BGOS 3DWIA 2WYUA 3D43A 3DLPX 3QJ5A 4GOKA 1G8PA 1T2EA 4EO4A 3ZE7A 1GIAA 1HDRA 3QVMA 3GI1A 3KL2A 2FMXA 1J56A 1LLCA 2AOXA 4FLFA 2DGDA 4R0NA 2P9YA 2HIMA 1LSJA 2QZ9A 4WIAA 2CUKA 2GZSA 4C0KA 4QM7A 1TE2A 5LC1A 2Z83A 3K9NA 4AWAA 1PT7A 3AVYA 4B32A 3IRUA 3NDIA 4XCQA 5HF8A 3V1KA 6LDHA 5JDIC 2ASEA 4JC5A 1Z5UA 2B82A 3B6KA 3EWSA 4LF7B 4KNVA 1JL3A 2VF4X 1YZTA 3DONA 4QDTA 5LMCA 4CL2A 1DQYA 1E8NA 2WFLA 5C8XA 1YR2A 3FDZA 2G5CA 3UWSA 2J4DA 1MNQA 4BLSA 2W0SA 2EX4A 4CV3A 3A6HA 4ZYYA 2ZWAA 3B2EA 2UUCB 4L5BA 1CVIA 4TV9B 5IVDA 1W34A 3WLEA 5A9RA 2PWAA 2CXNA 2V7WA 3L46A 2J9GA 3QU7A 5BVGA 1OFIA 3HCRA 1N2CA 4CEIA 1T3SA 1ZG3A 4BMNA 2NT3A 4V0LA 1XEFA 1I2DA 2XB6A 3WGKA 4EAAA 1DVRA 3TO5A 5KIAA 4KYVA 3DMFA 1DUIA 3S5JA 1H0RA 1DPGA 4NV3A 3T7SA 4WY2A 1NQOA 2I67A 4JLSA 2PRKA 4QRDA 5GY7A 5CFRA 4KW7A 3UOAB 3FWYA 3TRFA 1MRZA 3HI4A 3MOIA 1ZD8A 5EHGA 4R98A 4MUYA 4G07A 3G7NA 3REQB 1GITA 4RH0A 2CD7A 4DM7A 2ZROA 5ELXA 4G1EB 4R7GA 4NK5A 4EPXA 3MAAC 1J1IA 2R9VA 1CRQA 2QN8A 4O33A 5C31A 2QG6A 1Z62A 4P2GA 1A1VA 3U7QB 1XXLA 5AW3A 5A6SB 2NUPA 2P2NA 4EPWA 3KVNA 5K0SA 1C3OA 2GPTA 4QVIA 1EWQA 1YVPA 2FNAA 1RKBA 4MSUA 1KNQA 2RK6A 1J09A 2PMFA 5ERYA 2FPGA 2QAGB 3D81A 3IBFA 3K8QA 1MFPA 2CBZA 2V6JA 4G0YA 2AK3A 4KJZA 4RADA 3O3MB 5E7MA 5HRCA 3U61B 4G0UA 3TZEA 1H94A 1UZNA 5DOVA 3RWOA 1T8SA 5I5EA 1X87A 2B20A 4IVPA 5IFLA 2W37A 3I01M 4B7XA 3CEHA 2YVLA 5KHLB 3CV3A 1E1MA 5EWLB 5AI9A 1DCMA 3KJZA 1EX1A 4JN6B 2V65A 4MLPA 1Q7TA 2PQ2A 2TS1A 3VZCA 1FEZA 1UP7A 1XPRA 2QMYA 1U28C 2DKNA 1R0CA 2OXTA 1JYFA 3IEVA 4BMDA 4WK4B 4YMWA 1L7PA 5T3YA 4U2KA 4Q9IA 3UANA 5JWOA 2E18A 1ISSA 1MAVA 2IVZA 1QM5A 3D3WA 4ML3A 5DTRA 4J1TC 4BBAA 4DCNA 5LR6A 1GG5A 1Z22A 1Z33A 3EAQA 1EYZA 5ER9A 5KQRA 3UICA 1YULA 3P2OA 2EKBA 3U3KA 4AZ3A 2PQ0A 1IM2A 1SB8A 1NLMA 3LKDA 1TC1A 5DE3A 4BASA 1PNTA 2VDVE 1NFFA 2VN8A 3IQFA 3NWPA 4OAOA 4D81A 4DEXA 3UGJA 5IZCC 3TRKA 2GSWA 4MYTA 5EMKA 3INYA 5F3RA 1NBAA 5IRCD 2DKOA 1BHQ1 1K66A 3KAQA 5BQ3A 4P22A 3ZIAD 1FRFS 4YMVA 3D7NA 1ZM2A 5EZ6B 5HG0A 5HK8A 3BDAA 3G5MA 3W8RA 2AOVA 1CUFA 4ZAVA 5G0VA 1WV1A 4BV3A 4GOMD 1RZUA 2DC1A 1K6IA 3TSOA 4RA6A 4JQYA 5KS2A 4RJKA 4MRAA 3C4JA 3H4TA 3DDSA 4A6DA 4F3RA 1VKOA 2DH5A 3JSXA 1OYWA 4R40A 2Z6UA 1I3KA 3ZV7A 2XMRA 1QHFA 1TTTA 1Y8CA 5CB8A 5K6RA 1L7BA 1ISHA 2VF5X 3TECE 1JZQA 5IKXA 3LI2A 4ZOQI 3ZDFA 3BHMA 4FFLA 4FFNA 5AKJA 1R6DA 3ZEIA 2C96A 1PS8A 3VSBA 4M3NA 4DS3A 5B1YA 5BSHA 2EYQA 1CJBA 1OFGA 1YR1A 3IURA 1L4EA 1IXZA 5B30A 4BEWA 4W5TA 2VPPA 4ND8A 1X7WB 4PGMA 3WP1B 1ZL0A 1RVV1 1T5BA 1EG2A 1BW9A 2VP4A 3DTVB 3GAMA 3GRAA 3N8DA 2MTBA 3ZVRA 4LOHA 4FS8A 1WXQA 3PI6A 1QQ5A 1ENPA 1QWSA 4MRMA 3TX6A 4CFSA 4GYWA 1T9BA 4UOZA 1DTWA 4C0XA 5FBHA 1OXXK 4Y0VA 4LXTA 3ZGOA 3NTQA 1FYFA 2ODNA 1ZY2A 2YV3A 3PR2B 3GCDA 1K4MA 4ZARA 2JASA 3QKTA 2DZDA 3G9ZA 5TF0A 2QTHA 3D8UA 3L6RA 4BMZA 2C2HA 3W5UA 4R2JA 3GHYA 4YP5A 3AKDA 3AJ8A 1WW3A 2AHRA 2JFNA 1K7CA 2YOGA 3GEMA 5BXQC 2WP8J 3IBGA 3VZDA 5C5IA 2QTVB 4A0GA 2XIQA 5JJLA 5GZ3A 3QXXA 1ZK3A 1OOEA 4RNDB 4Z1MA 1GG8A 2CNWA 4L8GA 3ZK8A 2ZB3A 4E51A 2OSVA 1Y63A 4I50F 2AUTA 1XTUA 4Q9KA 3PXXA 3ILYA 3RYHB 4X3CA 2Q2QA 3NOVA 2YHAA 3EGEA 4OHWA 4TMWA 1IG3A 1XDBA 2FXIA 3KFVA 4D4HA 4H3KB 2X8AA 1RPNA 1MDBA 4EI7A 1I9GA 4CKCB 5JAPA 2J3DA 2V96A 2IU4A 2OTCA 2VAMA 4DV4B 1U0NA 2QZSA 1LDMA 1UQUA 3MTDA 5J4HA 1ZVKA 2WICA 5F12A 3A3OA 3K9FC 2BONA 3WGOA 1N3BA 1I6WA 1QH0A 2VQ6A 3CLTD 3T3EA 4JJ6A 4YAOA 1BOFA 2CLLB 2O5CA 4EQ6A 1ID1A 2O8CA 1Z75A 5H82A 1X39A 1F6DA 1NKVA 3SU8A 3IDOA 5F3WB 3IVMA 1IDOA 5CH3A 2YJNA 2X9LA 1LTQA 1YBMA 4L16A 4ZQGA 3X1DA 1CW2B 2XXAB 1KMIY 1QPGA 2C20A 3IQEA 4C14A 4DE5A 3WAGA 3IYLW 2CF5A 3HGTA 2QY9A 2H1HA 2QTNA 2ZJZA 3F5QA 2ONYA 2PLNA 3HB5X 2I8CA 1L5WA 2GARA 2IBMA 2X3UA 2ZQYA 5A5FA 5EHXA 3UJPA 1LSOA 4DB2A 1DAMA 3WK4A 3KJHA 4FUTA 1H2ZA 3SIWA 3TGWA 3VBCA 4ARAA 1EFLA 2WPDD 3PUKA 3QV1A 4MVJF 5I9NA 1UXGA 2FOIA 3ZK9A 4KACA 3ZYZA 3MJCA 3Q7RA 4OL9A 3SS8A 3NDBB 4DLWA 5KTRA 1XMOB 1B23P 1LV7A 4LTNA 1SA0B 3HV0A 5GTDA 1NMEA 2DWCA 4RVHA 1I10A 3RFVA 3PKIA 1XQXA 1N9ZA 1J42A 2QJFA 1QK5A 4HDMA 3KT3A 1KY2A 2XTMA 3JZMA 4JLJA 4X45A 4YH1A 2QQFA 5A3SA 3ORHA 4OREX 4YT8A 1TEXA 4G8BA 5JSFA 4MUBA 4PZZA 2R6JA 3PICA 1G8KA 3CF0A 2AN9A 4HZGA 3GPCA 3LOQA 3EPRA 1OBOA 3HO8A 3IILA 2JCGA 3I5AA 3SC2B 1PSWA 2VP3A 3MXOA 3QFCA 3BIFA 4L4RA 2PX6A 3G59A 5E9WA 5H59A 2JLCA 3K70C 4K5QA 1AUVA 3VR3D 3FLAA 3I4CA 1CUXA 1OXSC 4JB2A 2AOTA 3KYCA 5CAEB 1MCZA 3ZQJA 1UPCA 5SYNA 1WL8A 4OMCA 1Q95A 2HWKA 2G36A 1K27A 1Y80A 2AFRA 4D0GA 2F7SA 3HEBA 2HJRA 3V2IA 3AZOA 1PWYE 2FW6A 2BKXA 1AKUA 2GF2A 1AXEA 1WF6A 4GLFA 3W6NA 3V8EA 1F0NA 5KWJA 1RACA 2I4NA 1UBKS 5KZMB 3AI3A 1Q0TA 2JHPA 3ANNA 3S2IA 2XZPA 4BCCA 1U99A 1ZUNB 1JQJC 3B5EA 4YCSA 2VAPA 5LQCA 3P96A 4G0ZA 1OH8A 5JY1A 1KMHA 4REOA 2WJJA 3SZ3A 3LQ4A 2XSZD 4OMFG 4TMVA 3PQDA 1XXHB 2V97A 3ROTA 3PDHA 4CW7A 3DVQX 1E9AA 4FGZA 3DE4X 5G1PA 2BE9A 3UV3A 3FHOA 4OB8A 3MCZA 4D3XA 1RYDA 4FR5A 4AJKA 4IJ5A 2HU5A 1J99A 3OIDA 1WULS 2W8BA 3DXZA 2QQGA 4BEJA 4ZCRA 4GS5A 3K1YA 4TLLB 2V3CC 4DABA 4DIDA 1FMFA 5I8ZA 4X00A 3HBFA 4J7UA 2YWXA 2JAHA 4C07A 4UBKA 5KQPA 2VYNA 4B8WA 1ZH0A 1K92A 5CMLA 3W1WA 2OC4A 4TVOA 2HGSA 3B12A 3FROA 2E87A 2FJUA 2QVBA 3VU9A 3FX2A 4AM8A 2VDQB 3VR4D 4HQLA 4DM4A 2QG9A 2QSJA 1BMFD 3EQ7A 3ZJTA 2O0KA 2PV0A 2H16A 5AM3A 1QR2A 4JR0A 4TQAA 2WUFA 4ZO9A 4OVKA 1E2JA 4IJWA 2BFFB 1X8JA 3QNWA 1YHNA 3WLQA 2QN1A 5D3MB 3NWEA 3UMJA 4R05A 1K5PA 2P5TB 4HATA 3WRYC 5DT9A 5EXSA 5IVHA 4ZHQF 1L7MA 4F4HA 5H3CA 1EJ2A 1L8OA 3OEWA 3C3KA 4KO8A 4GI3A 2QM0A 2W98A 4HBZA 3TTVA 2J0SA 1ZJJA 4UU7A 1XD9A 2XKAA 4M1OA 1G20B 2PJUA 1ZK1A 3WRVA 2X0FA 2M32A 5FUWA 1GPDG 2VDOB 2HJWA 5GM2A 3NHUA 1XJ0A 3V4SA 1JILA 4MP6A 2I22A 2QYTA 5F52A 4POAA 5F1YA 4NCAA 4UHDA 5U4QA 2QTWB 3CS3A 2VTEA 2X86A 2LBPA 1LSSA 4GF5A 5FOXA 3VR5D 4DJEC 5FF9A 4Z4CA 2WQ6A 1SCDA 3DGEC 3GLIE 2FEWB 4MPRA 3RJ9A 1UBLS 1NQVA 1WCXA 3AW9A 4CUKA 3TPZA 1L7XA 1YZVA 4FT2A 5KMGA 1J8VA 3WB1A 3PXUA 3COWA 3GC6A 3NHAA 2JH8A 5H5JA 3TAXA 1J5XA 1BRTA 4JI4B 2ZIEA 3DJFA 4TLCA 4AD8A 3II6X 3JSAA 4ZQHA 1JEEA 4NABA 4GDFA 3FZGA 1T9CA 2G07A 4JUDX 5JCJD 3PNKA 4ZOLB 1JKJB 1NP3A 2FEAA 2JFQA 2WHRA 3MRVA 5G4KB 3TCNA 1FS6A 3WL4A 3EC2A 4X65B 3TR0A 4FOLA 2YWHA 3ZWYA 4KCGA 1UKVY 4EPVA 3RTEA 4J7AA 1UZAA 2H1FA 3DPIA 1CF2O 3KFLA 4M98A 4MWOA 1SVWA 2WI8A 3WR5A 5AW7A 5JT1A 1Z2EA 5K4HA 1IHUA 1LD3A 2NSJA 1HZZC 2OGZA 3DMPA 3SLRA 3AUYA 5BURA 3RQSA 3V8QA 1TA4A 1K98A 4ZO8A 4EY7A 2JKZA 4Y6LA 3K9HA 3G0GA 3UFXA 2Z3VA 3AP2A 2Q46A 1FOEB 5K3BA 2JB9A 1XZLA 1G60A 3F4LA 4F38A 1UK7A 4MWTA 4NZ9A 1JQKA 2XNDD 4CDGA 3W4KA 3KQVA 1KYQA 4HR7A 4A3SA 4G9EA 1OXTA 2OQRA 4BB9A 4YRSA 2FR1A 4M99A 1R4MB 3Q12A 2POCA 1DKLA 1PK8A 1RWBA 4J0GA 1Z35A 2BJVA 2OP0A 5ALEA 5DHFA 1Q0QA 2OT3B 5CX4A 4ER5A 3KQMA 4NCXA 2XCIA 1QRRA 3OG9A 5KDOA 2HA4A 3A8TA 1G291 5THQA 1PS9A 2XYVA 3BFJA 4KPFC 3D4PA 3AGPA 3DP7A 4DBLC 3FIUA 4KQ6A 4Q3NA 1SWVA 1X7ZB 2X5JO 3GDGA 3K2IA 1DE0A 1M2KA 3E70C 4OXRA 5A71A 3W9BA 2F8TA 5ARCA 1Z9BA 2R65A 1LKZA 3TM5A 2OMEA 5EHIA 3W6UA 5B6PA 3A2MA 2A0FA 1FS5A 3IHKA 4BTLA 2PMKA 1RIIA 2FFRA 2C5FA 4CL8A 4BRWA 1TQ4A 4D7AA 1BQ4A 2BM0A 2D0IA 3HJBA 1NTOA 5IDQA 2WHPB 5BP7A 4P35A 5FV7A 3F2IA 3IMCA 3G7SA 1ILWA 4JHXA 2XZOA 1NP6A 1W35A 3C1UA 4X1KA 5E6SB 2V5UA 3RODA 5JANA 1KJQA 3DC7A 1DEKA 1TL7C 2GF0A 3FPCA 4PYKA 4W7HA 5JNVA 1PQWA 1S8FA 3ZWBA 4GUAA 4R2LA 3KM0A 1A9YA 1PK9A 3A1WA 3P0JA 2Y3IA 5EE5B 2W42A 3FOWA 2KE5A 1N6IA 1SMKA 3JQ8B 3NV9A 3SCZA 4GX5A 2J3KA 1OPRA 1W4CA 3ZBTA 4LBZA 2A86A 3P97A 4JFAA 3WADA 2OV2A 2PKWA 1Z8NA 1BKDR 3IEKA 2ZYWX 3KZ1E 1RAEA 3UZUA 2JGFA 3OE7D 4X1OA 4ZVOA 3FSEA 3OEYA 4F7DA 2Q4DA 1NVTA 4IDHA 5E1OA 5KOJA 3KUXA 2UZ4A 2CUZA 1CY2A 3OMWA 4HWOA 4WACA 5I4CA 1UC8A 4DR4B 2YW2A 4PGFA 1HKUA 5BMVB 1WE2A 2OFFA 4NBTA 4B83A 2I4OA 4XA8A 2QD4A 4OXQA 1E1CB 3VQTA 2QM3A 3IIJA 4WLEA 1K0UA 1ZITA 1DJQA 1PFVA 2A78A 1OFUX 1HQKA 2JGDA 2YMPA 3LFHA 3RK0A 3WIEA 3GROA 2OILA 1ZD9A 3C3MA 4HUQB 4NNJA 5DGHA 1KZGB 4OP1A 5C5CA 1L1QA 2OHIA 3FBWA 3GN1A 3M9LA 3O83A 1EEXB 1OBFO 5CIQA 3USCS 1VDZA 4XOIA 1ECLA 2PIDA 1EUCA 3GEHA 4WASA 1F8UA 3GPDG 2FWMX 4G86A 2V5AA 1MPXA 5T41A 3AY0A 4C87A 2VK4A 4KBYA 1AQUA 2C29D 2P9JA 2WIFA 1FLDA 1RPTA 4HS9A 1AQIA 5G4LA 2EJUA 1RI2A 3FMFA 3KP1A 2C2MA 3PDIB 2ZSAA 3TEMA 2BBOA 2WFAA 5LP1A 1Y6GA 3OHPA 3DAGA 1W36C 3PC2A 1YTLA 4KX3A 4S1NA 4HX5A 4N8DA 1K08A 5EP3A 1XCPA 1T4MA 3ETJA 2YL2A 4AY4A 4IFTA 1FB5A 3W8DA 2O20A 3QE0A 4ZJYA 3TUZC 3ISVA 2UKDA 2WSBA 2Y1LA 3O1IC 5EYPB 5H1YA 1L5GB 3N74A 2DQZA 3R6LA 1JBEA 2OO7A 5I5GA 1SC4A 2ZGVA 5CU7A 5AKXA 4RMJA 4EY4A 4GWKA 4TV9F 3WK8A 3F71A 3FBGA 1W6RA 4NSNA 5J2TA 3OZFA 2YJGA 4CM1A 1KO7A 2RHHA 3AFHA 1V8PA 2AE2A 1ZIDA 3O9VA 1W4ZA 1ZJWA 1YJQA 5I45A 4UOEA 2RGBA 3W0LB 1IUPA 2I4MA 4ZEVA 1BGWA 2IBSA 3IV7A 4PQGA 4RSMA 4YS6A 4QXQA 5KTNA 1LDNA 3K0KA 1TJ5A 5IYZB 1PKXA 2AZ4A 4WW0A 2JFGA 3EUEA 4BGIA 4NXNB 3TZLA 1ZDMA 4ARCA 2V9PA 4NESA 1JHPA 3RS3A 2F4VB 2H9YA 4CM8B 1IB6A 3K3PA 5G2OA 2O06A 1SQGA 3UUWA 2KWIA 3D54D 2QX7A 1YZUA 2XUIA 4F3YA 1RMQA 1CR2A 3TZ6A 2A1TR 5ALIA 4X5OA 5KVVA 4WL0A 4RA9A 4I2VA 3JTMA 1Y3BE 3KT6A 3KD2A 1X1QA 4X1IA 4BP3A 3DOCA 5IFKA 2RB5A 5KTMA 4BAGA 3H5TA 2YN0A 1RM4A 4BE4A 3IAUA 1B8PA 1A5BB 2Y1CA 3IO3A 3ZW9A 5K6AC 3P26A 4L2IA 2G82A 4MR9A 3T0GA 4HTFB 1FY2A 2FX5A 1A7KA 4HNRA 3CLTC 3PUVA 1QAOA 3FVWA 3PEWA 4IJ6A 3OPYB 5KWVA 2OBMA 3HVHA 2F6RA 1P8JA 3AIOA 3BREA 2FWNA 3V6LA 4R71A 3HFJA 2INGX 2V3WA 3L7KA 3ZGVA 4X6UA 4N5HX 2JZCA 1MRNA 3HJGA 4EFMA 3AKZA 4CM4B 3DZ8A 3FDIA 2HPVA 2C4NA 2FW1A 1RFLA 2N0SA 2PA3A 4P34A 4QBKA 5TSDA 1MH1A 4RQBA 3TRIA 1X1RA 1GL6A 2IFTA 1RS0A 4K9OA 1ADGA 1N2JA 1X70A 3INTA 4RZIA 5DBFA 1DRJA 5HIIA 3VYRB 2BYTA 3NHJA 3N2LA 4WJZA 2J4FA 1CUDA 1KH2A 1G5FA 1W1IA 1WCIA 4TTIA 4MUNA 1EVQA 4KN5A 1OGIA 5BVHA 3U44B 1WKVA 4TWRA 1NBWB 3GFVA 1EM6A 1GNPA 1V5FA 3U3DA 4ZK6A 1SCBA 2DPHA 1DQNA 4KXQA 5BSMA 2EW1A 1UFRA 3T7EA 3WMXA 1I51A 1HG1A 2PBZA 2H1OA 4QNRA 5DHUA 3QK7A 4YPOA 3LBYA 1V7CA 1A2BA 1BVYF 1DFGA 1PT8A 1GZ5A 2PGNA 3PWTA 2JRLA 4P4SB 5T5QA 2WKRA 4EJSA 3IEMA 1WVIA 4G1MB 2G09A 3I5UA 2DT5A 2E4AA 1JI3A 1Z4PX 3ZE6A 2SKDA 1R8JA 3MLBA 1C8VB 4I19A 4GR5A 3B85A 4BX0A 2RE8A 4KTVE 5EJEA 1I4TD 1DX9A 3AKCA 2ZJ4A 5I7WA 2CK3A 3WK7A 5AVZA 2WIJA 4IMPA 2GVZC 3TBHA 2YZNA 2ZR0A 2R1VA 4FI3F 4C0BA 4LJAA 4KWHA 1MQ9A 1WXIA 3BZUA 4PV7A 3UT5B 3IXLA 4LJ9A 5C18A 4EABA 1XLVA 4FBGA 4PR0A 3QKSB 4YT5A 2C3YA 1U0LA 1X8LA 2DY0A 2ZDGA 2ZBFA 3H9QA 3MNFA 1U0EA 1D9ZA 4Y2VA 1GNTA 2IU0A 2PMBA 4YMHA 2ETXA 5DNDA 4JI2B 1DWPA 1E9EA 4RV9A 4DCCA 4JOCA 2VK8A 2QTLA 3F7TA 4V0KA 4AKEA 5DT2A 1Y3CE 4BLTA 5KOHB 4EMTA 1DT5A 1NOJA 1YBAA 4GMDA 2G28A 2H06A 1MJGA 1YQEA 3MBOA 4RCVA 1VJRA 3SEAA 3ZE8A 4KVFA 4C4ZA 1AMUA 3BJMA 1YCFA 3QXJA 1MG5A 8MHTA 3RRNA 1E1RA 1GZVA 1UAGA 3HJNA 4KBGA 1T2UA 2Q6VA 3IXMA 3ZW7A 1NONA 3C45A 3ODPA 4RK7A 5G0SA 5G41A 4EG6A 4L4YA 1DAFA 3GRZA 4NCJA 4ZCTA 2VJMA 1F2TB 4MUGA 2D1FA 2J3EA 4E5DA 2CLDX 3HDHA 3LD9A 2MR6A 3MWEB 1HFJA 3DHNA 3MWFA 1WDTA 1G3RA 4LVNA 4V0MA 3VO9A 1H65A 1N0HA 1FFBA 2FQYA 4D4JA 4RTSA 2J7PD 4JZYA 4B81A 5CDFE 1GN8A 1HDYA 4B84A 1NQWA 1DJLA 5KREA 1NF8A 3M5PA 3HUDA 2E89A 3A11A 3IAS6 2JK1A 2XDQA 3GVHA 3OE4A 4M0PA 4RIEA 1HH4A 3REFA 4IX1A 2FN3A 4EY6A 1G5QA 1JIKA 3C8ZA 2OLEA 1O4VA 4L5IA 4R1MA 4TL9A 3OEHD 3V8VA 4ROSA 5EL0A 1ENYA 3PQ6A 3K5HA 3WQRA 3K16A 2JFBA 2AB0A 4Q3EA 1HMYA 1DMRA 2VPWA 4KWCA 4M49A 5T4FA 5ARBA 1QKJA 1PJSA 1EA5A 3DDNA 5D6OA 4G0MA 3EAGA 3A9TA 2F4NA 1GYQA 1P3JA 3OJFA 3ESRA 1DXHA 4OGWA 3UK6A 2C2XA 1FFAA 3QVJA 3WLFA 5AM5A 2EFEB 1RAGA 1X14A 2AT1A 4M8SA 4TWZA 4WFKA 4UNIA 1IVYA 1WCV1 4RLFA 1V7ZA 3ISJA 4WJKB 4RMGA 1ZH2A 3CF4A 5K0EA 4ZEXA 4MW0A 1LVGA 3QVSA 5K4AA 2XYPA 3NANA 4P7FA 4TTVA 1Y8QA 5FPPA 3E1GA 4K1LA 2ISCA 1DRUA 2ZM5A 3NM5A 3BD7A 1NM5C 3BGIA 1ODTC 1YJAA 2FN9A 1WU7A 1KI9A 1QHHA 2F1IA 1SC3A 2GCPA 1H2AS 2N42A 2WAYA 5GGYA 1DB3A 2NPIA 3IUEA 3R5HA 4CV2A 2ZJ0A 2NU6A 1IWBB 2AQIA 1N2GA 3K0CA 3AL0C 4PWZA 1U5BA 1ZBQA 2HUNA 2FDRA 4LWZA 3SOZA 4BB0A 5A6VA 5BMOA 5DASA 5IJ9B 3O8LA 1VMDA 1LPPA 3OTWA 3ZHTA 4FFBA 1SR8A 2CDNA 2QMEA 2W93A 4NFHA 1DOAA 1VG9B 1M6VB 3PGA1 4M2LA 1Y48E 2H85A 4ZZ2A 3UJ9A 5ADVA 5K03A 1EUYA 4NOKA 5B2ZA 3VVBA 2EZTA 4R6XA 3OKPA 3GLHB 4YREA 2E4UA 2VJQA 1XR3A 1YL5A 3RG8A 1XD2B 2I2WA 2J3JA 3P0FA 1W0KA 3ZCRA 5EWMA 1D0VA 1ZXBA 1TK3A 4WOJA 2FA9A 4IDNA 3VJKA 5EHZA 5KYTA 4G8DA 3DWEX 3KLPX 4EGQA 2CCKA 2IHVA 5A3JA 4FZ3A 4MV8A 2OCXA 3NHLA 4K40A 1B15A 3NBXX 4ITUA 1YJBA 2YC2C 4DZZA 1L5FA 4MIOA 3I2GA 1X77A 2HLPA 5DWDA 3MIZA 3TGLA 3D6NB 4G4IA 1TCBA 1AKQA 1N2SA 2FOLA 3CX8A 1QQ7A 5EIWA 3UMYA 1TYZA 9ATCA 3R40A 4ZI7A 4BP9A 1X92A 3A27A 1OH6A 1DX6A 1K6EA 3HFGA 2JFHA 4KE6A 4IY1A 1Q3HA 3H7IA 4KLAA 4PO9A 3UJ7A 1XJ5A 5E6UA 2I4LA 2WG2A 3BC1A 3EW9A 4ZAYA 3ZE1B 2EBFX 4NULA 1OLXB 1YDMA 4FGSA 4Q6WA 4IDAA 4OO3A 4KSCA 4BFYA 3BD6A 3OPMA 5BPFA 2CT8A 1MC4A 1WXXA 3BXPA 1OV6A 1VL8A 2EFJA 1Z83A 3GDOA 1II0A 1KYWA 1O5OA 4KFRA 2NUTA 4KR2A 1Z08A 3E2IA 1JHDA 5DCUA 1FNBA 3U9TA 4EGJA 1SXJC 2GWHA 2MSLA 2W2TA 2WB2A 3GJXC 3MTGA 4J6EA 4KP7A 5F4BA 3JTEA 1Y7LA 2B7CA 5TQ2B 3ZWOA 4AL4A 5HR5A 3L84A 2DPLA 4D8WA 2DUWA 1GFIA 2VF7A 3FOBA 4YDQA 2WHEA 2BFCB 2I2BA 3DG9A 1YR9A 1GZDA 4TQGA 3HADA 5BYBA 3UK7A 4DSOA 3SYKA 4BLPA 4C6RA 3WXBA 3CR8A 4IGFA 3SQOA 2QXUA 1TF2A 2YBEA 2YHBA 4KZKA 3DTNA 3R9IA 4HDSB 3AETA 2QEQA 4NS1A 3T94A 3TK1A 5A5EA 2GA9A 2G6BA 1XYYA 2SECE 2G9ZA 3KTAA 5AKHA 3RLIA 4JJ4A 2PMWB 2DXIA 4JSYA 1PNOA 4PAQA 1RMTA 4NU8X 3P9ZA 1T0IA 2C9MA 4URHA 5AJUA 2WTXA 3OZCA 1BMDA 2PEYA 1N32B 4JDPA 3P94A 2R79A 3ED1A 3E18A 3WRWA 5AVSA 4ZFNA 2ZW9A 3VC1A 2FUG6 2O8NA 2VHEA 4KQKA 2YCLA 1ZUD1 2PRSA 4NECA 3OZVA 2VS1A 1ND5A 3T54A 2BH2A 1BE6A 2PH5A 3M89A 3WGMA 4JMLA 4C7KA 4JR2A 4D8UA 2E5WA 4M0KA 4R69A 5JDIA 5JD5A 5EIXA 3NVDA 4TT3D 1UFQA 4XM0A 1MT3A 3NM6B 4ITRC 3LPCA 4M53A 2O2XA 4NKRA 1MJFA 4G2NA 3ZW8A 1XU9A 1JPUA 3E53A 4HNHA 5DBEX 5K8TA 3GT0A 2JFWA 3B2QA 1Y7TA 2DJ5A 3QEMB 4TLEA 3SQLA 3IHLA 3JWJA 2AR9A 1JE1A 1W85A 1T5IA 1AQLA 1Y33E 1U0TA 1UPXA 2IOFA 4AJ9A 4DLAA 1CTQA 1QTIA 3QKRB 1OU4A 3SMVA 4D8XA 1MC8A 1LVHA 1JR3A 1A8SA 1XAHA 1ZLXA 2TMDA 3F46A 3EUAA 4FGKA 3NHWA 3NGMA 4RKEA 3MFQA 1G42A 4QX6A 4JI8B 3OZXA 1AK1A 3QOXA 4INPA 4JWTA 1OI4A 1KMCA 2DFDA 2VUUA 4ZOLF 1U0RA 1V26A 1ZCBA 3QVGB 1CYEA 3R3WA 1YRYE 4OPMA 5AM4A 3FOZA 1U1GA 4REQB 1M2VB 5E38A 5PGMA 4UNRA 4LRQA 3H9JA 1LQUA 1FNDA 2GZAA 1GV0A 1XMJA 2IXFA 3UHJA 3QFSA 5JXHA 3LLCA 1E58A 2ONKA 3IQZA 3FH0A 3MEQA 3P4XA 2CYBA 4XGIA 4HDCA 4P8RA 4KHPB 3TD2A 3KOXA 3S2ZA 1NW3A 9ABPA 3RIGA 4WOBA 1YMQA 2A5DA 3TRJA 3SC4A 5EJAA 3TOSA 1MEJA 3AVPA 2H4WA 5JXGA 4E12A 2H2FA 1Q0UA 1TX4B 1KZ9A 1XZNA 3DHVA 3KKQA 3A3KA 1UBSB 3Q10A 3LYHA 2CN1A 1TFUA 3L7NA 4UD2A 4X6LA 3E8XA 3UAGA 4LYEA 3FR8A 3EA5A 1QX3A 4J2HA 1Q0PA 1MIOB 4ZVKA 1NUAA 4Y1RA 2DQKA 1V1JA 2JF0A 1GZUA 1MHTA 1JJAA 3WGZA 1VJTA 1K1EA 1XDDA 3IIKA 3R4VA 5EXEA 4D3ZA 3D6TB 4YJ2A 2NQTA 5A0TA 1TMGE 3H4VA 3MXTA 4C89A 2ROQA 4JL8A 3K0HA 4BFTA 1VCHA 4X1YB 2OYRA 3VMMA 5JARA 2QBYA 3EG5A 2GZ1A 2WBLC 3CBQA 4R8SA 4A92A 1ZNXA 3GJZA 2QZJA 4H4DA 3Q8KA 3PDWA 4TL6A 3PKZA 2BRUC 1L4KA 4JLBA 4RY0A 4H6XA 4ZTUB 2WJYA 3ELDA 3K2BA 4TWIA 4J1TA 4XRRA 1ZMTA 3OHMA 3STWA 3U16A 4N5LA 3OFKA 4U9IS 4BLOA 1YXMA 4ZGWA 2WE7A 1NY6A 3ND6A 1YKSA 1FSZA 4X63A 2I55A 2QAIA 5KOYA 1ZNWA 1Y9JA 3H0EA 5IZCA 1T8PA 3WAJA 1M0EA 2WYWA 4ENQA 2Q3FA 1MABA 3IR6A 4XWGA 1VKNA 1OZFA 4KJXA 1JXQA 4JDUA 4LMBA 3UJAA 4B6JA 1KQFA 3CH5A 2QL5A 1YR3A 3KZKA 1TUEA 2P4HX 3W04A 5EEHA 2JPDA 3E9MA 1N6PA 1ZSVA 3NTLA 1QTNA 2QB5A 4MQ6A 2HWXA 2AC7A 2PD4A 2QY6A 2N1MA 4ZCLA 3ZHVA 2Z5GA 4WLFA 4NMMA 3F98A 3OCVA 1RLJA 3FMVA 2Z4TA 3C8UA 1QYRA 4MQMA 2JLAA 1QP8A 2VPZA 2FPIA 4FC6A 3W8EA 1QHNA 4YRDA 2IP2A 3CMCO 1TK2A 2ZT6A 3ADBA 2PK3A 1HZJA 121PA 3EHEA 5L7YA 1SU8A 1QH8B 2C3OA 4MR7A 3JVUA 2DBYA 4PC7A 4YV1A 1DWUA 1W5FA 2O1EA 1TTQB 1KMMA 1QGOA 5I7FA 3D7KA 1CDEA 3R7AA 3WSVA 2JDIA 2XCTB 4GG1A 3IDAA 1FXWA 3HZHA 2AOUB 3TI9A 4BQFA 4V24A 2GTHA 2B0CA 4AAYA 2XQFA 2WTUA 2DB3A 2O7SA 3FCUB 2BEVA 2VWHA 2VG8A 1V9CA 2HDOA 4U6SA 5H70A 4Y9TA 2EYUA 3RO7A 1U0HC 3ZE0B 1UMBB 1VBMA 3HNPA 2Q7OE 5K9ZA 3JYOA 4N0EA 3F6CA 4DWJA 5JSHA 1VHDA 4WZBB 4NYMR 2NPFA 3B82A 1SB9A 1ANKA 2BFDA 4BNJA 4MJ3A 4EUNA 3KQNA 2V9ZA 1JDUA 2IXDA 2IIVA 1ZFNA 3H9UA 2HYIC 2V5VA 1XROA 2GZ3A 2CUNA 3DDCA 2C92A 2JJMA 3IA2A 3OSZA 4QQ8A 3TD6A 2XGSA 3M4JA 3ZWXA 1AV7A 4B87A 1G3UA 1NVBA 1ZAKA 4F4JA 3DKKA 1VMAA 3ZNNA 1M75A 1IZZA 3RYIA 3R3SA 5JJIA 4GGOA 3PGMA 3USES 4K6MA 2A9JA 2GZMA 3LBIA 1ISRA 1S2NA 3FHJA 5JTTA 1NU8A 1II8B 1EFKA 3B52X 1JSXA 2OBFA 1R2QA 2P4UA 4GRAA 3WZMA 4CLRA 3KPVA 4CEJB 2Z09A 1TXGA 3N8HA 2CHGA 4V03A 4M1WA 4OHPA 2C5EA 4FOSA 1U0SY 1Z17A 3ECCA 1KU6A 1JLKA 4DV2B 4GZ6A 2QT9A 2P9HA 3PIDA 4BO0A 4DPKA 1IG0A 3EDOA 3CB4A 3THWB 1TNDA 4YT2A 3DLTA 3O0DA 1CU1A 4MARA 5JH7A 4U9HS 5DGCA 2IGTA 3CRW1 4WVLA 3EPLA 2PUDA 5E2IA 2HRCA 4YFVA 3WHLA 4CRWB 1HOXA 3GK3A 1I2ZA 2I0FA 1GTRA 2ZBPA 5F76A 1B74A 1L0BA 1R9JA 2I1QA 4HEA6 4EP1A 3K32A 1YJCA 2IYYA 3E8SA 3M1LA 4OUDA 2I4TA 2J6BA 2JEZA 3EBLA 5CA1A 2VC2B 4ZVQA 1T8UA 3U7QA 3L8HA 1C3JA 5KNCD 3K5WA 2C7OA 5LZ2A 1P9WA 4C01A 4OFBA 5DXAA 2VDLB 4QTUB 3D3KA 3VX3A 4LXHA 1NAHA 4OY3A 1CDOA 2HIGA 3DLHA 1N78A 4R31A 4G5XA 4GPIB 1QUEA 1W73A 3KBOA 1AVTA 4K6OA 1T3LA 4RKWA 3GFQA 3H97A 1JLLB 2WQZA 3DBRA 2RHDA 2NYUA 4TMTA 1RWQA 1I4DD 1YRBA 3CH6A 1AV6A 2IOQA 5K5EA 3P4YA 3C3XA 1S7CA 2DR0A 3P1JA 5FBWB 3I6MA 4IJVA 1IN1A 3D2CA 4OB6A 2C2GA 1P7YA 2A9RA 3LX5A 4KXMA 4RTPA 2HXYA 1K3UB 3H87A 3PQ3A 3PVZA 1VKZA 5IT4A 2DFPA 4ENUA 4GLJA 4EPYA 1SVMA 2GBFA 1KGSA 3V34A 2JI8A 2H3HA 1UJ2A 4BOYA 1N2BA 1XDWA 1I5OA 1ESZA 1P17A 2OV8A 3OQBA 3EDCA 3S1LA 4AJPA 1L4MA 1Y1PA 3JWPA 3MT9A 4HWGA 4L72A 4OYLA 4XJXA 5F5XA 3QLVA 1RPJA 4WOKA 5I8WA 4I4IA 4WZBE 2X7HA 3D0KA 3S1AB 4DDTA 4Z7QB 4H08A 2I6SA 4GPD1 4OQPA 1LDBA 3P7MA 2BISA 4RENA 4QLOA 4AYTA 1G4UR 3G9QA 3OTGA 3M8KA 5C2JB 3SDZA 3NOOA 3L7YA 2MSWA 4OQ4A 3WQHA 1NV8A 4B3CA 4DMLA 4YMUA 5BSWA 1H05A 4S3MA 1VPLA 2Z8ZA 1BXZA 4P3YA 5ENVA 2D62A 4N3NA 4A8JC 1M8PA 5DNCA 5LP6C 3CZCA 5HFNA 1ORTA 3TR5A 3OEEA 1XRQA 1KFEB 1N0IA 4UAUA 5J5AA 2G9NA 1NZDA 4G1CA 1YHYA 3ZD7A 1F6BA 2MR5A 4Z0HO 1E4EA 1VSQA 4Z4EA 3FA2A 3SXUA 2UU9B 3RTCA 3JARB 4C7OA 3SQDA 3GPIA 4JLUA 4K9QA 3MJ4A 4L28A 5BOSB 2ZYTX 4KRYA 3DL7A 3N2IA 3ZWAA 4EKGA 1T36A 4PNHA 5GZ1A 5TR9A 3AW8A 1GPYA 1SHUX 3ITDA 1SHTX 4C2AA 4DGSA 4F6LA 5L3SB 1DG1G 2DTXA 2KLHA 2NO0A 3K30A 3PWKA 5JO9A 4KNWA 3COSA 4KFUA 4BNMA 4AZ0B 1UXIA 3Q0TA 1QZ3A 3X1MA 2GN6A 4N9QA 1N9GA 4I3GA 3QELA 4MV7A 2WHXA 1CJVC 3TR6A 3ULKA 3D1LA 4YRJA 1G21B 4BWVA 5LA6B 5E8RA 2RCYA 4A2PA 2G9RA 5LL6P 2I99A 1ST3A 2WIDA 2LR0A 3GD7A 1XDZA 2XEDA 1PNVA 4RABA 2GNAA 1VE6A 5JS1A 1BFKA 2AE1A 3LC0A 2PCLA 4G37A 4RZHA 2D2VA 4ZMSA 4OH7A 4LUCA 4KBFA 1ORHA 3IXQA 4DCJA 1NOKA 2XNHA 2QG4A 1KJ8A 1RCUA 3M4ZA 4YRRA 4FCTA 4XASA 3JVDA 1N6KA 1PNQA 2ERXA 5BSTA 4U00A 1OLOA 2B6NA 3O26A 4I1IA 3SGLA 2Y92A 3TLYA 5H83A 3PJEA 4PN3A 3WYGA 1BDMA 2ORWA 3BGVA 3GOHA 2WTEA 3K9GA 4HFMA 5G3YA 1EGHA 2H4YA 4B44A 3QNMA 5IKPA 5KSYA 4QYSA 1O1YA 3TCKA 2BZGA 3JVEA 2F3RA 5CM2Z 3KWJA 1X1AA 4HDQB 2IYZA 5FB3A 1E5TA 2GJSA 5ALUA 2ZUTA 4AJOA 1VKHA 2RG7A 3RAJA 2PFSA 3MT8A 2QDKA 3PG5A 4WK6A 4YBZA 2HO5A 4YXFA 5HRAA 2GXQA 3A32A 3GDWA 2G5TA 4QXMA 2EU8A 5F2EA 3DWFA 3OQNA 2ZG6A 4EHJA 2R7KA 4YLEA 4O1HA 4TLMB 1X7YB 3PQ4A 1T1GA 4O02B 2B5WA 3NOQA 4C7MA 3ZDRA 1WXHA 3W8FA 821PA 3WWEA 2NYVA 4QGBA 1TAHA 5AFSA 4F3TA 1HLDA 3JWEA 4KPUA 2NYRA 2JLSA 2XWBF 3K2QA 5JASA 5A3VA 5FTKA 1BNCA 3Q5DA 5F1KA 2NVUB 3KQQA 5EZYA 3LKVA 3RF6A 5JCOC 2JC3A 4Q48A 2QN3A 1O03A 2OY0A 1FL9A 1P0PA 2QLJA 3EW7A 5JW6A 1CQZA 3LVQE 3SM3A 3ZHUA 1Z0DA 5FL3A 1USUA 2FPRA 1SKYB 2KJQA 1P5FA 3U7IA 3GLIA 1W4AA 2P9TA 3STYA 2H54A 2FV8A 3LUAA 3JYLA 2O8BA 4DNPA 1M1XB 3ZCQA 1Z18A 2IEZA 3PJDA 6YASA 3I8OA 3K8YA 3DDHA 3AHFA 3C7DB 3DOUA 3HJTA 3CF6R 3DXFA 3S0JA 3HN7A 3IAM6 1KYIA 4EX7A 1CJSA 1P7ZA 1V71A