2IX9A

Respective role of protein folding and glycosylation in the thermal stability of recombinant feruloyl esterase a
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
260
structure length
260
Chain Sequence
ASTQGISEDLYNRLVEMATISQAAYADLCNIPSTIIKGEKIYNAQTDINGWILRDDTSKEIITVFRGTGSDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISVQDQVESLVKQQASQYPDYALTVTGHSLGASMAALTAAQLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPAEQGYAHGGVEYWSVDPYSAQNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTSGACTW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Respective Importance of Protein Folding and Glycosylation in the Thermal Stability of Recombinant Feruloyl Esterase A.
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
molecule keywords FERULOYL ESTERASE A
total genus 97
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 3.1.1.73: Feruloyl esterase.
pdb deposition date 2006-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ix9A00
1SCQA 1XRNA 2H7CA 5CH5A 2O7RA 4OYYA 1CUXA 1CEXA 5A7GA 3WLAA 4G4GA 2CMFA 1O6GA 3HJUA 1R88A 5A62A 2VA9A 4GWLA 3I2JA 3IUNA 1AKNA 5AOBA 2RHTA 3JWEA 2XMRA 2OXEA 3IBTA 1MAAA 1EK1A 3W06A 3L1HA 3R3VA 3GA7A 1MNQA 2WU4A 4BCCA 2ECFA 2ZJ6A 3LCRA 1QIGA 2Z3WA 4QWWA 3HABA 3HI4A 4L9AA 3VJKA 4RGYA 1EK2A 4LYDA 1CQWA 1LPBB 3ESCA 4DMKA 2ORYA 3SWWA 2CEKA 1ACLA 4FLFA 4OPMA 4G8DA 5HF9A 3AILA 4QDOA 3O9VA 1QIMA 4X6YA 3C45A 1LGYA 1ZIYA 2QS9A 2P8SA 1UKCA 4CIAA 4QDZA 1LPOA 1CQZA 1YASA 5DWDA 2W22A 2WHRA 3FVRA 1S8OA 5AKHA 2ZSIA 2XUFA 3DS8A 4ZRDA 2H7XA 3T52A 5K3DA 3I2FA 4PO3X 5BWBA 1QIJA 1OILA 4KAAA 2VAVA 2XQIA 5LZ2A 2PUJA 4C6HA 1QE3A 4HTAA 4W1SA 2WIGA 2Q0XA 5AI9A 5IVIA 3O95A 4A16A 5AI8A 4AO7A 1XROA 1CUHA 3V1LA 3QH4A 4DM7A 4DTCA 3DKRA 1U65A 1GPLA 3WIOA 3ZV7A 4HAIA 3D0KA 3BL8A 5AM0A 2WLSA 2HA6A 2WIFA 1CUJA 2ZYRA 4TPKA 2CJPA 4C4XA 5JALA 1SFRA 1J2EA 1A88A 2BCEA 3O0DA 3E4DA 2YASA 3KWFA 3I6ZA 5F4ZA 1QO7A 1PV1A 4DNQA 1MO2A 2I3DA 5ALQA 5EIHA 2VATA 1A7UA 1MX1A 4C89A 3FCYA 1QIIA 3IVMA 2WIJA 2IX9A 4FNMA 5K5EA 2JGMA 1F0PA 1PFQA 3I2IA 1EB8A 4DIUA 1P0IA 1YB6A 2Z8XA 4Y2YA 2PU5A 3FSGA 3KXPA 2W6CX 4UBOA 1LZKA 1H22A 2XQKA 4BC0A 5A71A 4HRYA 5AK5A 1YB7A 1K4YA 1R9NA 4DSZA 1YAJA 2XMBA 5BV7A 3FAKA 2H1IA 1XZMA 3EQ8A 4JYMA 4PSDA 2XUKA 4KAFA 3Q8WA 5K3CA 2IITA 4UHHA 3DEAA 1IZ7A 4OSEA 3IUMA 2B20A 2O7VA 4B81A 3UUFA 2QTBA 4W1PA 3FCXA 2HM7A 4P93A 5LLSA 2J4CA 3TGLA 4Y2QA 1JMYA 4LKOA 3HC7A 2Z3ZA 3N2ZB 5ALJA 4E46A 2VTVA 1EH5A 4BBZA 2WU3A 1QTRA 5D7BA 5HF8A 1XFDA 5DYYA 5ALVA 3WYNA 2DHCA 3WK7A 5ALKA 5CTAA 2QT9A 4YPVA 1IUNA 2GYWA 3DL4A 1F0NA 4QE3A 3M83A 3IUQA 1SCKA 3QMWA 5EHXA 5CBKA 1CUSA 3STYA 5CH3A 1X2BA 1CR6A 1DU4A 1YS2X 5CRIA 4C87A 3BF7A 4H7HA 5CMLA 5I9IA 1JU3A 4J3JA 5I7UA 4MEBA 3C5VA 2H7YA 4X85A 5EIAA 3V9AA 4YX9A 5AJHA 5AIAA 4K6GA 5J3JA 2C58A 2BFNA 2G5PA 5FRDA 3WJ1A 3H04A 2FJ0A 5A2GA 1T4MA 2AJBA 4Q3LA 5ALTA 3QITA 1WOMA 1XZKA 1KU0A 1MN6A 4QDTA 3PUIA 1CUCA 1EXWA 5JZBA 4X71A 5ALUA 2IIVA 1Y7HA 3R3XA 4EY4A 5JARA 1XZHA 4BYMA 3TEJA 2ONCA 1UWCA 3I28A 2WIDA 4F60A 5H3HA 2PSEA 1LPNA 2D0DA 4FBMA 5AH0A 1Q84A 2QMQA 1IUOA 4OD0A 3IIIA 5SYMA 1CLEA 1TCBA 3CN9A 5DTJA 4NMWA 2J3DA 4HRXA 1FSSA 4GW3A 1E5TA 2VEOA 3WKEA 4Q1VA 2HADA 2JGJA 2FX5A 5EI5A 4DNPA 2BUBA 5EGNA 4OYLA 3H2JA 4GDMA 3LP5A 4QDUA 4ZWNA 3STUA 3G8YA 2XUOA 4KR0A 4QLOA 4CFSA 1D07A 5AKJA 5AOAA 5K3FA 1W75A 3P2MA 1VXOA 3FOBA 1AX9A 5AK3A 4KE7A 3HRHA 5JIBA 4J0CA 2OLEA 1MPXA 3L1JA 3WWPA 4LIPD 1XRRA 2OPHA 3M3DA 5AM3A 3PF9A 1Q83A 4HXEB 3F67A 3H2HA 4ITVA 4I4CA 2HA2A 4L0CA 3VVLA 3D3NA 4K6KA 1CUDA 1LBSA 3HEAA 3ICWA 2XUGA 5FV4A 3BXPA 5EHZA 2XUHA 4AN0A 2WFLB 1QIHA 1EDEA 1AMNA 5HCUA 4FLEA 2OCGA 1XZJA 3QYJA 1VKHA 3CXUA 5AM4A 4DYHA 4WFJA 1H2YA 2C5GA 1QO9A 3W2TA 1BCSA 2HA7A 1MX5A 3G9UA 5SYNA 4OB7A 1E89A 3SC2A 5LZ5A 4B9EA 4CG2A 5KWIA 4ZI5A 2OCKA 3G7NA 3WKAA 5A7HA 2AJLI 5EFZA 2G63A 1SCIA 3G02A 4DSAA 2DHEA 4KE9A 5IVKA 2H9YA 3OG9A 3V48A 2QXUA 5C8XA 3VJMA 2OAEA 4X93A 5JZ9A 1LPMA 3F96A 4L3WA 2VJBA 5LZ9A 3CCBA 2XUPA 2XLBA 1XZGA 3M81A 4KJXA 1N5RA 2WM2A 2VJDA 4Y2XA 1XRPA 2OGTA 4MXDA 1HLGA 4E14A 4X97A 3OURA 1GKLA 4JH0A 3G9XA 1W76A 2WG0A 1K5PA 3DYIA 1Y37A 3STTA 4BB0A 5JAPA 3K9BA 3WQHA 2XUIA 3ESAA 1RYYA 4PSUA 5AICA 2GYVA 1BS9A 1WM1A 4B80A 1ZI9A 2CKMA 2EDCA 4FFWA 4RE6A 1ZGBA 4EY7A 3RLIA 4U2GA 2E3JA 2HA3A 1CVLA 4HS9A 4M0MA 5AOCA 2PKYX 3IURA 4UBMA 1ORVA 4MYSA 2XI4A 3BJMA 1WPXA 5FDFA 2G4LA 1XZAA 3D59A 1ZOIA 3E1GA 5ESRA 5DLPA 5CURA 1RP1A 3WK6A 5AKYA 4XWGA 3VXKA 4DMFA 1SC9A 2QUBA 4ZV9A 1CUVA 2GZRA 5LZ7A 3NUZA 2WKWA 3V1MA 1IMJA 1GT6A 4OCZA 4UBKA 2D5LA 3K2IA 2V9ZA 2FUKA 4LXGA 1ETHA 5AKXA 2C4HA 3FSGD 1M33A 3H18A 1LBTA 4K6HA 1UK8A 4JYPA 1H2XA 5AKEA 5HKAA 4PSCA 1W6RA 2OQIA 1P0MA 4WFKA 3ZWQA 1YR2A 1K63A 2HA0A 2Z8ZA 2QVBA 2PM8A 1T2NA 4P08A 2BJHA 4X90A 2HFKA 2UZ0A 4DMCA 5ALZA 3I2HA 3DL7A 5E4YA 1QOZA 5T4BA 2I3ZA 5ALHA 3ESBA 3C6ZA 2RIPA 4BZWA 1CRLA 1JJBA 1JJFA 2QR5A 4H7JA 3STWA 1R50A 1JJIA 4AZ0A 3E0XA 1QIDA 1MJ5A 2JBWA 4CCYA 4GEGA 1LZLA 4C88A 4BATA 5IVDA 2WTNA 5T4FA 2G5TA 3JYHA 4BRZA 3ZLVA 2FJPA 4FKBA 5JASA 1VLQA 3C5WP 1FFCA 3WZMA 2ROQA 4KACA 3G9ZA 1P0PA 4LXHA 1VJ5A 4AB1A 4QA9A 1HDEA 3BIXA 4XJVA 4PV7A 1E8MA 1EVEA 5AKKA 2J4FA 1VA5A 5ALPA 2Z5GA 1A8QA 3AZQA 4Q34A 1L7QA 1MAHA 4W1QA 2QRUA 3HYSA 5JANA 4UBJA 2ZYSA 5LZ8A 2XDWA 3WA7A 1CUBA 4INZA 2LIPA 5CT5A 5HK8A 1E3QA 4BE4A 1DWOA 3GZJA 5AO9A 1EDDA 2RAUA 4BVLA 1CUGA 2OCLA 5JD5A 3DJYA 5KWJA 3I2GA 4H7KA 2VT7A 2RHWA 4HXFB 3WKBA 2AJ8A 4J0IA 3WK4A 1VZ3A 5CT9A 2PU7A 2WILA 2QJWA 1QIFA 4X3CA 1P0QA 1QFMA 4QZVA 3A2MA 4LXIA 3KD2A 1R1DA 4H35A 3LLCA 3AJAA 1VXRA 5DYTA 1LLFA 2Y2VA 5DYWA 1CPYA 5DJ5A 2YYSA 3QM1A 2GZSA 4QNNA 2BUAA 4F21A 2HDWA 5AI4A 4H7IA 5AM2A 2X76A 4ARAA 4OUKX 2HA5A 3E3AA 3PE6A 4EBBA 5C81A 5BWCA 3G9TA 2GBCA 2PSJA 5I8PA 1E8NA 5ALEA 1FFDA 2R11A 2XQJA 1L7AA 4AMZA 2DCMA 3RARA 4RE5A 3PFBA 1ZJ5A 1EB9A 5CXUA 1CUEA 3H2IA 4AZ3A 3GFFA 2C0PA 1U8EA 4MEAA 3QBJA 2BGRA 4Q3OA 4WDRA 3AIMA 4HXGA 4BAUA 1ZD5A 2RI6A 1ZI8A 1QIKA 1DT5A 4B9AA 1J1IA 1ORWA 2YXPX 2WFLA 3O4IA 4J0HA 4L72A 2WFMA 1X2EA 1C4XA 3WK5A 5FPQA 2CZQA 3PDCA 1J07A 2DQYA 4MWTA 3DKKA 4G4IA 2J3QA 1W52X 3R3YA 1G5FA 1XLUA 3O4GA 1XQWA 4QWMA 3AZPA 4MQLA 4KYVA 1UK9A 3UMJA 3X3HA 4BDTA 3ANSA 4BCDA 1JKMA 2OAGA 4MJ3A 2GYUA 1J06A 4Z49A 4G1FA 3YASA 4JUIA 3RK4A 1JU4A 5HQ3B 5ALWA 3GBSA 4XX1A 1E66A 4Y2VA 4I3FA 1CV2A 2AJDA 2K2QB 2OGZA 3G0BA 1UK7A 3R3ZA 1XZEA 4EY6A 2V96A 3I6YA 6YASA 2CBGA 1EX9A 2HU7A 4FDMA 5FUMA 2HA4A 3M82A 5JAOA 4AMYA 3EBLA 3G0CA 1IVYA 4OB6A 3HSSA 4U2FA 1FFBA 1XRMA 3T4UA 2DQZA 1GXSA 2X8BA 3D2CA 3V1KA 5HZGA 4AN1A 1XQVA 2PPLA 3CN7A 4YK7A 3W05A 1LNSA 5FOQA 4UBNA 4BAGA 5AKGA 1AURA 2Y6UA 4G8BA 2XQFA 1I6WA 4BVKA 2CUTA 2JGIA 5ALSA 2QZPA 2O2IA 4FLMA 4EB0A 4PF1A 5ALNA 5AM1A 5ALMA 2EDAA 5AI5A 2HU8A 2PVSA 2ACKA 2JGKA 4EUSA 2C0QA 4N5IX 4AQDA 3C87A 4U2EA 3VJLA 2WFZA 2BGNA 5HQ3A 5LKAA 4CCWA 1YCDA 5CXXA 5DNUA 3DOHA 2CB9A 3FYUC 3FYUB 1MNAA 3DQZA 1XLVA 2QOEA 3W9UA 3A6ZA 3STXA 4N8EA 1FFEA 4M0FA 1CIJA 1ZI6A 2JEYA 1EINA 3BE8A 1B41A 2XUAA 3WL5A 4IH1A 3FLEA 3WJ2A 3BDIA 4C4YA 4X91A 4BZZA 1G66A 4O08A 3OM8A 1DQZA 1ZGCA 4PQEA 5EHQA 1O6FA 4EY8A 1DX6A 1YA8A 1K6EA 1MU0A 4IH9A 3AFIA 5JAHA 4P9NA 1THTA 1CUYA 2XUJA 4X6UA 1NX9A 4J03A 4RPCA 1EVQA 4NS4A 4BC1A 2YH2A 2PL5A 2VF2A 1XZFA 3SX4A 4K5QA 1MTZA 3F98A 2XQGA 4UBIA 4DMHA 4XVCA 3L1IA 1F8UA 4FTWA 1UXOA 3I1YA 4B84A 1BU8A 4KRXA 2JIDA 4HZGA 4G4JA 3VKFA 3BJRA 3IB3A 2WHQA 4Q82A 2HFJA 3WIBA 5AKZA 3VVMA 4WJLA 1EHYA 4Y7DA 1XZLA 1DWQA 1AQLA 2GBIA 1DINA 4Q05A 1ZICA 4AO6A 4X6XA 1GKKA 1A8SA 3WMRA 4JNCA 2V98A 4H7EA 1E8DA 4UHCA 2JGEA 2ZJFA 4GLBA 3AIOA 1U4NA 5JD4A 3B5EA 1DQYA 1QLWA 4EY5A 3A70A 4LHEA 3C6YA 1A8UA 4ZV7A 2XUQA 4J7AA 3R0VA 4UHEA 1UT6A 3AIKA 3FNBA 3LIPA 3IDAA 2OGSA 4CCYB 3TRDA 3U1TA 5JADA 1AUOA 4DLNA 1TK3A 4UHFA 1Z68A 4U2BA 3ZPXA 2GBGA 5CT6A 1VA4A 3PICA 1YSCA 4BP8A 1UOOA 3SK0A 2DHDA 3VDXA 5LIPA 3G0DA 2ZYHA 2GBFA 4W9RA 4P92A 1GQRA 3WWEA 3A2LA 4IO0A 4UHBA 1QTIA 4C4ZA 2ES4A 1H23A 5DNVA 2HRQA 4J0JA 3S8YA 2BKLA 1DWPA 4I19A 4N8SA 1C7IA 2JGLA 5ALXA 3N0TA 1BROA 4OU5A 3JW8A 3NWOA 3Q0TA 2VQ6A 1Q0ZA 5JD6A 2XT0A 1XKTA 2PSFA 1XZBA 2C5FA 3H1AA 4DGQA 3QZUA 3BDVA 5K3FB 3IUJA 1MX9A 3HLKA 1LPSA 1ZD2P 5K3AA 1JT2A 2ZSHA 4MQMA 1ZD4A 1TCAA 4FFVA 4H7FA 4OU4A 3S2ZA 3WK9A 5IH7A 2WUDA 2AJCA 2QUAA 4G9EA 3MUOA 5HFNA 1IZ8A 4WDQA 4Y2PA 3PFCA 3V1NA 1NU6A 3D2BA 1VZ2A 4FWBA 4GHWA 4C01A 1UK6A 1LPPA 4BCBA 2B61A 3C6XA 3WWCA 2OCIA 4QEKA 4U2CA 3D7RA 4H77A 1N8SA 3R41A 2XUDA 4IQ4A 1WB4A 2BUCA 3RM3A 3DD5A 4UPDA 4OB8A 2JEZA 5FKJA 2X5XA 2O2GA 5FPPA 3F8SA 4CG1A 4PNZA 3O4JA 1Y7IA 2HU5A 2ACEA 4EHBA 5AKLA 1GPKA 3TJMA 1WB6A 4W63A 5C8ZA 3FLBA 1YAHA 5ALFA 4TVKA 4QDXA 1XQXA 3FWHA 4X00A 2VAXA 1OCEA 1WPRA 5FLKA 1WHSA 1BRTA 3WYDA 3I6MA 1C7JA 4WY8A 3K6KA 3GUUA 2R8BA 3F97A 4U2DA 3LS2A 5YASA 2VSQA 4KEAA 2C7BA 2Y6VA 3HACA 3R3UA 4CG3A 3NGMA 1CFJA 5JYCA 4WCVA 3QMVA 5A7FA 1EDBA 2PUHA 3DOIA 5K3EA 1BN7A 4CI9A 1VE6A 1KU6A 4ZREA 2QJRA 1G42A 4NZZA 1EA5A 3WL6A 3MUNA 1ISPA 2DSNA 3WK8A 5AM5A 3H0CA 4B85A 4G8CA 2PSHA 3H17A 3CCCA 2PSDA 1XRQA 2QM0A 3PUHA 4X94A 2XMZA 4BE9A 5ALLA 3EIOA 5LP1A 2XMQA 1UFOA 1N1MA 1ODCA 5C8VA 4ZXFA 5AK6A 4XIIA 4WY5A 4B82A 4UFNA 1U2EA 2NW6A 3AUKA 1QFSA 3BIWA 3QPCA 1YS1X 3ZLTA 1G4HA 3KOOA 4YASA 1BN6A 3ANTA 5HFAA 2RONA 1JI3A 4ARBA 4FHZA 3KSRA 4HVTA 3PF8A 3D5EA 3I1IA 3FLAA 4N5HX 4UHDA 1EI9A 4GI1A 1UKAA 1THGA 5KREA 5AP9A 3QVMA 1B6GA 3OTQA 1WB5A 2V97A 3UUEA 4PW0A 3RKSA 3DDUA 4FNGA 4UBLA 1ODTC 1N5MA 4FOLA 2XMSA 1FFAA 3HXKA 5E4TA 4BTVA 1WCYA 3FYUA 1F6WA 3WWDA 3QMMA 4AXBA 3LIIA 1HL7A 1QZ3A 1QGED 3C6BA 3WL7A 1XKLA 2WHPB 4N8DA 2Y1KA 1R3DA 3QPDA 4K2AA 2AXEA 2BAGA 1AC5A 3PI6A 4UUQA 1XLWA 5DNWA 1CUFA 5AIBA 2PBLA 5AI6A 1TKRA 4W1RA 3W04A 1OXMA 1XRLA 4KAJA 3IULA 3WWOA 3WKCA 4H0CA 5ALIA 2WJ3A 1H2ZA 2WUGA 3W9BA 5AI0A 4Y9SA 1XZDA 1JFRA 1H2WA 5AHXA 1USWA 3D2AA 1Q0RA 1W4LA 3ESDA 5EHNA 1DX4A 2ZJ7A 4EA6A 5HF5A 1GZ7A 5C7YA 1DT3A 2OQVA 2WUFA 5BOVA 2WUEA 4WFIA 3ZI7A 1R4ZA 1ODSA 5ALGA 3ED1A 1W1IA 1QJ4A 2WIKA 1QIEA 4E15A 2DR0A 2RGUA 2HL6A 5T4HA 5LYYA 5HF6A 4B6GA 3WKDA 1UKBA 4BVJA 1TRHA 3QPAA 4Y2UA 2OG1A 1PJAA 4FMPA 3AZOA 3FVTA 2WHPA 1BCRA 1HBJA 4DNFA 4Y2TA 1LPAB 5DTIA 4MWSA 4BDSA 3KWJA 3R40A 2EEPA 1BEZA 5JZSA 4B83A 1UOPA 4BAZA 3MVEA 1AGYA 2JGFA 5T4EA 1YA4A 2WJ4A 4Y2RA 1XZCA 1TQHA 3KDAA 5D3KA 4KE6A 4EZIA 3C8HA 5K3BA 4G9GA 1ZD3A 5IVHA 3DNMA 4AO8A 3AINA 4X92A 5E2IA 5JATA 2QXTA 4KRYA 4B7ZA 1MT3A 1R9MA 2B9VA 4G5XA 1BE0A 3I2KA 4Q3KA 1SOMA 4GBGA 1IUPA 3BF8A 3H2GA 2I03A 1XZIA 5ALRA 1GQSA 4BRSA 4DNOA 5LKRA 3OPMA 3H2KA 5EIEA 1ZJ4A 2VT6A 5ISMA 2WSLA 3R3WA 4ETWA 3ICVA 3VISA 4B0OA 2XMGA 3B12A 1CUIA 2DFPA 4NVRA 2QKYA 1WHTA 2XMCA 3IA2A 1HPLA 1VE7A 2O2HA 1XQYA 3ILSA 5ALDA 2HHAA 4B0PA 5AK4A 5ALOA 4A5SA 3U0VA 1HQDA 1VOTA 4Y2JA 4X7BA 4A23A 1X70A 4J0GA 3O9MA 2WG2A 1FJ2A 2XMDA 3EF3A 4ZGBA 1JMKC 4UFOA 2VJCA 2PX6A 3G0IA 7YASA 4F5ZA 4GXNA 5JAUA 1UZAA 5IKXA 3WA6A 4M0EA 5CH8A 4RNCA 2WTMA 3EQ7A 3DYVA 5AKIA 3OC0A 5CW2A 3B3QA 4IHAA 4MYDA 1CUAA 3BWXA 4IH4A 2HRRA 4CIBA 4S0XA 3NOXA 2Y2UA 5CT4A 1AZWA 4F0JA 2WG1A 1CUZA 1CUUA 1NU8A 4LYEA 3STVA 3GELA 3GROA 5FP0A 3C8DA 2ZYIA 3HZOA 5CT8A 1KEZA 2WJ6A 3DLTA 4V2IA 1TCCA 4X95A 1TAHA 3EQ9A 5A6VA 1L7RA 2ZVDA 4KE8A 3DCNA 4E11A 3C43A 5D3ZA 1UOQA 4ROTA 3WI7A 3F9CA 4J0DA 5LZ4A 1DTEA 2XLCA 2JF0A 3C70A 3WZLA 5D6OA 5ALYA 1TIBA 1K8QA 5KBYA 1BEEA 4BTLA 4FBLA 4BP9A 2VJAA 1GGVA 1ACJA 1CUWA 3ZLUA 3FYTA 3A2NA 3OOSA 4H18A 5HK9A 3FBWA 4AX4A 1GPNA 2HIHA 2WQZA 4GECA 1QONA 3WL8A 3D4LA 3MGAA 2I78A 4TGLA 3H19A 5HKBA 1RWQA 4J0KA 4QLAA 4D9JA 3O4HA 4Y2SA 4JEIA 4UFPA 2XB6A 5FXMA 1ZIXA 5E4JA 2XE4A 4H7DA 2B4KA 3H1BA 1HKHA 3G0GA
chains in the Genus database with same CATH superfamily
3DQQA 4V02A 4U0JA 1PV4A 2Q07A 3MILA 1ZWLA 5GP1A 4YAOA 3PHHA 2WWWA 1Z6PA 4UQOA 5DHRA 4CU5A 1WV0A 2IPOA 3C3DA 4OYYA 4XFJA 2X5NA 5FPYA 3LLMA 3P52A 4V38A 1NSTA 2C9OA 3IVAA 1FVOA 1NM5C 4CV2A 5DT2A 5A7GA 3T3IA 4PVDA 1PE0A 3JYNA 1P6XA 3HJUA 1R88A 5F9MA 1ZSVA 1Y8QB 1N0VC 4ON9A 1IY0A 1PT8A 4BNHA 3VNVA 3A9SA 3G5MA 3ZX4A 4F3TA 3EODA 4MI1A 5AOBA 2H31A 3DE0X 5DN6D 1PDWA 5LN1A 1NAHA 2BE9A 5GGXA 4LS3A 2XMRA 4EFLA 4EO4A 2OXEA 4N49A 1EK1A 2A14A 3B6EA 1I5EA 3Q7EA 4O63O 3F5MA 2M2IA 3K15A 3D3QA 2VDUE 1REQB 3T35A 4BE7B 4KYTA 3ZD8A 5HGXA 4V0RA 1Q0LA 4WUVA 4YIHA 1F4PA 1P2VA 4CXMA 5I9LA 1M6VB 4DJAA 2ZGVA 3T1YB 3IRVA 3GN2A 3LQQA 3D7KA 2F4NA 4MPPA 1YNOA 4YECA 1H65A 3FRIA 1ODFA 5HIMA 3KQHA 4BCCA 1ZCZA 2J09A 5G0TA 2ZJ6A 4BO5A 4QOIA 2AE2A 2PBFA 1QIGA 1VMDA 4JWTA 4FI3C 4Y30A 5B3JA 2R84A 3HABA 2GEVA 1L4HA 2B0JA 5F33A 4RGYA 5A5GA 3PHLA 3U1VA 4EYQA 1IN5A 4G5QA 4G89A 1LPBB 4H60A 5TF4A 3SWWA 2FQWA 3Q3VA 1ZR2A 4G0QA 4FLFA 4ZKDA 2H54A 4XZ3A 3WRYA 1RRFA 4B7AA 3DBLA 2ZCJA 1KFCB 1J2UA 4G8DA 1FXUA 2RJOA 4PCAA 5HF9A 5BOSB 5A1JA 3OMLA 2PAFA 1ZP6A 2Z8YA 4XWKA 5IJ9A 1FDIA 1QIMA 2NSLA 2EFGA 1UM9B 3QBDA 1KZYC 3QWIA 4RIFA 5B7QA 4DV0B 3A9TA 3PL5A 3CNLA 2WM8A 4L9SA 1YQGA 2JZCA 3RYHB 2FGKA 2F7SA 2WICA 4KZKA 2CXPA 3IQEA 4L5CA 1HNWB 3FTFA 5AVTA 4CLDA 4PFQA 5DYNA 4MMYB 3TIGA 2P4UA 3PUJA 1RXIA 3H8SA 2FRDC 1GA1A 2WYIA 3FCCA 4RTMA 3ZYCA 3JQ9A 2PXXA 1O94A 5KC8A 1U04A 3BXHA 4R7TA 2C00A 4ZQHA 4DLUA 2G5CA 1IUKA 1SC6A 1ZXLA 2DPYA 2WHRA 3FUVA 1B8VA 1RT9A 4Z3DA 5TVKA 1MABA 4L2IB 2IUEA 2NZWA 2OTCA 5AKHA 2FW1A 3RPEA 4YTEA 3VOTA 2ZSIA 5K3SA 3RJTA 4IWXA 3V6LA 1JEYB 4HX2A 4MIKA 5KSWB 1E20A 1QAQA 4CKEA 2VHUA 3GR6A 4KXWA 1R5OA 1TK2A 2HBZA 4G5SA 4YAJA 3TMAA 3F90A 3V7WA 2RHDA 3RYIA 5DHTA 1ULTA 2PH5A 4NNPA 4LCBA 3IMEA 5EINA 5F51A 2OPBA 2R9VA 1DNPA 4EG8A 3U60B 4DLAA 1QANA 2ZYTX 2K4MA 1U0BB 1BYIA 2DEUA 4GP6A 3C4QA 1Y7LA 2XQIA 3UIEA 2X41A 2C57A 4UPVA 5JPDA 1LFAA 1T0IA 2Q1WA 1T9ZA 1TECE 3C6MA 2WZDA 3R6TA 2RG7A 4MI3A 1JTFA 4AWXA 5G4LA 3KHKA 5J4YA 3AFMA 2MR5A 3CT6A 1GR1A 3TNFA 2PIAA 3VDRA 3UYKA 3HFGA 4LSWA 2VHTA 3X1MA 2GARA 4TMFA 4MUYA 1P6QA 2R1VB 4B47A 1QE5A 3NIFB 3WP0A 2WWXA 4Q37A 2VDJA 3LUBA 1PNOA 3JRXA 3GT7A 5CGZA 3QH4A 2Q4DA 4QGFA 1PDVA 2VHCA 4UOQA 4YJDA 2IODA 4YY3B 1CC1S 4FX2A 5K05A 5ILGA 1GJRA 3UANA 4QU8A 4GIBA 5AM0A 4IILA 4L5IA 1HEYA 3TE7A 3UUGA 2R6HA 4TTJA 2CLSA 2VKQA 3GU3A 1FFYA 1D4OA 2ZSDA 3R77A 1PO7A 3RB8A 2WE8A 5K51A 1N9KA 4ZA2A 2ZYRA 2X4IA 3FAZA 5ENVA 1GAJA 3ICCA 3AP2A 2EJVA 3QOFA 1V8DA 1CQIB 4D81A 4LK2A 5CDYA 1NBMD 1KRXA 2WKQA 4N5LA 1E1RA 4HVLA 5A5DA 1QRDA 3PDJA 3FIJA 2CXHA 3E4DA 2X19A 3GJXC 2D7CA 1SU4A 3ABIA 2I7DA 3TOXA 2G1KA 5F4ZA 2NPFA 3RNLA 4DNQA 2P2DA 3ZZMA 2ZIUB 3M1YA 5ICCA 1Z47A 1KVSA 2SCUA 2IEIA 3UN1A 3E53A 1A7UA 1MHTA 1PSWA 4JU9A 3O1HB 4JI6B 1TGVA 1JHQA 4Q16A 4U39A 3LYLA 5E9WA 1SKYB 3AEQB 3NBUA 2V1UA 3VX4A 5FTMA 5KAPA 1C3EA 1QCDA 1C2YA 2IX9A 2WTAA 3D0RA 5TY0A 2JGMA 3SXPA 1F0PA 1LSJA 3I2IA 4QDKA 1WMFA 4IDFA 3GFQA 4ER5A 2XEXA 1JEYA 1XMIA 3K72B 3VPXA 5BSUA 1FSPA 1YB6A 3N0RA 1EFPB 4GE0A 4Y2YA 2A5DA 1N9GB 1XEWY 3DCYA 1IH8A 2IEDA 3EXIA 4ZVMA 4PO1A 1IAVA 3IELA 2W6CX 3ZQ6A 3ZDQA 3Q41A 2OBYA 3KBOA 1KSGA 3RVDA 5JTTA 2BEKA 1UZUA 3GLHA 4H3KB 2WD7A 2XQKA 4NIMA 4YQYA 5A3QA 4CCSA 2V4UA 4OL0A 5KTSA 1NNSA 3WLLA 4JT8A 2VKTA 4KTVE 3U3OA 3VU9B 5AK5A 1S8FA 4E31A 1ADCA 1K4YA 1P18A 1WCXA 5JE8A 4RYDA 2OHVA 3Q8MA 3W2HA 3MJ4A 4DABA 1BMQA 1W85B 1H3FA 4F91B 4NBKA 4XGRA 5BQPA 1RACA 3FAKA 5LA6B 3ZU5A 5JYBA 4CEIA 2JI6A 4IDBA 2XUKA 3ZN2A 5AK0A 1G7TA 1EAYA 1TUGA 4JUFA 4F46A 3OH8A 3Q8WA 4D1YA 5KTOA 4GOOD 3D6JA 4L15A 4YAUA 3RRFA 3GT3A 1PUJA 2H11A 2P3QA 1XALA 4UE6A 5H5JA 3FRJA 1WWKA 4DLKA 4BQNA 2KB0A 4JV5B 2HSGA 3BORA 1MG0A 4YJGB 1E3IA 2HSJA 5JDCA 4TV8A 2VDVE 3O3NB 2OHHA 3PDUA 4W5JA 3HO8A 1RWPA 3UUFA 3DTVA 1J8FA 1DKUA 2ADMA 4Q1EA 1OFGA 1V7ZA 1W44A 2CNKA 2A4KA 2PL3A 3DEHA 4QGHA 2O8FA 3B2EA 3WE7A 2AZXA 5BN3B 1HE8B 1V6AA 5EWLB 3PUKA 2JCYA 3F71A 2ONYA 1JMYA 3K70D 1M2VA 2GGSA 2GOYA 4M53A 3HC7A 3Q7SA 3NONA 4ENWA 1UL1X 2QU7A 2MJLA 3JYQA 3INRA 3PGXA 2PH7A 4DUGD 2X14A 1L9XA 2BFDA 5C8DA 1ESEA 4RTJA 2ZE5A 4N41A 4U6NA 3GVCA 2NQTA 2P9TA 1KYVA 5FUXA 4IUYA 1JR4A 1HE2A 5F77A 5HF8A 2HK9A 3G2HA 2M1ZA 3FTPA 1M10A 1XFDA 5ED4A 2IFTA 4RXTA 3WIVA 5DYYA 5SY4A 5ALVA 4MR8B 3WYNA 2Q45A 2OHGA 3WK7A 2XTNA 2NX2A 5DT9A 3T12A 2YZNA 5ALKA 3OQIA 1SEPA 4QBIA 2AOTB 2D8MA 4YPVA 1IUNA 3ZY2A 3KU1A 3CVWA 2ZJ5A 1WCV1 3KV1A 1DELA 3FNRA 1JEJA 2B35A 3FTCA 4PXYA 1SCKA 1DRWA 3EEIA 1Y48E 3QMWA 1AGRA 2AUNA 1EUDB 1U80A 4YPFA 5CBKA 3W3AD 5DM2A 3STYA 3SSNA 4BO3A 5BV0A 4TLEA 1H4TA 5M7EA 4MCHA 3INNA 4YLYA 2ID9A 1JZTA 2I8LA 4JDUA 3WGUA 1JIJA 2YVKA 1Z7BA 2XF2A 1XDGA 5LBIA 1J23A 1R64A 4BO2A 1PVOA 3HB7A 3H5LA 2CYBA 3PGVA 5JNUA 3KSMA 5A4AA 4FZVA 4J3JA 1IQ0A 3VYTB 3BWYA 3DBHB 4TKVA 1VCMA 2W2VA 2OLJA 4FFDA 1Q1GA 2HJVA 5DU2A 4GT1A 1EVIA 1GDHA 3P0FA 4Y3UA 1PSZA 1SKYE 1XJCA 2PHZA 4GLLA 3WYGA 1KOFA 4NCAA 4F6RB 1CQXA 2ZSFA 1M1NB 3N0VA 5EKSA 4GKVA 1PNVA 1JDSA 2QI9C 1TVMA 2VDQB 3V9AA 2QQGA 4C1BA 2VTKA 2AKYA 3QELA 1ZMTA 4WN9A 3KQVA 4M1KA 1PNRA 1VHLA 2I4OA 2Q50A 2WVJA 4MWCA 3DWGA 3DXYA 4GR5A 2COKA 4TM8A 5MFPA 4CLRB 3AP3A 3WLHA 2XSZA 2ZQZA 5FRDA 1W29A 2D3WA 2FJ0A 3DVQX 2G7ZA 4M9SA 1E5XA 3NMUF 2ZI7A 2AJBA 1SR8A 2SECE 2QL5A 4PTYA 2IQIA 4Q3LA 5CX1B 5ALTA 1WOMA 5B37A 5BN3A 3E7WA 4NK4A 1HM5A 2J41A 2ZSKA 1TJ4A 1FIUA 1CE8B 1G19A 4K9KA 3U3XA 1KU0A 1KJWA 1W0KD 5DYIA 2N9UA 2FFQA 3G5TA 2OFFA 3LTNC 1CZNA 3U5ZB 1WU7A 4DLVA 2NXWA 4EJ6A 4Q6WA 4DV7B 1CD5A 5IWAB 4UAUA 4UDOA 4ZTUB 1RJDA 1SB8A 3GAFA 3IALA 4G0OA 3TZEA 2R8ZA 4EY4A 4E33A 3F1LA 4EX6A 2B6HA 5BT8A 5JARA 1Z5ZA 1DEAA 2ZYDA 3OQHA 4MKZA 2ONCA 1EGQA 1IFXA 2DPHA 2INGX 6REQB 3O8DA 3SEAA 1V1MA 1U0GA 4C2TA 1OA0A 4NCHA 3PEEA 3I28A 1EUQA 2AOXA 2B7CA 3EZXA 5FPHA 5DM70 1XHFA 1OBCA 2WIDA 3IOMA 2M32A 3JATA 3UJ9A 2Q5FA 3JZMA 4IQGA 3GEPA 3PNSA 4E5DA 4Z2AA 3KALA 4E4RA 4LHZA 1Q91A 5HKKA 4K6FA 4KK3A 3AJDA 4YPOA 2MMGA 4AUKA 2BFMA 3IIIA 1ZAYA 2CFCA 1GL7A 3CUUA 1IULA 3FPSA 4RK1A 1IZ0A 1TCBA 2FPRA 4YAWA 5K0FA 3KR9A 4XWWA 1KQFA 3LZ6A 1YJAA 2RG1A 3AEXA 5BXYA 5EJ4A 4NMWA 3NORA 2J3DA 2G3YA 621PA 4ND5A 1JHZA 2O7SA 1UBGA 2QW0X 3R6LA 2PRYA 1II8A 4B73A 4COKA 5KKNB 2ZI3A 3NBQA 3FWZA 3G3EA 4AX8A 4MYRA 4M8IA 1XPJA 2R66A 2PD6A 3WKEA 4DFDA 1RAHA 1NX6A 3CHYA 2HADA 2HRBA 2IDZA 2VRNA 2VK2A 4FGKA 4IVQA 2FX5A 2OBMA 2P4HX 3OLVA 1G9TA 3QEMA 1J8DA 1FRQA 3IBYA 4DNPA 5IDVA 2JI7A 5EGNA 4PIVA 4GM4A 2D0IA 1HTWA 3NWJA 1V7CA 1PAUA 1SCUA 3FD8A 1J49A 3VUEA 1AQYA 2WWHA 1TEVA 2PGLA 2VHWA 2W9XA 2HBYA 4AJEA 3LY9A 3ZU2A 1X39A 3HLYA 5LFAA 1W5BA 1BJKA 2NADA 3JWGA 4TKMA 2LDXA 5EJMA 4FUQA 1K7EB 1CEYA 3P2MA 4C43A 3PITA 3SJZA 2WMOB 2FKAA 2GO1A 1UXGA 2G67A 3SJCA 5IANA 1GNRA 2IYEA 1NP6A 2E1RA 1P4JA 3OU6A 1SC1A 5KU1A 4KE7A 2JLCA 1X42A 3UAGA 1VPLA 2QP9X 2RCNA 2RK3A 1VHTA 7REQB 2IE8A 1JVNA 1Z2NX 1ITZA 2Y67A 4WL0A 2L18A 3RVMA 1NUAA 3WWPA 4A8PA 4U5QA 3WB9A 3U16A 4KHPB 1N7JA 2P9HA 3Q0EA 1F2TA 3N9IA 1P9OA 4E2XA 4Q4HA 5BR1A 4P83A 5K0EA 1PFYA 1FQJA 2Y68A 1SO8A 3IQFA 1XD2A 5WRFA 3K5IA 1Q83A 1PR9A 1E32A 2O2XA 4BX2A 2JPDA 3KLOA 4KBFA 3KXIA 3IBSA 3V2IA 2WSSA 4K2HA 4B76A 4ZVUA 2HQRA 3LU1A 3CONA 1GNTA 2WNIA 4MO2A 1I94B 1P3DA 1JEQA 3E18A 4R51A 4HQ0A 3EXFB 2PVPA 3ELBA 3PTLA 4KXNA 1HG1A 3BHIA 3UJ7A 3MGCA 2PGJA 3FSEA 2V5AA 3G6WA 2R6GA 4L0CA 2IELA 4C0LA 3ETGA 4BO6A 4P4TA 3AFNA 2J9RA 3KCQA 1MC1A 2PR2A 4FHEA 5HDQA 3T5MA 3WTCA 5CFMA 1PL8A 4NBVA 1K6XA 4JC4A 3W2FA 3HV0A 5A4IS 5FV4A 4G5HA 2CXRA 4BNZA 3FF4A 3HBAA 4Q01A 3ZWPA 1XU9A 2J30A 3ANXA 3ETLA 3R7LA 1XU7A 2BHLA 3IAS6 4BEJA 2QROA 4N01A 1FBTA 5L6LB 4RQAA 3L5KA 1J24A 2IYYA 2P0EA 4YT8A 3EVEA 4K0RA 4MTCA 3UMMA 4QGAA 4NCXA 4MRSA 1QNFA 1JDBC 1W48A 2JI8A 3AB7A 4RQBA 1Q3HA 4DYHA 2FR0A 3EVDA 1H2YA 2C5GA 1EDOA 1QG4A 3CPSA 1QO9A 3DMTA 4KIUA 1NW5A 1NJGA 4G6ZA 4OLFA 2Y1CA 4J4TA 4QUGA 2HA7A 3AETA 2IIQA 1NKTA 3E3MA 4BRUA 3E22B 3WMGA 5BRAA 2WV9A 2EKBA 1DG3A 1SIBE 3KHUA 4GGPA 5I7WA 3JQRA 4CL2A 3SC2A 5LZ5A 3TX6A 4LHXA 2DBVO 1H85A 3B7PA 5KWIA 1NVUQ 2X77A 3L4BC 2OBXA 1M83A 3WY9A 2FSVA 5FI5A 1ZEJA 2O2ZA 5EFZA 4ZVLA 4PG8A 4KAXA 4C29A 2XCOA 1WHTB 3OJWA 4WECA 3TLAA 2O4UX 3INYA 4JSTA 2EZTA 4RA6B 3T3HA 5LQCA 4QUJA 2O8CB 2H0QA 2QRLA 2EOAA 4LBWA 4E13A 2DHRA 4L50A 2QX9A 5KU7A 1HT3A 4L6CA 1IC6A 3IESA 5I9MA 5IF3A 2B1JA 3UOAB 1T5BA 3BGVA 2OAEA 1YULA 1N9ZA 3I53A 2GA8A 4U9IS 4WLNA 1C9JA 1NIJA 2F3QA 4O4HF 3EVNA 3F96A 2E4ZA 4L3WA 1GCAA 1NPYA 1IG3A 3V80A 4D82A 1KYZA 3B9PA 4EEZA 3B9QA 2B8NA 2DOKA 3AW8A 3BTOA 2GCIA 3JX9A 4PTZA 1YHYA 2I6TA 3VSBA 3MMSA 1JDJA 1O54A 2FUNB 3GJ3A 3GIWA 4IHKA 2YJ3A 2H1FA 4MZXA 1YRLA 5KOYA 1XHLA 3HKBA 1HWYA 1FNMA 1XRPA 5KNBH 4E14A 1AG9A 2AN1A 2R6DA 4C0HA 1PQYA 1I4OA 2IXAA 1TO1E 4C21A 2BN4A 3G6KA 4WX2B 1XDWA 1HDYA 4F06A 2NUPB 5DRYA 2EARA 3VYVA 5CIWA 1DIHA 3BC1A 4LWPA 5DBFA 4EHJA 2WG0A 1WMBA 4ZVQA 1XQ9A 1K5PA 4QQNA 4RUKA 3STTA 1MV5A 4FW8A 3A0UA 5I7VA 4IIXA 1I7QB 4DLXA 3M1IA 1FUKA 3I0MA 2H57A 4MV0A 3K9BA 4G1UC 1VI2A 3LHIA 4ZAFA 3ANYB 4LXUA 5ADVA 2IZ1A 3OSUA 1BS9A 1WM1A 2OUIA 2OXFA 2RC5A 3QNMA 3FDXA 4JLKA 3P0IA 3FYHA 4ZGGA 1VFNA 3N2GB 1I6KA 3CURA 2I8AA 3HCWA 2WYOA 4EW2A 3C3PA 1KP2A 1Z2EA 2C9ZA 2A92A 2GVZC 4M0LA 4U2GA 4EHLA 4RTOA 4QT4A 2OE2A 2E3JA 3CR8A 2FQYA 3EC2A 4I4NA 1Z4MA 1B73A 3RFVA 3UK7A 2HA3A 1CVLA 4IG9A 4M0MA 5AOCA 5HJ7A 4JYAB 2VDWB 2JGNA 3RAFC 2JLUA 4MYSA 3QUTA 3UGQA 1BTOA 1MEOA 3HA5A 3OQBA 1YQ9A 5LSAA 5DIZA 4FVTA 4OQXA 3TOCA 1CQPA 4R31A 3D59A 3Q10A 5C34B 4HG2A 4JLWA 4BO1A 4CM4A 3ICEA 3KJZA 5HP4A 2UKDA 4QTXA 4LRUA 4N7BA 4IIFA 4RVDA 5ESRA 3SJ7A 5DLPA 2RCYA 4R1OA 4HVCA 3CH5A 1WA5A 2DGDA 2PH3A 1FZQA 1UBTS 1F1BA 3HB0A 2BKEA 5CURA 1M2KA 5U4QA 3NXSA 4ML3A 5CX1A 3GJ8A 4ZCTA 1IHOA 3EH1A 4G8JA 1SA0B 2NUAA 5H70A 3WK6A 5KNCH 4KPYA 4C22A 3IEIA 2HT1A 5AKYA 4NSNA 5TMDA 4EVQA 5CHEA 4NYMR 2ZJZA 4HS4A 3OIGA 4ZCLA 4RZQA 1KDYA 1T6XA 3E2PA 4P32A 3MWYW 5LXTA 4RXUA 2FK8A 1N2ZA 4ZEXA 2AXNA 3FDJA 4N03A 3RRNA 2V6MA 1J6UA 5AVJA 4DW8A 5JYEA 1P2GA 2YXBA 1RJ9B 1U3DA 3JZIA 2VQ3A 5DGHA 3VR5H 1OYWA 3I62A 3CWZA 4L9RA 5BV8A 1RHUA 2HWYA 1LF0A 1OY1A 3C7CB 5LZ7A 4B7XA 3RAJA 2QAGA 3V1MA 1SGWA 2IXTA 4LX0A 1BH2A 3CTMA 4YUWA 4ZMBA 2YCLA 2VHXA 3ZC3A 3R74A 4LAFA 1H4SA 4XYBA 5KDOA 1OXXK 1TJPB 5K8IA 1XF1A 4LXGA 1KZ7B 3MWJA 3SQNA 1KEVA 1Y3IA 2BBWA 2OBFA 2YW9A 3BBPA 3JD1A 3OFND 1PJ2A 3BXZA 3L6RA 2AYXA 4FEEA 4JENA 4RKYA 4NX2A 1ZC4A 2C4HA 2ECPA 3OZCA 4J90A 5ARCA 5T8KA 3QBTA 5CLIA 1G5HA 1OROA 2VPXA 3FJYA 3CF0A 4Y6PA 1QVVA 2EP7A 5T8KC 1T8RA 2WYUA 2WPDD 1TVKB 2DWOA 1W87A 2Q3JA 3BH7A 3GAAA 4WY2A 4DBLC 5CB0A 2WB2A 4BP1A 5CA0F 2Y1DA 3JZFA 3LG2A 5CGQB 1XC7A 4HGNA 4PGMA 1P81A 2PQ6A 3FFBA 1XAJA 4P35A 3HXTA 2OG2A 1GV0A 1PT5A 4IFIA 4YWHA 2R7LA 3AEUA 3S5JA 3U09A 1NXTA 1EUCA 2Y0PA 1KMQA 2OECA 2OQIA 3V8VA 4WFKA 4URUR 1L5OA 2WWIA 3ZWQA 3FHTA 1YR2A 4RENA 4CQNA 4NV1A 3KQYA 1DAIA 1USVA 2I87A 2IZ6A 1WUYA 1K7YA 1E1CA 2QJTA 2QVBA 3K30A 1RHQA 1VLZA 2CHFA 2H2HA 3EVZA 1GA6A 3N2NA 4EKYA 3I09A 2AG5A 2EKZA 3DV0A 4YXWA 1GIAA 2OM2A 4D02A 1RJWA 4D80A 5D6NA 2V8BA 1DO0A 4JOSA 3WAKA 4P08A 3QEJA 1NUHA 1YK1A 3TNYA 3AEQA 1ZRSA 1ZU5A 3SKYA 2P7IA 1H6AA 3FE2A 4X90A 1VL5A 2C7RA 1NT2A 1MG5A 2FXIA 4UOZA 5FA5A 3C1OA 1CNEA 3BRCA 4TXJA 3B36A 4NMMA 5EE9A 2O8BA 4MHOA 3I1FA 1NYQA 4N6OA 3KT8A 1X6VA 3OD1A 4EG1A 1MMFB 4RMGA 4ZCSA 2VP9A 2A2ZA 3BK7A 4C5BA 3HDVA 1ZHOA 3GP5A 3K73O 2I3ZA 3AHCA 3UK1A 2YV2A 5M5BA 4OUDA 3ZDEA 4RGQA 5BQFA 5TQVA 2P41A 1OKKD 3C0KA 2PMDA 3L0IB 2WMYA 4HN2A 4ND8A 1WIWA 1CRLA 1JJBA 4LVOA 4CLHA 2CFOA 4H7JA 2WD7B 1P6UA 2VDNB 2AN9A 3JD4A 4CKCB 3LC2O 3MZ0A 1SURA 4MUNA 4FOOA 5HKOA 1S5PA 4D99A 2PR7A 4D9BA 2WA2A 4AROA 4R7GA 2B7LA 4F5YA 4OXKA 5E6SB 4JJ7A 4S3MA 1RBMA 3A3KA 2VSNA 4WD3A 2R79A 1OBFO 1M2FA 1KKUA 2GF2A 2JBWA 2IPLA 3MT0A 4ZAZA 1ARZA 3PPYA 2X0FA 2N46A 1QTNA 3CRW1 1QDEA 4GEGA 1F06A 3G8DA 3GG9A 4C3OB 3NH6A 1OX4A 1R6XA 1ZGAA 3N87A 1OTYA 2FPMA 2WTNA 3IHWA 4ZAVA 3HDJA 5KSOA 2P30A 3QKTA 4NICA 1MAVA 2G5TA 1MO3A 3A4NA 3BGSA 3T0IA 4XAQA 1JQLB 3E7PA 3EFOA 4UM5A 3C5WP 1EUCB 4B3XA 4QT0A 3CR7A 2V4ZA 2FN3A 4NDZA 4TTSA 4IBOA 4BNIA 2YWCA 2BE7A 3OX4A 5TGTA 4UAGA 1RRPA 3V55A 4WNYA 4BKUA 2I3BA 3HU1A 3SQDA 4G1VA 5C18A 2C7PA 4IJ5A 3ZWXA 2ZRBA 2OCYC 2ZROA 1MHPA 3QFHA 1E0SA 4CZ2A 5KVCA 1MF7A 1O08A 3I92A 1U9YA 2O3RA 2PZEA 4RV9A 4AB1A 3EG9B 1HDEA 1GTG1 1K3UB 1N57A 3BIXA 4OSOA 4YMIA 5JDIC 1EVEA 3DZ8A 1IHXA 1PLKA 1EK5A 1JP7A 3KU4A 3E15A 4GAEA 1R0KA 3H8WA 5D8DA 1BQEA 3WGLA 2QRZA 1KI6B 5BSRA 3FOWA 1V3UA 4HGQA 3WQSB 2EWVA 5EIEA 2B8TA 3MT8A 4B6FA 2Z5GA 3AZQA 1G8JA 5JHHB 2HF8A 4YP0A 1VM6A 2YRFA 4MR9B 3W2GA 4W1QA 3K09C 3PCXA 4ZIRB 1QO0A 1RXSA 2ZPAA 3C7AA 3NYIA 4P31A 4R6WA 5IBPA 3RT1A 3KEMA 5AVVA 1ND5A 5JANA 2ZYSA 5M04A 4Y67A 2DT5A 1YFZA 1K68A 3E35A 3NBZC 3RJ9A 3L6CA 5F5XA 1RZVA 2NU9A 3R9XA 4ZT5A 1WDTA 3F5DA 1KIAA 1MZVA 4RLHA 3FMOB 2F8LA 4K46A 5CT5A 3F1KA 4BMXA 2WZCA 2FHPA 2V45A 2YFHA 3WICA 4GSLA 4RK0A 3WNZA 4NBLA 3ZQKA 4BE4A 3G1WA 3CIFA 4F4DA 3V4OA 4AY6A 5COQA 1A1VA 1CR1A 1H6DA 2DYKA 3BZBA 4S1VA 4DQ0A 1O5IA 3TKLA 4UM8B 2E6UX 4OMCA 1MO5A 3V7YA 2X5KO 3ZV3A 4F6RA 4AZ3B 1MP0A 2PX2A 1CUGA 1QHSA 1V41E 2X4DA 1I2MA 3DP9A 4DCPA 5JJ5A 5LMZA 3MWEA 5DWQA 3T9AA 1IIRA 1DTWA 2EKLA 3EAQA 3OPYB 4WACA 3UTCA 4PY2A 1VIYA 2HPZA 3NBYC 3FZQA 4FFBB 1Q7EA 3OUTA 2KE5A 3FPEA 3ZJ5A 4DRXA 5TJ9A 2G28A 2VNHA 2RH9B 3I2GA 3OJFA 4FD2A 3CX6A 4BMNA 4LQCA 2VT7A 4WESA 1RWXA 2Y9MB 3AXTA 5I7EA 3TPZA 1QFZA 2QLFA 3DBRB 1IBMB 3HZZA 1GUYA 4HXFB 3WKBA 2AJ8A 2AF3C 4INPA 3PJDA 3UBMA 4YCLA 1QH9A 5IJWA 4JCCA 3PHGA 1HMPA 5CT9A 5DZSA 5IKEA 4KO1S 2HXYA 2GFIA 4HNVA 2RGWA 3DC2A 1P0QA 2JI9A 3M5PA 3TEFA 4D8VA 4Z3KA 2Z5LA 3A2MA 3HM2A 3KD2A 2PBZA 1E7YA 4W9NC 4H35A 5LC1A 3OT1A 1DUIA 2UUAB 5DYTA 2B6NA 2P3LA 3OZ7A 1VCNA 3NDIA 4R01A 3IIEA 1NW7A 2GCPA 5DYWA 1RWBA 3JZAA 1G59A 1HEUA 4BV2A 1T9AA 1CPYA 1PF7E 3GGJA 4QC2A 3SHVA 4ALJA 4KO3S 3X1DA 3NC0C 1E3SA 3P9RA 4GEKA 1PT9A 3A6HA 3QM1A 3VI4B 3DP7A 1KI6A 1M54A 4IMJB 4QRIA 1G38A 2BUAA 2PUBA 4C7OB 4XR4A 1CDZA 4Z7QB 2H5JA 5EJ8A 3CLKA 4JR0A 2Z83A 3T9CA 4UCFA 1ZMXA 4GPD1 3RD5A 1AKVA 2AE1A 4EA9A 4KR6A 2CEAA 4ACAA 3PJRA 2IXGA 3E3AA 3PE6A 3CT4A 1ULHA 2IYAA 3R8CA 4EBBA 3FPCA 5C81A 4EJ2A 1W36D 3A1WA 3BA6A 3PC8C 3DXXA 3V4LA 2GBCA 2PSJA 3NM6B 3RIYA 3ZVLA 5I8PA 3MSCA 5ALEA 3ZDRA 3AHGA 3D6AA 3NHYA 4J1NA 4KQXA 1QP8A 2B98A 4QKQA 5IDWA 1AD2A 2XWSA 4OQQA 2CDRA 2X15A 1UFVA 1MKYA 3GDGA 5JCOA 3V4SA 1U5AA 4LJ6A 1H2EA 2FFHA 2XQJA 5BMVA 1UMKA 2JC3A 5BRNA 3VX3A 5JCOC 1WZIA 2GEDA 4EPVA 3ZE8A 1L7AA 2IS2A 2JH8A 4K9PA 2XB9A 2DCMA 3RARA 5LLTA 1YQUA 3ZE9A 4RE5A 2GPNA 4Y6QA 1UP6A 1P91A 4Z1OA 3GPDG 2X2PA 3RRXA 1RWMA 3ZWCA 1U5BB 1RQRA 3K6SA 4MVJH 3NRJA 4MB6A 3ZCUA 1PK7A 2G40A 5HZMA 5JBNA 1Q19A 2DUJA 5ARDA 2IYUA 4GLJA 4JVLA 2XGSA 2N42A 2Q9AA 3H1PA 3PKJA 1Z8FA 2J8ZA 3JQGA 2JAQA 3MT7A 4LNUA 3CWCA 3GFFA 1W94A 2C0PA 3IO3A 1ZM4A 3BOSA 1G8KA 1HZJA 3IODA 4NATA 2CXSA 4RELA 4EJSA 2FR8C 1U3UA 2PZAA 2C7QA 1RIFA 1SUWA 4BBJA 3H11B 3JRNA 4EYEA 1EFAA 3DZDA 3HB5X 1ECJA 4M2LA 3S0JA 4MQ4A 5KZMB 3QE4A 4Y7CA 5L3VA 1XCMA 4HXGA 1ZD5A 2EWMA 3DTYA 3FRHA 3LCUA 3LGSA 1MB9A 2BDUA 2EZUA 3NHBA 2Z4RA 1J1IA 2NV6A 4BPBA 2FX3A 2DULA 2WFLA 5K8VA 4KU4A 4ER3A 4J0HA 4MULA 3QWBA 2G0AA 2ZYWX 2VHQA 2X9NA 5BW6B 1E79D 3MS2A 3DOUA 3A6PC 3GT4A 1J00A 3EJWA 5FPQA 3WWZA 3TWOA 1J07A 1G9XA 2QTTA 3CEPB 3TM4A 1PG2A 4WBSA 1E9BA 2BKUA 2DQYA 2DJ5A 4MWTA 5BOSA 4G4IA 3J81A 5TQ0B 5IWCA 3HXOA 2I29A 1HH4A 2J3QA 3CE6A 1N6PA 1NXVA 1ONNA 4M1OA 4PVCA 2EJUA 1M2OA 2NPOA 3LNCA 4BMYA 3R3YA 4YO8A 1G5FA 1T8YA 4BQFA 3RBVA 1PZMA 2WJPA 4CEJA 3UNXA 1V1JA 5BQOA 3EDYA 3K8ZA 3ZWDA 1KO4A 2YXEA 4IOKA 1DIOB 3EPRA 2OYCA 3VH4A 3EXFA 4MV3A 4QO7A 1CJUC 2P90A 1ZGZA 3AZPA 1VSUA 2NLOA 2XVZA 1ZHHA 2NAFA 1IL0A 4JELA 3RRBA 4QG3A 3LUHA 3QE3A 4OI1A 1T2CA 3H4MA 4QJBA 5IH3A 2JFPA 2IYNA 1TF5A 3BAFA 1DAOA 3JQ8B 4OEHA 2PKRA 4EKIA 5CG2A 2C77A 1R6VA 1Z7WA 2OY0A 3ANSA 4BCDA 4EMTA 3RS8A 3M8KA 4TL8A 1D6NA 2J0EA 4CPDA 1QXSA 1DVRA 1E2UA 3DMPA 4HGRA 3U80A 5HA5A 4RCYA 1EFRA 1UZNA 4G1FA 1KYWA 1OX6A 5IN5A 5KYKA 1G21B 2G06A 3G2NA 1TMOA 2B4RO 3AM4A 3X2SA 1JU4A 3ODPA 2I4LA 4P80A 2BGIA 1KI4A 1ZK2A 1R74A 5L3RA 1TFRA 1E66A 3SVTA 2ZSUA 2Q4EA 5E6SA 3UXEA 4LYHA 2K2QB 2YZKA 2OVFA 2CY0A 3RSZA 1ZS9A 2P9EA 2G36A 5BVHB 4QQFA 1Z83A 3ER6A 2ERYA 5K0GA 4JI5B 3KOMA 3NKFA 4RADA 4ZU6X 3IDFA 1XIVA 4EY6A 3R8FA 5D00A 1EX9A 3GUHA 4HKTA 3S2FA 4AMYA 1G63A 3EBLA 3VO2A 5I3CA 2R1VA 2MOKA 2E0IA 1FFBA 2IYXA 1QR2A 3F4KA 3HSSA 4YUVA 4D6YA 2BGJA 5K8JB 1TVEA 1TZCA 1ZCFA 4ICIA 4GYJA 4DJJA 1ZUNB 4FEYA 1FFXB 1JHVA 1S1MA 5HR5A 3MS7A 1X7ZA 1PJSA 2YRWA 4AMVA 1KNXA 2PPLA 4JXZA 2EHDA 3W05A 1U6IA 4X44A 2C54A 1US8B 4D0NA 3HH8A 3QEBZ 4QICA 2X1VA 1TL7C 2JFZA 3AU8A 3NIGB 1MIHA 4QUHA 1L5GB 1OYYA 3LUJA 6PFKA 1USGA 3KR1A 3BYZA 4IIJB 4C4AA 4K03A 1TM5E 3SQXA 3IP9A 3T94A 3E81A 1M2NA 4BUZA 4MP6A 4W6QA 1JLMA 2PZGA 2BTQA 1U1CA 2YJNA 1C0IA 3ZVRA 2Y6UA 2OOSA 1ZA2A 4KKVA 3ZVKA 1Y6GA 2JGIA 2VAWA 3AP1A 4DBZA 2IU6A 3M9WA 3HA3A 3LP8A 2O2IA 2SCUB 3RUDA 3WTBA 2W8ZA 4PF1A 1TD1A 2QL7A 4A6EA 3ZBQA 5AI5A 5F7JA 3ENKA 1UFKA 2HU8A 4K40A 1AUPA 4FGWA 1SUSA 4B6RA 1NXXA 4KH1A 2H3EA 5MGNA 4X8OA 3BQMB 2A1IA 3ZI4A 2ID8A 1IM8A 3EY9A 3GPIA 3QNWA 4BNWA 4Q6BA 4EHNA 1P5RA 4YS6A 1EPUA 4LXXA 1KDRA 4KR7A 2BGNA 1N9GA 2JHGA 3PA8A 5CXXA 4YDQA 3JZDA 2PUGA 2F4VB 4E70A 1F8XA 2FLWA 5KO2A 1IZYA 1MQSA 5JS2A 2AMYA 4EQZA 1JKFA 1LA2A 3GLTA 4NL4H 2ZATA 3GEIA 2YY5A 3B3FA 3EPPA 3I9V6 3ZCSA 3DQZA 1XLVA 2QOEA 1GZVA 4JQOA 3RJZA 1DDOA 1B8OA 1PFKA 3DXZA 3UCEA 4DWWA 1IHYA 3RT9A 3W9UA 2R6FA 3HM9A 3URMA 2IXFA 4D3XA 2YN2A 2ODBA 4N8EA 4JUAA 1KMMA 2CNOA 4LDAA 5TGDA 1D2NA 1JQEA 2AEEA 4M0FA 5F1KA 4DTIA 1B0ZA 1EAMA 4MLZA 2GM3A 1B41A 3WDKA 2YUTA 1DMRA 2XUAA 1NSFA 1C9MA 4KQJA 3TDKA 3WLJA 3V42A 1YJQA 1O4VA 5AJXA 4YN3A 3U44A 2OESA 1E2LA 5BPFA 3IE1A 1N33B 1WXIA 1J09A 1MO6A 1L7NA 2H92A 5AW5A 4ZJPA 2CCJA 4PZAA 4F4UA 1MVNA 2HN9A 1LCIA 1QG6A 4YVFA 3IUYA 4XE5A 2NAPA 3QW2A 3WXBA 5CM2Z 3S2EA 4KR3A 1RYDA 3F9RA 3JSXA 3PXEA 1Z13A 1DC4A 2NVWA 1KIMA 1NI3A 4BXOA 3K0FA 5EHQA 2JIBA 1SC3A 3ADKA 3GF4A 5AUNB 2PRJA 3CF4A 4DC9A 2FSHA 1KERA 2DE0X 1DX6A 4PEVA 1E58A 4Y1EA 1RNLA 1DRJA 2JFUA 1R0LA 2I55A 5AOVA 3SYKA 3SZRA 1MU0A 3ZNNA 1P39A 4IH9A 2GBLA 3R2JA 2C59A 1CYDA 1HQCA 4R9UC 2WEKA 4U6QA 5FR1A 5IYZA 2UYCA 4N0DA 3AR8A 2V9PA 4X6UA 4HDMB 3FI0A 4IHJB 2C4MA 4IDOA 3OM0A 2CL5A 2J3JA 2PSSA 4Q12A 3JPWA 2XBMA 5KCZA 3TZCA 3A1SA 2QUJA 2HJGA 2FZKA 2VF2A 3B1JA 3QG5A 1X13A 4M22A 4R1UA 4QXRA 3SF8A 2LUOA 3VSCA 5KTRA 1SOVA 1OLUA 4MNTA 2XCSB 1MTZA 4OHKA 1XNRB 2ONJA 2QLNA 1USKA 3W5IA 6NULA 2QZ4A 4AULA 4IDEA 3L8EA 3TD2A 4UBIA 4XVCA 4FINA 4Q1AA 5E4FA 3D8HA 4ZMRA 3SX0A 3I1YA 5EP2A 3OI7A 3NHPA 2E5WA 1AKQA 3KQOA 4PZUA 3ZWWA 2YQ5A 5C7IO 2ZSBA 1GU1A 4JZYA 4QJ5A 1AO0A 4V0LA 1E9EA 4MRMA 4DCSA 4AS2A 3S5UA 4RZXA 2RBGA 4HZGA 1OV6A 4BZQA 1RZRD 1FRZA 5EWMB 1DSSG 4O8ZA 3IB3A 4Y0AA 3KDPA 2QN3A 4YJ2F 3IVCA 3RQSA 4K6CA 5AKZA 4EY8A 2C84A 2YZ7A 1XZQA 2R85A 2DECA 1U0TA 2V7UA 3BMQB 3REQB 2VZ8A 4O3FA 3EZFA 1VMEA 3ZV5A 1EHYA 4R69A 1R66A 1E0DA 3HVUA 1AQLA 4WEOA 3KO8A 3VDNB 4EVSA 4TYMA 4F2WA 1DINA 1KY3A 2FETA 2VJQA 3K0EA 1YUNA 3GEBA 5FA8A 2GBPA 2ODTX 2UYOA 3BCRA 3TQSA 5K8LA 1NRXA 2LP4Y 3O94A 3GCWA 2RHHA 3L5OA 4J1TC 4W8HA 3ZQUA 3LQFA 2AI3A 4JNCA 1GO2A 1KJ9A 4OBWA 3NWPA 1POWA 5E6RA 1VLHA 3L7KA 3PQ8A 1Z25A 4OF4A 4B3TB 3AVYA 2NSHA 3QVSA 3A9UA 4E5PA 3AIOA 4P7KA 1KE1A 1UIRA 2Q2QA 3DPSA 3AF2A 4RKRA 1KO1A 3LTEA 1Z7EA 3B5EA 3OCJA 5MN6A 4HPXB 2CW5A 4EY5A 1B15A 4F6CA 1O0SA 1QUFA 3A05A 2CNLA 4AT1A 3WYBA 4LI3X 3NHUA 2YCBA 5GQSA 1VPEA 2ET6A 3GOQA 5T57A 3DV2A 4GC5A 1VHJA 1NBAA 1FP4B 1UT6A 2CLIB 2Z04A 3V1YA 5LWQA 4Q3NA 4H1UA 2JFYA 4Q00A 1A96A 2VH5R 3P5BA 3E23A 1JAXA 1TUBB 3ET5A 5JADA 1GQOA 4LA4A 1TK3A 2GR9A 1Z68A 1SIUA 2C1EA 2XKJE 3ZPXA 1ZMOA 1XTIA 3SIRA 4DCJA 1DAGA 5CT6A 1KSJA 1J33A 1PTKA 4MDEA 2OUKA 3FCAA 1UOOA 5F52A 3VDXA 2YWRA 4L3OA 5FTNA 5LIPA 1SQSA 3G0DA 4YP5A 5C5DA 1GQRA 3WWEA 4PTLA 3X2EA 3B20A 2X2FA 4B35A 2D2XA 4JUDX 3ZCXA 5K0LA 2CK3A 5E1MA 1KYXA 2IGBA 4TL6A 4U5XA 4R2MA 1AZSC 4C4ZA 1ZO8A 4KN6A 3WB2A 4ID9A 2HRQA 2QYHA 3LKVA 4V0QA 5K9ZA 1DMSA 1Y8QA 2I67A 1YDGA 2GK4A 3UJ6A 4L8WB 4YCCA 4BNFA 1ZGGA 1G0NA 2JGLA 1YZTA 5CCXA 1RPJA 2GEKA 1U7XA 4X5OA 4E08A 3HGTA 2ID4A 3IEKA 2H48A 3RWOA 2P11A 2Z9CA 4INJA 2WVGA 3GXBA 3KJNA 4JVOA 5K0BA 1T5DX 1PBTA 1AN9A 5F35A 4B7UA 3NOQA 4PNEA 2XDQA 4PR0A 3P5SA 4ZDWA 3O0TA 4BV3A 3K71B 3WRVA 4K7JA 2QDKA 3OT4A 1FMJA 2IU3A 3ROPA 3T7TA 5BQXA 4LF4B 5EZYB 2ZQYA 3H1AA 4DGQA 3II6X 2CV0A 2W2MA 2JCBA 2MDTA 3HY3A 4X45A 1G3MA 4ZV4A 3CG4A 3JARA 2CVZA 1GILA 1QYIA 1ULAA 5K0ZA 4JC0A 4X9XA 1C9KA 3BDVA 5BSMA 4ABYA 4B6OA 4JSRA 1MX9A 4UC0A 1HYEA 3EFBA 3TLCA 1LPSA 5KJFA 5EIWA 4DN6A 2WIBA 4N3CA 4AS3A 4XCVA 5SY6A 4MQMA 4LN1A 1MBZA 4FFVA 4MVJD 1A69A 1O97D 2RGNC 3DG9A 4K26A 4ZOCA 1ZGHA 2C82A 1SWVA 5JPIA 5B3LA 2P2GA 3UGJA 4O4LA 3ROGA 3DCIA 4NZPA 4HBZA 2ZRAA 5HTOA 3UJNA 4LGVA 2QUAA 2QP3A 2CMHA 4G9EA 5CM8B 3U6KA 4Z53A 5HFNA 3VHLB 4J2HA 1EKXA 1A4UA 2Y99A 1NU6A 3FA2A 1SD5A 4FGUA 4MMXB 1DAEA 3P97A 3RSHA 1DEHA 1VZ2A 1JRLA 3AUTA 3QMPA 4FWBA 4UZSA 5IG2A 1HYHA 4HUTA 2I34A 1TU0A 1WQ3A 2ZRLA 2P9FA 1IEWA 2OK7A 3LT4A 4YQFA 1VBMA 2B61A 2ZS9A 3FFXA 1RQNA 2WZQA 1LDBA 3C6XA 1ECBA 4QEKA 3L0BA 2CE2X 4H77A 2WJHA 4EUKA 1N8SA 3MAAC 3R41A 1Z5GA 4KTTE 3HJHA 5GINE 5ICSA 3I6QA 4OGWA 2JEZA 2IUUA 3GRKA 3GVIA 4GG1A 5E6UB 1NVFA 1VSVA 2AMLA 3IV9A 5FKJA 4WCFC 2X5XA 3TLZA 3LDUA 5JH7A 1BFDA 3ABZA 3K9CA 1GCOA 1TB4A 4NG5A 5JAZA 1YIDA 4W5WA 5EUQB 5CDUA 1ZY2A 1KZ4A 3C6QA 3OT1B 3DL0A 4K9LA 3NCHA 4JR2A 1JB9A 1CNFA 4S1WA 4AECA 4RDIA 3N58A 4HMOA 1C30A 3RVLA 3FNGA 4F8YA 1K89A 5JJLA 4DCCA 1VBKA 1HT1E 3HXMA 2H2DA 1JR3A 2YN4A 3HJGA 3IJPA 2FEPA 5D3MB 5LMCA 2OO7A 2G80A 1RVDA 4XA8A 2XE7A 2YTZA 1YAHA 3TMYA 3L8MA 1GY8A 3BHMA 3HP4A 4LMBA 4UE3S 5ALFA 4GO1A 5JMWA 2X40A 1JF8A 3E22A 4PM4A 3PVSA 4X00A 2PFKA 1JU9A 4DAOA 1Z5OA 2VAXA 3K96A 3HWSA 3LRPA 4JY7A 4KQFA 4BNMA 6CHYA 1NMQA 2I4TA 3ANMA 1OCEA 3DHVA 4NRDA 4D44A 5LOVA 1M2GA 1GKIA 1G2PA 3CLHA 5ENZA 2FEOA 3Q6MA 1SHUX 2FPPB 1QE0A 2QD2A 3EA4A 1IWBB 1CVIA 3FG9A 2CF5A 3SQLA 2X4GA 4QATA 5IT5A 4EVRA 2IZ5A 3C7DB 5HIKA 3HCCA 5A9SB 5I7FA 2L69A 4C0QC 2F1OA 1SZJG 4UMDA 3QU7A 4BPRA 2ZIFA 5IAEA 1NW3A 4DZRA 4EJ0A 5JNLA 4CTMA 3BZUA 4BJ5A 5BR8B 2RHMA 4ZVVA 4OK3A 5FI0B 1UBOS 4DDWA 4L4ZA 2G6TA 2PQMA 5KVQA 3W7VA 5L7TA 2WWYA 3UXMA 4HJXA 1A2KC 2G4CA 2QXYA 2RIRA 4LW8A 2CFSA 2XA2A 5YASA 2R2AA 1H0KA 3U9SA 1RYMA 1RI4A 2RAPA 4KEAA 2C7BA 3AF0A 2PVCA 2VBGA 4RS4A 1IN7A 1AQIA 2CKDA 3QU5A 4CG3A 4DILA 5J2UA 2AVDA 3PG5A 1EM6A 1A8IA 5A7FA 2VF4X 5TMBA 1X1DA 4KR9A 3OE4A 2PUHA 4BBPA 1UPAA 2MYTA 4ZVRA 1NURA 4GLFA 4AJLA 1NYTA 1HORA 1ZD1A 1U6KA 1WD7A 1SB9A 1GPWB 3V8BA 3TVDA 3IEPA 1I4LD 1S3FA 4U02A 4PLGA 2PGIA 4QOFA 1LDEA 3QBEA 1Z63A 1HKUA 3CNHA 3AF5A 4EKEA 5IXYA 5AM5A 1FX0B 1PJ4A 1EHIA 3RSOA 3ZWOA 4KR2A 2PSHA 4TKZA 3H17A 1QGAA 1ZZGA 2HHLA 3FNEA 4HAYA 3CCCA 3U7IA 3ZWNA 4OOFA 1Q15A 5BORA 3PUHA 1JIUA 4P2BA 4RHUA 4DUYB 2XMZA 3GRVA 3Q3JB 3JQ7A 3LK6A 3CFYA 4Q21A 5ALLA 3S2UA 4DF3A 2P6NA 5GM1A 1NBHA 1JJAA 1YRAA 1Y1LA 2PKQP 1M1YB 5KYXB 5LP1A 1GU7A 2GK7A 4JS0A 4A8JB 5FAKA 2WA1A 3BVPA 1LRJA 2XMQA 5A05A 3P71T 4RO0A 3V2GA 2ZU0C 4EELA 5C8VA 1ZYUA 4ZXFA 5IUJC 3T0GA 4E1VA 1LD3A 1XVAA 1JIKA 3V2UA 3BIOA 4OTZA 3BFJA 3DB1A 1QKJA 1JG1A 3D8NA 4J07A 4XIIA 3QU2A 3F7TA 3V4PB 3LO5A 4P38A 2NO1A 2XDAA 2NW6A 3JQFC 3N8DA 4MJXA 4O4LF 2BMEA 4ZT7A 2YXNA 5LL6P 1MVOA 3L3BA 3QPCA 4IAOA 3COJA 4AG5A 4RKEA 1U94A 3H75A 1ULSA 3HYCA 4U7PB 3U9LA 3NTRA 1KK1A 3ZLTA 2CLFB 1Q21A 4NOKA 1EK0A 5HX7A 1T1IA 1WHSB 1WXGA 1V16B 3ZHTA 5LLDA 3ZHVA 1A5BB 1RQ7A 3F6CA 4YCMA 1ID1A 1SKBA 4DYDA 1KO7A 2TMDA 1C8LA 1JI3A 1TGYA 1JECA 5EY5B 1VCHA 3L4JA 3TM5A 2HWUA 1C1HA 2O1EA 2F3RA 4NLLA 3N59A 4FHZA 4BMCA 4D4MA 3CRQA 1XNJA 4CQMD 3DLAA 3PF8A 3EIQA 2IIBA 2R6JA 3OZDA 4OHBA 5I6DA 2HV8A 2GD6A 2IYZA 3I1IA 3V7UA 4YR7A 1JXAA 5K0SA 3VTZA 1E1LA 1GNLA 4ND3A 4GRIA 2BHRA 1YRWA 5TB5A 1FRNA 2VDMB 3HVIA 1JB1A 1THGA 3LI2A 5EE3A 2HHHB 4TWAA 4G01B 2BFPA 4S0ZA 1COWA 3VR4D 2V7EA 3ECCA 1L0BA 3CVUA 4EGCB 2F67A 5KEIA 2O3UA 3CC8A 1J0CA 3KDSE 1SVKA 3RKSA 5K03A 16PKA 3RC3A 2XRZA 1D7OA 1QGOA 4FNGA 3R6GA 1RKXA 4UBLA 4J94A 1U8AA 1FFHA 3EULA 1YXMA 1Q0HA 1WG8A 1ZUNA 1NMXA 2NWQA 3B85A 1ODIA 3G82C 1MX3A 3MHPA 3ZJ4A 3HXKA 4D3DA 4UHJA 4BTVA 1EWVA 2GD0A 3HY4A 3MCVA 5D2CA 4BEWA 1RHJA 2OV6A 4D56A 1SJ9A 4NMXB 3K70C 3H3XA 4IXDA 3SYRA 1ZVVA 1WCYA 3FYUA 2ZIEA 2PZFA 3EIEA 4IYJA 2A9PA 3QI2A 1OAKA 4AXBA 1NF8A 2X7XA 1XEAA 3G17A 3LIIA 1T2FA 4DE5A 4BX0A 2JGDB 1HL7A 3COPA 3LX4A 5HGJA 3KYDA 4WXEA 1R2QA 3HUTA 3NNSA 5EXSA 4PGAA 5IAGA 4GQBA 4PYLA 4GRAA 3ZBPA 2QRPA 1V5WA 5IM4F 4K0KB 5KVSA 4GS5A 3RREA 3IP5A 1BEUB 2JJ1D 3JQPA 1Y98A 1R3DA 2H1HA 3QPDA 3RUEA 3SYMA 2PWPA 5EXPA 4FZ5A 1P73A 3H83A 3KSUA 5G41A 2QBYB 1KRHA 4MVWA 2VYCA 1KP9A 1BXRB 1I4DD 3GJ4A 5FOWA 4BMOB 2FP4B 2EGGA 5BSWA 1W36B 1TM3E 2ZUUA 3VZQA 2HO5A 3LLUA 1SHJA 2AFHB 2C95A 3GQBB 5AHWA 3W04A 4AJOA 4QU9A 1OXMA 1FLNA 4LFCB 4DIEA 4D4HA 5J2TB 4MPTA 4BX8A 1Y5NA 1Z45A 1BX1A 3O6VA 4CKEB 2X0RA 3UMYA 4BKRA 1YB2A 2DUMA 1GGHA 1X8LA 4LJ8A 4JK3A 2WJ3A 4L74A 4TMYA 4XLZA 5CHYA 1QGUB 3LT0A 4ZO6A 1Z15A 3OZBA 3UH0A 2FMUA 1GQYA 3QNUA 5CAEB 1ISGA 4Y9SA 2IOQA 3DCJA 3LGXA 1S7GA 3ORRA 4B3BA 1V43A 4C0SA 2VG8A 1XZDA 2ZXUA 1A7AA 1XTQA 3C2QA 1AQJA 5KYYB 2ZWVA 1V1MB 5REQA 1Q0RA 1W4LA 2Q3EA 3RFUA 1DGQA 3TLJA 4LGMA 1SBHA 1KEEB 2OC9A 1F14A 4K3UA 4TWRA 4ENTA 1IBLB 1EZZA 4YMSA 5HF5A 5D87A 4EA6A 4OLBA 1DEKA 3PIRA 1WCWA 1MOPA 4E30A 3KT3A 3CB4A 4N65A 2HRZA 3I4CA 3R3SA 3NFYA 4XDGA 1T8SA 2IZZA 3WGGA 4CMEA 3TLEA 1VIMA 2OHXA 1VJDA 2CXUA 3O3MB 3HQ4O 4IRMA 1SEVA 5M2QA 2JIMA 5DI3A 1EJ0A 2HYDA 1UDXA 4A1OA 4EG3A 1LY1A 3ZKWA 4P3XA 3AR2A 2XCRB 3CX4A 2BFEB 4MUFA 2QE7D 2FEMA 4REMA 5LWHA 5B2EA 4YGXB 1CY7A 3R0XA 4AJNA 1Y1KE 4RIEA 2CNDA 1QJ4A 3UA4A 3QFTA 3P19A 2WIKA 4LV5B 3J7TA 4DM3A 3ZCRA 1NV9A 2JFXA 4N3BA 3ZJUA 2XTJA 5ABPA 4Q9IA 1EWQA 5DSZA 3K2QA 4AURA 3G85A 1Q0PA 4E2WA 2C2KA 1PR2A 1OX5A 1NN3A 4GNRA 5GMOA 1Z28A 2Z1NA 4KJZA 4WINA 4ZDJA 1UC8A 4IOJA 4DLLA 5K2OA 3R5HA 3EBOA 4WK0B 4NDNE 3FOEC 3EEFA 3GC6A 1UKBA 4BVJA 1UXJA 1D8TA 1RIIA 4FMBB 4B87A 3QPAA 1BMTA 3NEJA 4Y2UA 1W581 3HYRA 1R9JA 4YI3A 3BUSA 4JFRA 4FMPA 4D0GA 4MYHA 4JBLA 5CDFE 5IT0A 2NVBA 4MLCA 2WHPA 1XRSB 3GFOA 4NPAA 4P86A 4CIYA 4LKRA 1WBDA 3MAJA 3OCCA 1DRUA 1F9EA 2H65A 4Y2TA 3DEJA 4FCTA 1WV1A 1FP1D 4L57A 3O1IC 5DTIA 1SK8A 3KG2A 2GPYA 2RARA 2WDPA 3UJHA 4A2QA 2PX3A 3E27A 3Q11A 4GZ3A 3R40A 1QCCA 3TXYA 2IOFA 2W0MA 3PNVA 3WMWA 4GI3A 4XB6B 4AAYA 2ERCA 3NATA 3HJRA 5DTQA 3U56A 1NVVR 3NC1C 4NBRA 3I58A 2YQ4A 4ZTZB 3NEYA 1Y8ZA 1YA4A 2RH8A 2XYQA 3AUXA 4ALMA 2CNNA 2HOQA 2HUPA 3MG9A 4TVOA 4CMGA 4RBNA 3PTZA 2FSPA 3SEFA 4ARUA 5D3KA 5LP6F 4Q9LA 4YREA 2CJYA 1R0XA 3JAWA 3N7TA 4Z4QA 121PA 1CLUA 2IK8A 3BH0A 4DLWA 3WXMA 3TFOA 1JBQA 4KMOA 1BWSA 1U9ZA 2Z2YA 1R12A 3A25A 2D1SA 4AO8A 2ZRQA 4DT1B 1HYQA 4FYWA 4YI5A 1QC5A 4IF4A 1F48A 3S55A 3TZ6A 3OLWA 3KZMA 5LQSA 1W19A 3JQEA 3R7WB 1HA3A 2Z09A 1Z2AA 1JEDA 2PMCA 2ZIXB 4Z9FA 4BFZA 4ZEMA 2FMTA 1JDPA 1YFKA 5DNEA 1A4XA 3KQPA 1VMAA 4B7ZA 4ROSA 3UJCA 3D7MA 1QHYA 2XTMA 1CEQA 3AW9A 1ECLA 1R37A 1Z34A 2PRKA 3LUPA 1QAOA 3DBRA 5FL3A 2NXJA 3TRFA 3ADCA 3PFKA 1MT3A 5JSKA 5C5IA 1IE3A 3K35A 4MUEA 2E4YA 5B6PA 5B1EA 2B9VA 2QT1A 5JAIA 2GJSA 2PWYA 5AHOA 4G1EB 4R1SA 2HTEA 1YRYE 3K20A 3QHQA 1A5ZA 1L4BA 2VJKA 3TR6A 2W0SA 2Y4NA 1OZHA 1IUPA 4U6SA 4JKOA 2ZBEA 3FYCA 4G36A 1G9SA 2I03A 4ODIA 4DNOA 1IG0A 3FSRA 4Z7NB 2HBRA 3OPMA 4AMGA 3H2KA 1K7SN 2FPUA 4KZPA 3BJZA 2JLXA 4OI4A 4EGAA 2V7BA 2A5YB 4ITRC 4LDNA 3X1KA 3O75A 3A36A 3WRXC 5B1DA 2VA8A 3ESRA 1FP4A 1EIWA 4DEYA 2GSWA 3GZ4A 1U2DA 1XCBA 2JD1A 1D6MA 2YV1A 3DO6A 3MJVA 3R3WA 4PZ0A 4WA8A 4ETWA 4W9NA 2XMGA 4MWBA 4YH1A 3IV7A 4LYYA 4X1IA 2LDBA 3CCFA 3GHHA 5KSZA 1YCFA 3PC6A 4FMCF 1EFHA 4R1LA 2VJMB 4ZO8A 1F7VA 2CNWD 3B6IA 4ZHSA 2XMCA 3GJ6A 1IPFA 2A67A 3T7KA 4A92A 2O2HA 4KQIA 2VOJA 1H42A 1VKJA 3FGPA 3ILSA 4Y0VA 4KMSA 2H4WA 5G3YA 2XZOA 2VAPA 2HY7A 1UBLS 4J4BA 1K7CA 1QUEA 2XGOA 3ZHXA 4HADA 1TA0A 5A3RA 1GPJA 2FFAA 4WRRA 1I3MA 1XCPA 3SXUA 1LI5A 3IA7A 1DKPA 2B37A 2VT3A 1DXQA 1PTJC 3E6AA 3TTSA 1UPXA 5IVPA 4YDSA 3IPAA 4UEOA 1EVKA 2MINA 1FJXA 3KUCA 4J0GA 2CV2A 5BY2A 3GBPA 4TWZA 1GEGA 2K7FA 1DX9A 1ISHA 1U6JA 2FPGA 4B4KA 4ECAA 5IM4A 2IKQA 3O9MA 4OGKA 4R9NA 4QRHA 3H9UA 1EM8A 1JLSA 2AOUB 4DIFA 4UFOA 1IWPB 3RJ5A 1H93A 1CHDA 3THYB 4Q4CA 3R0ZA 2HHCA 2JATA 4GXNA 5JAUA 3HJFA 1JSRA 2YY6A 2JLWA 2V6IA 1A77A 4F3CA 2BCGY 3SVZA 5FFFA 3GEEA 5J59A 1PWEA 2C2GA 1DOZA 3HZHA 4RNCA 2WTMA 5K0NA 5TDHA 1YMVA 3T3NA 1SAYA 4PZYA 5ECDA 2C2MA 5AKIA 3IP8A 4TKUB 4ENRA 1XJWA 2W83A 3B3QA 4AJIA 1UKYA 1SM4A 2O54A 1IHUA 2XOXA 1Z0IA 2IL1A 2JIRA 2AW5A 3DFIA 3BWXA 3JQCA 4IH4A 3PXGA 4RY2A 2UXCB 2HRRA 4CIBA 2GN8A 4S0XA 1T8UA 3K0SA 1FJHA 1E5LA 4GX5A 3O1LA 5K8TA 3UY4A 3GRRA 4AYTA 2MWMA 3BEDA 4DC0A 5LR6A 4ZI2A 1AZWA 4ZQCB 4F0JA 4LX8A 2PUAA 3NM5A 2ZRMA 2Z4SA 4LZNA 1P72A 3LXMA 4XD7D 3UKOA 5C4MA 5KSYA 3STVA 5FP0A 4JJAA 3WLKX 1TPYA 4OXRA 1DS6A 3C24A 2J3EA 3IS3A 3IEUA 4KQ6A 1RZ3A 5EESA 2ACWA 1YZGA 2JA1A 3CMCO 2AFIE 1S6YA 4RVOA 4DPKA 4H1TA 1ZM3A 5JPCA 1P0CA 1B14A 3M6AA 1L3CA 1MFPA 1ILEA 4RX1A 2VJLA 4H6VA 4EI7A 1YVUA 4R16A 1C9NA 2OXTA 2H51A 1OJ7A 5L53A 1YZQA 3EQ9A 3QLVA 4ND1A 3IBCA 3GLQA 1DXHA 1W4CA 2EJTA 4GWGA 1PL7A 4B4OA 4YT4A 4OGGA 1P4AA 3DEYX 3I5XA 4IPTA 4MRRA 1ESZA 3U49A 2LIVA 4LHWA 3TRHA 5CK4A 2ZT8A 4ESOA 1UOQA 3G1TA 4ROTA 2F9MA 3SC4A 3D4BA 3RBZA 1SA0A 1L8LA 3A6GA 1TYAE 3NPAA 1I30A 4AYWA 5DMXA 3U61B 4PLVA 3F9CA 1J90A 1NMYA 3OWOA 2BF4A 1RM4A 3LE8A 3CISA 1HNNA 1MC8A 2IEYA 4LTNA 2XLCA 3B70A 1OI2A 1XVTA 2H5IA 3ZY5A 4L7VA 1FNNA 3LZCA 4P22A 4PG6A 4PN3A 5D6OA 1KEPA 2EYQA 1TIBA 4Q24A 1LV7A 4QPZA 3LC7O 1L5LA 5KYUA 1B8UA 1BEEA 1XVLA 1C8BA 1VJ1A 4C6TB 1ZUHA 3QEMB 2AEMA 1GL6A 2OCPA 1C30B 4Z4CA 4UTNA 2QAGB 2B25A 1QRSA 2ZREA 4RD1A 3ECSA 1UADA 2Z2ZA 3EWNA 2VJAA 5FFMA 3C8ZA 1SCAA 3IAUA 2WT9A 1Z4LA 3KYCA 1CUWA