2IX9A

Respective role of protein folding and glycosylation in the thermal stability of recombinant feruloyl esterase a
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
260
structure length
260
Chain Sequence
ASTQGISEDLYNRLVEMATISQAAYADLCNIPSTIIKGEKIYNAQTDINGWILRDDTSKEIITVFRGTGSDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISVQDQVESLVKQQASQYPDYALTVTGHSLGASMAALTAAQLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPAEQGYAHGGVEYWSVDPYSAQNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTSGACTW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Respective Importance of Protein Folding and Glycosylation in the Thermal Stability of Recombinant Feruloyl Esterase A.
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
molecule keywords FERULOYL ESTERASE A
total genus 97
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 3.1.1.73: Feruloyl esterase.
pdb deposition date 2006-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ix9A00
3AZPA 5CT5A 4MEAA 1GQSA 4GWLA 1T2NA 4QDXA 1XLVA 3DCNA 3ESBA 3D0KA 3K9BA 4UBJA 4BP8A 1EB9A 3PFCA 1K8QA 3ESAA 4OYYA 5FP0A 1XZFA 1TKRA 5ALTA 2JBWA 4UPDA 2PU5A 5AOCA 1EI9A 2HU7A 1EVQA 2XQFA 4H77A 2WU3A 3AFIA 3G0CA 2WIFA 3IVMA 5I9IA 4UFNA 3X3HA 3PFBA 3M81A 2WFLB 1YAJA 4S0XA 5E4JA 2V98A 3FCYA 4EY6A 5ALGA 5LP1A 2HA2A 4KR0A 2QR5A 1CUUA 2BUBA 2BFNA 1QIJA 4BRSA 3WA7A 4U2CA 1QTRA 1ZGBA 4G8DA 2I3ZA 4QEKA 1T4MA 3D2BA 1C4XA 2PSEA 5C8XA 2PM8A 3STWA 4C6HA 2CBGA 3VISA 3WK6A 1Z68A 2PBLA 4L0CA 2XQKA 5HF9A 1UKBA 3IUMA 5AKHA 3WK4A 3O4HA 4F21A 1JU4A 1X2EA 4L9AA 4GEGA 1QTIA 1R9MA 5KBYA 4EHBA 1XFDA 1SCKA 1GPNA 1QIKA 1A8QA 4ARBA 1W4LA 2VT7A 3PUHA 1LGYA 1YA8A 5I7UA 4C87A 3DOHA 1QIDA 5BWBA 3O0DA 2EDAA 1WCYA 1DINA 4E15A 3H19A 3G02A 1CUWA 4UBOA 3VVLA 4PSCA 3WL5A 4FNMA 2YH2A 1IUNA 3S8YA 1AX9A 3HLKA 3GUUA 5AO9A 5C7YA 3A2MA 5AKGA 3WI7A 1LPMA 1R88A 1HDEA 3KSRA 1CUIA 4LXIA 5LZ4A 5AM3A 3FBWA 3STTA 4RNCA 4F0JA 4DSZA 5SYNA 3WA6A 5A7GA 1XRQA 5JYCA 3EQ7A 3IB3A 1K6EA 4C01A 1CVLA 5A7FA 1QIIA 3DKKA 3IA2A 1MN6A 5ALQA 2PUHA 4WJLA 5AKKA 1CUVA 4MQLA 3LIPA 4X91A 4Y2YA 5K3FA 2RHWA 4HS9A 2HDWA 3OC0A 1ZD4A 4AZ3A 3F8SA 2H1IA 1J06A 1H22A 3O9VA 4UBMA 4G9EA 2B9VA 2WUGA 1EA5A 1CUHA 1Y7HA 1ZOIA 2WKWA 3STYA 2ROQA 3W06A 1U8EA 2OCLA 1XRLA 2JGFA 3L1JA 1UZAA 4EY5A 5CXUA 4B83A 3W2TA 1JJBA 2I3DA 4JEIA 3PF9A 1WB5A 2QM0A 1VLQA 4KE6A 4LYDA 3D5EA 1DT5A 4QDUA 4TPKA 2PUJA 5FV4A 3H2HA 3B5EA 4BVLA 2PPLA 4JYMA 4B9EA 4DNQA 2YASA 2PX6A 3BWXA 3WWCA 1XLUA 1NU6A 1NU8A 4F60A 2IITA 3WZLA 1UFOA 1XZKA 3H17A 1K63A 4H0CA 3HABA 1N5RA 3WMRA 2JEYA 1LBSA 3OOSA 3EQ8A 2G5TA 3DL4A 2XUJA 1J1IA 4J03A 5BWCA 2P8SA 5CT6A 5AKYA 1R3DA 3FLBA 1ETHA 3HZOA 4AN0A 5JZ9A 1ZJ5A 1B6GA 4DTCA 5C81A 1EDDA 1QFSA 3DYVA 1XZGA 2OXEA 2XMBA 2AJBA 1EX9A 4U2BA 2DHCA 3W9BA 4EY8A 5A62A 3WKEA 4W1QA 4JH0A 4N5IX 3AILA 5AI8A 4WCVA 2DQZA 1MTZA 2RIPA 3FLAA 3RK4A 4B0PA 4BE9A 1LPNA 3DYIA 4G5XA 5DYYA 1BE0A 4FHZA 2VJDA 1IVYA 3AUKA 3C6ZA 4Y9SA 1YA4A 4FBMA 4DYHA 3G9ZA 2WG2A 5CH5A 3WL8A 4L72A 1GKKA 4W1RA 2XQJA 1BN6A 1TQHA 2XUPA 3C43A 3C70A 3R0VA 3CN9A 4FMPA 2XUHA 1HBJA 3OPMA 3HACA 4QDTA 1RP1A 2Y6VA 4CIBA 5AI5A 4QNNA 1E5TA 3QBJA 5KWIA 1QGED 2AJLI 1E66A 3G9XA 2XUDA 3FSGA 5EHZA 2Y2VA 3VJMA 4G4JA 2PU7A 1USWA 3C5VA 2OAEA 4Y2PA 2HA5A 2XQIA 2ZVDA 2Z5GA 1THGA 5EHXA 2PSDA 3A70A 3FVTA 4FLFA 2XUOA 1XRNA 4DLNA 1ORVA 2H7YA 2GYUA 5DNWA 1G4HA 2CB9A 2JGMA 2PKYX 1H2YA 5EIEA 4A5SA 5EGNA 4Q3KA 4Y2VA 2HL6A 1DWPA 2JGJA 2XQGA 5JAOA 1YB7A 2NW6A 2AJ8A 2WJ3A 3PUIA 2QJRA 3OURA 3KDAA 4G9GA 2WILA 5FUMA 1XRRA 3ZPXA 4X6XA 1E8NA 2PL5A 1CFJA 4OU5A 5YASA 5LYYA 4HXFB 3WK7A 1IUPA 2RONA 2WUDA 1IZ8A 3GA7A 2WQZA 1OXMA 3NWOA 4MYSA 1MJ5A 2RHTA 1O6FA 4KACA 4Y2QA 1SFRA 3VJKA 4EB0A 3MUOA 5T4HA 3QZUA 1HPLA 4Y2SA 3CCBA 4BTLA 3WWDA 1S8OA 2WUEA 3BF7A 2VA9A 4DNPA 2OCIA 4ZV7A 1UK7A 4BP9A 5K3DA 1E8MA 1UOQA 4X97A 1CIJA 4ZXFA 5FPPA 1R4ZA 1YSCA 2FX5A 2VJBA 4OB6A 3MUNA 1DX6A 3R3WA 4ROTA 1JKMA 2RGUA 4JNCA 4FTWA 4H35A 1MNAA 1XQXA 4QWWA 1TCCA 2EDCA 3O95A 1ZI8A 5AK3A 3WKBA 3QITA 1U2EA 3GFFA 4NZZA 2QJWA 5ALJA 3WZMA 2WFMA 5D6OA 5HZGA 1GQRA 2C58A 5T4BA 3H18A 4Y2TA 1VXRA 4HXGA 1TK3A 3BL8A 4OPMA 5I8PA 2YYSA 5T4FA 5A6VA 4BZWA 5DLPA 4IO0A 1AKNA 2V9ZA 4W9RA 1U65A 1WB4A 1WM1A 4MWSA 4PNZA 2I78A 1MT3A 3I2GA 1O6GA 1XZAA 3I2JA 4Q3LA 2JGLA 1YB6A 4QE3A 4GLBA 2C0QA 3FYUB 5ALWA 1KU0A 1VOTA 1R50A 4OCZA 4Q3OA 1CEXA 1N5MA 1SOMA 4MXDA 1XZJA 2C5GA 4NMWA 1BEZA 1BROA 4B9AA 5AKLA 4B80A 1JT2A 4EUSA 3R40A 4X6UA 2C7BA 3HC7A 1CUEA 2WIJA 4B85A 3DEAA 5JANA 4ZI5A 4PSUA 5AKXA 4QA9A 4ZREA 2HA4A 2CZQA 1QO9A 1Y37A 6YASA 2VSQA 1LPOA 2QMQA 5ALOA 4C89A 5ALYA 1QLWA 2VJCA 3BIXA 4G8BA 3HYSA 2VAVA 4UBKA 1CUYA 4K6GA 2WFZA 4RE5A 1EXWA 3V1LA 2WJ6A 5CT8A 1PJAA 2XMGA 3O4IA 4M0EA 1CUGA 4Q1VA 2XLCA 5K3FB 1PFQA 4OSEA 2B20A 3G0BA 2DR0A 3DLTA 1JI3A 4GHWA 5AOBA 1MNQA 1DU4A 2OGZA 4H7KA 3WIBA 1ZICA 3I6ZA 1WOMA 1LPSA 3AIKA 4AQDA 5IVKA 1IMJA 2DFPA 5AM4A 4ZRDA 4CI9A 5A71A 5HQ3B 1QIMA 3DS8A 4D9JA 4K6HA 3STVA 3CCCA 1TIBA 4XJVA 4YASA 1W6RA 3D7RA 5BOVA 4ZV9A 2HA7A 1TCAA 1LPAB 1GGVA 3WYDA 1BRTA 1EDEA 4G4IA 3AZOA 4XX1A 1F0PA 5LZ5A 2JEZA 1HLGA 2HFJA 5ALHA 2CUTA 2ZYSA 4ARAA 2AXEA 5ALFA 4AB1A 1IUOA 3STXA 4QLOA 5LZ2A 5AK5A 2LIPA 2ZJFA 1B41A 4OB8A 4BDTA 1FJ2A 2WLSA 3FSGD 2GBGA 2GZRA 5LZ8A 5HKBA 4B0OA 3DNMA 2HRQA 1MAHA 4KYVA 2XI4A 2ES4A 3IUJA 1QJ4A 3I28A 1ZIYA 3FCXA 2W22A 5FXMA 5K3AA 1YAHA 3MGAA 4LKOA 4BC1A 4E11A 4Y2XA 4W1SA 2PVSA 2QZPA 4UHBA 3P2MA 4CIAA 3K2IA 4Q34A 1DQYA 1G42A 4IH4A 2V97A 3TJMA 1FFBA 3I1YA 4BZZA 1ODTC 3ZLTA 5E4TA 1ZIXA 3WJ1A 3C8DA 5K3BA 2WJ4A 4X3CA 3FWHA 2AJCA 3EBLA 5FRDA 5ALSA 2BKLA 5LKAA 1VA5A 2DHDA 4HRXA 4KRYA 1QZ3A 1JMYA 3FYUC 1R1DA 3WK8A 1UK8A 2FJ0A 2WHPA 1GPLA 1VA4A 2BGNA 3QMVA 4AO8A 1QIHA 4BCDA 5AHXA 3EQ9A 2JF0A 1XZMA 4U2GA 3CXUA 5KREA 3HSSA 5EIAA 1L7RA 1ZD2P 3A6ZA 1CQZA 3GELA 5AICA 3MVEA 3WKDA 5IH7A 2G4LA 4I3FA 1EDBA 1XZDA 4H7JA 4KE8A 5JZBA 2C5FA 3V1MA 3ED1A 4H7IA 2B4KA 4OD0A 3H2IA 4BAZA 1N8SA 4FFVA 1AGYA 3BE8A 2WHRA 2X8BA 3R3XA 4WY8A 2VTVA 2QXTA 1UT6A 1J2EA 3I1IA 5DTJA 3R41A 1CUJA 4FLEA 2VATA 2VF2A 1AUOA 2C0PA 1ZJ4A 2HA6A 5FDFA 3OG9A 4BAUA 3WWEA 5C8VA 3TRDA 1VZ3A 1XZHA 5JD6A 3FLEA 4PF1A 3PICA 2HA3A 1XROA 3ANTA 3N2ZB 1THTA 1LPBB 1L7AA 1G5FA 2J3QA 4RPCA 2Z3ZA 5T4EA 2QUBA 4WDRA 4HAIA 4WFKA 3C6XA 4J7AA 1W52X 4CG1A 2VEOA 1VZ2A 5JZSA 3E1GA 4LXHA 3W9UA 4AMYA 2OPHA 1DT3A 1XKTA 1Q84A 4AO7A 4J0KA 4GBGA 3SK0A 4NVRA 5HK8A 4DGQA 1CLEA 3LLCA 5CRIA 4WDQA 3ILSA 5AI4A 3C5WP 4G1FA 2GYVA 2OGTA 2XUFA 2QRUA 2YXPX 1ACJA 1CUFA 2O2HA 3LS2A 2VQ6A 1GKLA 4I4CA 5AI0A 4UHHA 4KAFA 1EK2A 5CT9A 5CW2A 3WWPA 1ODSA 3DD5A 1FFCA 4A23A 5JAHA 4OU4A 2C4HA 1GPKA 2HFKA 1MU0A 4UFOA 2QXUA 2XUGA 2CEKA 4W1PA 3H1BA 4YK7A 4UUQA 5JALA 3WWOA 4HTAA 1OILA 2G63A 3SWWA 5ALPA 5DNUA 2QT9A 3STUA 1VKHA 1JJIA 4PV7A 2WSLA 5CXXA 4J0IA 4BCCA 2CMFA 3BIWA 1QE3A 4BTVA 3ZI7A 5DWDA 5KWJA 1IZ7A 2AJDA 3PE6A 5DTIA 4K5QA 4Y2JA 1LLFA 1W1IA 2WHPB 1UKAA 1UKCA 1XRPA 4X85A 3F98A 3EIOA 2IX9A 3H2GA 3F9CA 2FUKA 4OYLA 1QIFA 4AN1A 1TCBA 4AX4A 2WU4A 2XMQA 4OB7A 2HRRA 4IQ4A 3VJLA 4H18A 4HZGA 5EI5A 3QMWA 4Z49A 2OQVA 4B82A 3KWFA 5CTAA 1L7QA 2VJAA 3D4LA 3PDCA 5AIAA 1LZKA 4M0MA 4WFIA 2J4CA 1NX9A 3T4UA 1WHTA 5DYWA 4H7HA 5LLSA 3A2LA 4Y7DA 2GBCA 2CKMA 3RLIA 4H7FA 4BYMA 3H0CA 5K5EA 4ETWA 5IVIA 2ZSHA 3WKAA 1AURA 3G7NA 5FOQA 4INZA 4DNOA 2ZYHA 4UHCA 4BC0A 3I2KA 4CCYA 3EF3A 5JADA 3U1TA 3GROA 1LNSA 2Z8ZA 4H7DA 2XB6A 5AM2A 2HU5A 3WKCA 4Y2UA 5HFAA 3QYJA 3G0IA 1OCEA 2BAGA 5ISMA 3SC2A 4J0CA 2RI6A 5CH8A 1U4NA 1VE6A 4MWTA 4MEBA 5IVDA 1HKHA 1XKLA 2WTMA 2OQIA 3R3UA 1RWQA 1JMKC 4AMZA 2ORYA 3A2NA 2XUKA 1D07A 3H2JA 5EHNA 3WIOA 3TGLA 5HF6A 3WL7A 4PW0A 3PI6A 4QDZA 3BJRA 4KAJA 2VT6A 3I6MA 4BBZA 4EY4A 1X70A 3QPDA 5LZ7A 1YS1X 1Q0ZA 3BDIA 3H2KA 4AO6A 5JD4A 3FYTA 3F67A 2OCGA 4X95A 1QFMA 1DQZA 3IUQA 3WLAA 5LKRA 1YR2A 1ZD5A 3RARA 2OCKA 5JASA 5HF8A 1W75A 3ZLVA 3FYUA 4B84A 4UHDA 3V48A 4W63A 4DMHA 5JAPA 4DNFA 3W05A 2WM2A 4X6YA 3QM1A 3G9UA 4X94A 4FKBA 2H9YA 2WFLA 3B12A 1CQWA 4N8EA 4HXEB 2UZ0A 4M0FA 4XWGA 4DMKA 3V1KA 3ESCA 4F5ZA 5ALDA 3NGMA 1K4YA 2Y1KA 3WK9A 3F96A 5AH0A 1CPYA 4BAGA 2H7CA 5EHQA 5E2IA 3AJAA 4GW3A 4X92A 1Q83A 2QVBA 3G9TA 4WFJA 3RM3A 1LZLA 5A2GA 1SCQA 5IKXA 3V9AA 5D3ZA 2E3JA 2O2GA 3M3DA 2WIKA 5AIBA 2Y6UA 2HADA 4FNGA 3PF8A 4UBNA 4C4XA 1ODCA 1EINA 2BJHA 3R3YA 3JYHA 3KOOA 1CUSA 5ALXA 3NUZA 4C4ZA 2J3DA 5ALUA 1FSSA 5ALVA 1XQWA 4CCYB 1AC5A 3WL6A 1FFEA 3WYNA 2R11A 3HEAA 3QMMA 2B61A 4K6KA 5CT4A 4FLMA 1VJ5A 3L1HA 4Y2RA 5ALMA 1CUCA 4P9NA 5CMLA 4V2IA 4BB0A 4BE4A 4N8DA 2OG1A 4C88A 1F6WA 3OTQA 4XVCA 1GXSA 4RGYA 3BDVA 4BCBA 2K2QB 1P0QA 4FDMA 2XDWA 2D5LA 5A7HA 4QLAA 4BDSA 3DQZA 3ZV7A 4FFWA 1BU8A 2GBIA 1WHSA 3UUFA 1ZI9A 3ICWA 2DHEA 2IIVA 5JD5A 3VDXA 2BGRA 4J0DA 5FKJA 2OLEA 2J4FA 2QUAA 4P08A 5F4ZA 4CG2A 3QPAA 2XE4A 1ORWA 5ALIA 1CRLA 2WIDA 1UXOA 3W04A 3C6YA 3VVMA 1H23A 3H1AA 3AIOA 4UBIA 2H7XA 2JGKA 1A7UA 2XLBA 2ACEA 4AZ0A 1P0PA 1P0IA 1YS2X 4UHEA 5AP9A 4DMFA 2QKYA 1QOZA 2QOEA 2PSJA 1DTEA 3JWEA 1UWCA 3KWJA 3LCRA 5FPQA 2FJPA 3D2AA 2HU8A 4CG3A 5AJHA 4G8CA 5CBKA 2ZSIA 3SX4A 1A88A 5DNVA 4J3JA 4QDOA 1WPRA 4BVKA 1UOPA 5K3EA 1LPPA 1KU6A 1EK1A 1AMNA 5HFNA 1JJFA 2XUQA 4DM7A 3O4GA 4LXGA 4RE6A 1P0MA 5LZ9A 3DOIA 5C8ZA 5ESRA 3HRHA 3QPCA 2GYWA 3I6YA 4MJ3A 3T52A 3G0GA 1XLWA 4PQEA 2X5XA 4OUKX 4U2FA 1G66A 3I2FA 1ISPA 1CUAA 2HM7A 2XMSA 4CFSA 3IURA 1BCRA 4KE7A 1DWOA 1BS9A 1PV1A 4YPVA 4A16A 5SYMA 3L1IA 2ZJ6A 5DJ5A 4BATA 1QIGA 5LIPA 1CUBA 4GDMA 2WG0A 5ALEA 3UMJA 4HVTA 3F97A 4KRXA 3ICVA 3LIIA 4U2DA 4TVKA 5AK6A 5D3KA 4B6GA 4GXNA 4Q05A 2EEPA 3FOBA 3YASA 1C7JA 3B3QA 4N5HX 1MX5A 1UK6A 5HCUA 2W6CX 4PO3X 1C7IA 4FOLA 1SC9A 5J3JA 1X2BA 1Y7IA 5AI9A 2D0DA 2O7VA 3DL7A 5ALRA 1FFDA 5AOAA 1F0NA 2JIDA 1XZBA 1BCSA 4N8SA 3ESDA 4LHEA 4B7ZA 4WY5A 5JAUA 4C4YA 5H3HA 2WIGA 1EHYA 3VKFA 4GECA 2ZJ7A 3IULA 1SCIA 3I2HA 4J0GA 1VXOA 7YASA 3G0DA 2WTNA 3TEJA 5JIBA 5IVHA 1K5PA 3IBTA 3D3NA 2XUAA 4EZIA 2OAGA 4TGLA 4KJXA 1UK9A 1ZD3A 1A8SA 4KEAA 1EH5A 2XMZA 1Q0RA 4B81A 2ECFA 1QIEA 3C87A 4GI1A 4MYDA 3H04A 2QTBA 4XIIA 2JGEA 2ZYRA 2HA0A 1E89A 2Y2UA 5ALKA 3O4JA 2XUIA 3M83A 2O7RA 4UHFA 1VE7A 5HQ3A 4IH9A 1N1MA 3IUNA 5EFZA 4ITVA 1JU3A 4JUIA 5AKEA 3NOXA 5AKIA 3D59A 3RKSA 4LIPD 1XZIA 1WPXA 1TRHA 3E0XA 1KEZA 4ZGBA 4BVJA 3N0TA 3C8HA 1MAAA 5ALNA 2I03A 3DJYA 3Q0TA 4X7BA 3C6BA 2XMRA 3ZLUA 2XMDA 4PSDA 2R8BA 5HK9A 3FNBA 1YCDA 2DCMA 5CURA 2OGSA 1CUXA 1MO2A 4X00A 1GT6A 1UOOA 3R3ZA 4HRYA 4ZWNA 1MPXA 1R9NA 4KE9A 2Q0XA 1JFRA 1QO7A 4J0JA 4QZVA 4YX9A 5ALLA 3UUEA 3LP5A 5EIHA 3HXKA 3JW8A 2QS9A 3ANSA 1W76A 4J0HA 2VAXA 2DSNA 3FVRA 2V96A 4L3WA 5AKZA 2Z8XA 4LYEA 3ZWQA 3FAKA 3HI4A 5ALZA 2ACKA 3BXPA 4E46A 2RAUA 4EY7A 4NS4A 1HL7A 2XMCA 1DWQA 1CR6A 5HKAA 3QH4A 5AI6A 2ZYIA 1ACLA 2WHQA 1EVEA 5HF5A 5K3CA 4JYPA 1J07A 2O2IA 2BUCA 4CCWA 1DX4A 2CJPA 1XZLA 3OM8A 3VXKA 2JGIA 1MX1A 2BCEA 3GZJA 1CUZA 5DYTA 3KXPA 1FFAA 4P93A 2DQYA 3BF8A 4K2AA 4FBLA 1EB8A 5JARA 4U2EA 5AM5A 3KD2A 1LBTA 3K6KA 4P92A 4FWBA 4BRZA 1QONA 1TAHA 4IH1A 2PSFA 3D2CA 2HHAA 3IDAA 4O08A 5AK4A 4QWMA 2BUAA 3AIMA 1ZI6A 3E3AA 4EA6A 2WG1A 3DKRA 1BEEA 5CH3A 5AM1A 1XZEA 4H7EA 5D7BA 1E8DA 1I6WA 1XQYA 3WJ2A 4EBBA 5JATA 4UFPA 2ONCA 4G4GA 1H2WA 3WQHA 4MQMA 3O9MA 5BV7A 2HIHA 1WB6A 4E14A 2G5PA 4KAAA 1M33A 1E3QA 3M82A 2GBFA 5FLKA 2XT0A 3DDUA 4Q82A 2WUFA 2PSHA 1YASA 4I19A 3S2ZA 3HJUA 4X90A 4UBLA 4DMCA 1AQLA 4X93A 5AM0A 1CV2A 3C45A 3IIIA 1H2ZA 1XRMA 3AZQA 4DSAA 2GZSA 1BN7A 1CUDA 3QVMA 3WK5A 4AXBA 1ZGCA 3BJMA 1MX9A 2Z3WA 1GZ7A 3U0VA 5AKJA 3GBSA 1H2XA 3R3VA 3G8YA 1F8UA 1A8UA 1RYYA 1AZWA 1XZCA 3CN7A 4DIUA 3V1NA 2X76A 1HQDA 3E4DA 3Q8WA 3I2IA 4IHAA 1XQVA 4X71A 3AINA 5E4YA
chains in the Genus database with same CATH superfamily
5CT5A 6CHYA 2F9FA 3E5NA 2PZJA 4M9RA 1PZHA 4WESB 5GAJA 1PR4A 2XTNA 4ABYA 3C4VA 1YWGO 5LOVB 1G3QA 3DZBA 1TAQA 2AX3A 3GLQA 3OLXA 1XLVA 5EZYF 4O5OA 3DCNA 1CY2A 3I53A 3L05A 4S1TA 4BFVA 1D4ZA 4AY6A 4TSRA 3Q72A 4OUDA 1YJCA 2J3JA 3RUCA 4DJTA 1GPBA 2BKXA 2JHAA 4RESA 4H1UA 4PWYA 1KEEB 1B8UA 5B7NA 1A77A 2DT8A 1JAHA 3ABQB 1GYPA 3FPAA 1KNXA 2YVLA 3GFTA 3HKBB 3KYDA 4YAUA 4XWWA 3UFXB 5EKDA 4ND5A 1N5KA 1RACA 5FBWB 2PTHA 4D4HA 5ALTA 2J5BA 4JA0A 1PZXA 5K0JA 3BBPA 4NEGA 4OK3A 4ZOLB 2JBWA 4AF6A 4IMJB 1JTFA 1SOUA 3U7RA 3DXFA 2HU7A 2FUCA 3IODA 2QNIA 4EL0A 1TM2A 1QVAA 4B7XA 4C03A 4H1WA 4LWZA 2FZKA 2SNIE 4MQUA 3RYHA 5IUJC 3QEAZ 1RYNA 2WU3A 3AFIA 3S1LA 4WL0A 2E55A 4W9NA 3NHYA 3OMXA 3OUZA 4LV5B 1VJDA 1ODKA 3TTXA 5J47A 2YN4A 1Z62A 1XPUA 1DELA 1US8B 1XJ5A 5JMWA 1ECCA 1Z06A 2C9MA 3W8DA 1YE5A 5CM2Z 2ODWA 5BSFA 2GHQA 2XD4A 2QN1A 3K1TA 4WA7A 4EECA 2VTBB 2BZ0A 2RH5A 4UPEA 1Y9AA 2Z1MA 1F8YA 5E9AA 1QNFA 4FGKA 4G1EB 3TQCA 3ZG6A 3RS4A 3S1SA 4G1CA 3FPCA 1N7JA 1OAKA 1OHHA 3GB9A 3PXCX 3S2SA 2GPJA 2X42A 3ICCA 1CRQA 4X64B 3QJYA 1N5LA 4DZTA 5G2OA 2B8EA 2YV4A 3CG4A 4IIJA 1NVXQ 4DS3A 4ZPJA 2CLCX 2JANA 2XDAA 3FWNA 3DTVD 1QTRA 3CR8A 2CT8A 4JI4B 4H59A 4I50A 2VUUA 2I3ZA 1IULA 3IMCA 5H8WA 4TSFD 3VR6H 3SBDA 1LBHA 4QEKA 1T4MA 3D2BA 4PLGA 4Q66C 5A04A 3HN6A 1CRZA 4N01A 2Y1DA 1R0XA 4OQNA 3C5HA 4Z6KA 3NW9A 4XW2A 3KJGA 1QS0B 3IXLA 2PSEA 2RGAA 3TE7A 3L04A 3STWA 5EWJA 3A58B 5I3CA 4O59O 4PGAA 3WK6A 3FMFA 3MWEB 4BO8A 2J67A 1M1UA 5IJ0A 1X1EA 1PJSA 1VIYA 1WSDA 4UULA 3WB2A 5IG2A 4JCOA 1DBIA 1TYEB 2NPOA 3DXXA 4A6PA 3HJHA 1J0CA 1HTWA 2DVMA 4J76A 5HF9A 2P30A 3A6KA 3LF1A 3WK4A 1PS8A 1OA1A 1YQTA 2JLCA 4PE5B 4YTEA 2ZIXA 4I0WB 3WLSA 1DKLA 3C3PA 4RF2A 3SSAA 4Q3BA 4OHPA 3NWBA 1X2EA 1ZEJA 1Z6TA 3NKFA 1M7BA 1KYWA 1QTIA 1WU8A 1JE1A 2O50A 3FNHA 1DKPA 4RJ2A 4DRYA 1R9MA 3B9BA 1V7ZA 4NYJR 1ZGZA 3A04A 5JH7B 2O8FB 1SCKA 1ULZA 4HAVA 2B30A 2H1RA 1X1QA 4ARBA 3G5AA 1OBVA 3W6OA 1UJ4A 1K86A 4B45A 3C14C 4HNTA 3TOZA 1LDYA 2C2YA 3KAPA 2V7WA 4D3XA 2PPVA 2ZJ1A 2C07A 5BWBA 1TD1A 2ODEA 2V0NA 2ZRMA 1KSHA 3E5HA 4FKMA 3W5HA 4TTRA 3IHWA 1SO8A 2UUAB 1WCYA 1ZUIA 2OO5A 4O4IA 3V7WA 4DC0A 4YT4A 2YJ5A 3WGOA 1XUOA 2C8JA 3K7EA 3VVLA 3C3MA 4HWKA 1X7WB 5CB4A 3RV4A 1RMQA 3D8TA 2DRIA 1KMCA 3WL5A 4ANFA 1NG9A 5D3MA 4H1HA 3R7NA 2BIFA 1OREA 1U9YA 4E13A 1C3VA 4YJFB 3ZS9A 4NRDA 4YP6A 2BFCB 1U8TA 2PDAA 4RK7A 2BLLA 2JAXA 2YV2A 2X9LA 1ZNYA 1FA9A 5LXTB 2P69A 1C5KA 1E9DA 2AS0A 2W00A 3BRQA 3R6LA 4KZPA 2PNJA 2BM8A 2XKAA 3HA7A 2YY5A 2A6PA 2JIBA 2BZGA 5KX5A 1HLDA 1PW7A 2AD1A 5EHGA 4AY2A 4FFBB 3BH7A 1AB6A 2XRFA 4RM2A 2IU0A 4AK9A 1IVSA 1O54A 3WI7A 1RWMA 1HETA 1Q7RA 3SE0A 2C8LA 2JJ1D 1IONA 2IVFA 4MVCA 3SIRA 1U1FA 3F1LA 4KW7A 2M6RA 3QG1A 3UQYS 2P9TA 3EEIA 3ZQUA 4OJMX 2I4LA 2XB9A 4H08A 5EHIA 2QAJA 3K2QA 2PANA 3LA8A 4ZO8A 5HMMA 2J3IA 3U3KA 5EJ7A 3BK7A 4B35A 5IYZB 5IHXA 4F0JA 5CA0F 2ZUCA 4KB5A 1EWVA 3T3PB 3T12A 1TQDA 2IEYA 4R1QA 3GF4A 5HWSA 5AVJA 5HZKA 1Z22A 5A7GA 1OKKD 4O5AA 1M2WA 3EQ7A 2H1LA 4RAQA 1X1BA 3DF7A 4M0UA 1UJMA 3GEIA 4MR8A 2Z08A 3QLEA 5I9MA 5ED4A 3QXCA 2IDZA 2P68A 3UWPA 4EI9A 5KDLA 1YKSA 3T1YB 5IBPA 4DBZA 1LJUA 3OY2A 1JFSA 2EX1A 2PUHA 2YCLA 2E1PA 2WLTA 3ETNA 4TWIA 3E9EA 3HXPA 4X63A 5I4IA 1ZW6A 1NP7A 4Y2YA 4I9UA 1OY1A 1IZZA 4JWTA 4ZTUB 1KP3A 5CK5A 1UDWA 1NJ2A 3W9YA 3ENWA 4YT8A 2AVNA 2COEA 2HDWA 3OC0A 2A7QA 3MERA 4A73A 3U1BA 3ANYB 1JEQA 3BFKA 3PWSA 3TB4A 3O9VA 3OSZA 4L9WA 3Q3GE 4G9EA 3HVUA 5TMEA 1D7AA 1BMFD 1QWOA 3DMHA 3LT4A 2IYLD 2AJTA 3IRVA 4GLOA 2I2BA 3NDIA 3M1YA 3SZRA 4WBNF 3FROA 1KPGA 4OLBA 3OVMA 521PA 5KYWA 3CZCA 1OW3B 2AXQA 4RA6B 3UK6A 4B6FA 3W06A 1M6HA 4ER3A 1BHQ1 2GEKA 1U8EA 4DCSA 4R9RA 1V71A 4KDCA 5CGZA 3RW9A 4W7IA 3AVYA 1UXKA 5AQ1A 1XVLA 4O25A 1F2VA 1XRLA 1R3UA 2JGFA 4XQGA 4C7BA 1UZAA 2O7SA 3L0IB 1JJBA 4LHZA 1KAOA 2ATIA 2RHDA 2I3DA 3HDHA 3K2BA 4YMHA 3ABZA 4M9QA 3BTOA 4NULA 4WCFB 3FUCA 3AI1A 3GG9A 1YL5A 3OZXA 4L7VA 2KMLA 1QV7A 1XK7A 4JLJA 2GH1A 3PC7A 2XNSA 1WIWA 1J0EA 4G1BA 4BQFA 1SUAA 2WB4A 2MIIA 5BV1A 1MO4A 2X1HA 4TPKA 1ESDA 2QPLA 3TTTA 2RJOA 4HVAA 3OLZA 1BVYF 4K9SA 3VC3A 2OYCA 2A5FA 4XM1A 4O4HB 1GCAA 5E9JA 3D7MA 3X1JA 2I76A 4DNQA 3BWXA 3BT7A 3NXKA 2H16A 2ZWAA 3PDIA 5JDIC 5FPHA 4EJ2A 3OWHA 4F4UA 1YNOA 3OQHA 5K4HA 2Q5LA 3CRVA 4A2QA 2Q3LA 2AD5A 1E98A 2QD5A 3G3EA 4DZZA 4O3FA 4F60A 5L4NA 2CJFA 3RR2A 4P8RA 4X1KA 4JI1B 5IT9A 5TT0A 1KY5A 5A05A 4YVFA 3ZDRA 2YS7A 3ELDA 1K63A 3M8KA 4YO7A 4MICA 3HABA 3PDUA 4YAEA 4E2ZA 1SXJB 5FUYA 4AG3A 4ZAGA 5JAMA 3O8CA 3FMGA 1UL1X 1LBSA 2BMEA 3M5DA 2Z1DA 2Z2IA 3OQIB 4QULA 1OAOA 1FF9A 2ZJOA 4IVNA 2EP7A 3DL4A 3WDKA 3U61B 2ZYDA 5DHRA 2XUJA 2G06A 5DI3B 1VI5A 3DHNA 4D9IA 4QPPA 1CRPA 4J03A 1NNLA 1XD2B 4LV8B 5CFZA 4NJOA 3IR5A 1H1DA 2PKRA 3NOQA 3OETA 3ZE9A 1IXZA 4EPYA 1I5OA 4X44A 4C1NA 2NT3A 4GRDA 4MWOA 4X6LA 1RXUA 4L8VA 4W99A 5J40A 5KSWB 5AWFC 5TJHA 2C4VA 2REXB 2O2ZA 2JJQA 3TZBA 1J24A 4BGVA 1ZOSA 2G9NA 1NATA 4KXXA 1PI3A 1ZGGA 4PO1A 3JY6A 1ULUA 2ZYWX 3K9FC 1ETHA 3HZOA 1PE0A 4DTCA 1BW9B 3TCNA 1C9MA 1OU4A 3TDMA 4ZRNA 2HT1A 1O4WA 1NQWA 1RWNA 1R4NB 2AC4A 2GVDC 3C7CB 4TS4A 1ICIA 4DG9A 4WBNA 4PLZA 2YY6A 4RVFA 4DXHA 5KYKA 1A7JA 1DHTA 3X1DA 1QFSA 4DV5B 4HGOA 3R9KA 3BZWA 1IDN1 3DYVA 1IHDA 1Q0UA 1QGZA 1UBCA 1JLKA 2UZ1A 3HZZA 5BYAA 1KJIA 3AVTA 3NXSA 4FEAA 1CDOA 1GFSA 1EX9A 4X61A 4DPLA 4E51A 4EABA 5HTOA 2ZUVA 2O7NA 2ZB3A 2G09A 1SXJE 4ZALA 4EY8A 4PZ9A 5EZSA 1TECE 2VHVA 5A62A 3WKEA 4PX3A 3OAAD 5SV2A 2OCAA 2WF5A 1YKFA 4ZAVA 3GCXA 3ZHVA 1XWFA 2BE9A 3F6BX 3OD5A 3QWBA 5AI8A 3TZCA 2DQZA 4EA7A 4FFLA 4MAMA 3FLAA 1D2EA 1KGSA 2YWFA 3EXFA 1SAYA 4B0PA 1H6BA 2H85A 1TF5A 1LPNA 3DYIA 4FN5A 4ND3A 4BUCA 2V3WA 3MCVA 5C32A 2PUDA 3K0CA 2O5CA 1BE0A 3TXAA 2XNDA 3O8OA 4L8YA 4R7ZA 3F7MA 4AC9A 3R0IA 3RSOA 3GT0A 1YQGA 5B2ZA 4ND8A 3LKBA 3NDBB 3KJEA 4RYDA 5CA0A 1Z2EA 3D4PA 4D44A 4GWKA 4QG3A 4G4SO 2O4UX 2IFTA 2ID4A 4I66A 4IFIA 4JJZA 5F4BA 6ADHA 1R9GA 2IVZA 5HM6A 5HUJA 3FNQA 3QI7A 2NYVA 4LXTA 4OLFA 1W6UA 2NZJA 2WG2A 5ICFA 1V1MA 5B6JA 3PJRA 5CH5A 4M7WA 4Q4HA 3ESYA 1QLHA 4W1RA 1T6YA 4Q9AA 2AZTA 4FUQA 1TQHA 1U3DA 1ESEA 2XUPA 1FY2A 3C70A 3R0VA 2OYSA 3DKIA 3IX7A 3U4DA 1NUPA 1Z73A 3ML1A 3AF0A 1KSGA 1OLXA 1KFBB 4FMPA 4JI6B 4DV0B 4CBVA 4DF3A 1T4CA 4DOMA 1E20A 1SVOA 2LGJA 3HACA 2Y6VA 4Y2HA 4CIBA 5KVVA 1KVUA 3E82A 3ZTTA 1SR8A 1DO8A 2I4MA 1EU1A 3A1CA 2GTIA 1C2YA 4QYXA 4LE1A 5H3LA 4AWAA 4YMUA 2F3UA 5KWIA 4PQGA 2GD6A 3S0JA 4L2IA 2H3EA 2IXBA 1G17A 4OIMA 4X8OA 3WYFA 1QVVA 3MBOA 2DETA 2IV2X 5IXYA 3FSGA 2QT0A 2X8JB 1ULAA 2Y2VA 5J4HA 3UAGA 1DOZA 2A9OA 2ZB4A 3WLIA 3ZU3A 4HN4B 4WK2B 4C78A 2HPHA 5CCXA 2Q9CA 5TPWB 4TKUB 2F9MA 3BGSA 4HVLA 4EJMA 2PU7A 1X8KA 2RI1A 3B53X 3IVCA 3MPUA 1HNXB 3IQZA 1VIVA 1Z0SA 4OXNA 4WGGA 2H63A 3KB2A 2C00A 3MGBA 2HA5A 2YYYA 4G97A 1NT4A 4F84A 3EFOA 1AQNA 4KIWA 4OQDA 4EJSA 3K8OE 5FAXA 2ZVDA 2GXUA 5KWVA 1H4TA 1NN5A 3B1ZA 4BNHA 2Q3EA 3HBAA 3SJBA 1PWZA 2FWIA 2YFYA 5FBKA 3CZPA 2E4ZA 5C7IO 3B6EA 3PUYA 1L4LA 1N6IA 1LFDB 4MWGA 1U0BB 4MS4A 3JZIA 4PC6A 4DLNA 3ZZ1A 1ZGAA 3KB1A 4LJLA 2EARA 4FEEA 1L5VA 1TZKA 1B6TA 3PX7A 1J97A 1UWVA 3THRA 3U44B 1G4HA 1G63A 2B78A 2JGMA 2Z2ZA 3KLMX 1V3VA 4Q93A 3PGXA 1XSEA 1XF1A 3UH1A 3VR3A 3TQRA 2PKYX 1H2YA 2O5VA 1ZKDA 4A5SA 2O1SA 4CKBA 4MV8A 5FWDA 2I22A 1Z5UA 4V39A 4X7RA 1I24A 1K7EB 5C34B 5KYYA 2BSQA 3MCWA 3N1UA 3ZXSA 4J6FA 1PKXA 1E3SA 3I0ZA 1X77A 2R1UA 3IIKA 1U9ZA 1C3EA 4JGBA 3ZH2A 4QUGA 2GRUA 2RH9B 5HFJA 3WOVA 3ZJYA 3B7WA 4CF7A 2BKUA 3OURA 4C6RA 3UY4A 5REQA 3GQBB 3L1UA 5JVDA 1H2BA 1KI7A 3KDAA 2WILA 3PEEA 2NTVA 1XRRA 4GF5A 4H4CA 1NKTA 4WK0B 3SBXA 3ZPXA 2NSLA 3SN6A 1U8UA 3KEMA 4S24A 3KTFA 3TSZA 1TEZA 1GAXA 4UEOA 2ZDHA 1TC2A 2RHHA 1TU3A 5YASA 4OFZA 4HKTA 5LYYA 1ONSA 4HXFB 4ZYXA 4X7PA 4OXXA 2QTMA 4RHCA 4KR2A 2GEDA 1V6SA 1YR3A 2FSSA 4ZIRB 4OLJA 1A9SA 2WRZA 1M6VA 1DFHA 2WQZA 3C4QA 3U7IA 4AT1A 4ZVTA 1FP4B 2VJYA 4GOLD 4H0NA 4BJ1A 2C9ZA 1AKVA 4K9NA 2OEPA 5T41A 1KVSA 1R5NA 1PIWA 1EFPA 4ONEA 4WBSA 2NXEA 4U0JA 3BWMA 4Y2QA 2IS4A 3VGJA 4O29A 5G40A 1FSGA 4IJQA 3VJKA 1ZGJA 3VZBA 3DTYA 4EB0A 5AJYA 1BWRA 1F3OA 3MUOA 5EZYA 1TAUA 4RD4A 2O8DB 4N7RA 1WUIS 3HVHA 1KRHA 3EXIB 5HEKA 3IUEA 5DI3A 3DFZA 1P2FA 1W5EA 1S8OA 3EG9A 3I1JA 3WWDA 3RB8A 4OFWA 1VPVA 3RVRA 2RD2A 4E94A 4QBHA 1EM6A 2PAAA 1BOOA 5L3SB 4X54A 1MQSA 4QUIA 3TF5A 5K3DA 5IKOA 5IWAB 1E8MA 1DIHA 3Q12A 5ARDA 2XEXA 3DBLB 2CCJA 5BORA 2IYVA 3AVWA 3D6UA 3PDHA 4EF6A 4BFYA 4JB8A 3T5TA 4HTFA 4KXYA 2CWDA 3EMDA 2C2OA 3CLKA 4TLEA 4X97A 4ZXFA 2FX5A 3PXXA 1VG0B 1VBNA 2Y67A 2VXYA 1DCMA 2JK1A 2JIOA 5IJAA 4RKYA 4EA8A 1KDOA 2ID8A 2IDMA 3C3BA 3LRPA 4G0NA 4D4LA 4HV4A 4DR7B 1JKMA 1WRBA 2BR4A 3O6VA 3B7PA 3G2IA 4QPZA 3CLTD 2XV1A 3OZEA 3J7AC 1JJAA 1GG2A 4RF4A 1FW8A 1MZVA 5ERYA 1RXYA 1UODA 1M1YE 1M2VA 2A9VA 4MJXA 1EM8A 1YZTA 3L8GA 4B74A 1C2TA 3EXAA 5LIRA 3P9NA 4PYJA 3TS1A 4BIMA 3KQLA 1LRLA 3L8YA 4B6RA 2ATXA 1A2QA 1ZK3A 2HTFA 4IIFA 4JI3B 2GKSA 4ZICA 1NLZA 2QJWA 2OR3A 2VSNA 2GKOA 3DWFA 4TV8B 1K5HA 3R5SA 5TQVA 3WZMA 4D4JA 2PX5A 3LY8A 2WFMA 3PCTA 5D6OA 4IJKA 4BMZA 5HZGA 2WA2A 4N0QA 2C4WA 2X7XA 1SC3A 1L4UA 4TYMA 3PPIA 1WCXA 1ISJA 2I7TA 4ADSG 1X1RA 1JLRA 3BGWA 4IEEA 4GR5A 3T6KA 2VPQA 1C1HA 4AN4A 1BCRB 4HF7A 3AEQA 3DBHA 1GUZA 4HQ6A 3ABIA 1ISFA 4ND8B 3HCAA 4PS1A 3TEMA 2NAPA 3T5BA 3ABSB 2XCQA 1UMCA 3IHKA 4MW2A 1VCHA 3O1HB 4PZEA 4QFBA 2WR8A 1IMOA 1E2EA 5A6VA 4WLVA 5DMXA 4QUJA 2EXXA 4OHXA 4YDQA 4IO0A 1TU0A 2EAUA 2Q9UA 2VFAA 1PN3A 2Q5HA 3QFSA 2B0CA 3OE1A 1F2UA 1Q0LA 2FW0A 1U65A 5A9SA 5J5AA 3HGQA 2OXFA 1VBMA 1Y34E 3KTDA 3DVRX 5JQGA 5FHQA 1JKJB 3GLHE 3SVLA 1II8A 1CY8A 3NHRA 2MOKA 2O7QA 1Z5WA 3TIIA 2RK6A 4AKHA 1OLUB 1T4CB 3V8VA 3VNBA 4C7KA 4B5LA 5DZSA 1WWKA 3RUPA 3N2LA 1TZMA 4P31A 4NR0A 2DERA 1JPVA 4KWHA 2N0SA 1EEXB 3ZV6A 1V16A 1QYXA 2PBRA 3CNBA 4F3CA 1U0TA 2JGLA 3K1AA 6PFKA 2R48A 4OHCA 1FSZA 2BFEA 2PZ8A 2PBFA 2VWPA 3ZXUB 3LO8A 3S28A 2H1OA 2O6LA 1V6AA 2NYAA 2A0KA 3OJCA 2YDYA 3WO0A 2EVWX 3DTVB 3LUHA 1FYFA 2EGUA 1ZOLA 1XKQA 1VOTA 4L74A 3LQYA 5FTNA 2PHZA 5FWYA 2VAMA 3HBLA 1HMYA 1ZUNA 5FTLA 1I0ZA 1SUCA 1ZO8A 1SOMA 4MVWA 3QNUA 4MXDA 4S3MA 1L5NA 3FTFA 1XZJA 2PUEA 3PFGA 3HYCA 1HQYE 3ZGXA 1GLVA 2V0CA 3B36A 2ZJ0A 4B9AA 5AKLA 4Z8XA 1HR0B 1YTUA 4ZCSA 3EWAA 3CF2A 4YCCA 2H48A 2IOHA 4J7UA 1F38A 2PS9A 3M3PA 5H81A 1SUDA 3BJIC 3CVJA 4X6UA 3ANLA 4EFNA 1W4RA 3OBBA 3OEHA 3ETCA 4DCNA 2H2GA 4LF4B 5HW0A 2QVXX 4AECA 1TC1A 3RUDA 2C7BA 1QCZA 3BMQB 3FOWA 1A9RA 5JI3E 2OD7A 1TYAE 5EFOA 1MRNA 3NAZA 1HG0A 1DJMA 1F8FA 2TS1A 3D5QA 3DMGA 1KEWA 1CUEA 1JHDA 2HJ9A 2Z8YA 4V02A 3RRBA 3WBBA 2PX4A 5JT1A 2DFNA 1UZLA 1AV7A 4F9TA 4ZI5A 3JS5A 3CV3A 4PSUA 3JATA 4Z4QA 1QUEA 2FMXA 3OZWA 4QA9A 4RHUA 2HHCA 5AKXA 3LC2O 1UMDB 3TNFA 3KAQA 4QICA 3OBIA 1WPQA 4OO3A 4TKVA 3DZFA 4P3PA 1DKOA 1SIUA 4XASA 1XDDA 3ZLBA 3CPHA 3D31A 4G0VA 5E6RA 1Y37A 6YASA 2ZI4A 1KFJB 1TZ2A 4I5EA 3O94A 4NV1A 4QLBA 4WESA 1M0WA 3H97A 4WGFA 4YRMA 5JV5A 4OGKA 4LSZA 3H5RA 2K87A 4LY3A 4L16A 4C89A 4CEHA 1NE2A 2MSWA 2QR3A 1HFWA 5ECYA 3TUJC 2FN9A 4PSVA 2MSLA 4BN5A 1Z2CA 3UB4A 1NN3A 2REOA 3ZWCA 5ITWA 1V26A 2HQBA 3BVPA 2VAVA 3QUCA 4OUDB 4N5DA 4UBKA 1KRWA 1T5HX 1XTJA 3L1VA 3EMBA 4EY3A 1E2QA 2WFZA 3HCNA 1FUKA 4L6CA 1VBKA 3URMA 1GAWA 4GI2A 1WO8A 1D0IA 2ZWPA 3KYJB 4OHUA 5DV9A 3O03A 4JBYA 2D8MA 5F12A 1IQ0A 5LQRA 1DXQA 2J6BA 2RHCA 4PRYA 5I7HA 1PJAA 1R0ZA 2XMGA 1MH1A 3H5NA 1MXHA 4JFAA 1VG1A 4O02B 1WX1A 4M0EA 1O94C 3K20A 4Q1VA 1X1DA 1YZFA 4R98A 3EZ2A 4R9NA 1T9DA 5EZYB 2B20A 4MKGA 2TECE 3I83A 621PA 3PENA 4L9SA 4TLMB 2BMWA 1M6YA 2HMAA 2ZSUA 3NDJA 3OLWA 4JZYA 4AUNA 2LWIA 1GCIA 4FYVA 3NC0C 4FEGA 2W93A 4TS3A 2ADOA 1N6LA 1ZCZA 2QRNA 3WRYC 3AONB 1BEUB 1ZPDA 1JI3A 5J4KA 2VL7A 4I6EA 4M53A 2AW3A 1YZKA 3JASA 3O26A 2QZSA 5IAJA 3TRFA 1H2EA 1MNQA 1W19A 1PWHA 1ZQ1A 1XEXA 3DDOA 4JROA 4O2LA 5EOVA 4H7KA 5CITA 2EFGA 2FWPA 4A7PA 2VTBA 5G0SA 1K3TA 4F5EA 2A7XA 5I7FA 1QCYA 5IVKA 2YQ5A 3IUSA 3TR0A 4FHDA 2CNDA 3KPYA 3G5TA 4QHTA 1OI3A 4FYKA 2HDOA 4MINA 3FTDA 3GLVA 4XIJA 5HQ3B 2IZ5A 5EQDA 4NZOA 3CGWA 3JVDA 5CYPA 3B2EA 4Q9DA 4D9JA 3CVYA 4DCVA 4HB0A 2B92A 2EHJA 4HH0A 5KDDA 5CD9A 1GGKA 1G8SA 4KWCA 4BNFA 4EPXA 3SJUA 5DHPA 4QBIA 2VI5A 3MOIA 2AQKA 3L5OA 5FWAA 4EELA 5BOVA 1FEZA 3U3RA 3N2EA 4IDAA 1A97A 1MABA 1T15A 4DA8A 3ECAA 1SVSA 1BTOA 5L3QA 2UXDB 1JFFA 2NUBA 3A4YA 3SZGA 2QN3A 5EWJB 3WVNA 3WYDA 1BRTA 1X74A 2XOXA 3AM3A 3WRYA 4QVIA 2P4SA 3MQ2A 3R5HA 1OFGA 4XX1A 2I62A 1HYEA 3ZU2A 2FWRA 5CYOA 5EJ6A 2FG7C 2JEZA 3DQQA 5K0EA 1HLGA 2VCHA 5KQLA 3MTDA 3QVWA 2G17A 3F49S 4KNVA 2H00A 1TK9A 2NUPB 4ARAA 2W90A 4YIHA 1JN0A 1RZUA 1WDTA 1SVKA 1NAIA 1NQAO 2VNJA 3B1VA 3MB8A 4AB1A 4X24A 1DC5A 4E1AA 4MV5A 1IIRA 3OE7A 5LNK6 3GEMA 1EFHA 1QO0A 1RE0A 2BTQB 4ZYUA 4OB8A 1E2DA 4BDTA 3DTTA 2VSOA 2IBSA 3U9TA 4GX2A 3ROXA 1L7NA 4MVXA 4ZP1A 1FJ2A 1QYVA 5E9WA 1PBTA 1F2UB 3OQBA 3JD3A 4FSHA 4FX2A 3UCEA 2GZRA 4IJ5A 2YVAA 4B0OA 3EG5A 1KDRA 3K1ZA 3K4QA 3NDPA 1XZ8A 5AUQA 1CJBA 5AVWA 4CFZA 4KYVA 1EUDB 2DEUA 4OQEA 3D8UA 3IB6A 1NBEA 3Q9NA 3QWHA 4S0ZA 3Q8KA 1NF2A 1DV1A 2AEFA 3IUJA 1QJ4A 1E94E 4TWZA 4CT0A 3NH9A 3H11A 3TSOA 4YYEA 1A8PA 3WLPA 2ZRNA 4QGGA 2EFYA 2CSUA 4PXAA 1QE5A 3A0UA 3ZY6A 2RHLA 5FXMA 5K3AA 3UWOA 2NP7A 3ZZNA 4QJIA 5LVAA 3OSUA 4LKOA 3O9ZA 1N0WA 4V1CB 1EP3B 1FYXA 2FA9A 4HUJA 5AOVA 3ZJ4A 2H5EA 4QQRA 4PC1A 1JXAA 4W1SA 4Y2XA 1SHZA 1AU9A 1P3DA 1UM8A 3VHXA 2QEQA 4G5RA 4UHBA 1P39A 4MRVA 3ZE7A 2UAGA 1ZWKA 2OLKA 3AT1A 3SOPA 2V58A 1AMUA 1R74A 4J16A 4B09A 4ZMSA 4K8RB 5JWOA 1G42A 3AF6A 2QR2A 5JFTA 3VVBA 4RQTA 1FFBA 1U5BA 2A1UA 4F3NA 1ODTC 2PXHA 2YWEA 4H6VA 5LA6A 4DAEA 1Q44A 5JCXA 5JNSA 3WJ1A 2EBFX 1GEEA 1E3LA 2DSTA 1U3FA 4OJKA 4BQIA 1NVFA 3ZE1B 2PKQO 1SQ0A 5JZVA 3FWHA 1MLDA 4DV1B 3T7KA 5E38A 4XUGB 1UBEA 5KU1A 1FTYA 3ZNNA 3I5UA 3FZEA 1DAHA 2Y76A 3LDAA 3IHTA 4CKZA 5HOQA 6ABPA 1AQIA 3LLVA 3CX7A 4PC3A 4X45A 1E3WA 1IDOA 2GM9A 1SCNE 3L1KA 1Y3IA 2E4YA 3FDIA 4ARSA 3BXXA 2FZ4A 1LVGA 1O8BA 4W5HA 4X66B 2H17A 5KVSA 3CRRA 3DWIA 3CLTC 3MJTA 4MR8B 2ZJ3A 2V54A 1QZ3A 3BWCA 3HR4A 3OE7D 4OAOA 4NBWA 4YT2A 1JF8A 1U8YA 4W5RA 1R1DA 2CXOA 3IQHX 5IX8A 5A0FA 2WHPA 4PG7A 3U4AA 4DA9A 5C5CA 1GDHA 3QMVA 1ZC3A 1J33A 3WHLA 4BVFA 3HXOA 3AR8A 2Y3IA 5IH3A 3ZD9A 2IXDA 3RSGA 3EZ9A 2JF0A 4E5UA 3TBHA 2HJWA 4IDPA 3SXUA 3T38A 5KREA 1L7RA 2N46A 5D01A 3M5WA 1ZD2P 3MVEA 5EXTA 2QL6A 4IINA 2HV8A 4GM4A 2H4HA 2PJZA 2ODQA 3N2KB 4PIPA 1KC1A 4U9IS 4WOJA 4Y6GB 4KP7A 5CA1F 3H05A 4IPTA 5KMGA 2VQEB 2CNLA 4II3A 4Y9RA 4KK3A 4GXQA 5DTQA 3FH0A 5LU9A 1FTQA 1Z0KA 3G8CA 3NPMA 4JDUA 4PFJA 4RK0A 3TX2A 4JEMA 4E1BA 2WKPA 1ORRA 2IYPA 1MB4A 3PWTA 3RC3A 3TR5A 3SZLA 2IZZA 4H7JA 2H1CA 3W4IA 4KE8A 2WTEA 5JZBA 1NDUA 3QIAA 2C5FA 2VDMB 5M04A 2DPXA 2F3RA 4HGQA 3FZQA 2IUYA 4TUYB 3UUGA 4CTJA 5KSZA 2B4KA 1YI8A 1N8SA 1EXNA 2GSWA 4EKYA 5E2AA 3QKRA 4FFVA 5AJTA 3C3XA 2VRCD 3HN2A 5DVZA 1SBTA 2B8WA 2HD4A 3H0KA 1TGYA 4R81A 4HWTA 13PKA 2OE2A 5U4QA 1ND6A 2MWMA 4Q01A 3OX3A 1Z47A 2WZDA 1E1QA 2O2XA 1KP9A 1P7WA 1GZSA 3QU7A 4R40A 2VATA 3I42A 4LOKA 4O8CA 4J3NA 4DV3B 1Z74A 2HA6A 4N1AA 3CY6A 4IGIA 1FRVA 4CIDA 2JKVA 3AR5A 4F1WA 4NJEA 4MGEA 1JJVA 5A5VA 2OK7A 4UM9D 1O9HA 2GO7A 3TRDA 1M2NA 1M5UA 1GQFA 1M1YB 5JD6A 2PS0A 3FLEA 1XWIA 4TKZA 5AVSA 4QJ3A 2FETA 4P58A 2B98A 4OGLA 1WV0A 5EEHA 1V45E 4WAUA 5IRCD 4INOA 1U28A 1MDFA 1ZMRA 3ZVMA 1E96A 3AHJA 5D3MB 3BQNB 1WUKS 1QGDA 1R5OA 1THTA 3FSEA 4DY6A 3DOCA 1XPOA 5TVGA 1B8PA 1FFHA 1PJLA 2WAYA 5TMDA 1ID1A 2P3QA 3IOEA 5IZCC 1FNMA 4PRLA 3L84A 1U2ZA 3WGJA 4YQYA 2XA2A 4EI7A 1P2BA 3UJNA 4PTLA 3TDNA 1V3UA 1ZMBA 5KNCH 5EN4A 4E5YA 3QOFA 1XNQB 5HA5A 2BH9A 1QGAA 3QUBA 1MR3F 1NBIA 1YZUA 2XE7A 2APJA 4Q39A 2HMYB 2IHYA 1VZ2A 2AN9A 1DAGA 1DUVG 2IP4A 3GRRA 4ZN6A 5BN3A 3E1GA 5JZSA 3WDMA 1GAJA 4LECA 1JHUA 3HL0A 2OWEA 2F55A 2FXIA 2BHRA 1U6JA 3PHCA 1HX7A 4XQ9A 3OJWA 5KQMA 2VBGA 4F5YA 1BYIA 4PVDA 1E1QD 1UUFA 2IQIA 3W5SA 4BFXA 2OTCA 4Y9UA 3M1AA 5JXWA 1S7GA 3IKJA 1FDWA 1BMFA 1UBTS 3SSNA 4F4DA 5FA6A 2GAAA 1G2QA 1KQ3A 1ULTA 2C42A 4OQXA 5EE0A 3REQA 3ILSA 3RVJA 5AI4A 4R69A 1YQWA 5CP8A 3RANA 2XD9A 1TEHA 5KOJA 2OGTA 4FX5A 2QMZA 3ZNQA 1K7YA 4II7A 5FUVA 2QYHA 2DJIA 5AJXA 2P90A 1YQDA 3T95A 2O2HA 2D7DA 2CZCA 4XIGS 2PVPA 4Q6BA 4O6VA 3TTVA 1Y7PA 4H3HB 2NZ8A 3QEOA 1EK2A 4KAFA 3HRIA 4B4KA 3P32A 1AKYA 1MO3A 3BWEA 1M10A 2EFEB 2WDPA 5EJ4A 2O8VA 4QYIB 1A7KA 1NT2A 4IQFA 2YQZA 4IFBA 3WGMA 2J48A 4IIDA 1X15A 2ZZKA 3KDSE 4D41A 4YRNA 1XI2A 1W5SA 2Q1XA 1DJPA 3ONVA 3HZRA 3B52X 4RQAA 4QOJA 1Q7GA 5SYAA 5JR3A 5JSZA 1UPAA 2J07A 1G21A 1AK9A 4B2IA 1I32A 2J0QA 1CQXA 5K01A 4L15A 1RZVA 4YJ2F 5JZMA 1IWPB 1JA1A 3JD2A 1J8VA 2D5CA 4L76A 3ZQ6A 4ZYTA 4ETMA 2ERXA 1GNRA 2P35A 3H1BA 5LA6B 4OXRA 4N0MA 3U0BA 2JJ1A 2AXPA 3MXOA 4RAOA 4YBRA 4HTAA 3HSKA 3IEMA 1LS6A 2J5XA 2X9VA 2D13A 2YZ7A 3QRWA 2G83A 4J0EA 1NMEA 3SYNA 3BEDA 3OHPA 4JJFA 4DSOA 5EMHA 3KUXA 3T7IA 5CFQA 1FMFA 2BFMA 4BCCA 1KMHB 2EWWA 4P4UA 4QAJA 4DJAA 3K5WA 4HQFA 1WXDA 5IK2D 2HQSA 3WL4A 4BTVA 3C5EA 2ZPUA 3PEWA 4J0QA 1DIGA 2P9QA 5DWDA 4BNVA 1O5OA 2I2XB 1VIAA 3F7TA 1DKQA 2ECQA 3R0XA 2AJDA 3PE6A 1AGXA 2GFQA 3F71A 3IILA 5DTIA 3QKSA 4Y2JA 4AYTA 3RD5A 5LJLA 1B23P 1D1TA 3A6PC 4EYKA 3VTFA 3D02A 1ZISA 1DLJA 3IQEA 2WHPB 1YCFA 4QJ4A 4ATNA 5C1IA 5FPTA 3KQPA 4KFSA 1NUTA 4CTNA 4BQSA 1YDMA 1N8NA 3KJZA 4RH3A 5K8LA 1XZQA 1EGAA 3LY5A 1YB4A 4X85A 4Y6QA 3C6MA 1QFZA 1W59A 3RVDA 4PFSA 1YOBA 3R8CA 3RYFA 3NKVA 4JLAA 3N8DA 3QGMA 1WJGA 2KW5A 2AK3A 2BVNA 1W94A 3I8SA 4QU5A 3JRXA 1PR3A 2UYHA 2FUKA 2H4FA 1ARZA 4AZWA 5LMNB 3QWIA 3FYSA 1KPHA 1I6MA 1UEIA 2XMQA 4UQPA 2VSXA 4YY3B 3CO0S 1FDUA 3VJLA 5A4DA 1CRWG 1XL1A 2HHJA 1C7EA 1XHLA 2RCNA 2I65A 2P3LA 3R09A 4B82A 1J0BA 4HDKA 5E6SA 1QH1B 2QORA 1ZS9A 3NONA 4NBNA 4TWRA 1PX0A 2VJAA 3Q7IA 2R87A 4JBNA 4A91A 4CIVA 3BWVA 1C80A 3WR5A 2EJBA 3PYMA 2CBXA 4DIOA 2Y99A 2JG3A 5EYPB 1L3BA 4J6EA 4EHFA 5KYYB 1Y80A 3M6XA 4QTYA 1ZLXA 3G8AA 5LLSA 1P19A 2WNHA 1KBOA 3DEIA 3UPTA 1E3MA 1EDZA 1WVMA 3QVUA 4ZYLA 2PFKA 4CM5A 3OPNA 2R8RA 1Y8QA 1P81A 3U60B 2ZQZA 4KCGA 3KUDA 3L6UA 3RBVA 3RLIA 1O5IA 4V0ME 3WTCA 4C0KA 3H0CA 4E5VA 1KJWA 4Q02A 1VL0A 1E2BA 1WVGA 1XTIA 1J8DA 2QLJA 5DGCA 3WLMA 3DBOB 2ZSHA 1VPDA 2PX2A 3WKAA 4GGOA 5ARBA 3GLRA 2G6BA 1VMDA 1E1NA 4TSFA 1BXRA 3DJFA 2ZYHA 4K05A 2FHSA 2PTGA 4JLNA 2NUAB 3KKZA 2QRHA 4XLTA 1NQ5A 3LQFA 3COJA 3EMVA 1OX4A 4CCYA 1B3BA 3GJYA 3KB6A 5HKKA 2EIXA 3EF3A 2PA0A 4ND1A 2AWNA 4QUAA 1TMOA 5A1JA 1JDUA 1VP3A 2CFIA 3U1TA 4BGEA 3GROA 1LNSA 1EFPB 3OT4A 2CJWB 3UANA 3W1WA 2XB6A 3L01A 4RF3A 4Y7CA 2HU5A 4N0EA 2ST1A 1VTKA 4EYOA 4KTTE 3RQSA 3QYJA 4BMVA 4C14A 2I2WA 1VCIA 1CNEA 1YFKA 2BAGA 3O8OB 1K5GA 4YIKA 1CZRA 5ISMA 2NVOA 4J0CA 3SC2A 2WMOB 3IAEA 2PX8A 5ILOA 3JCZA 4YRKA 2BI4A 2AKAB 2YR0A 3PZRA 4ZT6A 1T9HA 2Q5JA 3U31A 3GP5A 4P5PA 4MWTA 3UJHA 4BKRA 4CIWA 1NX6A 1Y6JA 3B5JA 3F6SA 4QNMA 1BMQA 5IM4A 1PUXA 4JR2A 1I7NA 3HFJA 1XKLA 4RJKA 5JFOA 5K0ZA 4CVNA 3PRJA 1OGJA 4J4HA 5J5VA 4A0QA 1VB5A 2ZROA 1T1GA 1Y5LA 3S2GA 5T7BA 4MR7A 4FQ5A 4DB2A 1GA4A 2ORYA 3A2NA 1C0LA 2IHBA 5ENZA 4HQOA 5U4XA 4DR6B 3LPMA 1DG3A 1KH3A 5K51A 3LXMA 3LCUA 2SKEA 5JJBA 5FX2A 5HS4A 1VI2A 3TGLA 4MWZA 4YAGA 1ZMXA 2GCOA 2FXVA 4LJRA 2AR9A 4IOJA 3FTEA 2QBYA 1ISIA 3DXZA 1FW6A 1ECPA 2AZXA 2TMDA 2XBLA 5JJKA 5DULA 2X8JA 4A82A 3GC6A 1VKJA 5B6PA 4JENA 2VT6A 4C0AC 1XMIA 1HZZC 1E3IA 1VE3A 1XNRB 1Z7YA 1GG8A 1ODFA 5J59A 1X70A 4EENA 1R6DA 2YFKA 2JRLA 3EDMA 2FJUA 4AO6A 4MV3A 2JI4A 2ZSKA 3E6AA 3FYTA 4L5AA 5H0IA 1WVIA 4PONA 1V35A 2OCGA 2W6ID 3WLAA 1UXIA 5DBEX 4BVGA 5JS8A 2YRWA 3FUTA 4DA4A 4PZLA 4HLUC 4HQNA 1R18A 1A5TA 1JH8A 4MCIA 5HRAA 5CU7A 3ER6A 3AW8A 3N74A 3LWNA 3RARA 2YHIA 1T9KA 1T9GR 3LMKA 2ZAOA 5L51A 4MQ4A 1W34A 4URVR 3EAQA 3JWGA 3VO1A 4F2WA 4Q4AA 3UGKA 1NL3A 3FYUA 2NQTA 4PFQA 1Q15A 3UGJA 1KXZA 3EAFA 1CY7A 2EKBA 2XTAA 4GAEA 3RIGA 4BRWA 1A8HA 2PL3A 4HSEA 3PNSA 5EJEA 4UE3S 4OHWA 3PJDA 2WM2A 4EMBA 3FFBA 1FFGA 2C04A 2V8BA 1KQPA 3NP9A 1DJOA 5EUCA 5TEWA 1KI6A 4FGLA 2OQ2A 5EJ9A 3RRZA 3R74A 4W5OA 2BI7A 4ZAFA 5T3UA 4CT4B 1YBMA 4DW8A 4EX7A 2WFLA 4BNDA 5GZ1A 3QEMA 2YBDA 5BW4A 1JR3A 3FN4A 5JQGB 1KI8A 5G53C 4N9WA 3T3EA 1CQWA 1XQ6A 4HNUA 4I8IA 1KMHA 4N8EA 4BNUA 3O8DA 2UZ0A 3D6JA 1FMLA 3GQBA 3JWHA 4DMKA 2A9FA 2XAAA 3GYGA 3HWX1 1GNPA 1Z5PA 4JA2A 4CF4A 3K1AB 1OWLA 5BSGA 3FDFA 3AVUA 3FBGA 2PO7A 4L50A 2ZQ5A 3RF6A 4NXMB 4YDHB 4R2IA 4U7GA 3RKUA 2M32A 2WNSA 1RM4A 3NBQA 2PGXA 1T8PA 4FB5A 3EHEA 5C4IA 3U4QA 3BSFA 4F5ZA 1A96A 3NJRA 2H5IA 5AHKA 4HB2A 2BN4A 4Q37A 1XYVA 4GVPA 1HA3A 2J30A 2QUKA 2WSSD 4ETNA 5K0FA 3PWZA 4D9MA 3VNUA 5J5CA 2BBSA 2WTXA 1NBHA 1PFWA 1HLFA 4EPVA 2H4XA 2RGBA 4OJYA 4TTQA 3H6HA 4FYWA 4XCQA 5IC5A 5JO9A 3VOTA 3EB9A 4WOKA 4HY3A 3HWSA 1NW9B 4K3UA 4XSVA 4UTZA 2I7XA 4URWR 4AKGA 4GM1A 4R84A 5EHQA 1VHWA 3CEAA 3UV7A 5E2IA 1H5NA 1KZYC 3AJAA 1PNOA 4LDQA 3TW8B 1D6SA 3B1XA 3HTXA 3D0OA 3NTXA 3OE5A 1IN4A 2VJOA 1N2ZA 4QXPA 1NTOA 1X1SA 3AG6A 3B6MA 5FO1A 5JC8A 3G13A 3TBFA 2DWQA 2MSEB 1B74A 1G5PA 1BFUA 4ENQA 3ZWAA 2VXOA 3RM3A 1GDTA 2NV0A 2DBYA 3UCXA 3NV9A 4IJVA 3K70B 1DPFA 2M98A 2EZUA 2C1ZA 3RNLA 2G7MC 3VA7A 2GN6A 2E3JA 4IWYA 1CX9B 2FPOA 1TNDA 3I4FA 3WBJA 3CS3A 5FQOA 2W5UA 2X0IA 5AHWA 5AIBA 2RHBA 4V3BA 1SUBA 1Y8QB 2QMHA 1UMDA 2HADA 2JA1A 4FNGA 3B7GA 4ZQFA 1JAXA 1QQ7A 4AMBA 2A92A 2H65A 4MULA 3FX2A 2BGJA 2C0CA 4OFBA 4ZJPA 2C7PA 4P0TA 4JMLA 4N65A 1T5DX 3CNHA 3MCUA 1PX2A 4QEDA 1SC1A 1RPAA 2PRSA 2TMKA 4HNGA 5ALXA 3T3NA 4C4ZA 2V7EA 4AJ4A 3EXEA 3S99A 5BUQA 4E09A 2PUGA 4WNAA 1KEKA 3DE4X 1QSGA 3H9BA 4BQEA 4FWTA 3R2JA 1GUBA 1VI6A 2IYSA 1KDYA 4CCYB 2NN3C 5A5GA 1P5RA 1QRTA 5KKNB 3ZKWB 4R9UC 1ZM3A 3KCQA 2R11A 3RYIA 4CM9D 4UQLA 4DE5A 3EWIA 1SUWA 2FQXA 2DP4E 3GLSA 3RC7A 4P3XA 3TI7A 1EEHA 1YQUA 4K6KA 1V41E 3TPZA 4WZAB 1KPIA 2PQ0A 2VPPA 1X80B 2ZIFA 1XHFA 3UH0A 5CT4A 1MAWA 3ESXA 3SQOA 5B6IA 3CMCO 4BMDA 1OE0A 3I61A 3IPRA 4DWVA 2FPSA 4CQLA 4C6TA 1RD4A 2ZRJA 2IXTA 3E2IA 5DRTA 5JHGB 1I0IA 1TM1E 4UMDA 3VO8A 2DX7A 2OG1A 4P6VF 4C88A 1KEPA 2JIPA 1WXIA 5GADl 4G85A 4XVCA 1GXSA 2IHVA 3GW8A 1EFVB 3VU3A 1JKFA 2EC5A 3BDVA 1SK8A 4NCIA 1D0VA 1RDFA 4G86A 1XEXB 1P0QA 3DE7X 3JU3A 2PD3A 5EXPA 1DOHA 1JAZA 2YW9A 2ZRCA 3JYNA 3Q98A 5A7HA 3E03A 1NKVA 1Q14A 1ECLA 1FTSA 4HXYA 4NMLA 4TYPA 3GRKA 3GZNA 1JKJA 3HPRA 3G5UA 4R8RA 3ZJVA 2FSGA 1PYOA 4RDXA 3VAYA 3M4NA 4KQMA 1L0BA 1OLUA 5JSKA 3Q3VA 4J4BA 3UUFA 5A02A 3LQ1A 2CE2X 2DJ5A 1QYDA 1Y5MA 3ICWA 2IIVA 3CR3C 3RGWS 2XGOA 1NM5A 4JYBA 2VHZA 1C1XA 1W49A 1QBKC 1X1TA 2X40A 1N75A 4P08A 3VYUB 4O33A 2PO5A 4F38A 5F4ZA 3CUVA 3QPAA 3LTNC 2CNWD 1IPFA 2TMGA 3L4JA 4BNKA 3ZDAA 2XE4A 4ISBA 4WW0A 3UG7A 4OL9A 1VHJA 1C4KA 4JXXA 4DRZA 1JFFB 4KDEA 1UMKA 4HLNA 5EKUA 4RVDA 3VJRA 2N75A 4GP9A 3TNDA 4HEQA 1YIAA 4DB4A 1H23A 1W85B 4JASB 1QH8B 4G0OA 4AUKA 4ER5A 4AMVA 4PHTA 2D6FA 2NO4A 1F7UA 3TLJA 1K9VF 4DMLA 4DVGA 1R0LA 2GWHA 4R54A 4TZKA 2E5WA 1XC7A 2MSNA 4E5KA 1P0IA 1YS2X 2P9ZA 2VZEA 1SKBA 4FS8A 4UHEA 3DB2A 3SPXA 3UHFA 3HKDB 3V4FA 3ORHA 5DN9A 1J8MF 3AXSA 1QJCA 3KVNA 4C4SA 1OTHA 2QOEA 1XU4A 1TW2A 3SLGA 3PEUA 1VYVA 1G38A 4CM4A 1Z3IX 1UWCA 2DWCA 1EVKA 1DDOA 4ZQEA 5B58T 3MSCA 5FPQA 1OIXA 4NECA 1RQGA 2H51A 4JOBA 5KAPA 2JFOA 5CBKA 3FPBA 3RH0A 4L02A 2PJUA 2D2XA 1VLHA 5DSTA 3R7BA 3CZ5A 2GILA 2EF0A 3DMRA 5F9HA 5DNVA 1ML4A 5EMJA 4QDOA 1MF7A 2VF4X 2WD7A 1X0XA 3O8NA 1M6NA 1UOPA 1GA1A 4YYZA 1NJFA 4E5DA 5HGXA 1ZN8A 1KO5A 1XOIA 3R5TA 4R0VA 3VMMA 5JOQA 3COVA 1GNVA 1RYDA 2PT7A 3IHLA 1VCMA 1NRWA 2ACWA 1EK1A 2PLRA 4FC6A 4RWZA 5F2EA 4XUDA 3L7KA 1RRFA 1N8TA 4F72A 1J8YF 3BULA 1CZHA 2E18A 5E9QA 3ROPA 5BSKA 2NSDA 4TS1A 3UFBA 4K9KA 3R20A 4S2EA 1QM5A 3IDSA 4CMKA 4DM7A 3DVAA 4WOCA 4E2XA 2EZTA 5CR9A 5MGNA 1HK7A 3O4GA 4GMDA 4RY9A 2JH8A 2EKQA 2XX3A 3CNOA 1C1YA 1RI3A 3SQNA 4GMKA 2NU7A 5LZ9A 3GPIA 2VDJA 2Y05A 1JWAB 3JAWA 4ALNA 3OM9A 3VHXB 2N47A 2A9QA 3DDHA 1K4KA 4S1WA 3RS7A 1JG6A 1Y6QA 3FB4A 3WGHA 5C8ZA 5CFOA 2OCYC 2E9SA 1RWVA 1IRXA 2A0UA 4OF4A 2V55B 4HH4A 2RHMA 2PGLA 2H31A 2KM1A 2POQX 3GRPA 2D74A 2VP9A 5EE9A 3WRXA 2MYNA 4E12A 2WINI 2Q7OE 2DHRA 1PJZA 3FWPA 1EESA 1IWOA 2GYWA 1Y3CE 3CR7A 1DV2A 1QHHA 2BBTA 3T52A 3A31A 2JVIA 5JNWA 1NW5A 3G0GA 4V0LA 1XLWA 2BMVA 3E9QA 3BC1A 4YP7A 2R9VA 3D4OA 4F97A 2X2EA 4YV7A 3QTLA 3L49A 2FR0A 4DPMA 4AJ9A 3UK2A 2X4GA 4YAKA 3E7DA 2JLRA 4UREA 3ZDCA 4J94A 5BRNA 3R3HA 1RRMA 2J6HA 3EK2A 1CUAA 3NBUA 5HDQA 4F8YA 1Z4LA 1W5FA 3G2LA 3LBIA 3QVLA 2P5TB 3BHJA 3D4IA 4G24A 5CVUA 3CVXA 2RIRA 2O0JA 3HLYA 2VPYA 3OZ7A 2FX3A 3LZ6A 1RJDA 2G1UA 2P4UA 3IDFA 4XSHA 4DWWA 2DQKA 3ND8A 1ZH8A 4L4ZA 3OTWA 4A16A 4YPVA 1NUSA 2FX2A 3QHQA 4EBFA 3FMVA 3KQVA 1OBFO 9LDTA 1F3LA 2ZJ6A 4UXHA 4CDRA 1JH9A 2VYQA 4Q1BA 4FN4A 2OWDA 2ZUWA 3GLKA 5DJ5A 3W90A 4HN9A 4DQUA 1NKSA 2RC6A 4KXUA 2C78A 2BFDB 1C3XA 1CUBA 2P4EA 1GJRA 4JQCA 1C9JA 2HRDA 1SXJD 2BFFA 2WG0A 3NHMA 1R0CA 4HVTA 3STHA 4R68A 3G7UA 4BX2A 4EEXA 1Q0TA 3KKNA 4TVKA 4HDMB 3MM4A 1Y1LA 2O57A 3DGEC 2FSVC 1S6YA 4B6GA 4AD8A 3G89A 3NYQA 2EEPA 4Q05A 4CM3A 4O2BB 2ICAA 4XVHA 1NZJA 5K0LA 2BHNA 4I9FA 2RAVA 4IKEA 3TQOA 1B43A 5FTKA 1MX5A 4IX9A 1UPXA 3HUUA 4JY7A 3LUCA 1G3IA 1GADO 4PO3X 1TPZA 3SIPA 4CEJA 5GV8A 1E99A 1P4AA 3PX2A 4GZ6A 5BRJA 3O1JC 3CRW1 4KO4S 3DB1A 3V7UA 1MRZA 4C4PA 3TIVA 4NZ9A 1YL6A 3OT1A 3ZYZA 1BX1A 3K0EA 4NBRA 4AURA 1CE8A 2WPNA 3M9LA 5G1NA 1VJGA 1GSAA 4EMSA 2QB5A 4GI5A 4Q4JB 3KEQA 2JIDA 5HUQA 2KQUA 4LUCA 4Y6LA 3CQ9A 3KVYA 5IHPA 3VNSA 3GVPA 5CIQA 1XA0A 1J21A 2DBVO 2HSGA 5BYBA 2WIGA 4EG4A 2X0NA 3INGA 1UKEA 4GECA 2AMLA 2ZJ7A 3IULA 1AKTA 4Q7MB 4IV5A 1XLTC 1RTTA 3G2HA 1R8XA 3ZGNA 4DIEA 2NSHA 4J0GA 4TZTA 3TRKA 3LHIA 7YASA 1N3YA 5E4FA 5LUAA 4RPLA 1Y3FE 3DMDA 4HK4A 4F86A 5FFFA 4HGNA 5JCZA 1ZXXA 3GZNB 3VNVA 3VGPA 4RIGA 4BTEA 4D0RA 4YLEA 5IVHA 3IPYA 4UCXA 1KFCB 1EUDA 3HG7A 1R9JA 1SK9A 4P36A 5FNVA 3A6JA 1PK8A 1GGFA 2PFGA 3DBRA 4C5CA 4ZHQF 4IKPA 2YV1A 1ZAYA 5KSYA 3P8ZA 3WLTA 4LFAB 5CLQA 1C81A 2EX0A 2GERA 4PLWA 5JQGF 3WWZA 2WYIA 1ZD3A 4TYWA 4W5NA 1A8SA 4AF7A 1RAEA 3GOQA 3IUPA 3AUXA 3PL5A 4LRYA 5U1PA 5CDFE 2JLWA 3GFPA 1AHIA 5K3SA 1C4OA 1BA2A 3AKDA 4EYSA 3L6CA 2CD7A 1MTOA 2ZR7A 3G5MA 3LKZA 4KL8S 2A58A 3A3YA 4R2HA 4UZEA 1UDCA 4NOMA 4XD7A 4BN0A 2OL4A 2ECFA 4MYDA 1WR8A 2I6SA 4AYWA 2A30A 4DANA 1X94A 5DHAA 2W48A 4ARZA 1P74A 1W85A 3IP3A 2YWJA 2QTBA 3OQJA 4KWTA 4MRSA 4RH0A 4XIIA 1DTWB 1TL7C 1E89A 1W36D 3MRSA 1EKXA 3HCCA 4RKWA 3EVBA 1PGPA 3JWJA 2FW6A 2HF8A 4KO8A 1Z38A 1JEDA 3SBOA 1PQUA 4RX1A 3G59A 5SZIA 4C30A 4NCHA 4NE9A 1BG6A 4XCVA 3B3JA 1JU9A 4IZIA 3HLTA 3MFYA 2QN7A 1SBCA 3HMKA 3M83A 2YV3A 4UHFA 4ZAYA 3KO8A 1L1QA 2YINC 5CDUA 4P7BA 2MTBA 3QU2A 4IH9A 4K1XA 1XZPA 5GMOA 1N1MA 1X38A 2R65A 3JAKA 4ITVA 1A9TA 4NIMA 2GN4A 3KLOA 1TT7A 3O84A 3HVRA 3N07A 3NOXA 3WQSB 4WINA 2FPUA 3FPKA 1R0YA 3IP9A 4JI5B 3HM9A 1YV9A 1ZCAA 2F6RA 3JQ6A 2W2QA 1KY3A 3TSAA 1KF0A 5JJ5A 5IT0A 2PT6A 1ZVJA 3C8HA 3SX2A 1MAAA 4Y0NA 1V7CA 3ISJA 1MEOA 1Y5NA 4LZPA 3SKXA 4DCCA 2QRGA 5K0BA 5MF6A 1EVIA 2XYHA 2ZW9A 1CJTC 1SXGA 2UDPA 5HJ2A 1QOPB 3C6BA 3ZLUA 1UADA 2XMDA 3D8HA 3SG0A 3MK31 2CXQA 3V4SA 1C7ZA 2ZSBA 2F67A 4WZZA 3N05A 4PSDA 3N39C 4YCDA 4GKBA 3PUWA 2GN2A 2YOHA 3JWPA 2FQYA 3S1AA 4B75A 5LQDA 1IY1A 1DBRA 1H6DA 3TO5A 1M74A 2ZOSA 2DCMA 4F04A 1Y98A 2AXNA 3EXHC 1NVUQ 2C92A 1CUXA 2JB9A 3FCUB 1MO2A 2I6FA 2IK8A 1TGVA 3QQPA 3EFHA 3FPSA 2QPTA 4X00A 5FUXA 3SKVA 1XJ0A 8LDHA 3TJRA 3PZBA 2AR0A 4LDAA 3R3ZA 5D8DA 3IELA 1F1BA 3LPAA 5LLTA 2Y77A 1Y7LA 3U7QA 1T13A 1O87A 2CNBA 4Z9BA 1MPXA 1NR5A 4ZWNA 1U2GA 1ZSNA 5M3BA 1VL1A 1OB5A 2IQ5A 4NONA 4RKEA 3KKQA 2FMIA 1EBBA 2HTEA 3T3IA 1E4EA 3W7VA 5FPKA 5JYDA 2KB0A 1GTG1 1MGPA 4PZPA 4QD3A 1MO6A 4QZVA 1K75A 2AZMA 1CDZA 1RPTA 5LP6B 1K92A 3A2KA 4WACA 4FJ2A 3G23A 2XXBA 5DHFA 4FYJA 1LU9A 3GAMA 1KOJA 2BRUC 3U4IA 1G3UA 2XRYA 4JP5A 4TXLA 3VPGA 3VR5D 4Q7QA 4LOJA 4JHLA 3JV7A 3HXKA 2QA5A 3ANSA 4IF6A 2OFPA 2VJKA 5GOZA 3CZ9A 5HCNA 1ZJ6A 1NAHA 4D57A 4D5GA 5B57C 5EVJA 2VAXA 1OPRA 1E18A 2BELA 3GCZA 3LUFA 4II2A 4OKSA 3ROGA 2ZYVX 3KAJA 3UJ3X 4B3BA 4L3WA 1I4EB 3AVXA 5AKZA 2BEVB 2P2ZA 3ET4A 4CM8A 3KTAA 5CBPB 1Y8RB 5JXIA 1JBEA 4C43A 4ER0A 3FAKA 1HYBA 1MG0A 3LWZA 1B2LA 1P77A 3GWZA 1BFKA 1X7GA 1N7HA 2D7CA 3C3EA 4FFSA 4QDKA 4ROSA 4BO4A 3L7NA 4EY7A 4ZDIA 5EZ5A 2HJHA 4MS3A 4QQFA 4RVHA 3ICEA 1CR6A 1EE2A 2ZG6A 1OT3A 2CXTA 4E5MA 4OA5A 4B3SB 1C0IA 1W0JD 2WD9A 2FZVA 3QY0A 3E2PA 4BMPB 2ZYIA 1J2TA 3OJXA 3JQBA 1AS3A 1ACLA 3KQWA 1HDCA 1Y3DE 3FMIA 4JYPA 2EQ5A 4QBKA 5HRUA 2FP4B 5BVHB 2KS6A 2JLSA 2BUCA 4CCWA 2CL0X 3GN1A 4MYHA 5FUBA 2QQFA 3SR3A 2CNNA 4MVJD 4CQMB 1L7EA 3ZZMA 2YHSA 4D26A 3TECE 4KSYA 1ZC4A 2BCEA 2VP0A 5E8RA 1CUZA 1GZ5A 3OCYA 3EPRA 1L7XA 2JKZA 3LBYA 4BX3A 5DYTA 2ZBRA 1G8MA 2I8AA 1P9OA 3QG5A 4R1PA 3T7TA 1EB8A 3R76A 2XVXA 3I9V6 2VDKB 5AM5A 5I7RA 5JARA 1LBTA 2WV9A 4M9UA 4P92A 4JLWA 1LX7A 4M7OA 1O6BA 1UM9A 2OPBA 3MTBA 1RWBA 1OZAA 5EYPA 1ZJZA 2BJVA 1B8NA 2SHKA 3GFVA 1PT8A 4O08A 4DQXA 4IGEA 2QENA 4Q3AA 1C0EA 1JV2B 1T0HB 4IHJA 3U3OA 4CW7A 1HNNA 4DNXA 4ZZ1A 2YIVX 4WVFA 3JQCA 1ZI6A 3E3AA 2YJ4A 5B2EA 1IOLA 2CXHA 4PPYA 4EA6A 2WG1A 4QKQA 1NN0A 5CH3A 4IIHA 1XZEA 4ZAXA 4H7EA 3X1WA 3NQ41 5FV7A 1XQYA 1MVNA 4RIFA 3NATA 2PWBA 1AHHA 4F3KA 4NI5A 1GNLA 3QF4A 1ZRHA 2ONCA 4F8JA 1OVGA 5HVNA 1XMPA 3NBXX 1I7PA 3G17A 4G4GA 2PKEA 3LYUA 4R2XA 4Z3KA 2OHIA 2B6HA 2YZKA 2FN8A 2O4CA 2R6ZA 1E62A 1QZUA 2CWWA 3DOEA 3H42B 3N5KA 1OXUA 1JQKA 3ENVA 3Q3CA 4D8VA 4DUGA 5FNVB 4F45A 4HUQA 2HIHA 1T24A 5CB4F 3UTCA 4RANA 2X4LA 2ONJA 2YDXA 4TRRA 4C4TA 3EGXB 4TTIA 4B8YA 1KEVA 2TSYB 1T6XA 2GBFA 3M82A 2XT0A 2P78A 4H4DA 3NYRA 1ZUHA 2R1TA 4WZ6A 4YJ3F 2UUCB 4Z3OA 4Q82A 4QFCA 2WUFA 2ORIA 1YASA 4LXUA 3S2ZA 3EVGA 2QDXA 1IHPA 5NULA 2EIHA 2C5HA 3CH6A 4BQQA 4X93A 4PLCA 4Q1DA 1NVMB 4P5DA 3ZU5A 2YKGA 3AC0A 4BNTA 3KD3A 1BMTA 4BV2A 3BIJA 4ZT4A 1CV2A 3C45A 3DZ8A 3IIIA 3VDRA 3A9WA 4A8JC 6REQB 2I6QA 2JCGA 2FYTA 3AZQA 4BPBA 1TTTA 1QKKA 2EP8A 3O31A 5EESA 5CAEB 5LB2A 4G2TA 3TW6A 1E6MA 1RMYA 1Z75A 1XPRA 3P9IA 3OH8A 2Q2WA 4BASA 2NSYA 2J3HA 3EOZA 1W48A 2WTUA 2HLDA 1OTYA 3W4JA 1PJQA 5CLHA 1QFXA 3R7LA 1E9BA 4TYNA 2Z6QA 1USVA 1EDOA 1R8JA 3FZYA 4TL9A 2OZPA 1GZ7A 5F1YA 4L5IA 1SB9A 4GX0A 1BE1A 3M33A 1KJYA 2B82A 3UZUA 3NT4A 2JJMA 1A8UA 1RRPA