2IXGA

Crystal structure of the atpase domain of tap1 with atp (s621a, g622v, d645n mutant)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
254
structure length
254
Chain Sequence
LSGSLAPLNMKGLVKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLAVGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSMVEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Distinct Structural and Functional Properties of the ATPase Sites in an Asymmetric Abc Transporter.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords ANTIGEN PEPTIDE TRANSPORTER 1
total genus 78
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2006-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ixgA01
1KNXA 4ZDJA 4DCSA 1GILA 1PVOA 4L15A 5DN6D 4XWAA 1U99A 2AD1A 4TL7A 1M2OB 3FVQA 4X8OA 3TSOA 3EW9A 3OFNA 4MYUA 1N5JA 3VR6A 5EE9A 4AIIA 2XTNA 3UG7A 4UQOA 1EFCA 1YU9A 1YR7A 2J7PA 2VF8A 3VU9A 4WXPA 4EKDA 1W46A 4HUTA 5J47A 3G82C 5HE8A 3GLFE 1YE8A 2QAGC 3N2EA 1E79D 1GAJA 3OHMA 4M8NE 1OXUA 2MSCB 3HYRA 3BFKA 3C16C 1MABA 1D8TA 3CH5A 3K9NA 3K0AB 3T15A 2WZQA 2OHFA 3KB2A 4HDQB 2ZE8A 1F2UB 4KVAA 1ZD1A 4JLKA 4NYMR 5SZKB 4NU0A 1N6OA 4D0NA 2QBYB 4B2LA 2D06A 3B1YA 3E2IA 4DDUA 1AS3A 3BE4A 1E2NA 2B8TA 2BIFA 4TQUS 4Q9JA 2GCOA 2XX3A 2O8BB 3K0EA 2P0EA 3KJGA 2PX0A 3N2IA 2WJGA 3FKSD 4MYHA 5TARA 2ZJZA 1OYWA 1PLLA 2R6DA 2ANBA 3P4XA 1N5LA 1KDPA 1I4LD 3K0CA 3PR1A 4NCJA 4X8HA 4EAQA 2EFHB 3HP1A 4CT4B 4M1KA 2X2EA 2VHJA 2X8AA 4UNNA 3T1TA 1P62B 2JLUA 2QY9A 3ECCA 2P67A 2V3CC 1LS6A 2W00A 5EXTA 1ONBA 1XBTA 3QBVA 5E4FA 4KBFA 1KJYA 4WBSA 1EESA 3EPKA 1KI9A 1BH2A 1KI8A 1XJ0A 1QF9A 1Z5ZA 2FPKA 4IDOA 1ZRHA 3LQRA 1W0KD 2RH5A 4BFZA 4QGHA 2RGDA 3TQFA 1L7VC 4AG5A 4V03A 4XTRA 1SVSA 1XX6A 4LRWA 3ZD6A 2BJVA 4XD7A 2ZS9A 3THOA 3UWOA 4K46A 5K8TA 3TVTA 4A6PA 2VH5R 3CPEA 2BM1A 3KJEA 1N0VC 4ARZA 1CR1A 4L9WA 1CF4A 3MUFA 4IDNA 1KHTA 1VKJA 1X1RA 4UNRA 1P9RA 4URZR 4Q1EA 1TADA 1RW4A 1TAGA 1NRJB 2AFIE 1ODFA 2F55A 1GUAA 1IN7A 3DVLA 4MRNA 2V6IA 1W4AA 4BFXA 4L4UA 5CB8A 3ND8A 1GRQA 4CEIB 2HYDA 1KSGA 2D2EA 1HT2E 1RRPA 1ZP6A 2ZRMA 3L43A 3SS8A 2NGRA 1T4GA 4MITA 5JCPA 2QAGA 3RC3A 2ZE6A 1AZTA 3U44B 2A5YB 1G8HA 2P65A 1N6PA 4V0KA 2J0UA 4NTZA 2OAQ1 4RFSA 3UMRA 3VHXA 1XEWX 1E0SA 2FSFA 4Q19A 2GILA 2H57A 1Q3TA 1TF2A 4BLSA 3LA6A 2BV3A 1JEEA 1F2TB 1G6OA 4GDFA 4KYUA 4F38A 2BWJA 4PPNA 4Q1BA 4ZDWA 3X1DA 1NBME 3C5CA 5CIWA 4RD2A 1P6XA 4AC9A 3M0EA 3IIJA 1ZM2A 1G291 1AGRA 2Q3FA 3LY5A 1JBKA 4PC6A 3PEYA 4LGMA 2CLDX 3GEHA 4OYHA 1RYFA 1EK0A 3TSWA 2OBMA 4AWXA 3TVDA 1G3RA 2JIZA 2HXYA 4HLUA 4JMPA 1MABB 3OEHA 4DCUA 4AKIA 1E9EA 2W6JA 5HPYB 1A2KC 3TKLA 3F5FA 2GK7A 3W5JA 2IHYA 2JLSA 3ZS8A 5E7JA 1F2UA 4IEIA 4KFTA 1J90A 4L8GA 1E9CA 4PPGA 2ZU6A 4UNQA 4IXNA 5EP2A 4C0SA 2WWYA 4GMXA 4KSCA 3AVOA 1TNDA 3TW4A 1AZSC 1X6VA 4M1TA 4D4JA 2HF9A 2BBSA 1G8YA 1KJWA 1Q20A 5FPYA 3A1TA 3DZDA 4Q4HB 2W6JD 1A1VA 3EASA 3SQXA 1IN4A 521PA 5JRZA 2O8BA 3QF4A 4PAOA 5FPKA 2AN9A 2FG5A 2JAQA 4FMBB 3X1WA 4MGIR 2IC5A 1DOAA 2ZR0A 1AA9A 3WXMA 2WHXA 1N6LA 4ASUD 2P6NA 1D9XA 4HLCA 4P4SA 2PH1A 3KKQA 4BLPA 2G0TA 1YJ5A 5JHHB 3PV0A 4DCVA 3K0FB 1DELA 2XNDA 5HKKA 1GKUB 1XD2A 2OFWA 2NTYC 2R65A 2ZRHA 3AF3A 4HAZA 2XOKA 4WOPA 3Q3JB 4P33A 4XVUA 2RGNA 1X8KA 3Q5EA 1J8MF 3B1ZA 4GFDA 4HAUA 5FTNA 1OHHD 1U90A 3GLGB 1SULA 1OV4A 1HTWA 3LH5A 4B75A 3SEAA 1DO2A 3H84A 4PX9A 3SJBA 5A4JA 1FX0A 2QTFA 2JGNA 2HLDA 3VR5A 1G16A 4OQXA 2D7CA 3A1UA 3E1SA 2EQBA 3CRQA 4DDTA 2GZHA 4B2IA 1YR9A 1MO3A 4BLRA 3LBIA 5EP3A 2PT5A 1RRFA 1E79A 3NKVA 1UDXA 1QHXA 2BEKA 1Z63A 1KI1A 4TYQA 2CEAA 4WAUA 1KGDA 3KTAA 5LPNA 3VNVA 1VG1A 4ZIRA 2A2ZA 2F3TA 2H8KA 2IS4A 621PA 1IAQA 2JIZD 2F6RA 2H7VA 1JR3D 1XP8A 2QUZA 4D25A 3WYAA 1OIWA 1P9NA 1KAGA 2WAYA 4XJXA 2QORA 1DARA 3QIAA 3I1FA 3AVQA 2G1KA 4DZZA 3GJ8A 1WB9A 5JSZA 2AD5A 2Q3HA 3U3KA 4DEYA 2RHMA 3H1TA 1MH1A 4LOAA 2D3WA 1HY3A 1DAMA 1OF1A 1JR3A 2WIAA 4BGDA 3QOFA 1G17A 4HB0A 4B3FX 4ACBA 2JJ2A 1BKDR 2HEIA 1D2NA 1U94A 3CX6A 1TU3A 1EWQA 3D8BA 2HYIC 4ZCIA 2WAXA 3A58B 1LVGA 1VHTA 2ZJBA 4M2LA 1QHGA 2BEJA 1Z0FA 4TTPA 1UKZA 4QJ4A 4UJ5A 5K8UA 5EUQB 1CJVC 3OIWA 2PLFA 5F2EA 5KUTA 4PHFA 2G9NA 1Z3IX 1KMQA 2CL0X 1S8FA 2XNDD 1OXVA 4A4DA 3DKPA 4HAXA 3BS4A 5EP1A 4BZXA 4LK2A 4DSTA 4PXAA 1KI7A 1HUQA 2YV5A 2ZSFA 3FPAA 2ZRPA 2FN4A 3QG1A 2GZAA 3TUJC 4B32A 4DLXA 2P6RA 3NHBA 2J0QA 1SXJB 1DO0A 4JKYA 4IDHA 4US0R 3I73A 1W49A 5EXPA 3UWKA 1E2DA 2IYWA 4MYCA 1KO4A 1E94E 1MO6A 1QHYA 2CE2X 4LSGA 4Q00A 3T5GA 2YKGA 3FGNA 4DT1B 1I2MA 4A0GA 1XEFA 1TEVA 4KODA 3I5XA 1TUEA 2C78A 3SFVA 2V7QD 4NCHA 3R9XA 1NIJA 2GJKA 3K0AA 2ZRFA 1IM2A 4M9SA 5P21A 2CK3D 2Q9CA 1YHNA 4M1OA 3CRMA 3AF2A 2YWGA 2PEZA 1TPZA 2D62A 2CHQA 3GJ6A 2GEUA 4B34A 1XMIA 4RZ3A 3BB3A 3FDIA 3RSOA 4MUBA 3TE6A 3UK6A 4CRWB 5CITA 2O8EA 3TRFA 2NZ8A 3CKLA 3PXGA 3MMPA 5AUOB 3M6AA 4A15A 2PEYA 2OXRA 3T12A 4DLRA 1E2EA 1EX7A 1HT1E 1R0WA 4O25A 2QPTA 3GFOA 3LLUA 1M7BA 1CJTC 1R0XA 2ZITA 1G3UA 1YR6A 3I61A 1RKBA 1EFRD 1LNZA 3VQTA 4B71A 4NL4H 4BLOA 1FW6A 4JVSB 3BRWD 1P7CA 2IS6A 4FN5A 1FMJA 4MDEA 2OEPA 3U3MA 3EWSA 2R6CA 2QA5A 3PQCA 2IYLD 3EPLA 2F1IA 2D74A 3FHTA 5C1BA 4PC7A 1SKQA 1QHIA 3TBKA 5KSZA 4I1SA 2OT3B 3AP1A 1US8B 2YWHA 4TL9A 2QROA 4DJTA 1IOZA 3GJ3A 2IXEA 3HPQA 2QAJA 2WJYA 1MO5A 2YVUA 5FOSA 1KDOA 1CR2A 1Z6XA 4PQRA 3GEEA 3A4MA 4RD1A 4TZ6A 1M8PA 3Q8XB 1UEIA 3T1VA 2CMKA 3S1AB 2QGNA 4YLGA 2XB2A 4PHHA 3FHOA 2FPMA 4PPQA 3RDPA 1NNEA 5F98A 4ON9A 2BJWA 5CDFA 2IHBA 1AIPA 3H0KA 1WQ1R 4KITB 1FMLA 3AB3A 2UVQA 5GJCA 1S1MA 1MV5A 3BD9A 1LW7A 3CF6R 2R44A 4MA4A 5FOTA 2KE5A 1E1QA 2QMHA 3NHAA 1G3IA 1VHLA 2FWRA 3LV8A 3GLHE 4R9UC 3FOZA 2ZR7A 1OFIA 4NMMA 3SR0A 5FBQB 2BBTA 3LX5A 2KI5A 2PT7A 1Z8FA 2VIIA 2FPLA 4P3YA 3V4RA 3RS5A 1Z28A 1E2PA 1XF9A 3I8XA 3VX4A 1BIFA 1XU4A 4BUJA 1KMHB 1XJQA 2EWWA 4N3NA 1QVRA 2B8WA 2FGJA 3H86A 1KJZA 1KNQA 2GBLA 3IBGA 2IT1A 1XMSA 5CB6A 3U60B 4RZXA 4V0OA 4Q9IA 4B47A 3BC1A 4I1OA 5KYKA 5A5GA 1XNJA 2GAAA 2C04A 2GK6A 4HB2A 4Q1CA 1E2MA 5JWRA 3BXZA 1E0KA 4B44A 3RC8A 3IO5A 4QBHA 3EA0A 4JL5A 2WOJA 4JVLA 1UBEA 4FIDA 5EXSA 4Q7LA 2JLQA 2QT0A 2QL6A 3OIVA 1S96A 2ZRAA 4LHXA 1Z22A 2WWHA 2VP2A 1KYIA 3AUXA 1RC8A 1VYTA 1S3GA 2GVDC 4XIGS 1G41A 4JL6A 3AUYA 2ZXUA 5CK5A 1ZIPA 3QVUA 1E2FA 5AJYA 3PEVA 3NDBB 2J5XA 2OFXA 3TAHA 5F9HA 2F9LA 2A78A 1A2BA 3BH0A 4LV8B 5AJWA 4RD0A 5GADl 2XXAA 2JJ8A 2ATVA 3NDPA 2ODWA 3BWDD 4KAXA 4WZAE 3K70D 1G20E 4RVCA 3KKPA 8OHMA 4MRVA 4TLEA 2C96A 1E2GA 2BDTA 3TH5A 2QGZA 3X1XA 4IVQA 4XD7D 1O87A 3FHCB 1TQDA 3B78A 4JLBA 4KFRA 4NKRA 4NHOA 5L3SB 2OE2A 3ZIAA 2IUTA 2AXNA 4DSOA 1XCPA 2A3RA 1P60A 3UMFA 4EPYA 3K53A 1HQCA 2FSIA 1OH7A 4EJSA 1N6HA 3A4NA 4P4TA 1CLUA 3RWOA 1GKYA 1G3MA 3DM5A 5B30A 4XVQA 4G5OA 3B1XA 1YR8A 5DSZA 1B23P 1KTVA 1OKKA 4XOIA 2C2HA 4D4MA 3BB4A 4U7DA 1NKTA 3D3QA 4KLZA 2VHUA 4LHYA 1QHSA 2G1JA 5TY0A 2RB4A 3L0OA 5GJVC 4HAYA 2Y8EA 3ZZ0A 1C1YA 4MUAA 5JJLA 1RYHA 2H18A 4LX0A 4PTLA 4WXRA 3TAUA 1YRAA 1Q22A 2ZETA 3B8HA 4LBYA 4OL0A 5JS8A 1WDTA 3PUWA 4NCNA 1TF7A 2XOKD 4OHZA 2C9CA 5BN4A 5ELXA 1II9A 1WRBA 3NH6A 2VLIA 4Q4HA 1ZM4A 3UATA 2ZYUX 3S1AA 3Q7PA 1M6NA 1L4YA 2ZYWX 1UKVY 4IOMA 4LHVA 821PA 3U7EB 3W3ZB 2NPFA 4JLOA 1Z6TA 1ZMXA 4QBIA 4AG6A 1IJFA 2C5LA 4I4LA 4D2IA 1UBGA 5E7MA 2QE7D 1HEIA 1WMSA 3B60A 4UNSA 3GJ5A 2BOVA 1NG1A 4IEEA 1KI6A 2OM2A 3KXIA 4L5BA 2FFHA 2OV2A 2VEDA 4XVRA 1OSNA 3W34A 1T0JB 5JJKA 1SVLA 4GP7A 1US8A 3I4LA 4GOKA 1M34E 1P3JA 1W5TA 5JSZB 2R6GA 4IFEA 1KAOA 3CRVA 1GOTA 1HYQA 1UJ2A 2ECKA 4C0HA 1JECA 3K70B 2DR3A 5KNDA 1I4TD 1ZUIA 1CBUA 3C14C 2WMNB 3SJCA 1Q1EA 4JS0A 1TMKA 1X1SA 3L0PA 1Z47A 1ZU5A 1OXSC 2ORIA 3CF0A 1LB1B 1KDTA 2ZJ8A 1TUIA 2QRNA 4Q9KA 2ZJAA 3QNUA 3F3YA 4JLDA 4C7OA 4YXWD 4XH9B 1UBFA 2WOOA 3DMDA 3CR7A 1BMFA 2ZJ2A 3GEIA 5GJWC 2N1BA 5HCNA 2ZYVX 2VP0A 3PUYA 1NJGA 1ZNWA 721PA 4FMDB 1YRBA 2PCLA 3TNFA 4JLJA 2CHVA 2Z43A 5BYKA 3X1ZA 3U2QA 2G6BA 5JHGB 1DAIA 3QG5A 3P20A 2OUKA 1S1CA 4CYMA 1NIPA 1QHHB 1YKSA 2OFOA 3FMIA 4W9MC 3ADBA 4RZUA 3F8TA 1G21E 3UKDA 5IK2A 1EWRA 1GVNB 1EGAA 4JBWA 4MYTA 1IJEA 3UXMA 4DEXA 3K0FA 5BYJA 2ZRLA 2FZLA 4DT1A 1XD2B 4NCKA 4GRAA 3W6OA 1KSHA 2ODBA 4G3XA 3KUCA 5DGXA 5JCZA 1TU4A 2F3RA 1PLKA 1WCV1 1LS1A 5UKDA 2IYQA 1LFDB 1KDRA 4AI6A 4QBFA 3Q9LA 1FUUA 4JJZA 4W5HA 4QKQA 4IFBA 1U0JA 4MKIA 3NBYC 4RY2A 3NXSA 3RS3A 5AJVB 1R0ZA 3CBQA 2G83A 2OG2A 1ETUA 3L2OB 4HSEA 4DC9A 5G40A 1ZD8A 3V4FA 2OBLA 4ABYA 4FWTA 4PFSA 4KHZA 1KK1A 4Q4LA 3LO5A 4C7OB 4A0FA 4QJ3A 5AUQA 1KI2A 2W6IA 5DE3A 3T06B 3W9YA 2XGJA 3KXLA 1E2IA 5JMTA 1JB1A 5HE9A 2EYQA 2XAUA 1D5CA 1KY3A 2FJUA 2XJ4A 2WPDD 5FTJA 4TYNA 1DG3A 2VHTA 2ONKA 4LHWA 4NE2A 3AV0B 2YHSA 4DIEA 3PUXA 2AKAB 1YVDA 4YDSA 2C8VA 4LV5B 3TUIC 1W4BA 3OEHD 1TL7C 1QZXA 3R20A 1Z08A 2P5SA 4NCIA 5DYGA 3RRYA 4O3MA 1RZ3A 2O52A 3L8ZA 3RS0A 3TR5A 3BJIC 2RGNC 4F4IA 4NBSA 2AR7A 2ZI5A 1JEDA 4M9QA 3PG5A 4F93B 1SXJE 3HU1A 3RS7A 2VL7A 4K8OA 4A0RA 1ZC3A 1E4YA 4Y0VA 3EIEA 3PEUA 5TVKA 4ZKEA 2TMKA 1W0JD 1FZQA 5J40A 5TDHA 3U3OA 2HCBA 1EXMA 4MKFA 2JDID 1XXHA 1DTSA 1R7RA 2ZVPX 1KOFA 4GI7A 3P4YA 4PZLA 2QT1A 2GJ8A 4ESVA 3PIRA 2IK8A 4CEIA 4PSKA 4JYCA 2NQ2C 4YDHB 4DLTA 1W47A 1SVOA 4PO8A 4R98A 2WPDA 5FTKA 4E09A 5AJZA 2QAGB 2QP3A 4UXIA 4F92B 3U44A 5KDOA 4OBEA 5IDVA 2O8EB 1L4UA 3CRW1 5FOVA 1EFUA 1OKKD 1QG4A 4A2QA 2EFEB 4PHTA 4RKFA 2Z4SA 3DZ8A 1KK3A 1ZU4A 3R8FA 3DM9B 4XSHA 2Q9BA 3ZD7A 1E6CA 4M1MA 4EPVA 2P6UA 2H17A 2YNMA 1W48A 3DKVA 5KU1A 2JLZA 4HLUC 3T34A 1WF3A 2DB3A 4DUGA 4PO1A 2BM0A 2V4ZA 4M1SA 1Z6AA 3BH7A 4TMXA 4QBGB 4BEBA 4RCZA 1DAKA 2H1LA 3LXRA 4W5JA 4V0NA 5M04A 1BYIA 1OFUX 3QKRA 4HLQB 3I32A 5FI0B 3IEVA 1D9ZA 2QI9C 2ZSBA 2J3EA 4JL8A 4XWKA 2YOFA 1WBBA 2GF9A 1SGWA 5JFGA 3SDZA 3KQNA 2GETA 3KJHA 1XMVA 4PHGA 1DPFA 3I8SA 2OXCA 3ZVMA 2O8DB 1FQKA 1IQPA 1XXHE 2BBWA 3R8CA 2WWIA 2V55B 2IX3A 1L2TA 1GZSA 3QPWA 4QC2A 5FL7A 2DBYA 1GP2A 2R9VA 4URXR 2MSEB 3K0SA 2AXPA 5FUVA 2JCSA 3M1IA 2XTMA 3EZ2A 2PMDA 3GJ7A 3RLFA 1GNQA 4ZCLA 2FMXA 3SJZA 5EE0A 4OQNA 3DL0A 4ZKDA 1GWNA 1JPNA 1CJKC 3KKMA 3GLIB 1YZQA 1S9DA 5CYOA 4TL8A 5L3RA 3U7HB 1NN0A 1O3YA 3KJIA 4XSGA 2EW1A 4Z1MD 3IHLA 2ZVQX 1E69A 4WVFA 1JQJC 4GT1A 1NJFA 4A2PA 2O0KA 2PL3A 3W90A 3WP0A 3MWYW 2ZU0C 2ZIAA 4B33A 3RS4A 2QG6A 1OJLA 1N5KA 1GKIA 3VR3A 3W6NA 5D3QA 4MQBA 2ZM5A 1M7HA 2NPIA 4US2R 3U4QA 4BRUA 3JVUA 3VR1A 2GXQA 2RAPA 1PV4A 3IKJA 5AWFC 1GL7A 1FUKA 4DLWA 4YMTA 1N6IA 2WVJA 4JBYA 1YQTA 1H8EA 5F3WB 3P1JA 3GP8A 1NKSA 3AVXA 3U7FB 4PC1A 2AX4A 1FTNA 2QMUA 3R7WB 4Z54A 1JPJA 4B6FA 4KVGA 4ACAA 1H8HD 4A0HA 2JLYA 1Q1QA 1NSFA 4UNPA 2FSHA 2ZUDA 4Q02A 4Q7MB 4BECA 5JWOA 2QP4A 1U2RA 2IYTA 4OJKA 1D2EA 1M1YE 4LJYA 3NBXX 1N0UA 2WKPA 4DRZA 4LJ7A 2VHCA 4KV9A 5EZ5A 3UG6A 5JRJA 4D6PA 4AK9A 2FGKA 1JAIA 1SHKA 2VYFA 4TMKA 4NP6A 1Z29A 2GJSA 1YZUA 4B3GA 5BQ5A 1NP6A 1U81A 1GRRA 2ZAOA 3PEWA 3VX3A 1XEXA 2CCJA 2W6ID 3MG9A 3W8RA 1DG1G 3RS2A 1N25A 2CDNA 4I1VA 4TMTA 4TMZA 221PA 1V5WA 3KFVA 3UIEA 1W36B 4EFLA 2GXUA 5CM9C 1E0AA 4C30A 3ZIAD 1KO1A 4TYPA 4GSYA 4FMCB 4POAA 2Q21A 3AKYA 4LWZA 2EYUA 4PR0A 1NVUQ 4GOXA 3CB4A 1HURA 3MJRA 4NYIR 5FTLA 2CNWA 3KUDA 2P2LA 4D0LB 1TX4B 4BLTA 2JJ2D 4E5UA 4QHSA 5DI9A 5IHPA 3U7GA 1R2QA 3AKDA 3BBPA 3QKSA 3D31A 4F7WA 2I4IA 2GZDA 1NY5A 4S35A 1G9XA 2GCOB 1S3SA 4Q1DA 1AKYA 1JALA 2IF2A 3MWLA 4JVMA 3WNBA 3BERA 3DEFA 3ZYCA 4UJ3A 3WNDA 3QPVA 4QJ5A 3VMFA 4BFTA 3PITA 4TYYA 3NVAA 2YZ2A 3WY9A 5H1YA 1XDBA 4Z51A 1NBMD 3QXCA 4Q1AA 3ZVLA 1E96A 2F1JA 4PPFA 5KOYA 3B85A 4R2IA 3WBJA 1SXJA 2B7CA 5TV2A 5KO2A 3KL4A 4QM6A 2YJTD 3KKNA 2VPPA 4LJ4A 3SYNA 3OF5A 1XCGB 1ZJ6A 2FEOA 3I3SR 3M4YA 2DYKA 1Z0DA 3Q72A 2O0JA 3RAPR 3K09A 2BVNA 1D2MA 2OCYC 3SNHA 421PA 3WMGA 1E1RA 1XRJA 3LBHA 1CJUC 1QG2A 2CCKA 5C4GB 1T6NA 4I1UA 5EE3A 1ZC4A 4PAQA 1IN8A 1SXJD 1CXZA 2WM9B 1G7CA 3JZAA 4E07A 1W0KA 4BZQA 3VKGA 3RANA 1ZAKA 4H1VA 2EFDB 1E98A 4Q01A 4FCTA 1OXTA 4DKXA 2GTPA 1F3OA 2QPOA 4BPBA 5F9FA 1G5RA 4CGZA 3OAAA 1CIPA 1G19A 4YONB 4GZLA 3THWB 1HH4A 1R6BX 2E9SA 5BW8A 3HR8A 3NG1A 2NZJA 4QNRA 3K9GA 3J81k 3L0SA 4KU4A 4II7A 2VP6A 4OK3A 5FFMA 3IEUA 1N6RA 4CIDA 3ZH9B 1DBSA 4LCBA 4YXWA 2VHQA 3T1OA 4KFUA 3PENA 2A5DA 2IEYA 5FPTA 4EQ6A 5ANRB 2KBFA 4G5RA 5E7IA 4D0GA 2DFKB 3THXB 2QU8A 2REOA 3AVVA 4J0QA 3MD0A 1E1RD 1VCNA 1J8YF 5C18A 2CJWB 2W2XA 1GRNA 3ZGXA 3BB1A 3FMPB 1ZIOA 4AYWA 4QHTA 2G3YA 4JSYA 4PSVA 1WBDA 2UKDA 3B7GA 3D6TB 2ZUCA 2WMOB 4PQFA 1T91A 1ZBDA 5IRCD 2B21A 3R9IA 5EXXA 1OXXK 1Y63A 2ZJ5A 3QPUA 4DIDA 2DWPA 2JLWA 1F48A 3KB1A 4QOSA 2LCFA 4QRHA 2QM8A 1VIYA 1NN1A 3IUYA 4IDPA 3GLFB 4UXHA 1J2JA 1F6BA 1U8ZA 3FB4A 1YZNA 2QZ4A 2AWNA 1LTQA 3CONA 1CULC 4YMWA 2BMEA 1Q12A 5FPHA 4BFYA 3GLIE 3VHLB 1OB2A 1NL3A 3THWA 3AF0A 2R8RA 4LHZA 1Q3HA 1N0WA 4D80A 4TSFA 2J0UB 1W0JA 2RGXA 4KBGA 3FYHA 3RRMA 4TLDA 3IQXA 1FP6A 3P26A 3W6PA 5KDDA 1XZPA 2YWEA 1F2TA 3B13B 1GITA 1N3BA 3VNUA 2FX3A 3JZMA 3KDSE 4HEJA 5CLQA 1GNRA 2GRJA 3QEJA 5LBIA 2V1XA 4EQ6B 1A5TA 4RFVA 1YZLA 1W7AA 5FBWB 3MRSA 4G5GA 4P4SB 3TUZC 3KQLA 1S2MA 5JEEA 2IYYA 2W2VA 4DVGA 4OI4A 1LF5A 5E95A 3OAAD 1HV8A 1VECA 1P2TA 1DAEA 3O8CA 2O8DA 2QEQA 1VG8A 4CEJA 4BLQA 3EWAA 4OK5A 2QBYA 1FNNA 1AJEA 2WKRA 3LNCA 2VRWA 2LKDA 4D4LA 2YINC 3EX7C 1GTVA 4WZ6A 4URVR 3WYFA 3C41J 5KHOC 1DAHA 2WWGA 3AQ4A 4L16A 2AWOA 1MOZA 1T3SA 1R5OA 1J70A 1S9HA 2XSZD 4NPHA 2WBLC 1W2HA 4D81A 3FWYA 2H16A 4B2PA 1U8YA 2CXXA 4B3XA 3VKWA 1CP2A 2GNOA 1NVXQ 4Q18A 1BOFA 3PUVA 2ASEA 1DVRA 2ZRCA 2CBZA 4EFMA 1OT3A 2GXAA 3ADDA 4FD2A 3B9PA 2HCJB 4S2EA 2Q6TA 4EIWA 1E2HA 1G3QA 1KO7A 4OI0A 2F43B 5DLQC 4HATA 1KI4A 3EIQA 1ESNA 2A7QA 1ZM3A 5FOUA 4Z8YA 4B43A 2D4HA 2ZRGA 2IYVA 2EVWX 1XPOA 2DFLA 1G64A 4HDOB 5FI1B 5LD2B 4QG7A 2BBOA 2ZE7A 1VCOA 4B6EA 1P2SA 1H65A 1R8QA 3U3JA 2F1RA 1GG2A 3CR8A 4I81A 1XPRA 1AS2A 4NH0A 4MRSA 1WA5A 2GVZC 2REXB 3U6KA 2KSQA 2RGAA 1G5PA 3OESA 2BMFA 2W83A 4OI1A 5KNBA 4FCWA 5JI3E 3ICEA 1BYUA 3A1WA 3B82A 4C2TA 2JATA 1RRGA 5A0FA 1AN0A 1FX0B 4AYXA 4LYJA 4RD4A 1HA3A 2ZRKA 3QE0A 4CT5A 3N5CA 1CS4C 5EP4A 2ZTSA 3CNLA 3WMFA 4CDGA 2FDCA 1OIXA 2PZEA 4KXFB 2ORWA 1G1MA 2VSOA 4C9BA 5FR1A 3FKQA 3CLVA 2ZROA 2CVFA 1ZD9A 3D7MA 4C0LA 2DWOA 2OESA 2O8FA 4M21A 1UFQA 3REFA 3DOEA 1AK2A 1E32A 4R7ZA 3WHLA 3O8RA 4JT4A 4JLVA 4YMSA 1I2DA 2IYZA 2GWHA 4X8MA 2V9PA 2AK3A 2QPAA 4Q9HA 4DBLC 2WIBA 4D26A 3GLGE 2NO1A 2VP5A 1TQ4A 4AKHA 4Q7KA 1II0A 1RFLA 2ZE5A 3BAFA 3MLEA 3NBFA 4JVNA 3O47A 2HXSA 1EX6A 5BN5A 4RSGA 1G4AE 2GF0A 4CEJB 2HLDD 3W5IA 2VF7A 3IPXA 3OZXA 3RRZA 4LYHA 2CCGA 2PBRA 5CIQA 2OAP1 2WSSA 3KX2A 1H8HA 1XTIA 3QXSA 4M53A 1Z06A 3R7WA 2J41A 4LI0A 4M9ZA 5KDLA 2GCPA 2OO7A 3I5YA 2CLCX 3QSYA 1W1WA 4KYIB 2KBEA 1M7GA 1Z83A 4EPXA 2B92A 3NC0C 3BIFA 1CR4A 3NH9A 4KCGA 3RYTC 3P32A 5FBRB 4D82A 2XITA 3MCAA 4BFSA 3SBEA 3T5DA 3OE7A 1P61B 5KPDA 1A82A 1G8PA 2FA9A 2ZI6A 3QBTA 2ZI4A 4QM7A 3A36A 5D3MB 4ASUA 5IF9A 2PCJA 3LLMA 2RCNA 3LX8A 4DCTA 3CZQA 3GD7A 3I92A 4QXAA 4AKEA 2BC9A 2Z0MA 4LDJA 5LD2C 4C4PA 4DB2A 1NMXA 3KFXA 1U9IA 4Q7JB 1GDDA 1OW3B 2GCNA 4TL6A 4P31A 1HQYE 1G18A 1E9SA 3GLHA 2ONJA 4LBZA 1VCIA 4JLNA 1UAAA 4LJ9A 3NC1C 3SHWA 1OE0A 1D6JA 2F1HA 3THYA 2JLRA 3MWJA 3VR2A 3CX7A 4H9GA 1OFTA 1T3LA 1Z6YA 1TQ2A 4BWYA 1XZQA 3U4QB 3PCRB 1U9IC 1JNYA 4WA7A 1MT0A 4DLVA 1NVVQ 4XWOA 4Q47A 2ZQ5A 4E22A 5CDFE 3H4MA 3OEED 4Q48A 1XXHB 5TB5A 3DPUA 2JJ1D 1Z2AA 3CNNA 2V7QA 1UBCA 3E70C 3DHWC 4OKSA 4A36A 1NMZA 2R2AA 3WRYC 2GJ9A 3CNOA 2NG1A 3QXXA 2IA5A 3T61A 1PJRA 2WICA 3AVWA 3CX8A 3CRRA 4TN1A 3MWKA 1NG9A 1IY2A 4Q03A 2C9OA 3AKEA 3TW8B 5GJBA 4DB4A 1IHUA 2BCJQ 1Q44A 2JJ1A 2YWFA 2GBLC 2WJJA 4OI2A 4ERNA 2GAOA 5TMPA 1CJMA 1FTSA 3GFTA 3QXJA 4MRPA 3G0HA 2FV8A 2EFGA 3UANA 3LD9A 5DI3B 1SKYB 5AUNB 1GFIA 2F9MA 2ODNA 1I4DD 2OLKA 5CM8B 5J5CA 1Q1BA 2EU8A 3RNLA 2K5UA 1SKYE 3W8NA 2XZLA 3QF4B 2IUUA 2RGBA 3LVQE 1ZVQA 2ZRJA 2IYSA 4HZUA 1KKMA 4BRWA 2N46A 1SZPA 2BCGY 3B5JA 2GKSA 1UM8A 4LPSA 4Q4JB 6Q21A 3I72A 1CKEA 3QKUA 3SU8A 1GNPA 3HU3A 4Z1MA 2NO7A 4H1UA 4BE7B 4URYR 2WJIA 5KPJA 2P5TB 4V02A 2ATXA 1X3SA 3VTKA 2F7SA 1G7SA 2G88A 3C8UA 2QSZA 1NF3A 121PA 5EUMA 4HYYA 1NBMA 2WTUA 3W3AA 1VYUA 3K1JA 4IOKA 1G4UR 3U6BA 2Z83A 3NIBA 1SVWA 1SXJC 1NY6A 2XTZA 4OQFA 3ZVNA 3AH8A 4BFWA 2NOAA 3VU9B 4LJAA 3ND9A 5KTYA 4QGAA 4WZBE 1K5GA 1LV7A 1L8QA 5BN3A 3NTUA 2AK2A 4O2LA 3U5ZB 1IY0A 4MKGA 4PZYA 5H8WA 4KI0A 3EZ7A 3PFIA 3SHFA 5J4LA 4MDFA 3A37A 1KZ7B 3BK7A 5CJ2A 4MH0R 1OH5A 1K8RA 4LJ8A 1BMFD 4NYJR 4Q4AA 3GFPA 1FL9A 1YZKA 4DLYA 2XZOA 1GL9B 2OCBA 4C0KA 1KIMA 2C77A 2BKEA 4B3CA 1XTJA 3GLHB 4DDVA 4Q4JA 4IVPA 4V0ME 2DY1A 2QSYA 3EG5A 1LY1A 4ZCMA 2HT1A 3BGWA 4M1WA 4AY2A 4Q21A 3E5HA 2ZSAA 2G0NA 1EFRA 1OLOA 2NO6A 4TLAA 1TQ6A 2J7KA 3RWMB 5DHFA 3IPYA 3QUSA 4KJZA 1NLFA 3ZJYA 1X8JA 1Q1ZA 1Z0AA 2FU5C 4IKEA 1T5LA 1ZUNB 3DOFA 2QM7A 2JASA 1TTTA 2X1VA 4AURA 3EXAA 5L3VA 1W4RA 4A9AA 1RIFA 5D3MA 1XD8A 4MKHA 3A4LA 3SE0A 3WNCA 3FMOB 5KNCA 1Q0UA 2FF7A 4FCVA 3B1VA 4FMCF 2ZSEA 1FNMA 1IXSB 3MAAC 5B2ZA 4LYFA 2MSDB 2WSMA 3DDCA 1XEWY 2Z4RA 4JBXA 3C7KA 1CTQA 1E4VA 4EPRA 1XD9A 2J9RA 2JA1A 1TEXA 4ZO4A 1J7KA 2KJQA 5B58C 4A8JA 2VSXA 5GVSA 4JIMA 2KWIA 1P4SA 4BQSA 2ZJOA 3CPHA 4NYIQ 4TYWA 4WW0A 3OE7D 3IGFA 1XTSA 3RRNA 1AGPA 1E0JA 1U98A 2VA8A 2ZRNA 2IW3A 3EA5A 4OHYA 1T8TA 2IXGA 2IS2A 4FW9A 3ASYA 2QNRA 2IUSA 4U5XA 1Z2CA 3ZZTA 1W2GA 4FWIB 2AHOA 2ZR9A 2FFAA 2QTHA 3WRXC 4A8JC 2UZ3A 2XSZA 3PVSA 1MRSA 1OYYA 4C3ZA 5FUWA 3CWQA 4JSTA 2UZIR 2DWQA 4LC1A 1IXZA 2CHGA 4NYJQ 1OH6A 2YC2C 2X19A 1OH8A 3EPHA 1CEEA 5HTKA 1Z0IA 2RGEA 1VMAA 1JQLB 4BEJA 3CIOA 2DFNA 1II8A 1KK2A 4P0TA 2PMKA 3FMFA 3UMSA 3NWJA 4E03A 3ADCA 4R2HA 4DLUA 3KQKA 1E9DA 2RHDA 2OILA 3Q5DA 5LB4A 3X1YA 1CRPA 3KZ1E 3ICQB 4G5SA 2WWWA 4RFSB 4O2RA 4N0EA 4TMVA 4LJ6A 4NONA 4W5WA 2VSFA 2WV9A 2QQ0A 3HR7A 1K5DA 1KKLA 1R0YA 1YZGA 3SJAA 1VYVA 3A1VA 3TK1A 4NYMQ 4GZMA 1P2VA 1UEJA 1ZCAA 3HYTA 2ZREA 1R10A 2QN6A 3SFZA 4CEHB 3JVVA 1UF9A 3ZS9A 1XCMA 4ZV4A 4DLZA 3AGQA 1V43A 2C98A 3F0TA 2FE4A 1N6NA 2HF8A 2LWIA 3B9QA 5DH9A 1ZW6A 3TGPA 2DHRA 1RPZA 1IXRC 2ERXA 2YOGA 1UPTA 4BFUA 2V6JA 3LW8A 1NSTA 1EFTA 2XEXA 4HAVA 5JWHA 1PZNA 5BWMA 1E2QA 4JZKA 2QMEA 3ASZA 3BH6A 5TXGA 4ILEA 5J4VA 1AM4D 2QP9X 1G6HA 4RD3A 4LYAA 3VR4A 5HKKD 3NEJA 5CK4A 2E87A 1W44A 4CVNA 3IQWA 1XEXB 3QENA 4HDCA 1Z0KA 4P32A 3BOSA 4DUGD 1ANKA 2WSSD 3VKHA 2QE7A 2WJHA 4ZI3A 4UXJA 4G01B 1NI3A 1ELOA 3TMKA 2OLJA 2VBCA 2AKYA 3SYKA 2HDNB 1XB2A 2ERYA 1U8AA 2XXAB 2V8OA 3RSLA 2D2FA 4KSBA 1R5BA 5KSPA 3QVVA 3EAQA 5LB2A 5DO9A 2CLSA 3HPRA 5EQTA 3ETLA 3BFXA 1VIAA 3U61B 5C46F 4IRUB 4B3BA 3QKSB 4MGYR 1WE2A 2D7DA 1M74A 1E9AA 1JXOA 3B1WA 4LBVA 5C2JB 4A82A 5SZHB 2XNSA 2GJAA 1KO8A 1W4CA 2RGCA 2BMDA 4QHYA 2HUPA 4OQLA 4GL2A 4Q4AB 1ZYUA 3TJZA 2VP4A 4DSUA 2XJ9A 4TZ0A 2KB0A 5JBQA 1WXQA 2W0MA 4PQYA 1HE1C 3NEYA 1G7TA 2JLXA 2DCUA 1R8SA 3CF2A 3AM1A 3ZQJA 2A5GA 2YYZA 4QNMA 3SN6A 2O8CB 1XPUA 2J0SA 3CWZA 2A9KA 4NDZA 3ONWA 4BASA 2EWVA 5C4MA 4V0MA 1SVMA 2NO0A 2NO9A 2XZPA 5DN6A 1NMYA 4Z8XA 4JLMA 3PJRA 2E1RA 4C0QC 3LFUA 4KLNA 4HAWA 3EIHA 4Q9LA 5L3QA 4HUQA 2ODEA 4M0LA 1X8LA 2BKUA 1ZCBA 1N2CE 3A8TA 1P73A 3EZFA 2J46A 2ZRIA 4US1R 5L3SA 4EUNA 4K81B 4MGKR 4LY6A 1P72A 3CM0A 1KI3A 3QF7A 2O8FB 1II8B 1T9HA 5EE1A 2R6FA 4EJSB 4PANA 3AVPA 4ZDIA 2W2TA 1YZTA 3ZZUA 1Q21A 2WJVA 2IL1A 3ADKA 3LAWA 3NBZC 4IDQA 1ZINA 4Q1FA 1DS6A 4RKEA 3TQCA 3L0IB 2ZRDA 4JYBA 3LBNA 3IILA 1KI6B 2REBA 2ZJYA 5JS7A 1A7JA 4BFVA 1EFHA 3LW7A 2FFQA 3THXA 4MGZR 2OZEA 1X86B 4LZZA 5FBLB 1E2KA 2CJWA 2ZUBA 2V54A 1K6MA 4ZDKA 4W7SA 4DHEA 2ZI9A 1FOEB 2AL7A 4HZUB 3EARA 2J1LA 4TWZA 3V9PA 1JAHA 3CZPA 2J59A 3ZQ6A 4GP6A 4BZPA 4CF7A 1UKEA 1WP9A 2X77A 5H68A 4Y0AA 2FNAA 5AR1A 4YMVA 4PC2A 5FUYA 1E1QD 2O5VA 1RJ9A 3A1SA 4B76A 1F5NA 1SVKA 1Q57A 1UKYA 5LDDC 3DO6A 3U3RA 2ZS7A 1G7RA 4FI3C 1QRAA 3ZDQA 3CH4B 1B0UA 1ZNXA 1NLZA 2PX3A 2QENA 3TSZA 2FH5B 2Q9AA 5JI2E 1FPMA 3AF4A 4GPTA 3GJXC 1E9FA 1PUJA 2IYXA 4X8LA 3K70C 3OIUA 1NVWQ 3LRPA 3T1QA 3VFDA 2Z6VA 1G8GA 2J45A 3SC3A 3GLIA 2VTKA 2JLVA 2A5FA 1CRQA 1VTKA 5FH9A 5FR2A 4C2UA 2PJRA 3KKOA 4OHWA 3LVRE 5SZJA 3SOPA 1GM5A 4HZIA 4EFNA 5BXQC 5SZIA 2IF0A 4FMDF 2CVHA 2NMVA 1VDZA 3K9LA 4I99A 4PZZA 1XTRA 3CW2A 5AUPB 4TMWA 4ZIRB 1C9KA 2GEVA 1PUIA 1XTKA 1RVDA 1OHHA 3WYGA 3KQUA 3AVUA 2ZPTX 2FSGA 1JJVA 3GCGA 4L9SA 3AP2A 3K0CC 2RGGA 1QBKC 3THYB 1J99A 2PZFA 2ZAMA 4TT3A 2ZANA 1XTQA 2W0SA 3IO3A 1SQ5A 3C5HA 2I1QA 4HB3A 2O0HA 5DI3A 3QKRB 1A4RA 4B73A 3MSXA 1AQYA 4TSFD 1JJ7A 1KK0A 5G53C 3I62A 4IHQA 4YQFA 1Z6GA 2PZGA 4G1UC 1E3MA 3AP3A 5DIFA 3AVYA 3TIFA 5EJEA 1Z0JA 1QDEA 3FE2A 3O8BA 4LPKA 1S4QA 1RE0A 5IT5A 4OK6A 1DE0A 2OBNA 2ZI3A 1NLYA 4EDHA 4URUR 1AQUA 4RZ2A 1RRCA 4JKIA 1TF5A 5DISB 3QI2A 2ANCA 1JR6A 2AFHE 2JEOA 3GLFA 4XTCS 1QHHA 2H5EA 3EZ6A 5J4YA 2ZRBA 3ZLJA 4DWJA 1E2LA 4LBWA 1IN5A 2PJZA 3QEOA 1T8UA 1AS0A 3DMNA 2J87A 1XWIA 3HU2A 4HUQB 2IXFA 4URWR 4A2WA 2Z5FA 1KSJA 3SQWA 1COWA 3AEZA 1QHNA 2QRZA 1U0HC 1T3HA 1CR0A 2OCAA 5J4HA 5FBVB 4A92A 3QY0A 5FOWA 4OQMA 5DNYB 2Q0HA 5FPSA 2VO1A 1KMHA 5JLJA 4ESHA 5K8LA 3IHWA 3OIYA 1RJ9B 4TQ9A 4C0AC 3IBYA 4Q5IA 1EG7A 1KSFX 2JDIA 3CO5A 1OPXA 4AKGA 4HB4A 4HI0E 2YC4C 3P27A 4WIAA 3RABA 4EPTA 3GJ4A 1IBRA 3K9HA 1E9RA 4EPWA 4A1FA 2ZI7A 4QGFA 5B57C 1SHZA 2VQSA 4IW3B 2FZ4A 3IIKA 4NZYA 5G3YA 1DADA 3GMTA 1R5NA 1ZNZA 3GLGA 2IYRA 1T0HB 4LC0A 3H2YA 1XFAA 1PLJA 3OFND 5KSYA 3EZ9A 4ARZB 5FUXA 4IOJA 5L8VA 3IIMA 3SI7A 2OSBA 5L3QB 1ESMA 4RD6A 4D4KA 4M22A 3CPJB 1GIAA 2FFBA 1H8ED 3HDTA 1R4AA 1COWD 1P5ZB 3GQBA 2EFCB 2P3SA 1MRNA 4PO9A 2BMJA 4JT2A 2VP9A 4IJMA 4YC7A 3FTQA 3L82B 4G5QA 1XMJA 3MFYA 5EE5B 4PAMA 3R9WA 4JLPA 2G77B 4A6XA 5J4KA 2WWXA 4QFMA 4A8JB 1NVVR 1S0UA 4DLSA 3IDQA 1OIVA 1JXMA 3WHKA 3C15C 5G41A 4HLDA 5FL3A 4QGGA 3AGPA 1IN6A 1P75A 3BORA 2IWHA 2F43A 2I3BA 4B74A 4N0DA 4EJSC 4CEHA 2IWRA 3SBDA 3UPUA 1N6KA 2R62A 2C03A 5CLLA 1SVIA 2XB4A 2IEZA 5CJPA 4FXPA 3REGA 4ZI2A 4CZ2A 3X2SA 2C9YA 1N5IA 2ZYTX 3AF1A 1P2UA 3SZRA 3ZVRA 2WWFA 2CL6X 1MR3F 4GNKA 1FP7A 2IYUA 5DHAA 1ZNYA 5FOXA 4C0BA 2ZEJA 2A30A 3A6PC 5DYIA 2MMCA 3LWNA 2QMOA 1JI0A 5H70A 2C99A 4IOLA 3TLXA 4DXAA 5HZHA 1HE8B 3QXHA 1W36C 4MRRA 2J0VA 2HV8A 1FQJA 2Q3MA 3AVTA 1KY2A 2DFTA 3K8YA 1BO6A 2GXSA 1KZGB 4U02A 2B7BA 1UDWA 4F4JA 4M1YA 4C0JA 1XJCA 3B6EA 3RVBA 3BFVA 4FINA 5GVRA 3MGCA 2A5JA 2ZSDA 4TTRA 3EC2A 2GEDA 4AD8A 3T35A 4QL3A 4TQAA 1AKEA 1NN3A 4KO8A 4YMUA 4B35A 4AYTA 2ORVA 3VAAA 2HT6A 4TLBA 4ZPXA 5K8IA 3CUEF 5HR5A 1W5SA 1LF0A 2IS1A 2SHKA 2HJGA 4DDWA 1E2JA 2W58A 5FL7D 5E3HA 1P9WA 2V1UA 2WKQA 3WMEA 5CYPA 1NN5A 3FFAA 4G0NA 1U0LA 3AKCA 1QVAA 2CE7A 4CW7A 4F4CA 3L8YA 1G5TA 4OJQA 2OCPA 1OB5A 1BS1A 1CU1A 5JECA 4OHVA 4GMDA 3HJNA 1MKYA 4JJKA 1MO4A 4IXMA 3KQHA 2ZS8A 5EZ6B 5JJIA 1VG0B 3Q85A 2GA8A 3C4JA 5KSOA 3Q7QA 3PUZA 3HWSA 3EC1A 4O0MA 2X2FA 3QQ5A 2CL7X 4F91B 2HJVA 4U00A 3LQQA 4TT3D 3TR0A 3OEEA 4M4SA 4P4UA 4M9XA 4OHXA 4Q66C 3GPLA 2RKOA 1VG9B 2QQEA 5AK0A 4PSAA 4V0LA 2BHRA 3LXXA 3GJ0A 4RCYA 1E99A 1Y3AA 2CK3A 3KTAB 1IY1A 2QTVB 4LJ5A 2H92A 1ZM7A 3QJYA 2MMGA 1W36D 4B3DA 4B48A 3EPJA 3K09C 4DSNA 1GL6A 5FTMA 5JEDA 4KFSA 2FOLA 2GDJA 1F60A 1DEKA 1VPLA 3KXKA 1C4OA 4IVRA 2R6AA 2NIPA 1Z07A 3B2EA 5B64A 1DAFA 2FEMA 2B6HA 3O8DA 3RHFA 4JLAA 4GBMA 4TLCA 3WP1B 5IK2D 3N70A 2DPXA 2C95A 4GOJA 1ZM9A 2PLRA 1KO5A 1VCMA 2LKCA 1UADA 4UKDA 3WBKA 5AJXA 2I1VB 1DAGA 4DCNA 2CNWD 4LUCA 3MJHA 3QKTA 5HZKA 5G3ZA 2IBMA 2GESA 1IONA 1JR3E 1ZUHA 4TTQA 5HCIA 2N42A 2GHIA 4N1AA 1G8FA 2YOHA 4LV6A 4R71A 3G5UA 2O8CA 5JZVA 1T5IA 4PC3A 1E9BA 4ITRC 4RJLA 3V00A 3SYLA 3LDAA 1GSIA 3FFBA 2J7PD 1OFHA 2RMKA 2L0XA 1FFHA 3FKSA
chains in the Genus database with same CATH superfamily
1ZK0A 5J43A 5HVNA 1XR3A 1O6FA 4FGUA 1GILA 5FPPA 1XOIA 2OBYA 4TL7A 1M2OB 4X8OA 2QWXA 1RJEA 1TMOA 3EW9A 3U17A 3UY4A 1A8SA 3VISA 4EEZA 4DUZB 2HZBA 1Y6GA 1PW5A 4KQXA 3AR4A 1BS2A 3VU9A 3SIPA 1YU9A 3YASA 3I3OA 3LCMA 4L4ZA 4I4CA 4ND6A 2AJBA 4WXPA 5CLIA 5J47A 3EIXA 5HFNA 4I2NA 4ZVMA 1TO6A 1EHIA 3OHMA 1MAVA 3ANTA 6LDHA 3E15A 3BFKA 4J0IA 2X8JB 1CYDA 4ZZ2A 3CH5A 3K9NA 4XPIA 3RTEA 1I2ZA 5GAJA 1ITZA 3IJEB 4PLWA 3QWAA 1RLIA 1VIMA 1GLGA 5GADl 3L6CA 4FVTA 2ZE8A 3H2IA 1F2UB 3ICWA 3LUHA 3MLBA 4KVAA 3GJYA 3SZ3A 3GMDA 4JLKA 1JIUA 3C87A 3LBYA 5G0WA 4BPRA 4C7KA 2QBYB 4L6AA 3B1YA 1LUAA 3HGTA 3ETNA 3ZJVA 2RK4A 3UMJA 2Y66A 2PKWA 3DNMA 1KU0A 3BE4A 4IUBS 4OQPA 2F17A 2EP8A 2F2TA 4G5HA 5B3KA 1D2HA 1LLDA 2Q2WA 2O8BB 3K0EA 3E7WA 4A8TA 4DM7A 3A25A 4PLCA 2NUPA 3N2IA 4ZODA 4PSUA 4CMIB 3DE0X 5EIAA 1KQGA 4NZOA 3UAWA 1TT5B 4V38A 4EUFA 2PRIA 3CVYA 4NCJA 4RHFA 4DCOA 3NIGB 3DR3A 3KYJB 4RPCA 3JALA 5C1PA 4CT4B 3D7NA 3GNTA 4C6HA 5ALZA 3I52A 1A9YA 1LPBB 3FNRA 4HDRA 1G59A 3ILVA 2J3MA 3IPAA 3KKEA 5I8ZA 3CVXA 3UJHA 4BO9A 4BO4A 5KTMA 3AZPA 1BD3A 4MV4A 3A04A 1BHO1 3ZWXA 3K2BA 5C1DA 3AIMA 5HRUA 4MI1A 2FUEA 1GPWB 2KMLA 4IIHA 1LSUA 1M72A 2DZDA 2H85A 2ZTUA 4PTYA 4X3CA 5C8VA 4FX2A 3GP5A 1CP3A 3AUAA 2NSYA 2YNMD 4IDOA 3HKCA 1ORWA 4C03A 1MA0A 4MR9A 1J9EA 3DBHA 2ZLBA 2HADA 3D3JA 1M8GA 4OA8A 3VVCA 1T25A 2MU1A 4GW3A 3WLEA 4OXKA 3A0RB 4V03A 3WGUA 1ZR4A 3OPXA 1XX6A 3D9QX 4YASA 4MHSA 3T1HB 3WZ2A 4EHLA 1P0FA 3BM5A 3S2FA 2G9ZA 2ZS9A 3DP9A 3FPCA 2PUFA 4XQCA 5K8TA 2RBKA 2Q4OA 3CPEA 4I9UA 5IJZA 2DH5A 4ARZA 1CR1A 3CUWA 1KHTA 4LSZA 3TQIA 4UNRA 3FHTA 1O9GA 1BDMA 1Z6PA 4FYXA 5DMXA 3RBZA 3OX1A 4URZR 1W94A 4D56A 3PPIA 1RM0A 1V45E 2BEWB 3KAPA 4B3TB 5AI9A 2OQ2A 4GQAA 2F55A 3AEQB 4W5QA 1F6WA 3DVLA 2OORC 4DIMA 4L4UA 3ND8A 2D2EA 4L07A 4JY7A 3SBOA 1ZP6A 4QECA 4FOPA 2ZRMA 4L7VA 2WTAA 2IZ1A 3UOWA 4MITA 4PN3A 3NM6B 1RCUA 2X0RA 1P91A 3U44B 2ZTHA 2A5YB 1DTWA 3QLEA 5KYGA 2GR9A 1RZRD 2X1HA 4V0KA 2PSHA 4NTZA 2OAQ1 5TR9A 1QFJA 1O57A 1KFJB 3OCVA 1L4HA 3ZK8A 1Q3TA 4JJ7A 4JEUA 1SBIA 2PMEA 4O1IA 5H80A 4YJ3A 5CB4B 4N76A 1F2TB 4JYAB 1N7JA 1WCWA 5BPHA 4GDFA 1K2WA 3RUPA 1NBME 4UHJA 3LS2A 1LPMA 4GLBA 4RD2A 1P6XA 2N47A 5KVSA 5LZ9A 4RDIA 2GBGA 3G79A 1UKBA 4R9VA 5H9WA 3GVIA 2TRSB 1RWVA 4IIDA 4KYVA 3UAGA 1G9TA 3PEYA 1R6DA 1FDWA 4R3NA 2Y4NA 5M5BA 1RYFA 4DBVO 4DR5B 4I1IA 4FFSA 3CUUA 1LJ8A 5GIOE 5AM2A 1I30A 2H1WA 4AWXA 3PLAE 4DV0B 3SR3A 4DIFA 1K6EA 1KVRA 4DDHA 3V6MA 5C81A 3DH0A 5LOVA 4AKIA 1BDIA 5HPYB 4YRLA 1EK2A 3DLTA 1SPBS 4CV1A 1TUBA 1HG0A 2C83A 3EY4A 1OOEA 2JLSA 1ZX1A 3I6YA 1IZ8A 3ECSA 1DC3A 4R1OA 1G8KA 5DNVA 4KIWA 4C0QC 4AICA 4IXNA 5LZ7A 1V5GA 4M1TA 1VSVA 1X6VA 3Q0TA 5C5CA 4ZU3A 1PZGA 1G8YA 3T7KA 3VR4H 3QFTA 5IJXA 3T9CA 2FAXA 4K9NA 3DZDA 2W6JD 1PFVA 2RGYA 1A9PA 2RG7A 2X13A 5D5PA 3O92A 2R87A 4NFHA 2AQIA 5DM4A 4FMBB 3FYUB 2ZR0A 1T2EA 3S70A 4GI5A 1K5PA 4NE7A 2QZJA 2GPAA 3KU4A 5K09A 3P9ZA 1GT91 4HLCA 4NNPA 2PH1A 5FDFA 1Z6QA 4H3KB 3AJ8A 4RXTA 4BO7A 4M0CA 4D8XA 1MX5A 2PZLA 1ADYA 3HDGA 1PQYA 2WHYA 3K0FB 3NEAA 4DCVA 1T15A 4ZCTA 1N7IA 2EFJA 4FSXA 4WFJA 4CDNA 1WUHS 3BSWA 4IHAA 3ZUGA 1XAIA 2VT6A 5DLYA 2WVAA 4IFIA 4DILA 4R05A 3ZI0A 3K31A 4PG4A 2OORA 1XTVA 3BYZA 1RI5A 3K8OE 3PJDA 5T64A 4P33A 4XVUA 2RGNA 4G0XA 1J8MF 2FRXA 5FTNA 2FXIA 5C5EA 1OHHD 3TDKA 4QT4A 1SULA 2EF1A 2HPAA 2GN8A 4MK4A 4BGUA 4DNXA 1ISGA 3BDVA 2I22A 4LNUA 4PX9A 1NPDA 1P4JA 1FX0A 4L28A 5TPZD 2AQHA 2HLDA 3JAMA 3ACBA 4OQXA 5COAA 2IU0A 3TXYA 2VJAA 3E1SA 2EQBA 3UB2A 1EA7A 2PGDA 1L5QA 1JHOA 1H2ZA 3AL3A 1RBMA 1YR9A 1DOZA 3F1LA 3LUGA 4RY9A 4LWOA 1JSRA 2FW6A 3Q98A 2FWNA 2Q4TA 4C7VA 4ZI7A 5EP3A 3B70A 2HCTA 4OFXA 4Z9YA 2PT5A 1RRFA 2QN2A 1YOBA 1JDVA 1MTOA 1ONSA 3NKVA 4NENA 1XJWA 4HFJA 4CLHA 1OBOA 2WAMA 1T3GA 1QH9A 2F90A 2O3SA 1LBIA 5JDCA 1MJNA 2IZ0A 2P9BA 4UAJA 1GCUA 2RH8A 4ARCA 1PU2A 2A2ZA 1DKOA 1SWWA 2X5KO 3AEUB 4JASB 5EKUA 4D3DA 1XP8A 4D25A 1KZ4A 3WSTA 3TLYA 1CJSA 1P9NA 1KAGA 2WAYA 5EIBC 3RROA 4XJXA 2PXAA 3TZLA 1R1DA 2B1RA 6REQB 4ZAZA 2XUAA 3I1FA 2JKZA 3AVQA 1XZLA 2AYZA 2G1KA 3JAWA 3OCUA 4DZZA 1YB6A 3CHYA 4CV3A 5JSZA 3UWPA 4B17A 3U3KA 3W9BA 4UZFA 4B8WA 1MFZA 4RVNA 4DEYA 1DIRA 1ODTC 3RUAA 1Y8RA 2D3WA 4GEKA 1C3JA 4E5MA 5AVRA 1OF1A 2DUMA 3A2LA 1JIXA 4B3FX 3KEMA 1BKDR 1J22A 2EF0A 3CX6A 3FPKA 4S1TA 5H02A 3S2UA 4DC0A 1MNQA 1VFPA 4ZCIA 2WAXA 3A58B 1SELA 4FHZA 4OHKA 1QHGA 1XVTA 1VB3A 4V1CB 1UKZA 2Q1SA 1B00A 1WABA 1Z75A 4QJ4A 5K8UA 1PE0A 2C9ZA 5EUQB 1CJVC 2YV3A 3LY9A 5E9WA 3QPDA 3UWMA 1ORIA 3BULA 4IGEA 3HWX1 1H6CA 2C31A 4AJNA 2MJLA 2Q5OA 2REQB 3FZGA 2DTXA 4Y3UA 1GQRA 3QMPA 1PFQA 1OXVA 1THMA 3G2LA 1YQQA 5CW1A 5K0TA 2AFIA 2FZEA 3JZFA 2QR3A 3DKPA 4HAXA 1G20B 4OCZA 3JQCA 4BZXA 1ZSYA 1WBJB 1E92A 4BV3A 4DSTA 4PXAA 5LYYA 1KI7A 2YJ3A 2YV5A 3BCRA 4KNVA 4DN6A 3EDYA 4JYMA 3OJEA 2DRIA 3QG1A 4AS1A 1VQ1A 4TYMA 1D2AA 3TUJC 5BN3B 2QAIA 3PHCA 1SD5A 3EXHB 5AKJA 3P52A 5ELLA 4CXMA 3CZ5A 1O0CA 2WE8A 1A7UA 3MGGA 3V9AA 2JAPA 1Z8DA 1DO0A 4JKYA 4OGFA 1JS1X 3PVZA 4PR3A 2QRGA 5FT9A 3R7FA 1VMIA 4NWIA 5EXPA 2Y1LA 4MYCA 2H4FA 3EDQA 1MO6A 1H2HA 2A1UA 3BICA 3T5GA 3UTCA 2YKGA 5ICCA 4RA9A 4QXOA 5EIEA 4XIFA 3UGJA 3ZWNA 1QRSA 1CERA 2R11A 3EQ2A 3KPWA 1KMCA 4HEA6 4F6RA 4BB6A 2XMRA 1U1CA 2C78A 2DTEA 1SK8A 1X70A 2IGBA 2ZIWB 5T57A 3SFVA 4LYGA 4R2WA 1E1CB 4PBRA 1SCKA 3VSCA 3K0AA 1IM2A 3VYUB 3F4BA 1TM4E 1YHNA 4L8LA 1V8ZA 3AF2A 4TWIA 2IYFA 2YWGA 2PEZA 1TPZA 2D62A 3O1IC 1FX1A 4MWZA 3GJ6A 4YJFA 2GEUA 3WJ2A 1XMIA 2QRPA 3FDIA 3F3KA 3ZNQA 3CZMA 1XVAA 4WK4B 4DW8A 1D07A 3FF1A 3CRNA 3NHJA 1OJ7A 3MMPA 3C0KA 5AUOB 4YI5A 4JV5B 3JRNA 4IGAA 2H00A 2PEYA 3AT1A 3DFZA 1TKAA 2BJHA 3KOUA 3MTIA 1R0WA 3F3SA 2HBYA 4N01A 4DLRA 4AULA 1FPQA 2QPTA 1N77A 2ZITA 1CJTC 3GFQA 1R0CA 4K6HA 3B2QA 1M1ZA 1BJKA 3S2GA 1SKAA 4NBTA 1EFRD 1LNZA 1QS0B 1X7YA 2VS1A 3N0TA 5FA8A 5ITZA 5ESRA 1G2PA 3U49A 1QPGA 1CSEE 2YICA 3BRWD 4UEWA 5AW0A 5K3OA 2IS6A 1FMJA 3A10A 3NP9A 3ESDA 3OP4A 3JVDA 4IINA 3T1NA 3U3MA 1POXA 4BO2A 2I91A 3KSMA 4X93A 3H1AA 4UBJA 2IYLD 1Y5RA 4COKA 3EPLA 3PGVA 1PUXA 2D74A 2JFUA 2ORED 1ONPA 1SKQA 2B99A 1Z18A 2R79A 4HGOA 4RBNA 1U28C 4XPIB 1A1SA 1I2BA 5D5QA 3HDYA 4B4UA 4WDRA 1UPUA 1US8B 4TL9A 2W4MA 1YE5A 2QROA 4UE2A 5E9JA 3OF2A 1E7SA 1Z4KA 2IXEA 1ILWA 2J3KA 3EH1A 2QAJA 2ERCA 1NQVA 3HPQA 5CUQA 4I9GA 4DA8A 1GAWA 2YJ6A 5AKZA 1KDOA 2DFDA 1P17A 1Z6XA 3N0RA 3G0GA 4M55A 4XUCA 2ZM6B 2O5EA 3GEEA 4IM7A 3EWIA 4M0UA 1XRLA 1UEIA 4CLRB 5G4LA 2IXDA 2C8LA 4AJLA 3L4BA 2QGNA 5EWMA 5J63A 1RJGA 2RHWA 3E7DA 4UBMA 1CQJB 1NNEA 4WCDA 2IFTA 2BJWA 2CWDA 2QHXA 2XA2A 2OGWA 4H4DA 3EUWA 4P81A 1FP4B 5G1PA 4L78A 2UUPA 2UVQA 3MJSA 3MMSA 5GJCA 2XY4A 1LI5A 1NV9A 1A27A 4CU5A 2CXOA 3BD9A 5KHAA 5EVCA 3AI3A 4HYTA 4OX9B 3UPDA 5BXYA 5FWNA 1M66A 1UMBB 3QVMA 2XUGA 1NE7A 3KYBA 4R9UC 1QX3A 3LV8A 4U4AA 1U11A 5COQA 5HA5A 2LUOA 1LSSA 2O05A 1EJ0A 2Q9UA 4EYEA 1I01A 1PO7A 1ULHA 1YRLA 4M0DA 4OMCA 1Z8FA 3T5BA 1VGRA 3GUCA 4P3YA 3I8XA 3ITKA 3NM5A 4GX0A 1SB8A 3HA2A 2VBGA 3FBGA 3ROZA 3AL0C 1KMHB 1R9GA 3LQKA 4WGFA 1QVRA 2B8WA 3FKJA 4L5AA 2RHLA 4GGPA 4LRUA 1Y7LA 3H86A 4XGQA 1KJZA 1AKUA 1KNQA 1PR2A 3L7MA 4M0EA 4ZAYA 4KC0A 5JZSA 3IBGA 4AXBA 5I51A 5AIAA 4RZXA 4V0OA 4HXGA 4QASA 4L5IA 4D9BA 1XNJA 3FM9A 4CKZA 4FXOA 2YRXA 4HB2A 1N3IA 4J90A 1RQRA 1Y8RB 1ZS9A 5JWRA 4ND1A 3MWEA 1E0KA 1YZVA 3IO5A 1XDUA 1GZ5A 3OLCX 1OFGA 4JL5A 1DB3A 1UBEA 2VRCA 8MHTA 1HLGA 3MJDA 1Y9EA 1XA3A 2HRBA 3I9LA 2X0EA 2QT0A 3O2SB 3V46A 3RTBA 2ZRAA 3WWPA 3OETA 3AUXA 1Z45A 3FOAA 4X6YA 1NXPA 2EGGA 1M6HA 4U2GA 1VYTA 5ED4A 1PEDA 2WTNA 3KJQA 5CFLA 2LBPA 3L5KA 3CIFA 4JL6A 3WADA 1PJ3A 3LOQA 4EFDA 2JBHA 1DRWA 5IWCA 1DT3A 3WXBA 3PEVA 4JX8A 5DX8A 4AP6A 5CVTA 4XIIA 5JVDB 1N33B 3C3MA 4RE6A 3IDAA 3KLBA 1QP0A 2QYTA 3L07A 4LV8B 3E3NA 3H9UA 4RD0A 4UE3S 4JBIA 5AJWA 3U4CA 3EG9A 1CZRA 1C8LA 1GZ7A 1G20E 2HA0A 2ZBUA 4M38A 2QTZA 3DV0A 2BE7A 2E37A 2BM8A 2QGFA 4PGMA 2QGZA 4PYOA 3X1XA 2PH5A 2JCYA 4JBGA 3BF7A 1ID1A 1TQDA 4KFRA 4O8ZA 2OE2A 2W43A 4B1FA 2AXNA 5JW6A 1EWVA 2OR3A 1V26A 3G8AA 1OH7A 2WJ6A 3K53A 3ZC3A 3L7KA 3UKOA 2IV7A 1C7IA 3M81A 5LWHA 5K8VA 2D0PB 3DM5A 1H2EA 1UMCB 2RK6A 2ZB7A 4XVQA 2IODA 4N48A 2J8ZA 3VOTA 1TVEA 2C2HA 5BSKA 5KYUB 4D4MA 1E5VA 3BB4A 1R0SA 1EJ2A 4WNAA 1A9TA 4ND8B 2ODAA 1NKTA 1U6KA 3HCBA 4A91A 4ZI7F 3EDCA 1U9ZA 4BLVA 2ZCVA 2G1JA 3ENNA 5TY0A 3VC1A 5EINA 1L6RA 4HAYA 4XQGA 4ZJZA 4MUAA 2IPNA 1P81A 2DSNA 3D2BA 4LX0A 3TAUA 3PT5A 3WNQA 1FLDA 3IAM1 1Q22A 3L7IA 4XKJA 3WLOA 4OL0A 4NCNA 1XXLA 1EUCB 3R6TA 3JQGA 1OZ0A 1A8IA 3WWZA 2XOKD 1WEHA 4H59A 3HACA 4ZVQA 1ZM4A 1DKLA 3E9YA 4I4NA 2XMGA 3L8EA 3Q7PA 1EZZA 3G3EA 3HA3A 2WTMA 5BV1A 1CE8B 1X7ZB 3VOSA 1XAJA 3WFIA 1ILEA 3TLKA 4IOMA 3QX3A 5FEMA 1VLQA 4IWNA 3W3ZB 3PA6A 5I7OA 1ZMXA 3EFBA 1YRQA 2C5LA 1CUHA 3QVGA 1JHPA 1NW6A 2I80A 2XUDA 4HNGA 3RHZA 1HEIA 3EULA 4URFA 2JAUA 1A8UA 3B60A 3NAQA 3NX4A 4UNSA 2Q7OE 2DETA 3DA8A 3BHIA 3L7CA 4MW5A 1C7FA 1L7RA 3KHSA 1KI6A 1RR6A 2Z1NA 5EESA 1R74A 1EK6A 2FFHA 2OV2A 5TGDA 1IFXA 1OASA 1T2FA 1T0JB 5JJKA 4ALKA 1ECFA 1DIGA 1FU7A 2Q3BA 5FNZA 3I4LA 1KY5A 2HSGA 1M34E 2GS9A 5DOZA 3K32A 2J3IA 1P45A 3EIWA 3QRWA 4I8XA 4MVCA 2Y0EA 3HUUA 5DCYA 4RHYA 1L7XA 3LU1A 3CRVA 4OP1A 1HYQA 5CEJA 5CBKA 1SBYA 2ECKA 5KAMA 1UWVA 4QYXA 5JS7A 5ADUS 3DDWA 1ZUIA 4LDNA 4BQPA 4ZGGA 1CBUA 3CSUA 2AVNA 1BU8A 3VDMA 2XVMA 1QLHA 3NOQA 4P7BA 3CGWA 4CQNA 3ZDEA 4MO9A 1NVDA 1N2EA 2EG5A 2I2CA 2ORIA 3CF0A 3L0PA 1LB1B 2W22A 4B6JA 1U7TA 4EZIA 3TQTA 5KYXB 2QRNA 3FUTA 1GDHA 4Q9KA 4KR0A 4X1YA 3T3DA 3QNUA 1KRHA 4R1LA 4JLDA 2G8NA 1C81A 1LQUA 1UINA 1NQTA 2P79A 5CJJA 4XH9B 4C7OA 5K0FA 5DX0A 5IJAA 5EIXA 3K0BA 1UBFA 3BJRA 3DMDA 4CQMD 3CR7A 5IVDA 2GPBA 3GC6A 3FMGA 5EG5A 4PLYA 2H1CA 3BL5A 4FMDB 1KQFA 3D8HA 2XHZA 4QJIA 1ORRA 1EXNA 5GWXA 2Z43A 3AESA 3QBEA 4ZQCB 1G21B 4F85A 4AFNA 2QIOA 3P9CA 4DLKA 3DOHA 1R6VA 3FMIA 3OZRA 4UM8B 3V1LA 5FO1A 3UKDA 5DDIP 3EOAI 4IZ6A 3A6LA 3CVVA 1PNOA 1GVNB 1K86A 2JGAA 1OWMA 2VWPA 1EGAA 2UZ0A 3QVWA 1CUVA 4KP7A 4PN7A 2RD2A 2IHJA 3AG5A 4RYDA 4FYPA 4PGHA 5FOQA 4DEXA 5DU2A 3DD5A 3OJCA 4W9RA 5BYJA 4DT1A 5KX5F 1KWGA 4NCKA 2WIJA 4GRAA 1KSHA 4G3XA 3K8ZA 2VDJA 1RSZA 5JCZA 3ANLA 1TU4A 4AL4A 1PLKA 2F3RA 3B9BA 4YUWA 4AI6A 4WZBB 1LFDB 1KDRA 1W29A 2GYVA 3Q9LA 1FUUA 1PR3A 2JFQA 3GPIA 2GAFA 1OLUA 4RSRA 1DV1A 1PF7E 2LIPA 2QOEA 4JJZA 4W5HA 2P1RA 4IIBA 3COYA 5FBKA 3O93A 4OGKA 5CHYA 4RY2A 4B7UA 1GTSA 4WH0A 4RV9A 1ULAA 4IMIB 3WO0A 5H3CA 3CBQA 1C7ZA 2G83A 4QBTA 2JGDB 1GARA 3CEHA 3PKIA 3L2OB 4S1WA 4HSEA 3HEMA 1H0HA 1I3CA 2CZCA 3ZLUA 4DWVA 1PWYE 4FWTA 1RI4A 2CUZA 1I3LA 5LIRA 5LQKA 1KIAA 3AZQA 1RXYA 3G89A 1GUDA 3EIUA 2BEWA 5LKRA 5DE3A 5HJ7A 3W9YA 1SH7A 4PLHA 1UFVA 5LZ2A 5JMTA 3MTQA 4PXSA 5GGXA 5HE9A 3PJGA 1QC5A 1D5CA 1KY3A 2FJUA 5AOBA 4LTNA 5FTJA 5C5DA 4Q34A 5JRDS 5JPCA 1CUDA 4NE2A 3AV0B 4KXVA 3PUXA 1LQ2A 1U5BB 2QTTA 4BE9A 1T5OA 3SQLA 4I1YA 5DYGA 4QDXA 2X5NA 1JH8A 3RRYA 3R44A 4B40A 2R6ZA 3D2LA 1PHPA 1SD2A 3RS0A 2FFJA 4JAVC 5ITSA 3UK2A 1TW2A 1APBA 3ZWMA 3QEKA 4OQDA 1YT5A 2OD2A 2AA3A 2FK7A 2QR2A 2XEDA 1ZPDA 2Z58A 3AOGA 3HU1A 2R96A 2VYNA 4BAGA 1E4YA 4O2BB 4UUAA 3ONDA 4GGMX 1CIJA 3PEUA 4GRIA 1V9SA 4GF5A 4XEHA 4HQLA 4NAHA 3OKCA 3W79A 1ZUWA 2HCBA 4K9DA 2PX2A 2QR5A 4HLNA 1VMDA 4IEFB 3W6ZA 3CTMA 4CR7A 3EGXA 5EJ8A 3EVZA 5F7JA 4W9NC 1R7RA 2W2OA 1QKJA 3C3AA 4HWSA 1NUAA 5T8KC 1YE3A 3GDHA 1PBNA 2IHVA 4WE3A 4B3SB 1JAZA 5CNIA 4AJPA 2IDMA 5FNVA 1NASA 5FI3A 1X7DA 3ANMA 1H9CA 4YDHB 2PJDA 2DC1A 3MT7A 4MVYA 4DC1A 3AW8A 2WWVD 1SVOA 5CURA 1USUA 2I7CA 1Z2PX 3IIEA 1WPGA 4I6JA 2HRRA 4OBEA 1R12A 5K51A 1UDCA 3ZV3A 1EFUA 3I34X 1FQOA 2EFEB 1RXUA 1BQEA 3PQ8A 1BXKA 1CVLA 4INJA 1WUIS 1Q92A 5F78A 5ECWA 4EY5A 4O4LA 3R8FA 1FNBA 1CRZA 4EEKA 1IRXA 1SBCA 2RHBA 1SUCA 1EDZA 2C5HA 2Y6UA 3OZAA 4LVOA 1M2GA 2VSYA 3C43A 4P2GA 1TD9A 3BHNA 3GGOA 2JLZA 5JFTA 3OWHA 2O7VA 3ENWA 4G09A 1NVKA 3T34A 3TDMA 3ZWOA 3OD1A 2DB3A 3ZGYA 1HDIA 3OT1A 3THRA 4EG1A 2BM0A 2V4ZA 4I4TF 5D86A 4GS5A 1WM1A 1W88A 2HUNA 1P80A 3O4RA 4TMXA 4ARSA 4EI2A 2H1LA 2V5VA 2BCEA 2W2PA 1SOMA 3G2HA 4W5JA 2NU8A 4DGSA 3ZCRA 3DUWA 3Q2KA 1BYIA 3PQ3A 1OFUX 2PUCA 2F4VB 2LVBA 3I32A 1D9ZA 3N2GA 3WE7A 1WBBA 4XWKA 1SGWA 1MZVA 1WKBA 3IELA 2GETA 1MJFA 4OXXA 3G9ZA 4TT8A 3L02A 2D7JA 4QWMA 5B1EA 2ZCJA 3IDSA 4TUYB 4Y2TA 2PUTA 1JG7A 3PK0A 2V55B 1OLSB 2YHIA 2R1ZA 2YY5A 5B4VA 2IHUA 3ZCVA 3BTSA 3OLYA 2C7RA 2Z6UA 3GEGA 5EI5A 4EA7A 3QMMA 2OZPA 2MSEB 3K0SA 5DGDA 1Y8QA 4W6QA 1WXDA 2XTMA 3GJ7A 1Z26A 2PYZA 1SPXA 2N3ZA 2FZ5A 3AHIA 2QJFA 3I64A 3RU2A 3JD4A 2Z08A 3ETDA 1PT7A 3GGDA 1E6KA 3KKMA 3BWVA 4L3WA 2OUIA 2D1SA 4B3HA 1ZUNA 4IP0A 3OQPA 4LOLA 1PR1A 2GH1A 4KTTE 5FAKA 3U7HB 3DHVA 3IHLA 5HF8A 3VBEA 1WJGA 4E51A 1WKCA 1Y9ZA 1IK6A 1NJFA 3EJWA 2VCHA 6NULA 4UATA 1YRHA 4U3JB 4AP9A 1GGMA 4BX8A 4B33A 3OY2A 2B30A 2OCGA 5LL6P 3JWJA 3OQ6A 4MWBA 3VDNB 5K05A 4LS3A 3U1VA 2J4DA 3GPCA 4EVQA 1NVGA 1GKIA 2Z6AA 3ZOZA 3VR3A 5B3AA 1XMPA 4MQBA 2PA0A 3K4QA 2WB2A 1YUMA 2ZWAA 3U4GA 2IY7A 2CUTA 5FEUA 2RAPA 2K7ZA 3DT6A 4OTZA 3SXUB 2WSLA 4IIJA 2HAEA 1GL7A 3FH0A 4L4RA 4BFCA 4B46A 2AZ4A 4ZQEA 4DLWA 1N6IA 4YMTA 1UL1X 5JIBA 2QX4A 5C9ZA 1VB5A 1YQTA 1ZGBA 3EXEA 2C0QA 3P1JA 4HS9A 2Q1XA 4LSMA 1NXQA 2MHCA 5EJ2A 2Q46A 2XB8A 4L4YA 5GTDA 3U7FB 4J0GA 2VAVA 3I01A 4XFDA 5AKLA 3GL9A 2FPXA 2QG9A 5ENVA 2C4UA 4Z54A 3ZHCA 2YMPA 4CCYA 2SICE 4YJGA 1SRRA 4QPDA 1BHSA 2IIQA 4QVIA 5GONA 5E6SB 4FR2A 5CLJA 3G0CA 4HFNA 3LCCA 1JQEA 1N2BA 1NXWA 2XDQB 3A9UA 3C97A 1IIBA 1K68A 3ITDA 1D2EA 2J5QA 1Z7YA 2WF6A 3MT9A 4JP8A 2JZCA 4IMPA 1N0UA 2H07A 1LPNA 1JLLA 2WKPA 5E6UB 4KV9A 1E0DA 1I3MA 1O9HA 2PU7A 4FP9A 4AS2A 2ZUWA 2BW0A 1TC2A 2WF8A 3GRZA 1LX7A 4MDHA 1JAIA 2XBLA 4F0JA 1T8RA 3JVIA 2YH2A 4IV8A 3GRCA 3UNXA 2GJSA 3I1YA 1LW6E 3HR4A 4KIGA 2DECA 3I0ZA 1U3VA 5K2MA 1NF2A 5CG1A 5KJEA 4MR8B 4MVJI 7ADHA 2PG3A 1A9OA 3HKEB 3VX3A 2W6ID 3A28A 3GY0A 3ZHXA 4BAZA 3SHQA 4ZHQF 1X1TA 3W8RA 1N25A 1UBHS 3AI7A 3H7AA 4I1VA 4RF3A 2QJRA 4HVLA 2FPPB 5A2QA 1M34A 1V5WA 4EVSA 3K1AB 3Q1LA 5HIMA 4E5SA 3OLVA 2H1VA 3KFVA 3UIEA 4NCBA 1JIVA 4C1NA 4HNUA 1ADGA 4C30A 3N6XA 3SXJA 4CI9A 4NMXB 4LZJA 3P9NA 5IPFA 4HN4B 4N6OA 1Y42X 1SIWA 2VHZA 4POAA 3O03A 3HFJA 4YT8A 4PLFA 1M54A 4FDUA 4PR0A 4ROTA 4GSKA 4ZEOA 4KE9A 3CB4A 4R1SA 1T0PA 1YQDA 4NYIR 4EKYA 4N41A 1UDRA 3HN7A 1YTUA 1H1LA 4MZXA 4WBNB 4FOOA 2WABA 3K1ZA 1TX4B 3AOEC 4ND2A 4XXHA 3RVRA 5GIPE 4RHXA 5IHPA 3U7GA 1T3ZA 1BGVA 4CM4B 1XTZA 5JYDA 5J23A 1AKNA 1E5TA 3L7DA 1AUOA 1C9MA 1NY5A 4FGZA 4S35A 1XDDA 1KZ9A 4WJKB 2WHQA 3IOBA 3HCFA 5I4IA 5LXTB 2X7XA 2IF2A 3EFEA 4LZLA 3MWLA 4JVMA 3MTJA 1O97D 1WW3A 3BERA 3DEFA 4MWSA 4XGKA 5ALIA 5K3DA 4ALIA 2ZUEA 3PU6A 1SHJA 4HNSA 4BTLA 3DB1A 3IESA 3WNDA 1GV1A 3L93A 3QPVA 4EMSA 4D9FA 3PQ6A 4KWEA 3ESBA 3O4FA 4TYYA 1NTRA 5DHQA 2YZ2A 5GINE 2I5PO 4DQUA 1UZNA 4Q15A 2YQ4A 1CS0B 1FFXB 3UFXB 1XDBA 5ALPA 3HB0A 3DAHA 4QREA 5F2OA 3ZVLA 1IDOA 1SXJA 2B7CA 5KO2A 2ZT6A 3KL4A 1XEAA 3KKNA 4K9PA 4QM6A 1EIZA 3H2SA 4B0PA 3PICA 4B4WA 5LFAA 2JFHA 2Y0CA 4GX5A 1XCGB 4WN3A 4YP0A 1CB7A 1L4KA 3I3SR 4C78A 4X20B 5J2TA 1XWFA 1H4VB 2C61A 2ZYSA 3VVLA 4YYZA 3GHYA 3KU1A 3L1HA 4AECA 1VKHA 5BN4B 3WGNA 4CG1A 1ZC4A 2FR8A 2X5JO 5IKEA 3GDWA 5AKEA 3TPZA 1PK8A 4G1BA 4AROA 2IPLA 1JR4A 4WCFB 2QX9A 1RLUA 3RANA 3D54D 5JARA 2VRBA 1ZAKA 2Q3LA 1GEGA 2EFDB 3LI2A 4H1VA 3QFFA 4Q01A 1LLFA 1NTOA 1RQNA 2V65A 4ZVUA 1OXTA 2QVXX 2VNJA 4WXHA 4DKXA 3U7QB 3SZMA 1HKUA 2QPOA 3HDVA 3IODA 1SURA 3NBUA 1G5RA 2WWRA 4CGZA 4YONB 1G19A 4UMDA 4P3XA 3DYIA 2RBGA 2ZG6A 2E9SA 4C29A 4K6GA 3DT8A 3NG1A 2PE5A 3M7IA 4H7IA 3DE6X 2VPZA 2QXYA 2ZB8A 4PX3A 4KU4A 2IRWA 5FFMA 4OK3A 5U4XA 4CIDA 4RMHA 5MN6A 2ZWMA 5H81A 2HO4A 3DXYA 4AUKA 3HHPA 3KEFA 3TZKA 3AETA 1IZYA 4CHTA 4BKQA 5LQUA 4RK1A 4F8EA 1E1KA 1P1IA 2UYYA 2IEYA 3JASB 3BTOA 3X44A 4PYJA 2KBFA 1QPBA 2XYGA 3RPEA 4BVLA 2DEUA 2DFKB 5E9AA 2PYDA 2REOA 1FMCA 1N8TA 3MD0A 1E1RD 1HGXA 1VCNA 3M9WA 3U09A 1EGMB 3DZKA 2CJWB 2BMVA 2W2XA 3KOYA 5AVWA 1MIHA 1LFAA 3HCOA 3IQFA 4JK3A 3T9FA 3EF1A 4EW3A 2Q3DA 4KVZA 3IAUA 2IOHA 2J9FB 1ZZEA 2WU0A 4AYWA 4D9NA 1WBDA 4C4XA 2UKDA 1I24A 2FPGB 1SCNE 2WMOB 1T91A 4I4TB 1ZBDA 4FT4A 4CFZA 1Y63A 2P9GA 2DWPA 1IATA 4PAWA 1H69A 1GLNA 2FG7C 4Q1VA 1KAHA 2GHTA 3OPMA 4QOSA 5EZSA 2JLWA 4IX9A 1VIYA 3P5BA 3CB2A 1KEPA 1PJCA 2JD0A 3NORA 3OBIA 4IDPA 5TGTA 1NW3A 1U8ZA 3FB4A 3PCTA 2QZ4A 3ULKA 1P44A 4BQEA 2RFLA 1RABA 1MEEA 2YBEA 1HE5A 1Q12A 5ES4B 1JHQA 3CCCA 3VHLB 1NL3A 1RLOA 2OHGA 4YJHB 3VR6D 4O5OA 1FE8A 2YL2A 4M0KA 4UM9D 1YB5A 1QLJA 3H99A 4JGGA 3I4CA 5CVCA 3ZCXA 3PQ5A 2PX5A 1I2CA 4R51A 4TSFA 5AQ1A 1B8UA 2RGXA 5A3QA 2YMQA 4KN9S 1ZR2A 3MYRA 3IQXA 4MS3A 2CFRA 4N6GA 4EA6A 1V9CA 2X9LA 2ZTLA 4AKSA 4PONA 3HXLA 3E3AA 4YR9A 5KDDA 1FFYA 4J7UA 1GITA 1RXEA 5EIHA 2BI7A 3JZMA 5JATA 3I5MA 3WB0A 3QEJA 3QP9A 5LBIA 1FLNA 4PYKA 4EQ6B 4QOEA 1A5TA 3TL6A 2YJ5A 1AC5A 1YZLA 1Z5PA 5FBWB 2W6NA 1DEAA 2PHZA 3D59A 4DUYB 2WKSA 4KQMA 1S2MA 4BV9A 4BATA 3FBTA 3Q8WA 1P2TA 3ESYA 4QYSA 4DUPA 4MICA 4YP1A 5JC8A 2ZSKA 3RTAA 4BLQA 3EWAA 2GM3A 3LHKA 1EUCA 3MEQA 1MG0A 2UYCA 3EGWA 1UJBA 4Y6PA 2LKDA 4BBZA 1TUBB 4D4LA 2YINC 3DWGA 5A1JA 2FRDC 4WZ6A 3KQYA 4X5OA 1QGYA 1WG8A 2VH2A 2WWGA 1PJAA 3AIIA 4KTVE 4N3AA 1L5HB 4Y9RA 5LZ8A 2XSZD 3VPHA 5DGIA 1S9HA 1TLLA 4J94A 1VIDA 2NXJA 3MWDA 2DTDA 2I8LA 1NSYA 2H16A 1N3LA 2HD4A 3LRTA 1U8YA 4QYWA 5DCWA 3RIHA 4BO0A 3HC7A 1J0EA 4Q18A 1BOFA 4YPFA 5ALVA 4O1HA 2CBZA 2I62A 4AMBA 4DR1B 4EI7A 1E5XA 1AY0A 3INGA 1EK5A 1KXZA 3P0HA 3UAZA 3IP6A 1X2BA 4BNJA 4G0YA 1KJQA 3O21A 1SEVA 4H15A 2F43B 2PTGA 1XDWA 3HJBA 4CKBB 4YCAA 4RPJA 3RADC 1U7WA 3IPRA 3WQBA 1ESNA 1ZM3A 2V4MA 4Z8YA 5FUMA 2EVWX 4KQCA 1G64A 1GV0A 1S01A 1IG3A 1M10A 1A98A 1BMDA 3G8CA 5T7BA 1JLSA 3M3PA 5AM4A 1OX5A 3VV2A 3B6JA 5IXYA 1M67A 2YFQA 3CC8A 5E38A 3X1JA 1KP3A 2RHJA 3U6KA 4BJHB 3D2AA 2FKAA 1ECGA 1EVLA 3K20A 2W83A 5FCDA 4DMGA 5KNBA 1JU3A 4FCWA 4IQGA 1BYUA 3ICEA 1I51A 2QM0A 1RRGA 3HGMA 1FX0B 3QE2A 4LYJA 4UAUA 4TS3A 1MNAA 2BT4A 2XPCA 1Y98A 3U5TA 3OSZA 3KR9A 1XT6A 3QE0A 1L4NA 4MV8A 3ABIA 1CS4C 3FRIA 1N75A 3LL4A 3N2KA 1KE2A 4JR2A 3EZNA 2GLUA 4CDGA 4CDRA 1DMRA 2PZEA 4O3FA 1G1MA 4RIIA 4IX1A 1JJAA 2BEUA 3PNQA 5HCUA 4D41A 2CVFA 3O3OB 4KNWA 3FGZA 2OESA 4U9HS 1RHRA 4C2UA 1R5JA 1ZXLA 4M21A 1Y8AA 4RJIA