2IXGA

Crystal structure of the atpase domain of tap1 with atp (s621a, g622v, d645n mutant)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
254
structure length
254
Chain Sequence
LSGSLAPLNMKGLVKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLAVGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSMVEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Distinct Structural and Functional Properties of the ATPase Sites in an Asymmetric Abc Transporter.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords ANTIGEN PEPTIDE TRANSPORTER 1
total genus 78
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2006-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ixgA01
2KWIA 4YDHB 4EPRA 1G5TA 3AVOA 1J8MF 2CK3D 4RZUA 2JLUA 5B64A 1E0KA 1VCNA 2J87A 2QPTA 3WMFA 4TYNA 2X2FA 2A3RA 4CGZA 2CDNA 4IDHA 2R6FA 2OUKA 2FSHA 4QXAA 4HLQB 5TDHA 2ZU0C 2PCJA 4US2R 4EAQA 1RJ9A 5F3WB 2IXGA 2A5DA 1ZC3A 2PMKA 3AVUA 1SVWA 3DKPA 1Z6XA 4WIAA 4XWKA 2OEPA 1VG0B 5BXQC 4BEBA 3AKCA 4OKSA 1M2OB 4PPQA 4YMTA 1TQ4A 4A4DA 4LV6A 5CK4A 3P27A 2KE5A 4M22A 5J4VA 1OH7A 4B3DA 3OIUA 1FUUA 1QDEA 1Z6TA 2ZSBA 4QFMA 1NLYA 1J70A 1W36C 4I1OA 5KSZA 5G41A 3GLIA 2ZR9A 1NBMD 3RWOA 1TUIA 4UNRA 3EA5A 1HUQA 2B7CA 5KHOC 1G64A 1XCMA 2X19A 4IOJA 4O25A 4IFEA 4RCZA 3RHFA 4KYIB 3U60B 1M34E 1U2RA 3WMGA 2FU5C 1N6PA 1Z83A 2QP3A 3KJGA 4Q00A 3MJRA 4HLDA 4IRUB 1E6CA 1JAIA 2D2EA 4RKFA 4C0SA 3AF0A 1KMQA 1MRSA 2WTUA 4QGFA 3RANA 1CP2A 1VTKA 1F5NA 1VG8A 3I5YA 3DZ8A 4F4CA 5GVSA 1R0WA 1QVRA 2JDID 2OBLA 1HY3A 2D06A 3UATA 1GKIA 3I61A 4JYCA 2IYUA 3CIOA 1FFHA 2RHMA 1CTQA 1OFIA 2V7QA 1GAJA 2A5JA 1YKSA 2DPXA 2WIBA 3O8DA 1L4UA 4RJLA 4GI7A 4LYHA 1FX0B 4KCGA 2X1VA 5TVKA 2HJVA 2REOA 1TL7C 2W58A 4X8LA 2KB0A 3PG5A 2G77B 2MSEB 3BD9A 1G18A 3WYFA 5CDFA 4EJSB 1PVOA 1SVKA 3LAWA 2YWEA 3BS4A 4EPYA 5JWRA 4HLUA 1W49A 4Q02A 2AWOA 3F0TA 4M1OA 1ZNYA 4FIDA 4TLCA 3K09A 1LFDB 4AYTA 2PEYA 4R98A 2ZI6A 1E9RA 3W8NA 2R62A 1ZUNB 4IOMA 1VYTA 5KSOA 1NRJB 1NY6A 4RZXA 1ZM9A 3HWSA 3SEAA 3FFAA 1IAQA 3GP8A 3PIRA 2J0VA 4NH0A 1QF9A 1M1YE 2XSZD 2FFBA 3OAAA 4OHVA 2ZJ2A 2GEDA 1G8HA 1SXJE 2GEUA 3SYKA 3ZDQA 4DVGA 2P6UA 3EIQA 1S8FA 4MRRA 221PA 4BFYA 1YZKA 1KAGA 121PA 4LYAA 4PAOA 2IK8A 1CRQA 1TADA 2FJUA 1L7VC 1S2MA 3IIMA 1WP9A 2H16A 2REXB 4PHFA 1GDDA 3CRMA 1KSJA 3IHLA 2ORWA 4M0LA 4TLBA 3U3RA 4B73A 1W36B 1E2JA 2F3RA 2WWFA 3AVVA 4BFWA 5C18A 5KDLA 4ZDIA 4Q7LA 1YZNA 1EGAA 2JLSA 3QKTA 1F6BA 4DCTA 4V03A 4BWYA 3TUJC 2GZDA 1SGWA 3GEEA 1LTQA 3ZIAA 1XU4A 4OQMA 1QRAA 2QU8A 1N6OA 4DC9A 2QZ4A 3GLGE 1DARA 3RDPA 4A15A 3LX5A 3FB4A 4UJ5A 4OHZA 2QQ0A 3QIAA 1ZNWA 2CBZA 3CRVA 4IDNA 2D4HA 4TLAA 5EP4A 5B58C 1D5CA 2IUUA 4ARZB 5EP2A 2O52A 2HXSA 2ZSEA 1G4AE 1RYHA 3I1FA 4D0LB 3ADKA 4U5XA 3B8HA 3OE7D 1NIJA 4ZO4A 5F2EA 1I4LD 3BH0A 3IHWA 2XB2A 3FFBA 3HPRA 4TSFA 4DUGD 1P9RA 2CXXA 1H8EA 3BFKA 4R71A 2ZVPX 5JECA 1OH5A 1EFRA 1KYIA 5E7JA 2V9PA 4P4SA 5FOTA 2DWPA 3FMPB 4CRWB 1E0SA 1G291 4FW9A 2C98A 3KL4A 2VSFA 4XSHA 5TY0A 1FMJA 1Q1ZA 2RHDA 4Q4HB 4QGGA 4CYMA 2GRJA 2BMDA 4UNSA 2AWNA 1QVAA 2VQSA 3SC3A 4C0HA 4BFSA 3RRMA 1RRGA 1VPLA 5JRJA 2C8VA 4C3ZA 3K70D 3UMSA 4JBWA 4TLEA 1WBBA 3X2SA 3K9GA 2G6BA 1DG3A 3GLFA 2HXYA 3FHTA 3BAFA 5DI3B 2ZJZA 3MFYA 2GDJA 4DSTA 2V3CC 1F2UA 1II8A 3VR2A 3KQUA 2IYWA 3K8YA 1RC8A 1IN4A 5F9FA 3LDAA 3U4QB 1VCIA 2H8KA 2GHIA 1XTJA 4LJ7A 3H86A 4RKEA 2F1JA 4Q9IA 1T4GA 4KO8A 1MO6A 4C7OA 1XTQA 1X8JA 521PA 4KFSA 2QT0A 4E22A 1PZNA 3VR6A 3WNBA 5CLQA 2O8CA 2ATXA 2F1IA 1XXHB 1G7RA 1IY2A 1AS0A 1JPJA 3CR7A 4E5UA 2G1KA 1DAHA 4JBXA 1XNJA 5BN4A 2ZSFA 1Z47A 3BWDD 2C9YA 5J4LA 3ZJYA 1X6VA 4KFTA 1XD9A 4L15A 2FX3A 3W6PA 4PO8A 4GP7A 4D4LA 1RIFA 3PEUA 4Q4LA 1OIXA 2GJSA 2OCYC 3CNNA 1OYYA 1P7CA 1TQDA 2VHJA 3JVVA 1WB9A 3GQBA 2C95A 1YRAA 1U9IA 2JDIA 1W44A 3CWZA 4Q4JA 3J81k 3SQWA 5FPSA 3AB3A 1S3GA 3N70A 2WICA 4BLSA 3PCRB 4PC2A 5JEDA 1BO6A 1PJRA 2ODBA 2P65A 4LC1A 3U5ZB 1D2NA 3GFTA 2OG2A 2OCAA 2J3EA 4LGMA 2QBYB 1N6LA 1ESMA 1ZJ6A 2IEZA 4AURA 3BXZA 2NZJA 4KI0A 1XMIA 2Q3HA 3RAPR 3A6PC 3CWQA 2J0UA 4JLJA 5L3RA 3VKGA 2ERYA 2WM9B 5L3QA 1M6NA 2MMGA 4MUBA 3CX8A 3NBXX 4US1R 4B3GA 3CPEA 4NU0A 3HU3A 2V6IA 3TSWA 1D8TA 2P5SA 3O47A 2B6HA 3TW8B 4C0LA 4LJYA 3EX7C 2QA5A 1HT1E 5JWOA 1G7CA 2H17A 2WBLC 2W00A 3U3KA 1WRBA 3I72A 3CF0A 3KTAB 4POAA 4EFMA 4B6FA 3AVPA 4DDVA 3TK1A 1HYQA 2FFAA 2WMNB 4DLUA 1ZD9A 1KO5A 2O5VA 4Z1MA 2IC5A 2Z5FA 3FMOB 1S4QA 2YC4C 4KFUA 2ZI3A 1P2SA 1GRQA 4S35A 2F55A 5F98A 1RVDA 3EC1A 4KJZA 4O2LA 4C0BA 4AKHA 3MMPA 4C7OB 4PQRA 4Z1MD 1GKYA 1XEWY 3QF4A 4Q18A 4MDFA 2RGGA 2WWHA 3THWB 5FBRB 2N1BA 4FCWA 3RSOA 1A5TA 4UNPA 4QGHA 3WBKA 1W4RA 2EU8A 1GNQA 1G6HA 1RW4A 1P2VA 4WZAE 2GJ9A 3TRFA 3IPYA 2RH5A 5JWHA 5AUQA 4RD3A 1R7RA 1VYUA 2HT6A 1OSNA 3OEHA 5JS8A 3B1ZA 1N3BA 3HDTA 4PHGA 3WXMA 1SQ5A 4WZ6A 1KDPA 5JBQA 3GEIA 4AK9A 1E9SA 1YQTA 2AKAB 1E99A 1NBMA 4GPTA 5G40A 4OJQA 1R0YA 3L0PA 4B47A 4NYJR 5AJXA 2W6JA 5G3ZA 3QEJA 2BM0A 3EZFA 2B92A 2IYSA 4OHXA 3VQTA 4DSNA 1WE2A 1KDTA 3OEHD 5BWMA 3EZ6A 2UKDA 4R7ZA 1DAEA 1NBME 1IJFA 4TLDA 4BLQA 1HEIA 4TSFD 4HATA 4LPKA 3VX4A 4FWIB 2FGKA 4L16A 3LA6A 4KVAA 3C14C 3LBIA 1D9ZA 3P26A 5JFGA 4V0KA 1IXSB 1R2QA 3IIKA 1IN8A 3JZAA 4G1UC 3VX3A 1QHNA 3DL0A 2IUSA 2ZI7A 3CF2A 5ELXA 3FYHA 2OXRA 4JIMA 1LS6A 4LBYA 5FR2A 3LX8A 1NVVQ 4BRWA 1ZM2A 2FNAA 4PHTA 4FINA 4GMDA 2GAAA 2QENA 1J2JA 4Q1FA 2YOHA 3FPAA 3LWNA 4TYYA 3B1VA 3NKVA 4J0QA 4A8JA 3ZD7A 1R10A 1W4BA 2WOJA 3TSZA 3PJRA 4LHWA 3CX6A 2C2HA 3QBTA 2QE7D 1QG4A 3G5UA 2YC2C 2ZE5A 1ZU5A 3LXRA 1ZD8A 2I4IA 1QHYA 5KPDA 1J7KA 4AYWA 3LLUA 5C46F 4ZIRA 4OQNA 1LV7A 5AJYA 3UG7A 3SU8A 2ZRNA 5CK5A 2R6DA 5G53C 3TVDA 1VIYA 4MGKR 1NNEA 2F6RA 2QM8A 3AGPA 3FMIA 4EKDA 2OXCA 3FKSA 3P4XA 4JVNA 1NMZA 1T9HA 2ZYVX 3CH4B 1W1WA 4HAVA 4XD7A 2A5YB 2J46A 5EUQB 2NTYC 3X1ZA 2B8WA 4IOLA 1CJKC 1IOZA 1UJ2A 2VP0A 4DXAA 3L8ZA 721PA 1OPXA 3D7MA 2CK3A 3OEED 5EE1A 3B1WA 1CJTC 3QVVA 3W5IA 1LS1A 5HCNA 1KK0A 3L43A 5GJCA 4Y0AA 5EE0A 2QORA 1P72A 4Q4AA 4DLRA 2QSZA 4ZI3A 1UKVY 1W48A 2ODNA 4O2RA 5G3YA 4DDTA 1GITA 4DUGA 5FOWA 3GLHA 2ZRAA 4IDQA 1GVNB 4LCBA 5AUOB 3CBQA 1TF5A 5M04A 3NC0C 1UEIA 3B82A 1FW6A 3SFVA 1G7SA 3SHWA 3R9WA 1PLLA 2OLKA 4M1SA 2O8EA 1E4VA 2PCLA 1UBGA 3Q7QA 4JKYA 3ZS8A 1COWA 4U02A 4TT3D 1KIMA 3PEWA 4ZDJA 3AF4A 4KSBA 1Z5ZA 3DPUA 4IDPA 2J41A 4QM7A 3AM1A 4M1TA 1GKUB 3UWOA 4KAXA 1TQ2A 2J7PD 1JECA 3CX7A 3GJ0A 5SZJA 2ZE8A 2EFGA 5DNYB 3E2IA 2CL6X 2ZPTX 1Y3AA 1Z6YA 5JS7A 2Z83A 1NKTA 1MO3A 2LCFA 5K8UA 2NGRA 3CW2A 4URUR 3MCAA 3BH7A 1G21E 4EQ6A 1XMSA 3BB1A 4DJTA 4CEJB 3GLGB 3GJXC 3KXKA 2OFWA 3Q9LA 5DHFA 1S1MA 1B0UA 1OXUA 4LJ8A 421PA 2XXAA 4S2EA 3IEUA 1PUIA 4PC1A 4UKDA 3B7GA 5CIWA 2VF7A 1KAOA 2CLSA 4JLKA 4KITB 2O8BA 1A4RA 1DOAA 2R6CA 2FGJA 2HYDA 3C15C 5CDFE 4XVRA 2BMEA 4CEHB 4RY2A 1OJLA 2VIIA 3T06B 3DMDA 1ZIOA 2XJ4A 3R8CA 4LJ9A 3BBPA 4ZIRB 1BKDR 2HF9A 2W6IA 4F92B 1CIPA 1E9AA 3SZRA 3QKRA 1ZW6A 3RYTC 1KO7A 1ZNXA 5H68A 1AQUA 2Z4SA 1KJYA 2NO0A 3FVQA 1NN0A 1YZLA 1GUAA 1YRBA 2IT1A 4YMWA 2IHBA 4R2IA 4ERNA 2VP5A 5BN3A 5JHGB 4LHVA 1G8GA 1TNDA 2E1RA 2RGEA 4G5SA 1N6IA 1UDWA 4XWOA 3U7HB 2JJ2A 2UZ3A 2VHUA 4B34A 4BECA 3BH6A 2OCPA 3K9NA 4I1VA 5KO2A 4DCNA 3F3YA 4F7WA 4D25A 1CULC 1N0VC 2I3BA 3NH6A 2F3TA 3AF3A 3NBFA 3GLGA 1ESNA 3G82C 1P9NA 4DLWA 3DKVA 4B3CA 4Q1EA 2JGNA 2OAP1 1GRNA 4GBMA 2KBEA 2VSXA 3A4NA 4GT1A 1BMFD 4LX0A 5P21A 3EXAA 2Q3MA 3TJZA 3I73A 3QXHA 2VLIA 821PA 5AUPB 2HEIA 4XJXA 4Z54A 1VG1A 2ZTSA 5HR5A 4GL2A 4LZZA 3TUZC 1GL6A 2AL7A 2MMCA 4IEEA 2G0TA 4ITRC 4U7DA 3VNUA 4D26A 2BBWA 1OIVA 2OSBA 3IBGA 3KKPA 2ATVA 2D7CA 4X8OA 5C1BA 1CU1A 1XCGB 1G8YA 1N6KA 5TARA 4PSKA 4CEJA 4PTLA 1IXRC 1HURA 5D3MB 1KNQA 1X3SA 2DCUA 2Z43A 3CPHA 4WZBE 2GF0A 2CNWA 1D2MA 1DS6A 3SBDA 1N5IA 1E9BA 4RD6A 1X1RA 4FN5A 4PANA 1T5LA 1NJGA 3GLHB 5FBQB 1US8A 2ZRMA 3B6EA 3CH5A 3NVAA 1OFTA 4JYBA 4ABYA 3P20A 3HU1A 4TQUS 4AWXA 4N0DA 1KDRA 4JT2A 1AK2A 4TZ6A 3BFXA 4ZV4A 3B60A 4QGAA 3HR7A 1EFUA 4AKEA 2WKRA 4LJ5A 5BYKA 2V55B 4ZCIA 2Q9CA 4TN1A 4A6XA 4NMMA 3ND8A 1GTVA 1D2EA 4RD1A 1OXVA 5DISB 3O8RA 2GTPA 2CHQA 2DFNA 3ZQJA 1O3YA 1W7AA 1UKEA 3BB3A 2EFEB 3KB2A 2RGAA 2FPKA 3EASA 4URVR 1L4YA 2HJGA 3K1JA 1UKYA 1EX7A 4WBSA 2CCKA 2AKYA 3IILA 4PZLA 1F48A 2XITA 1RJ9B 2QMUA 3K9HA 3RRNA 5KSPA 5DHAA 1CEEA 1E1QD 1X8LA 1SKQA 1UDXA 2PLRA 4MRVA 4LBWA 1KGDA 2RGNA 1EFCA 2ZRBA 1P9WA 3EZ2A 3MG9A 4D0GA 5C2JB 3BIFA 5JLJA 2WJGA 5LDDC 4B3BA 1OIWA 3VNVA 2AR7A 3T34A 3AVQA 1T0JB 2YNMA 5FUWA 3DMNA 1C9KA 3P1JA 3X1WA 4OHWA 2RGNC 4Q7MB 5FPKA 1DAKA 3GJ3A 5LBIA 2ZUCA 1AJEA 3CKLA 1ZMXA 1OXXK 1P5ZB 2ZAMA 2PT5A 4URZR 3QEOA 4JT4A 5GJVC 2EFDB 2CL7X 5H1YA 4OI1A 3SJBA 1NN3A 2C9CA 2ZYWX 2FSGA 3VU9A 3LVRE 1SVMA 5IRCD 4E09A 3SHFA 1T8TA 1VIAA 1WMSA 3FOZA 2WAYA 3KB1A 2CE7A 1XJCA 3OEEA 4V0OA 2IS2A 4RCYA 1JBKA 1K6MA 3O8BA 2IWHA 1OFUX 4URYR 4M8NE 3REFA 1N0UA 4Q1CA 5KPJA 1T3LA 1AZTA 4MKIA 2FEOA 3BB4A 2QAJA 1WCV1 2BBOA 1K8RA 1FNMA 2J59A 1IY1A 2BIFA 3QQ5A 1ZYUA 1G20E 3B9QA 3S1AA 1NVXQ 4NCNA 2AX4A 2F1RA 1Z2AA 3HJNA 2QAGC 3ZGXA 5KSYA 3VTKA 1KY3A 1A2BA 3NC1C 3AGQA 4OI2A 4AKIA 3SNHA 4EJSA 5DI9A 2W2TA 4NDZA 1PLKA 2BBTA 4RZ2A 1ZM3A 1OKKA 2JATA 2ZUBA 3THXB 1DAFA 1I2MA 3TR0A 3LVQE 3B13B 3PXGA 3SR0A 2QEQA 3TGPA 3MAAC 4QBGB 4JLVA 2ONJA 2ODEA 3ZQ6A 1W2HA 3PV0A 2HV8A 1G5PA 2QMEA 1H8ED 1E2NA 1DE0A 1Q1BA 4UXJA 1AM4D 5KDOA 3NDBB 3I8SA 1EFRD 3QPVA 4A1FA 3C7KA 2LWIA 1NG9A 5EUMA 4BFUA 2XEXA 3ZVRA 2WWYA 1CJUC 1R5NA 3GJ4A 3KXIA 1Q21A 3K70B 3AEZA 6Q21A 2JIZA 4NCJA 2ZJOA 5FBVB 1GL7A 3ONWA 4NTZA 4D0NA 1S9HA 5FTLA 4MQBA 4PFSA 2ZANA 4PC6A 5DYGA 5A0FA 2WV9A 2IYLD 2AD5A 2JLQA 5GADl 4NKRA 5DN6D 4A36A 3MWJA 2YINC 3MWKA 4B44A 4LJAA 4II7A 4OQFA 3KZ1E 3H84A 4JSTA 2WJYA 3M1IA 5HKKA 5JZVA 1Z06A 4JVLA 2IBMA 1E2HA 3SJAA 1ZC4A 1IJEA 5JI3E 2D3WA 3VMFA 1KSHA 4Q48A 4QHSA 1YZGA 3VKWA 1TEXA 2GCPA 3F8TA 4NYIR 3VU9B 1NSFA 4RD2A 4QNRA 2QY9A 1I4DD 2FPMA 3S1AB 4K81B 1OB5A 4DT1A 2GA8A 1II9A 1N2CE 2VA8A 3EWSA 1D9XA 3R7WB 5H8WA 4YONB 4BASA 1HV8A 4B2LA 2ORVA 2ZI4A 1ANKA 1FTNA 2WAXA 5AR1A 5GJBA 3PUXA 3W6NA 5BW8A 1XMJA 1NVWQ 2YOGA 3WP1B 5EXSA 2HT1A 2GEVA 3A1VA 4Q1AA 1AKEA 3U3MA 1T5IA 4ESHA 1S9DA 2QRNA 5IHPA 1XP8A 4IKEA 2ZS9A 1G8PA 2ZVQX 3L0IB 4UNQA 2WKPA 4M9ZA 4CF7A 1HQYE 1KMHB 3HR8A 2MSDB 1KHTA 2ZJ5A 4FXPA 5EXXA 2ANBA 2QP9X 4XWAA 5AJZA 3UIEA 3B5JA 2DR3A 1F2TA 4KYUA 5D3MA 4DCVA 5DYIA 2NG1A 3DDCA 1N6HA 1XDBA 1FP7A 4LSGA 3V00A 1FPMA 3A37A 5TXGA 1DADA 3EIHA 2HLDA 2FG5A 4FMCB 1E2IA 1U0JA 1VHTA 3QUSA 1LVGA 3GLFB 3BE4A 1ZD1A 1DAGA 3LO5A 2X77A 4XH9B 5DN6A 5HZHA 2ECKA 4OK3A 2XZLA 4LPSA 4C0KA 5HE8A 5EQTA 4PPGA 2C04A 4PC7A 4JLBA 2JJ2D 1VHLA 3K70C 5CJPA 1N5KA 1HQCA 1NVVR 3P32A 4TMTA 2QMOA 1JJ7A 2FFQA 1W5TA 4M2LA 4O3MA 2F1HA 1P73A 4NYJQ 2CEAA 1KTVA 1GSIA 4QJ3A 1OE0A 3A36A 2GETA 3GMTA 3HYTA 1Z0KA 3VKHA 2OM2A 3GPLA 1OV4A 2EFCB 2GVDC 4DBLC 1XXHA 1Q3TA 3NEYA 4ILEA 5L3SB 2Q3FA 2H5EA 3FDIA 1P6XA 5L8VA 2ONKA 3RSLA 4HSEA 4GFDA 1VYVA 2ZREA 3LY5A 1Z0DA 4QG7A 3OESA 2R6GA 4KSCA 4LHXA 1NSTA 3QJYA 3U4QA 2V1UA 2IA5A 2YWGA 2ZM5A 3ZVMA 3QBVA 4FMBB 1JPNA 4EPTA 4EPVA 1QHGA 4Y0VA 2BJVA 5SZHB 1YVDA 3IGFA 4HB3A 4BGDA 1HT2E 3RS4A 4ASUA 1JR3E 2N42A 1MABB 1SHKA 3LW8A 1U8ZA 4V02A 3UXMA 5FOXA 4PQYA 4MYHA 4A0RA 2ZYUX 1T0HB 2G3YA 1AKYA 2WKQA 1IONA 2PZGA 3TIFA 1WBDA 4TYWA 4JS0A 1LF0A 4JJZA 2ORIA 2GCOA 2ZRFA 3T1QA 2ZR7A 3SYNA 2VRWA 2NPFA 4M1MA 2YV5A 5FL7A 2H92A 5AWFC 4LYFA 3M6AA 4HB0A 3SN6A 1QHXA 3W3AA 3LLMA 4V0ME 3EZ9A 1Z6GA 3OFNA 1F2TB 2AFIE 2YOFA 1IM2A 4DEXA 4D4MA 2OCBA 1E9DA 4B2IA 1JI0A 1OT3A 1TPZA 3IUYA 3KFVA 3ADDA 1KO8A 4PZZA 3FMFA 2C78A 3T12A 5EE3A 4TL7A 4BLTA 5JCPA 3LRPA 2J0QA 2JJ8A 1GL9B 1XWIA 5KDDA 2YZ2A 1SXJB 1G4UR 2RGDA 1W0JA 2NQ2C 2WJVA 2FDCA 1B23P 1OB2A 2YWHA 1DTSA 1TUEA 1S0UA 1DO2A 1E3MA 4JMPA 2J0SA 2R65A 3OIYA 4UQOA 1M7BA 2QTFA 4UNNA 3RVBA 4HI0E 4A9AA 1AGRA 2QROA 4OL0A 1NY5A 1QZXA 2EWWA 3BK7A 4MUAA 1E79A 3L82B 2CJWA 4JL5A 1X86B 5CLLA 3MSXA 1R5OA 4MKHA 3OHMA 3K09C 3R20A 4HUQB 2V1XA 2H7VA 1XEWX 1Z2CA 1NLZA 2JCSA 2P2LA 2H1LA 4UJ3A 4YC7A 5L3VA 3U44A 1XRJA 2KJQA 2QTHA 3AP1A 2QI9C 5FOSA 3PITA 1UBFA 1U81A 5JSZA 3IPXA 3W3ZB 1T3HA 4PZYA 3G0HA 3V4RA 4N3NA 4HAZA 1XTIA 3OZXA 1Q57A 3TLXA 4HEJA 3THYB 2O0JA 3PVSA 3JZMA 3QI2A 1NN1A 2NO7A 4WOPA 3EPLA 2CHVA 4QM6A 1XD2B 5UKDA 4H1VA 4G3XA 3EC2A 4DSUA 3WY9A 1ZUHA 5FL7D 1Q44A 2F7SA 1KZ7B 3CRRA 5CB6A 1E9FA 2OT3B 2KSQA 2R9VA 1NP6A 4NYMQ 2IYTA 3EARA 3WMEA 2D62A 1G3RA 2P67A 4B75A 1US8B 1VMAA 5AJWA 1XTSA 1QHHB 2IW3A 1VG9B 1IY0A 3OIWA 4C0JA 1OH8A 3K0EA 1XF9A 4DT1B 4KV9A 4PR0A 5C4GB 3NBYC 2D74A 1EWQA 1YE8A 1SXJD 3T61A 1ZNZA 2IF0A 4C4PA 5H70A 3B1XA 1TF2A 3NHAA 3TBKA 1KOFA 1G16A 5HKKD 4MRSA 4Q21A 1UPTA 4KBFA 4PXAA 4BFZA 4W5WA 3HP1A 1ZIPA 1FZQA 4IEIA 5IF9A 1SXJA 5JJLA 1YHNA 4XVQA 4ZI2A 3LNCA 2BV3A 4P3YA 4WAUA 4YXWA 3TE6A 4HB4A 2FPLA 2VHTA 1II8B 1ZVQA 1SVLA 2IUTA 3ASYA 2Z0MA 3QKRB 1U94A 3CF6R 1ZAKA 4BQSA 4DCSA 2JAQA 1A2KC 3A8TA 3RNLA 2JJ1D 5CYOA 2WJJA 4PSVA 4OI0A 3AV0B 2CLDX 2A5GA 3K0FA 5DH9A 2C99A 1UM8A 3ETLA 2IYVA 1FNNA 3R9IA 5JJIA 4A8JC 4NYMR 3ZS9A 5JMTA 4LWZA 1E2DA 1KO4A 3A1UA 3EAQA 3DEFA 3VR4A 3CUEF 5JHHB 4EUNA 4PO9A 1UBEA 1RFLA 1E0JA 2R44A 1DVRA 4LY6A 1A1VA 2YHSA 5FTMA 1GZSA 5A4JA 1YJ5A 3VR3A 3SDZA 3HYRA 3SI7A 4AG5A 1E1QA 1TU3A 3I62A 2GZAA 1GRRA 1QHHA 3A1WA 4IVQA 2GILA 3GCGA 1CLUA 2P6NA 4B6EA 3SJZA 2IYRA 2XNDA 4MGIR 4RD0A 2BOVA 1YR8A 4E03A 4AG6A 1KMHA 1Z28A 2W0SA 4TTRA 1YZQA 4PQFA 2Q0HA 3N2IA 4MRPA 2F43A 1ZCAA 3H4MA 5DO9A 4B48A 2CL0X 3C16C 4AI6A 1OHHA 3QNUA 3U2QA 3LH5A 3I5XA 1XMVA 1MO4A 1H8HA 1ZRHA 2Q21A 2DYKA 3T5GA 1BYUA 5KUTA 3BOSA 3MRSA 1P60A 4F38A 4TMZA 2XZOA 4AY2A 1V5WA 3GJ8A 4Q66C 4N1AA 3QPWA 5DLQC 2VSOA 1SHZA 3CLVA 2GZHA 3CNOA 2H18A 2FN4A 4B35A 3ASZA 2FWRA 3GLIE 2VBCA 1EFHA 2WJIA 3DM9B 3NBZC 2FFHA 1KI3A 1W47A 2REBA 4BPBA 2O8DA 1NL3A 2BKUA 4B71A 4TMVA 3QF7A 5KOYA 3W34A 4M53A 5JEEA 1C4OA 1M7GA 2IS6A 4QC2A 4W5HA 4ARZA 4PC3A 4V0NA 4D4KA 3BERA 2ZEJA 3W8RA 4C2UA 1Z0AA 5KNDA 1GM5A 1W2GA 3A4LA 5AK0A 4CEIB 2IF2A 3VR5A 2A7QA 1E1RA 5TB5A 4FCTA 4U00A 2OBMA 4M1YA 3B1YA 4NONA 5EXPA 4PPFA 1QBKC 3GD7A 4US0R 1N0WA 5J4KA 4NCHA 4Q03A 1E2LA 2W2VA 4JJKA 2GK7A 3THWA 1Z63A 2JLRA 1F3OA 1KSFX 1CKEA 2IXEA 4ASUD 2NO9A 4M1WA 2UVQA 3X1DA 2V8OA 2PBRA 2QGNA 3L0OA 4R9UC 4DLSA 1U99A 2F9MA 3LD9A 4IVPA 4LV8B 4JL8A 1KI6A 1O87A 3U7FB 4FWTA 1YZTA 4CVNA 1Q1QA 2ZJAA 4NE2A 2QSYA 2A9KA 2RCNA 4BZPA 5LPNA 2BWJA 5FI1B 3N2EA 3ZYCA 1H65A 1YZUA 1KDOA 2BKEA 5HTKA 2GXUA 2ZR0A 5FBWB 3TAUA 1SVOA 2QUZA 4DEYA 5FTJA 3IKJA 3H1TA 4L4UA 1X8KA 4LJ6A 2BDTA 2XJ9A 4AIIA 1E9EA 1BOFA 3AF1A 2J9RA 4IXNA 4G5OA 4RFSB 2G9NA 4BRUA 2FA9A 5JI2E 2EWVA 4YQFA 4Q1BA 5FTNA 3RRZA 5DI3A 3ADBA 3PUYA 2HCBA 4LJ4A 4XSGA 3WP0A 4NCIA 3DOFA 4KHZA 4GOXA 4TL9A 2ZU6A 3DOEA 2R8RA 3UG6A 4D2IA 4GP6A 3H2YA 1E96A 1AN0A 1FX0A 1RYFA 2FV8A 3LV8A 4G5RA 4CW7A 2C9OA 1MRNA 4W9MC 1E9CA 4QKQA 3N5CA 3PENA 2W2XA 2ZROA 3D31A 1DPFA 4KLZA 4TL6A 2IS4A 2DFKB 2O8EB 4JVMA 1XTKA 1N6RA 2ZRJA 4F91B 1M7HA 5CITA 2HCJB 1U0LA 1E2EA 2ZSAA 1JXOA 4RFSA 2JJ1A 1N25A 2BC9A 4EFLA 4MH0R 1L2TA 4EIWA 2BMFA 3ICQB 2CNWD 1G8FA 5C4MA 2GESA 2A2ZA 4BFVA 2CCJA 3FE2A 3MGCA 3SE0A 2PX0A 3SYLA 1NF3A 2ZAOA 4HLCA 4BFTA 2JLXA 2WJHA 4LHZA 2OHFA 2I1QA 3AVWA 1IXZA 3BJIC 2C5LA 3EPKA 3IIJA 1W4AA 1XEXB 1FQKA 1P62B 1GNRA 3A1SA 5B2ZA 4D81A 2WWIA 2ZE6A 3EIEA 2GVZC 5BQ5A 4H1UA 3U7EB 1HTWA 1KO1A 3WYGA 1DBSA 1T91A 4HLUC 4HYYA 3ZH9B 1G1MA 1NKSA 3O8CA 2XB4A 2O8FA 4V0MA 4D6PA 4L9SA 5TMPA 4DB2A 4LOAA 3T5DA 2XNDD 3D6TB 2OBNA 5K8TA 1Q0UA 4QHTA 1VDZA 3Q8XB 1EFTA 1WQ1R 4XOIA 3W90A 3W6OA 2AFHE 1ZM4A 2Y8EA 5EE5B 3LXXA 4EPXA 1ZUIA 2G0NA 2QQEA 4N0EA 4RSGA 4FCVA 1OHHD 1W5SA 3Q5DA 2WWGA 4Z8YA 3NIBA 3ZVNA 1LF5A 1NLFA 1XD2A 2IYQA 5IK2A 4B3XA 1JB1A 4D4JA 4ZPXA 2DWQA 1G3MA 4B74A 5FH9A 5J4HA 2D7DA 1G3UA 2AD1A 1CXZA 5HE9A 4M21A 3T1OA 4ACAA 4DLXA 2W83A 4Q19A 3FHCB 1BH2A 1S1CA 2AN9A 4NCKA 3VHLB 2NMVA 3EPHA 2VTKA 2VP6A 4MYTA 4URWR 2PZFA 4W7SA 3KQLA 2HF8A 3ZD6A 4TQAA 1XB2A 3QG5A 5DGXA 2IXFA 3AP2A 3TMKA 1UFQA 5CYPA 3RS7A 2OFXA 2OAQ1 5FUXA 1CBUA 4DIDA 3K0CA 1EESA 4NL4H 2XNSA 2CJWB 2GXQA 4MYCA 4P31A 5CM8B 4YDSA 4LBVA 1F60A 1SXJC 3TAHA 3IDQA 3QKSA 4TQ9A 4HAUA 1COWD 2PJZA 1OF1A 4NZYA 3KTAA 1G3QA 4TL8A 2V54A 1BYIA 2ZSDA 4C9BA 3U6BA 3M0EA 4GMXA 4K8OA 4MITA 3T35A 3THYA 1ETUA 4YXWD 5SZIA 1XJ0A 3AP3A 5JCZA 4BZQA 1TU4A 2FE4A 2OILA 2VPPA 1TEVA 2ZITA 2JLYA 1JALA 3ICEA 2ANCA 4HZUB 1N5JA 4TMXA 2YYZA 4GOKA 4XIGS 4PHHA 3OFND 4LBZA 1JR3A 1IQPA 1OFHA 5DSZA 5FUVA 3ND9A 3QF4B 2O8CB 3QXCA 4TZ0A 3C4JA 3MWYW 1ZINA 3NDPA 3BGWA 3PR1A 1P61B 5E7MA 1V43A 2ZRLA 5SZKB 1MR3F 2XGJA 4DWJA 4DDUA 5L3SA 1OKKD 4IFBA 2GXAA 3TNFA 2GJ8A 3RRYA 1RE0A 2JEOA 5KU1A 1BIFA 2DB3A 3CO5A 4B32A 4I1SA 1AGPA 4BFXA 2EYUA 4NPHA 5BN5A 5KYKA 2GWHA 5FFMA 4Z8XA 3REGA 4WVFA 2FH5B 2FSIA 3M4YA 4OJKA 5LD2B 3U7GA 2GXSA 3R9XA 3OE7A 3X1YA 2Z6VA 3SJCA 1N6NA 2CLCX 1SVIA 1JEEA 4RZ3A 4M9SA 1MO5A 4AD8A 2WIAA 1HE8B 2CMKA 2QE7A 4BLRA 1AA9A 1NVUQ 1SKYB 2HUPA 1YR9A 4WW0A 1Q12A 5EP3A 5L3QB 2JLWA 4Q4AB 4F4IA 4CEIA 3T15A 2WPDD 3KKNA 4GNKA 2VHQA 2ZJYA 1UEJA 2ZRKA 5D3QA 4MYUA 1CRPA 1HH4A 4C2TA 4OK5A 4MKFA 2VL7A 1QHSA 4HDCA 4DCUA 1J90A 2AXNA 1XEXA 2QPOA 1AIPA 2WSSA 1R8QA 5B57C 4XD7D 1U90A 3GFPA 2C03A 2EVWX 1W46A 1NN5A 3SOPA 5CB8A 4PPNA 2O8DB 3RC8A 3AVYA 4FI3C 3K0AB 1R0ZA 4QHYA 1TF7A 1Z22A 4PX9A 1RKBA 1MABA 3UANA 3WHLA 4KU4A 3C5CA 3UWKA 1XJQA 1R0XA 2EQBA 2G88A 3TQCA 2ZETA 4IVRA 4NHOA 4P0TA 3Q85A 3ADCA 2OFOA 1XPOA 2LKDA 4I81A 3MJHA 1KK2A 3I92A 1E94E 1CF4A 1T8UA 2CVFA 2Q9AA 3DM5A 3QXSA 1RRPA 4Q9HA 2ZS7A 5HCIA 1XBTA 1CR1A 4B43A 4YMSA 1XX6A 2OV2A 4Q5IA 3VAAA 1E98A 2J7KA 3L2OB 4UXIA 3X1XA 4ON9A 1JQJC 4C30A 2CVHA 4DLZA 1T6NA 3K53A 1P2TA 1MH1A 4TWZA 3CRQA 4YMVA 4JLMA 4TT3A 1W4CA 2H57A 2XXAB 4KLNA 1GP2A 1KI4A 2BHRA 3NEJA 3QG1A 4RD4A 3NXSA 2XTNA 3VFDA 4G0NA 4XTCS 3U44B 1MKYA 2BEJA 4WXPA 2IYZA 2JA1A 4GSYA 3TQFA 3BRWD 2RAPA 1Q3HA 4GRAA 4CEHA 2OLJA 4M1KA 5CIQA 1S96A 1KK1A 1CJVC 2ZRIA 2GJAA 2GBLA 2R6AA 3CONA 3SS8A 2ZQ5A 4DHEA 4ZKDA 8OHMA 5IK2D 4DIEA 1RPZA 1U9IC 2E9SA 1I2DA 2MSCB 4HAWA 4A6PA 1E2QA 2RGXA 2BCJQ 1KJZA 2BJWA 1JQLB 1CR0A 1KKLA 4IOKA 3QY0A 2NIPA 1EK0A 1G3IA 2CCGA 2VP2A 3QKSB 4NBSA 4ZDWA 4DLYA 3CZPA 1N5LA 1D6JA 1TAGA 4QL3A 2DY1A 3B78A 3AVXA 5FBLB 2ZIAA 3CM0A 1XPRA 1G9XA 5TV2A 3AF2A 2IS1A 1LY1A 4XTRA 1A82A 1CR2A 2ZRCA 1EX6A 2W6ID 4LV5B 3Q7PA 2QP4A 1A7JA 2GNOA 1W36D 1QHIA 4Q7JB 3SQXA 4JL6A 5IDVA 3R8FA 1IHUA 1Z08A 3AUYA 3VHXA 2V7QD 4OQLA 5IT5A 2QMHA 1OYWA 1VCOA 2YKGA 2ZJBA 1KKMA 5FI0B 3KQHA 5E7IA 3GFOA 3KKOA 1EWRA 2IEYA 5FR1A 1PLJA 1FTSA 2N46A 4OK6A 4QOSA 1DAIA 4RFVA 4JLAA 4DRZA 1BMFA 3QKUA 1IN7A 4ZCLA 2HLDD 1ZM7A 4QBHA 2P5TB 1RZ3A 2YJTD 1M74A 1K5GA 5KNBA 1JR6A 2ERXA 3KQNA 1FMLA 4G01B 4OYHA 3KUCA 4GOJA 1KSGA 2IYYA 3Q3JB 2GCNA 3TUIC 3Q5EA 1CJMA 4A82A 1Z8FA 2GK6A 2IL1A 2F9LA 3FTQA 4GZMA 1Y63A 3IQWA 3QENA 2VEDA 4WA7A 2RGBA 1GOTA 2QAGA 2FZ4A 4X8MA 1FUKA 3AKYA 2XSZA 1DAMA 3ZVLA 2WHXA 1Q20A 2E87A 2ZRGA 1PV4A 4OHYA 4BUJA 5JJKA 2F43B 3I32A 3PQCA 4DB4A 3E70C 4DSOA 1OW3B 2L0XA 3BC1A 3QVUA 1XD8A 3RWMB 4AKGA 2QL6A 2NZ8A 2RKOA 4KFRA 2JLVA 4MA4A 1MV5A 3KKMA 1U8YA 1KI1A 2I1VB 4HB2A 5DE3A 4A8JB 5FTKA 1DEKA 2QNRA 4P32A 3HPQA 4JLPA 4DLTA 2ZRHA 4OBEA 5LB2A 1UF9A 1KK3A 1XXHE 4LDJA 2PLFA 2V6JA 4JLNA 4CT5A 1SULA 3ZZUA 5K8IA 1NJFA 2QAGB 2FOLA 2ZUDA 2NOAA 1XPUA 4A0GA 1FP6A 2VHCA 3UPUA 3NHBA 1E4YA 1X1SA 2BCGY 3V9PA 1GWNA 4HAXA 3R7WA 1WA5A 2ZI5A 1R5BA 5J4YA 1Z0JA 1T3SA 2NPIA 4JZKA 1II0A 1ZBDA 2QM7A 3NWJA 3UMRA 4AC9A 3K9LA 4DLVA 4ACBA 4EQ6B 4Q7KA 2RGCA 3RS0A 4QBFA 1KJWA 4MGYR 3LFUA 4A2PA 4A2QA 3TKLA 5EZ5A 3DHWC 4C0QC 3LBHA 4YMUA 1S3SA 1K5DA 1XZPA 2YVUA 3A58B 3FKQA 4BE7B 1NMXA 5HPYB 1OLOA 3HU2A 3AQ4A 2O8BB 1SKYE 4GDFA 3AKEA 2C96A 1XFAA 1ELOA 1GG2A 3P4YA 3MD0A 3PUWA 4KODA 4AYXA 2QT1A 4R2HA 2D2FA 1G5RA 2GJKA 4FMDF 2DFTA 4PAMA 3KJEA 2BM1A 5ANRB 1Q1EA 1WF3A 3THOA 2CHGA 4QNMA 5E95A 4G5GA 4P4SB 2PJRA 3KXLA 3T1TA 1TMKA 3GJ5A 3K0AA 4NYIQ 1TQ6A 1YR6A 4UXHA 3WYAA 3BFVA 1WDTA 5KNCA 2WPDA 3OIVA 5J40A 4DDWA 4B2PA 2P0EA 2J0UB 2VYFA 3CRW1 5HZKA 3UMFA 2GF9A 1AS3A 2A30A 3WBJA 2SHKA 2WSSD 3GLHE 5A5GA 1UAAA 1QG2A 1KI9A 3MLEA 4V0LA 4E07A 5B30A 2AXPA 2CE2X 4PAQA 2ZRDA 5K8LA 1U8AA 1KY2A 5GVRA 2FF7A 1VECA 4JLDA 1Z0IA 2LKCA 3B85A 1PUJA 4GZLA 4IHQA 5EE9A 3ECCA 3QOFA 5FPHA 3V4FA 3NH9A 2TMKA 1IBRA 4A0FA 2J1LA 1E2FA 4TYPA 2RMKA 5FUYA 1R4AA 3E1SA 3RS3A 1OXSC 4PO1A 3W5JA 4MGZR 1NI3A 2VF8A 2DHRA 4HUQA 1TTTA 4URXR 5F9HA 5EXTA 2DWOA 3PUVA 2VP4A 2QTVB 5DIFA 1Q22A 2J5XA 2NO6A 3KKQA 4I99A 4ZDKA 1SZPA 3I4LA 2OESA 3RC3A 2GCOB 3MUFA 1E79D 3T1VA 4LYJA 4CDGA 2OZEA 4W5JA 4NP6A 3FWYA 4QBIA 1RRFA 2FMXA 4IDOA 4Q01A 1JJVA 3OF5A 1KI7A 3U3OA 1FOEB 2IWRA 2YWFA 4JVSB 4I1UA 3Q72A 2WOOA 4HDQB 4EPWA 1ZCBA 3U3JA 2DFLA 3KJIA 1E0AA 1LB1B 2W6JD 3U61B 3CR8A 2AHOA 2AK2A 1MOZA 3PEYA 2O8FB 4KXFB 4LC0A 2Q6TA 4O0MA 2EFHB 1I4TD 4HUTA 3IO3A 2R2AA 3RLFA 1Z3IX 3L0SA 2P6RA 4Q9KA 1H8HD 2VO1A 3SBEA 2ODWA 4BZXA 2QGZA 1GIAA 4Q4HA 2WWWA 1UKZA 3MWLA 3EWAA 4YLGA 1IN6A 3C8UA 1Z0FA 2GKSA 2EW1A 4HAYA 5BYJA 3B9PA 4IXMA 1FL9A 4HZUA 4QJ4A 4X8HA 3A4MA 1XZQA 2HYIC 1SVSA 2A5FA 2KBFA 2P3SA 4Q4JB 4A2WA 3KDSE 1L8QA 3U6KA 2ZJ8A 3CNLA 3TR5A 5EJEA 4L8GA 3LQRA 1JEDA 1G19A 1ZU4A 2FZLA 4FD2A 4JBYA 3WRXC 5CJ2A 3WNDA 621PA 3EZ7A 1NMYA 3GJ6A 3FGNA 1FQJA 2BEKA 3OAAD 4Z51A 3CZQA 1LNZA 4BLOA 4L9WA 4LI0A 3PEVA 4TYQA 5FPYA 1YR7A 1P3JA 3DVLA 3L8YA 3WRYC 4TMKA 2O0KA 2WWXA 1HA3A 2XTZA 4Q9JA 2VP9A 1P75A 3AH8A 4MRNA 3AVTA 1DO0A 3A1TA 3EW9A 4BEJA 1W0KA 4TMWA 2PH1A 1E69A 3NTUA 1JNYA 3KJHA 5AJVB 1UADA 4P33A 2V4ZA 1E32A 4H9GA 5FPTA 3UKDA 1LW7A 5J5CA 2KI5A 2X2EA 1XCPA 3C41J 4OQXA 4IJMA 3PFIA 2ASEA 3WNCA 1G17A 1M8PA 2BBSA 3W9YA 3WHKA 4CZ2A 2X8AA 3QXJA 2QG6A 3TSOA 1U98A 3QPUA 1CS4C 3CB4A 4ZCMA 1E2GA 4P4TA 4Q9LA 2QBYA 2ZI9A 1HE1C 2XAUA 4TTQA 4D82A 4JLOA 3TH5A 4ESVA 2BMJA 2PX3A 1Z6AA 2VH5R 2GAOA 2JIZD 3DZDA 2JLZA 2Q9BA 1WXQA 1P4SA 4OI4A 2XOKD 1XTRA 3JVUA 2PEZA 1BS1A 1VKJA 1ZP6A 2IHYA 2J45A 2WMOB 1KI2A 2QPAA 3TVTA 5JSZB 3FHOA 1R6BX 3QXXA 4KVGA 3AKDA 4EDHA 3SFZA 4IW3B 3KX2A 3ZZ0A 1ODFA 4A0HA 4EFNA 2PZEA 3PUZA 4D80A 5FOVA 1Z29A 1GNPA 3C5HA 3UK6A 3KUDA 3FKSD 2JASA 2NO1A 1G6OA 3VR1A 4LRWA 3LBNA 2WSMA 4I4LA 3GEHA 3ZIAD 3GJ7A 2UZIR 2XZPA 4B3FX 3THXA 4EJSC 3EA0A 2B21A 3K0CC 1AQYA 2DBYA 2ZS8A 3ZZTA 5KTYA 3RABA 4C0AC 2XTMA 1EXMA 1OXTA 2G83A 1RRCA 4MKGA 1F2UB 1JAHA 2AK3A 2ZRPA 4HDOB 3IO5A 4P4UA 1W0KD 1DELA 2XX3A 3EG5A 4Q1DA 1MT0A 2J7PA 2IX3A 2B7BA 5JRZA 2ZE7A 2W0MA 1OH6A 5FOUA 1JXMA 4M9XA 5E3HA 3NG1A 2ZYTX 3ZLJA 1NG1A 4A92A 3KFXA 2K5UA 1AS2A 2OE2A 1E1RD 1E2PA 1E2KA 2PL3A 4Q47A 4QRHA 4B33A 5FL3A 4XVUA 3IEVA 4DKXA 2IYXA 3K0SA 1KI8A 4JKIA 1C1YA 3CPJB 1XEFA 3RS2A 2PT7A 2QRZA 3E5HA 1JR3D 1KZGB 2A78A 4G5QA 3GLFE 5LD2C 1Z07A 4K46A 5E4FA 2HDNB 2QN6A 4PSAA 3AUXA 4QJ5A 1W0JD 1P2UA 5GJWC 4B76A 1VCMA 4KBGA 4FMDB 5EZ6B 3I8XA 3BORA 3I3SR 3K0FB 2XOKA 4L5BA 5LB4A 3DO6A 4JSYA 4F93B 3EPJA 1ONBA 1CR4A 3H0KA 4DZZA 3D8BA 1UBCA 3KQKA 2WVJA 3B2EA 4WXRA 4M4SA 3RS5A 4LUCA 2Z4RA 4M9QA 5AUNB 3LQQA 1YU9A 1TX4B 2EYQA 3GLIB 2BVNA 3QE0A 3F5FA 3LW7A 1GFIA 3TW4A 3QSYA 1IN5A 2RB4A 4BLPA 1G7TA 5J47A 4LK2A 1J8YF 1G41A 1KI6B 2PMDA 2B8TA 1E2MA 2ZXUA 2FEMA 1R8SA 2WZQA 1EG7A 1KNXA 1GILA 1NIPA 3IQXA 4HZIA 4CT4B 4CIDA 1J99A 2OO7A 4TTPA 1U0HC 5EP1A 3D3QA 4LHYA 4ZKEA 2G1JA 4MDEA 1AZSC 2GBLC 4RVCA 4FMCF 1DG1G 3IBYA 2FSFA 5CM9C 4F4JA 2C77A 2O0HA
chains in the Genus database with same CATH superfamily
4RK7A 5K51A 5GV8A 2KWIA 4C5CA 4EEZA 3EAGA 3FTDA 1Y9ZA 1RXVA 5A4DA 3CLRD 3ISVA 2R5FA 5LDGA 3RRFA 5ILQA 5IKXA 4RK1A 4II3A 2OBYA 5JTTA 4WT7A 4TYNA 5G0SA 3ADPA 3IB3A 1EHIA 1CUJA 4CGZA 3TDNA 3JR3A 1Y5MA 1XZCA 4MVWA 1XDDA 3Q2IA 4KZKA 2AUMA 2OUKA 2CXUA 2YYSA 3LQ1A 5JC8A 4WKCA 1M1XB 2WF6A 2YX1A 2ZU0C 4MLDA 4R1TA 4EAQA 1RJ9A 3FZYA 1RAHA 4LYGA 2PMKA 3C48A 2P90A 4F5EA 5F77A 3TEMA 3JRWA 1CNMA 1U28A 3OHSX 4GX2A 1VG0B 4XCQA 2ZBFA 5MDHA 4P9NA 1U0GA 2ZSUA 3AG6A 4DR6B 3I1YA 1IXKA 2G9VA 5IVKA 1L4FA 1X2EA 3O3MB 1EEHA 2KE5A 2YFYA 5FLXA 1J24A 1L5WA 5B3AA 1TVKA 1H5UA 4YWHA 3K8OE 1J70A 3K1TA 3CLSC 3GLIA 3N8GA 3SQMA 3KZCA 4HYQA 4K6OA 3UHAA 5TIIA 3H1PA 4FU0A 8MHTA 1M83A 3EA5A 4G5XA 4YV1A 4U39A 5AOBA 2IUYA 1KJNA 2XKBA 2R1TA 4GE3A 4KUHA 1XTBA 1GV0A 1W85B 5C51B 1J2UA 4NBNA 3WMGA 1L7PA 3PWTA 1R0BA 3JXEA 3T4UA 3VC1A 5ILGA 5AK3A 3DC2A 2F2TA 3KJGA 1ULTA 3M4JA 2R00A 1P33A 4HLDA 4IRUB 3P7MA 4RKFA 2M6KA 2K87A 4BZWA 4IDDA 2WTUA 4JXJA 3M70A 1PFYA 4RZIA 4Q34A 3GLTA 3RAGA 3T7RA 4BCDA 4O4LB 2QV7A 2NN3C 2YIMA 4MZXA 2IH4A 4BNYA 2XI4A 3GUYA 4P1ZA 3BF7A 4ARUA 1GKIA 1J0CA 3W1EA 4KWTA 2IYUA 4J0IA 1XA3A 1CTQA 4XYLA 2A5JA 4R6WA 1YKSA 2WIBA 4PZEA 4ZODA 3M3PA 4O4JB 1NBEA 4ITUA 4P3PA 3R0IA 5AVRA 4KGVA 5J5VA 4M8KA 2HWWA 4NBTA 5ALTA 5I9BA 5JC1A 2C7QA 1VI6A 3EC7A 5KOJB 1TL7C 2KB0A 3BD9A 1PVOA 3PHHA 1G18A 1KRHA 1BDJA 1EQUA 4ALNA 3BWMA 2FPPA 3C85A 3E7DA 3I9V6 4EPYA 4D92A 2UAGA 4ZV9A 4DBLE 1L0BA 1TFRA 4JUDX 2ZYDA 2AWOA 4CLOB 4M1OA 1DRVA 1WXGA 1ZNYA 2E5FA 3AFIA 1A04A 3HI6A 4MWBA 4TLCA 3RVPA 5GM2A 1N9KA 1U04A 4AYTA 4R98A 4E5SA 2WYHA 1I01A 1SIOA 4G1EB 4JJ4A 5LOVB 5BV7A 1SOUA 4WOKA 2B4TO 3PC8C 3W8NA 3D5QA 4OEHA 3FRIA 4XWGA 3GFRA 4JOCA 3A32A 4UEOA 2V7TA 1ZM9A 3HWSA 2QX9A 4NECA 4RE6A 1IAQA 1L5HA 1JBQA 3GP8A 4ZHQA 4YS6A 5K3AA 4NH0A 5B6IA 3VZDA 3OAAA 2ZJ2A 2GEDA 4J1SA 5GIPE 3UCFA 3AFOA 2XDWA 1CUZA 2NTNA 4A5SA 3V46A 2QAIA 4AJ9A 3ZDQA 1P81A 3WQQA 3IEKA 1Q74A 2P6UA 2ZFUA 3EIQA 4P83A 4BNWA 4S0ZA 4MPJA 4DVGA 4ZJZA 2G76A 1Q17A 4N0MA 5B1IA 1IIRA 4DJAA 121PA 3PHGA 1CRQA 1TADA 1I7NA 1TLFA 1S2MA 1Y33E 1RTTA 1U80A 3OA2A 4QU9A 1IQ0A 4DB2A 4KLCA 2INGX 3IHLA 1TLTA 1NVKA 2ORWA 4M0LA 5AHXA 4R51A 2WWFA 1NX6A 5AD1A 3AVVA 1KXZA 1JAZA 3H2IA 1HG0A 4JQZA 4BOYA 1EGAA 2OCGA 3QKTA 1XKQA 2O7VA 1RJFA 2P4EA 3WVNA 3CLHA 2WQ6A 2C7GA 3GJSA 3GUHA 2WUWE 3W2HA 1K7SN 3GEEA 1LI5A 3IAFA 1L5HB 1XU4A 4UUAA 3FDFA 2C07A 4OHRA 3W2EA 4F8JA 1N6OA 3VYWA 1RWMA 4A15A 3LX5A 3DZFA 3FB4A 4E30A 3S1SA 1QQ6A 1MOPA 1ST2A 3OKPA 4IILA 5B58C 2XIJA 1D5CA 1ZONA 3K9CA 5BW5A 1AHIA 3OFJA 1WV1A 1RYHA 2OD7A 2R7LA 1OVMA 2X4IA 1R27A 2HN9A 2YUIA 3QX9A 4N9QA 3RS8A 4CR7A 4DL9A 4WASA 2YWCA 3GA0A 4QFDA 1O6CA 1C14A 2ICAA 4ZO4A 5GONF 5LUBA 1TYBE 3BH0A 5FLYA 1XKLA 3GUVA 4RM2A 4Y6LA 4DSZA 3SMVA 4TSFA 4Y7DA 1EKXA 3CT4A 3UGJA 2RI6A 2CBXA 2YCLA 2C88A 2YV3A 1NJ2A 1UC9A 4LXIA 5LQSA 5CAEA 2XMQA 1OH5A 3GRRA 2AMFA 3GZNB 4TYMA 2DWPA 3W6ZA 4ZFNA 4DR2B 4EG8A 4FW9A 1Y6RA 2H48A 3G1UA 5L40A 4YK7A 3FX2A 1N36B 3WICA 2GTHA 1U3TA 5BNTA 3HEAA 2P6MA 2B35A 2GRJA 1ZH0A 2BMDA 3ITNA 1SC3A 4G6ZA 4UNSA 2PGAA 5F4BA 4P5PA 3SC3A 3E4CA 3IDAA 5A9TA 3RRMA 5KVVA 1L5VA 1VPLA 3GV0A 5JRJA 1UC5B 4DR3B 4C4RA 2P0AA 4JBWA 4UBNA 1O95C 1P44A 2XIQA 4YCNA 1CP3A 2PE5A 1KH2A 2Q5JA 2QVLA 5KWIA 5CMLA 2ZJZA 4G37A 3HKCA 2ZUEA 1DQSA 3ESDA 1PZXA 2AVNA 3UV3A 1II8A 4LDNA 5F33A 3HTXA 2FX5A 3RVQA 4WSOA 2ZTHA 1C7JA 1VCIA 3BA1A 4RABA 5A1TA 1YOVB 4BN0A 3NYQA 3HY3A 1FXWA 5NLLA 2F1JA 4G0ZA 4CFZA 4RTLA 1UC4B 1MO6A 1QDUA 3ZH2A 2GM5A 1XROA 3RJ9A 1XTQA 3U49A 4EI7A 4KFSA 3JAKB 5ERGB 2ODAA 2Q9UA 1M8GA 3VH3A 2BRUA 5CLQA 2O8CA 2JGMA 3QM1A 4FFSA 1UBTS 1IY2A 2FMUA 3COVA 1V4NA 1MC8A 1JPJA 2JI6A 4QUKA 2G1KA 1C3JA 3TLMA 3ESQA 5BN4A 5J4LA 2GERA 1L8AA 2OB1A 3P0RA 1XD9A 4KFTA 4L15A 5E38A 3Q9NA 5TQVA 3W6PA 4CMCA 4GP7A 2NNLD 3AI3A 4D4LA 3JYPA 2P2NA 5DRTA 1MJFA 5IM5A 1OYYA 1P7CA 2LDXA 1FRQA 3JVVA 2PN1A 2EP7A 4FOOA 4IPTA 2JDIA 4J1TA 1NAIA 2IOHA 3CWZA 4N03A 1T1EA 3X44A 1ESEA 5LA6A 3SBXA 2AJCA 1ZWKA 4PC2A 1SKUA 3U48A 1UMBB 2VAWA 3GFTA 3DFUA 1N8KA 2OG2A 2QTWB 3BD6A 3OE5A 5I9MA 2QSUA 1KVQA 4RA6A 1KYZA 2FR8C 4LK3A 5I7RA 4LGMA 3DBRA 3FXAA 2GRUA 2DSTA 2JVIA 1V9SA 4BNIA 1DUVG 4C29A 3NT2A 2Z58A 3RAPR 3B70A 1NUAA 4X0EA 1JYEA 2UYHA 5L3RA 4MVJA 2IP2A 2MMGA 4PYQA 4RVOA 3NBXX 1ECFA 1YC5A 2P8JA 3DYIA 3FGPA 3NYRA 4XJTA 4B3GA 1NVFA 2WTXA 1ECPA 3JARB 4DC0A 3D5EA 3HU3A 1QG6A 2JFOA 4LXHA 4ZRMA 5T64A 4WY5A 3SZGA 3TSWA 4MS3A 1T1JA 3DLBA 3H04A 5TS2A 2IXTA 4ZO9A 5AM5A 5AI5A 1I2CA 1E1CA 3GQBB 3EX7C 4DGSA 2Q7OE 4KLAA 4OUDA 3VA7A 1G7CA 1I4OA 2CYBA 1ZD5A 1VXRA 3KAQA 1L7MA 3D2LA 3K94A 3GBVA 3LO8A 1G5HA 3I72A 1YIAA 1U6JA 4KE6A 1PT5A 1WXEA 2XRFA 2WTMA 3AVPA 3RU7A 2ZTVA 3DBHA 1HYQA 3E82A 3GYGA 2YJNA 4IS3A 1DINA 5IYZF 2IC5A 3FMOB 5HIJA 4N7JA 4EUHA 4GOOD 3D9QX 2HCFA 2H2AA 4M0EA 4S35A 4E5KA 2F55A 5F98A 2BUBA 2ADOA 4GWKA 3EC1A 3GIDA 2QTVA 1HDYA 2I6GA 4WDRA 2GHRA 4O2LA 3S55A 2HRRA 2PIDA 5I7OA 2Q7XA 3BRWA 3EEFA 4C7OB 3MBOA 5BR4A 4Z9YA 2HSZA 5HGXA 4WKGA 4Q18A 3DFKA 5CH3A 3FWKA 2RK6A 4GDMA 3I04M 5EMNA 2XCTB 3NHSA 5FBRB 2N1BA 5FPQA 4HNSA 4UNPA 1IC6A 3WBKA 1J21A 2WD8A 4BLUA 1QWOA 2EU8A 5BNIA 3V32A 2ZTMA 3X3HA 2I6TA 2H7CA 1WM1A 4WZAE 3EE6A 4PE5B 4MRAA 2EC5A 1NAHA 2I8AA 3QWBA 4PLTA 3IPYA 3QHQA 3E05A 5CNMA 4ZQFA 3UAWA 2HT6A 2WA2A 2Y92A 3SCZA 1DOZA 3IKVA 3GP5A 1E63A 1ZI9A 3B1ZA 1PJTA 3IP3A 4PQGA 1N3BA 4B8ZA 5JBQA 4HGPA 1SQ5A 1EP3B 1K66A 4ND1A 2Q28A 4U6QA 4BO2A 3ZU4A 4AK9A 1YQTA 2J6CA 2AKAB 1YONA 2HYIC 1E99A 5DBFA 3L0PA 2QUAA 4CHTA 1XT6A 8GPBA 2JAXA 2B92A 4OHXA 3B1FA 3OEYA 2GF2A 1WE2A 1KDTA 2FPGA 5IMBA 3NOQA 5HDQA 4B5LA 4FFPA 3IXLA 4JP5A 5HSGA 2H59A 2YIJA 3FNBA 4FGLA 1NBME 4IJ6A 3PVZA 4BLQA 4TLDA 5BV1A 1HEIA 1MV8A 4PX3A 4TSFD 3G2HA 3VPXA 3I2YX 3L1HA 1K86A 3CNHA 3EEIA 2B5WA 2I3ZA 1R6DA 1ECJA 5A7HA 2YBEA 1EI9A 3LBAA 3DB2A 3IQEA 4NFHA 4H7PA 1MHPA 1C8VB 3FTNA 3PSHA 3LYAA 2FW0A 3BTOA 5ENVA 2ZI7A 4JIMA 5ICFA 1NVVQ 4WLEA 1W19A 4BX2A 4MX8A 1PX0A 2Z08A 3WLJA 4E7OA 2QENA 1I3CA 1J2JA 4O1IA 3DZGA 5KYUA 2WZBA 2YOHA 3DMGA 3E6AA 2I87A 3NKVA 3DZJA 3UJBA 1S2IA 4QUJA 1W4BA 4WLOA 4G8BA 3CX6A 4CV0A 2IZ1A 3VJKA 2QE7D 1V5IA 2YC2C 3LZ6A 4KX3A 3BQNB 1ZD8A 3ELUA 1QHYA 1WUKS 1HKUA 3LLUA 4MQFA 5AJYA 4F9TA 3UG7A 3SU8A 3WLFA 3GMIA 5CB4F 4AIRA 4DIMA 4ZEWA 2AC2A 4A3SA 4ZT7A 2B3DA 2XCSB 1QCCA 1MB3A 1R6UA 1DUIA 3CZ9A 1O6GA 3QKWA 3FKSA 3QU4A 4HNHA 4JVNA 4HYTA 4TWBA 1LLDA 2ZYVX 1DRJA 3DOIA 5EUQB 4KN6A 2QTZA 4XEHA 4IOLA 4ABTA 3HXLA 3UCXA 2A94A 3L8ZA 1HPLA 1CQXA 5IVDA 3IOEA 1ECCA 4J3FA 3D7MA 1Z74A 2CK3A 3EYWA 3B1WA 4PTYA 2BFEB 3W5IA 5HCNA 3WNVA 1EWYA 1TJNA 4K7JA 1YA4A 4ZZ3A 1CUAA 3DYVA 3HG7A 3KSUA 3NIFB 4Q4AA 3F7NA 3SAJA 5IVHA 5G3YA 4INAA 4KK4A 3Q11A 4Q05A 2J5KA 3TRDA 2DH6A 3D81A 3BXPA 3ROTA 2HEGA 3CVWA 1GVNB 4LCBA 3WYAA 2QJTA 5E3IA 4L5IA 3WZ2A 1O5TA 2QYOA 4J7XA 3NC0C 1UEIA 5JDIA 1A71A 2GZRA 3G7UA 5KMGA 3HLYA 1YULA 1TM2A 3GJRA 1PLLA 2RIRA 3DE2X 3E27A 3EUAA 3SHWA 3HXQA 4RVHA 1IHYA 4TZTA 4KXXA 3OUTA 2HF2A 3ZS8A 5I7VA 2FZ5A 1RZUA 3HXPA 2A0WA 3AF4A 3DULA 4OTZA 2I6QA 1Z5ZA 1A27A 3INRA 5C8YB 3NANA 3PFBA 4P7GA 2J41A 2PD6A 1Z4MA 4QARA 3AFHA 4U8GA 3UWOA 1YNSA 4MUGA 4KAXA 1QGAA 2HNAA 4Z3OA 4R54A 4S12A 1EVQA 3KPWA 2EFGA 2J3QA 3E2IA 4WBXC 4GKKB 1YR1A 3LP6A 5SYNA 4LEIA 4YJ3A 1NKTA 1PZEA 2LCFA 3SEQA 4RDHA 2NGRA 4ROTA 4QYMA 4EG4A 3U0BA 1D0IA 1X7GA 1DNPA 3MCAA 4JOBA 4Z4IA 3F90A 1G21E 1WXHA 3BB1A 4C6TB 1C29B 1UIMA 3GLGB 3KXKA 2IYNA 3TZLA 5C7YA 2XXAA 1B0UA 4LJ8A 1PR4A 4EB6B 4UULA 4I9FA 4A10A 1ZCJA 4PLYA 1PUIA 1YSCA 4PGFA 4IG9A 5EJ8A 2JD1A 3PT9A 3LDUA 4YRJA 2VF7A 1XZNA 3FCCA 2IY8A 2Q5QA 4YP9A 2O8BA 3GEDA 4ZYVA 1XELA 5FTWA 5GGXA 4D8TA 5IF3A 5CDFE 4XVRA 2JIDA 3A7EA 4NNOA 1Y80A 3ED1A 4B7AA 1Q11A 2WSLA 2BLLA 1OJLA 1UINA 4JJGA 1G5IA 1X0VA 1Y9AA 3MWGA 2JBAB 1Y89A 1TZJA 5E2BA 1SIWA 4ARIA 4MOWA 3LT2A 1EINA 1ULBA 2X14A 2DJ5A 1SRRA 2XDQB 2E85A 3QBEA 4JGBA 1E9AA 4ZAGA 2ZBVA 2DUMA 2C9MA 3SZRA 3PS9A 1ZW6A 1C7FA 3TTSA 3VU3A 5E6RA 1GPNA 1W52X 3ZJVA 3LY8A 5SY4A 3IPRA 1F51E 3WWCA 2CXNA 4AX4A 5HKAA 1U2GC 1Z36A 1NN0A 1KS2A 1CS0A 2YXNA 3QSGA 4GGPA 4OQEA 3LDFA 4QYTA 1RM3A 3ZY5A 1R0KA 1QV6A 2Q1YA 1XVTA 4X7BA 2IT1A 4XQCA 2IHBA 3NASA 2VTBB 4LXYA 3M9XA 2RGRA 4OFXA 4ERNA 5BN3A 3OJXA 2COKA 2H1HA 4H6XA 4R1MA 4LHVA 1TNDA 2E1RA 2AV6A 2GHQA 2RGEA 4G5SA 1N6IA 4Q37A 2PU5A 4RPHA 2NTEA 4L0MA 3OQIA 7YASA 1XHEA 1P0FA 4J3JA 4HVLA 3QVGA 3GJZA 4B4WA 5B7PA 4F4FA 1YQUA 1OWOA 5CVVA 3GXOA 3WQRA 4DV3B 1R3UA 4MSUA 4KNWA 1C9MA 2C7BA 5EJMA 1YS2X 3ETDA 4DMHA 1N0VC 2GAJA 1E4EB 4RWEA 3SG0A 3AR3A 2AE2A 4LE0A 5AVXA 4IIJF 4F84A 3SLKA 4B3CA 3HO6A 4UU0A 3QJGA 4GBMA 4KPGA 4XPIA 3VPCA 4OHFA 1X1CA 2VSXA 4QTZA 3A4NA 4GT1A 4AT1A 3B9RA 4RL6A 4FYMA 2O0MA 4PR3A 2B7LA 4NARA 1USWA 3IBFA 3D3WB 3I73A 3D6NB 3P97A 3SYNA 2HEIA 1EYZA 1GUZA 1K4YA 1PT6A 2YZNA 5EMLA 1DQRA 3RGGA 4JI8B 4KYVA 1W5BA 2OXTA 3ZHBA 1TC1A 2VSQA 4LZZA 3TUZC 1KEKA 3S7TA 2C97A 1GL6A 1SQGA 3TX6A 4N8SA 1RLTA 2MMCA 4IEEA 5T6MA 1I9CA 4U7DA 2F3UA 4I55B 1GKLA 3PE3A 1OIVA 1FUEA 2JCYA 1PJ8A 5MGBA 5JCJD 5KYYA 1ZZEA 1M1ZA 1R9GA 3FZEA 3OPVA 4FZRA 1HL7A 1G8YA 1XCGB 4IV0A 4MNTA 3M3HA 1CZHA 3S70A 3E61A 3S8YA 4FHZA 2W48A 3NS7A 1CX9B 5KTSA 1M75A 2VTBA 1TKCA 2XE6A 2DCUA 1H9AA 3GO4A 3CUSA 1XVLA 1ZN8A 4MWGA 3SYRA 1D2MA 4TSKA 1ACJA 4RD6A 4R81A 1RFGE 4GR5A 1OLSB 3WS7A 3GLHB 4BNZA 5FBQB 3NVAA 1SG6A 3W04A 2IYEA 3KHSA 4RX1A 1QFZA 4HXFB 2AB0A 4YMIA 2PZJA 3RFFA 4TQUS 3UHFA 4C01A 1YL7A 4C4YA 4LF7B 4YRSA 5IPFA 2PO7A 1U9YA 3QVGB 3B60A 5DP2A 4P86A 4AKEA 1Y4SA 4RV5A 3P9KA 1WL8A 1WPXA 1PUXA 2WKRA 3HSKA 2X4GA 5DASA 1WO8A 5BYKA 5AOVA 2BL4A 1OI2A 1ZCFA 2J9YB 2Q9CA 2X0JA 4OQPA 4UCFA 5E8RA 5GGYA 2NQTA 2X6RA 3F3KA 1GTVA 2WYWA 4U5QA 2RHLA 1ZR2A 5FQNA 4LXUA 3A6FA 4PIPA 2WUDA 3RFUA 3ZQJA 1O3YA 2W6PA 5B4TA 1W7AA 5FAXA 2WD9A 2V0CA 3FCSB 5BV0A 3KB2A 2RGAA 2CLHB 2L2QA 3QE3A 2V74B 3EASA 4URVR 2YHIB 5KJ1A 3E81A 1L4YA 4EI2A 2I8LA 5KTRA 4EYQA 3PLAE 2AKYA 2LIPA 3IILA 4ESEA 3S8MA 5EJ2A 4BVEA 5IDXA 1L7DA 4J8PA 1JTFA 1XUOA 2J6HA 5DHAA 1CEEA 1U3FA 3M6UA 4NQRA 4YI5A 1UZLA 4MRVA 4MW7A 2VF5X 1LVHA 3EZ2A 1ZK3A 3MG9A 3AC0A 1EFLA 2XQVA 5JLJA 1CFJA 4B3BA 1LI7A 1OIWA 2AR7A 2Q8NA 4LMPA 4QUEA 3AVQA 4JT8A 4OHWA 1YXMA 1DAKA 2P0YA 4UTRA 1S4MA 1APBA 4DVJA 2ZUCA 4JHXA 5J2TB 1AJEA 1P91A 1XDGA 2BR5A 2HPAA 3CKLA 3ICVA 3MB5A 3EGDA 1GPAA 3ZR4B 2JAHA 2CFOA 3D6FA 1UQRA 4JT4A 4XFDA 2EFDB 2CL7X 4NBVA 5H1YA 4OI1A 3SJBA 3OLWA 1R5JA 2C9CA 1L7AA 3C1UA 3OMWA 3PC7A 2CFCA 1ZRNA 4G36A 3U7RA 3VU9A 1SVMA 3UBMA 10MHA 1F1BA 1T8TA 1WMSA 4K26A 4EKGA 5BUSA 3A06A 4TWIA 1EWVA 4V0OA 2HBQA 3HKEB 3RUDA 1K6MA 1OFUX 1DKOA 1Y81A 4D9JA 3NLLA 3RTEA 1KC1A 1T3LA 3H9CA 3USES 1UP4A 1E1DA 3KEOA 1HFJA 4A91A 2X1LA 2CNDA 2FEOA 2WHQA 3ENWA 1U7ZA 2IPLA 2QAJA 5FLKA 3MCZA 2D1FA 5CA1B 3BWYA 5KAPA 4HSGA 2CDBA 3ER6A 2WK1A 3KETA 2VH1A 5IC6A 5B1SA 5C3UA 1EGHA 3G0BA 2OVBA 1G20E 3B9QA 3BQMB 3C39A 1NVXQ 3H2HA 4WNAA 3ZGXA 3O1IC 1USKA 2QAGC 2O2GA 4XQ9A 3Q7SA 5F1OA 1RAEA 4BKOA 3PJGA 3AGQA 4OI2A 5KVQA 2QWXA 1L1EA 4NDZA 3FPGA 3MK31 1ZH2A 4GMFA 1UM9B 2Q5HA 1J1UA 3THXB 1FB5A 2BFWA 4DA6A 5DSTA 2BFCA 3LVQE 3B13B 3SR0A 2REQA 3OH8A 4LXTA 1MXFA 2XRMA 3MAAC 4IBOA 4JLVA 3SC2A 2ODEA 4C08A 1INLA 1W2HA 2E4VA 2QRKA 1ZN7A 3A26A 1MLDA 2HV8A 2QMEA 1E2NA 1IDN1 3L05A 3U81A 3ZZMA 3J81k 1JSZA 5TGZA 1RPAA 3HGMA 1M34A 3FFTA 1QONA 5AKEA 3AT1A 1VI2A 3ZGLA 2P2ZA 1BGXT 2G04A 1HO3A 2PX8A 1J9ZA 3FZNA 3HVJA 5ALXA 2PD3A 5T57A 5LP6B 3KXIA 4NDNE 1Q21A 2IE0A 3K70B 1VXOA 2HHCA 1QIFA 3AEZA 4OG2A 4BAGA 2A92A 4ZZ1A 4H77A 4NTZA 4D0NA 5ESWA 3KFLA 4PFSA 1FZTA 2V7PA 2YXBA 2ZANA 1I0IA 2WV9A 2PY6A 3C1OA 3FSGA 3K9QO 3EVCA 3ONNA 4H6WA 2XQKA 2JLQA 3IEXA 3IUNA 3NYWA 3DDSA 4UNNA 4CLRB 4NKRA 5IFLA 4JT9A 1EIWA 5FX2A 4A36A 2VLBA 3MWJA 2HA6A 4H4CA 2YINC 4O4HA 5EGNA 3VOTA 2XHZA 1B6SA 1E8MA 3KYCB 4OQFA 2O2IA 3GCXA 3IIEA 2X58A 4IHJF 2FSVA 4JSTA 4Y2HA 2B4QA 1VIDA 3NHPA 2PKRA 1YL6A 2IBMA 4V0SA 1AKMA 1E2HA 1VSUA 3KALA 3FBTA 4YRRA 5K2OA 2GTIA 4LQ4A 1Q16A 5LUAA 3G1WA 3ZVKA 3I9MA 1JILA 3L6CA 4RD2A 1VSVA 3W4JA 1I4DD 2FPMA 3CUUA 3GAFA 2DPGA 3L6DA 3S1AB 4K9NA 4X64B 3QE4A 3FMVA 4DT1A 1OB5A 1L5GB 3S8EA 2XT6A 1HM5A 2RARA 5T6BA 3S29A 3WLSA 4CU5A 2VA8A 4PGMA 4QVGA 5DGCA 4ZYTA 5JADA 4L4UA 4D7AA 3R7WB 4PCAA 2NNWB 1HV8A 2P9FA 4JJIA 4GXNA 2ZI4A 3ICEA 4C7JA 3FM9A 2DQYA 4IM7A 5AR1A 1Q15A 4C3VA 4MHTA 3W6NA 4ZVKA 3W4KA 2YOGA 4KRGA 5AI6A 4Y6PA 3UO8B 1U5AA 4RANA 4U7JA 3D1LA 1WUIS 1SXIA 3NDRA 1YE5A 4X54A 1DJMA 2J3MA 3F9IA 3A1VA 2W6MA 1AKEA 5DF1A 1T5IA 4M9UA 3UJAA 4E31A 4ESHA 5IHPA 1MC4A 3LCCA 1TCCA 3F2VA 1Y3BE 4IKEA 5A3QA 4L9AA 2VDWA 4J1QA 1T6YA 2ZVQX 5TMDA 1NATA 3SJ7A 3ZDEA 4CTOA 2PRYA 4PYKA 4FJ1A 4HNGA 3SSNA 2TMGA 4GSKA 2VC2B 2D5AA 3FMGA 4XWAA 4DA7A 3DLIA 5AJZA 5HUQA 1M3SA 3CNQS 3II6X 4OUDB 5DYIA 5F3DA 4R1UA 4F46A 1CCWA 2RHJA 3QA9A 5LQKA 1O08A 4YCCA 1WPQA 1XO1A 1IK4A 1M2OA 4LSGA 5AKKA 3V00A 4B4OA 4MV7A 3A37A 2V3WA 4RGVA 2X0FA 5JT1A 4NI5A 3EIHA 3X2FA 1GQ2A 3KKKA 2XUOA 3OZIA 4D98A 3QUSA 2FP4A 3GLFB 1RI5A 1ZD1A 2OV1A 2QZPA 2FLKA 3Q3GE 5DN6A 1NONA 1ULHA 4DR4B 4XI9A 3BMNB 1GG5A 5BW6B 3AYZB 3CZ4A 5HE8A 2BHNA 1SURA 3B3FA 3G3EA 4PC7A 5EQTA 4BQNA 1M33A 5JTUA 1DC8A 1VHLA 1KMMA 1OTYA 1I0LA 3OJEA 1TM4E 4U63A 3W8FA 2I80A 1N5KA 4QJBA 4WOBA 1NYTA 3WIDA 4AB1A 4LHSA 1HQCA 3ZHZA 4TMTA 4EYOA 1U9CA 2ZK7A 2UUAB 1JJ7A 1VPEA 4ZCPA 2FFQA 3V1KA 5ISMA 2H4ZA 3F6SA 4Q9DA 2UV8A 3HKBB 4YCMA 1P73A 5BSMA 1RMYA 2CEAA 1KTVA 2OK7A 2OYCA 3VKVA 1OE0A 5KCZA 3CFYA 4P36A 1HDZA 3GMTA 3AY6A 3K6RA 1OV4A 2EFCB 2HHAA 3QVXA 5AVYA 1KXJA 1NOIA 2JFXA 3HKDB 1IH8A 1RLOA 3KC2A 5E3JA 3HVRA 1Q3TA 3ESAA 4E3WA 4ILEA 5LFAA 4YCJA 5L3SB 1E6UA 3TFOA 1TC2A 1DHRA 1P6XA 5NULA 4YJKA 1VYVA 2AW5A 3U31A 5KNBH 1IM8A 3ONFA 2GN9A 1JSXA 3CZAA 3OESA 4RUKA 4I55A 4JBHA 3FOFC 3WK8A 3F8SA 3MTQA 1B26A 1C9EA 2P2GA 1NSTA 2PKWA 5A62A 3O0DA 2JVJA 3OSZA 3DHEA 1ORVA 1W8IA 3UAOA 2IA5A 1Y1LA 3V55A 1FFXB 2QTGA 3ZVMA 3QBVA 4CIXA 1JPNA 2QM3A 2BPOA 3PRJA 4D9MA 2BM8A 2DPLA 2BJVA 5CLHA 3W5VA 4ND8B 3IGFA 1Y7TA 4X6YA 4LNAA 4ONEA 1T6BY 3LXMA 3N5KA 3ZWAA 3SX4A 1MABB 1SHKA 3E03A 4IIBA 5FIUA 3QVWA 2JCXA 1OFGA 1JZQA 5AQEA 4N0PA 2QTNA 1IHOA 2QYSA 1VJDA 5D51S 3P9RA 1IG3A 1PQUA 2VUTA 4ZEMA 1UC8A 3GG9A 3WLEA 1GN9A 1WBDA 2RCYA 2RHOA 1LF0A 2JEZA 2VDUE 2GCOA 3IOCA 3OZFA 1T2DA 3U4HA 2VRWA 3MIZA 1XZ8A 4M1MA 1XU9A 1Y6ZA 3QTTA 1IZ0A 3W05A 2VNKA 1ZGGA 2GR9A 4NZ9A 5IBPA 1HEYA 1SHJA 4LYFA 2F90A 2AS0A 4NH4A 4KMOA 3L9XA 3ZZ1A 5BSWA 1E7YA 1DEOA 2NWQA 3Q6IA 4V0ME 1L4HA 2MCFA 4AF8A 4YJHA 3C7TA 1P0QA 1TRHA 3NBKA 4WN3A 5JYDA 1W6RA 4V2IA 4D4MA 2D5CA 2FKNA 3C43A 4HQKA 1DGQA 4EZIA 3IOBA 1OT3A 3O4FA 3IUYA 3KFVA 2DLCX 4PZZA 1L5KA 4CF6A 5EE3A 4D97A 4BLTA 5EYPA 1GL9B 4DILA 1PNQA 1B00A 1H2EA 2J3IA 2X9GA 4I3HA 2YZ2A 3HB4X 4TKVB 2FOXA 1G4UR 1KBQA 4CKCA 2RGDA 2NQ2C 1RCUA 3B6MA 1JF8A 3EFBA 3EVFA 4DN6A 3JRXA 4HCJA 4D9FA 1E3MA 3DBLB 2PUAA 4F3RA 2YS7A 1B2RA 3G68A 2FE1A 3B2NA 3CKMA 1OC4A 4JAVC 5IBCA 2AC7A 4EARA 3QY9A 4KVFA 4JJAA 5J1TB 1PN3A 3K5IA 1HMPA 1ORRA 3O8OB 2CJWA 1CUYA 1WZNA 1X86B 2EJCA 2VYVA 2ZBGA 3INNA 3IKTA 5EKSA 1R5OA 3EZGA 1GZDA 3RV4A 3O82A 5ADHA 2JCSA 4Z0PA 3U44A 2H1LA 2P2LA 3AHIA 4ODIA 2QTHA 3AP1A 3WLRA 3QOXA 2QI9C 4P8RA 4F96A 1BCSB 2IQ5A 3HBJA 5FOSA 2G5GX 4KPFC 4G0UA 4PGAA 4Y3UA 1H0KA 1T3HA 3F5DA 3NTLA 3V4RA 5GPBA 3RO7A 4HAZA 1XTIA 4K3VA 3TJRA 1C9JA 1O1YA 2HA3A 1NNSA 3E2MA 4UPDA 3PVSA 2ZCVA 2ADFA 4BJHB 2D3TA 4W8HA 3E0XA 1C3XA 1PZHA 3AMVA 3IBSA 3CISA 2PGJA 3Q7RA 4H1VA 4LN1A 5DWQA 4CKBA 2ODPA 1YI1A 3WDMA 1IWPB 2PWYA 1Q44A 1KZ7B 4HFMA 5AICA 1AZWA 1FEZA 1D1TA 4BMCA 1W2WB 2OT3B 1K8QA 1QTIA 3JWGA 4CTJA 4ZYLA 1O89A 3MIIA 5E0KB 3ZG6A 4NYMQ 3DXYA 4OUKX 3VJLA 3EARA 3KXDA 1RADA 1U4SA 3WMEA 1X87A 1G3RA 5KOIA 2P67A 1UPUA 1W34A 1ZI6A 1VG9B 1OH8A 1SHTX 1ZK4A 2JGDA 2PGXA 4J2OA 1PR3A 5C4GB 1PJ3A 3NBYC 3A4YA 2PX2A 1OZGA 2D74A 2VPZA 2XUDA 1DB3A 3O3CA 1IB0A 3ZD9A 4H6VA 1B6GA 3IEIA 3TBKA 2X0NA 4FYXA 4E33A 2Y99A 3OZDA 5HKKD 2VJYA 4JD5A 2BSXA 4MRSA 1UZMA 4NU5A 2JZCA 2P40A 1UPTA 5AOAA 4ZAXA 3D3NA 3RSHA 1F7VA 3LQ4A 2O07A 1Q3KA 3N0XA 4MAMA 4L3WA 5IF9A 1FZQA 2WF7A 4C05A 1AN9A 3KO8A 5JJLA 2XQFA 3PL5A 2C2ZA 3LOUA 4Q15A 4XVQA 3UWMA 3IVRA 1M2WA 3F6BX 4ZI2A 2E37A 6AT1A 4OLAA 4CG3A 5L4LA 2ZR8A 4HB4A 2BEUA 4CUKA 3MB8A 3V6LA 2K6GA 3RYHA 4B79A 5DM60 2PUDA 4UEJA 1U94A 1A8SA 4JB3A 3VO2A 4BQSA 5G0VA 2QOEA 4L02A 1HDIA 1TA4A 4LKOA 3KPVA 2NU6A 1RHMA 5DH9A 3T3GA 1CRWG 2PQ0A 3KEGA 1U2SA 5A3JA 4Y9UA 2Z2ZA 4AXXA 1NV8A 1PD0A 2G0AA 1I33A 2GZ2A 4LWZA 3WNZA 1V7PC 3OWOA 4PLVA 4ZYUA 4DJDC 2JAOA 3W9BA 3MZ0A 2NZ2A 1RFLA 3MRVA 1QGUB 3EN0A 2PRJA 1DVRA 1XCJA 1QYWA 2VT7A 4TRMA 4ZQCB 1WHSA 1FCJA 5THQA 5IULC 4AY6A 1GZSA 2ACEA 2Q99A 4BV9A 5LMZA 2EFYA 2GBGA 3SI7A 5DM70 3AL0C 4DM4A 1TU3A 2XVMA 1TYAE 3HCNA 3WKAA 4B7XA 2WINI 2H4YA 2PT6A 2WSBA 3BK1A 3GCGA 4IVQA 4II2A 5JCOC 4EG1A 1PFQA 3EVTA 2IYRA 2RH4A 4MGIR 4QUBA 4CIBA 1C1DB 4KXVA 4B4DA 1KJIA 3HEMA 4FS3A 5AXAA 4H1WA 1C3VA 4AG6A 4XPZA 5AVSA 1M72A 3ZDCA 2J3JA 4RQAA 3ITKA 4MRPA 2IBSA 5DO9A 1KRXA 4KWIA 4GO1A 4B48A 1DAPA 1A2QA 1J33A 3TR6A 1L6IA 2W11A 4HHEA 3DNPA 3H2KA 1SK8A 1BEZA 1AH2A 2OAEA 3FLBA 5JCJA 4YAEA 3FCAA 4AY2A 1DZIA 3O95A 3P2MA 4TMZA 2I3AA 3WKCA 1V5WA 2I6UA 4N1AA 1Y1KE 2O4CA 2AOTA 3QMVA 5DLQC 2E4ZA 3SNKA 4OP1A 1SHZA 1Y8QA 1K3TA 1ZOIA 3TL3A 2MJLA 2WF9A 1V11B 4UHBA 3FYDA 3WB0A 3I30X 4YEDA 1J2EA 1EFHA 3CF4A 1EAYA 1NMEA 1KI3A 1P77A 1W47A 2GD0A 4BPBA 2JA2A 2O8DA 1R15A 3LF1A 1JJIA 5C8ZA 4EAAA 5JO9A 1N2HA 4TMVA 4EKDA 1ZMRA 4UD6A 1KVTA 4KN9S 2AOUA 1C4OA 4B6SA 2HSEA 3COSA 5H3HA 4U7FA 4ZZIA 3Q3EA 3IE2A 2GD2A 4BNFA 5CDGA 3MBIA 2WYOA 2DHCA 3N53A 1QVZA 3IHTA 3SM9A 3AYXB 3A4LA 2I7VA 2ZP1A 3RU2A 2GGSA 2IF2A 2IKQA 1RVV1 2A7QA 2UYOA 1JVBA 1NYRA 5TB5A 5TPZA 4FZJA 3QVTA 2OBMA 4M1YA 3ZI4A 4E4TA 2LBPA 2JAWA 4NONA 4ZOEA 3DJFA 3O7WA 3Q5GA 4EB3A 1QBKC 4LF6B 5B7NA 3GZ4A 1C30B 1BKYA 2DLNA 1SU4A 4E13A 4Q03A 1JP7A 1UZUA 1Z63A 1SUPA 2JLRA 1KSFX 2IXEA 3CNEA 3I9KA 2NO9A 3IPCA 2UVQA 3U4AA 3VR4H 1N34B 2V8OA 2PBRA 3L0OA 4A7PA 1MEEA 1WCIB 2E4WA 3L7CA 3WBFA 2FEAA 1GGJA 5GM1A 3JWHA 3WNQA 3E22B 5AESA 1VKRA 3COWA 3BE5A 4IVPA 4NLLA 3ZWPA 2GMWA 1KI6A 4AMBA 3WDLA 3CVJA 4U7HA 5K6TA 5F78A 4Z6KA 3U7FB