2IXGA

Crystal structure of the atpase domain of tap1 with atp (s621a, g622v, d645n mutant)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
254
structure length
254
Chain Sequence
b'LSGSLAPLNMKGLVKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLAVGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSMVEAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ANTIGEN PEPTIDE TRANSPORTER 1
publication title Distinct Structural and Functional Properties of the ATPase Sites in an Asymmetric Abc Transporter.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 78
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2006-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ixgA01
2GBLA 4GSYA 1YVDA 5HKKA 3BJIC 4Q1BA 4ESHA 1ZC3A 5FBQB 2X77A 4OQLA 1XWIA 4IOLA 1E2FA 4K8OA 3A1WA 1IY2A 1H65A 1ZBDA 2BWJA 3B78A 4URYR 2D74A 4ASUD 4FCWA 1W7AA 1E9BA 4X8OA 2WSSD 3IIKA 1OFTA 1XP8A 2C99A 1NSFA 2OAP1 2WWWA 4URWR 3UG7A 3W9YA 2YWFA 4HAUA 1DAEA 1P61B 1W36D 2V7QA 5C2JB 2FF7A 3WRYC 3I61A 1HURA 1Z22A 1J8MF 3KTAA 4MDEA 1LS1A 4F93B 1UKZA 2MSDB 2ZIAA 4HYYA 4UNSA 1A2BA 4TQUS 1KNXA 2JLRA 3SJBA 3U6KA 1MR3F 4C30A 2JJ8A 3WXMA 3ZGXA 3ZIAD 2C98A 4GBMA 3FFBA 5JLJA 2GVDC 2BCJQ 2ZR9A 1Z3IX 3K0CC 3IGFA 4QRHA 2BHRA 3T1VA 3GLIB 2FSIA 3CX6A 4FD2A 4RSGA 1TX4B 4DBLC 1CXZA 2X2FA 3U4QB 3AVPA 1TPZA 2UZIR 2ZRPA 1EG7A 1W4AA 2UZ3A 4PO8A 1NY6A 4LZZA 4X8LA 1Y3AA 3EZ6A 1T3SA 4C0QC 1VCIA 3GFPA 1X1SA 2PX0A 2W6IA 4NYMR 1NBME 2BJVA 3B1ZA 3DO6A 1CULC 2CNWD 2GZAA 3QG1A 4MDFA 1KO7A 3Q72A 1AZTA 1ODFA 2ODBA 4ZO4A 1CR1A 2VTKA 3LH5A 1OB5A 1GG2A 3MGCA 2P0EA 2NO9A 4US2R 1RE0A 1R2QA 4OQNA 2Z83A 1T3LA 4K81B 1NVVQ 2QE7D 3TUJC 5AJXA 3THWA 4PPNA 5JS7A 2F3TA 1M7BA 3QF4A 2W2VA 4JLPA 3AVQA 3CUEF 1QBKC 1RJ9B 1XMJA 4Q66C 3K70D 1CEEA 4LPKA 3GMTA 4JL6A 2NO0A 5FOXA 4PAQA 4LHVA 4W5HA 1ANKA 2IC5A 1WE2A 3LXRA 1LNZA 4C0AC 3L8ZA 3UXMA 2IF0A 1J90A 4MKFA 4BRWA 4IFBA 4CEHB 1UBEA 2GETA 4QHYA 3GEIA 4D6PA 1CR2A 4B71A 1FTSA 1NY5A 5GVRA 4IOJA 3FMIA 2V4ZA 5KOYA 2O52A 5G3YA 4UJ3A 3A4LA 1F2UB 1HUQA 3WNBA 1NNEA 4TQ9A 1DAMA 5C4GB 2E87A 2REOA 3B8HA 1CR4A 2P5TB 3LQRA 4PZYA 2IUTA 2H17A 4WOPA 2XZLA 1Z47A 3K0FA 3GLFB 4MKHA 2WMNB 5CB6A 3K09A 3LX5A 3E70C 4HLUC 5L3QB 1G5RA 2GXQA 1H8ED 1EFRA 5AJYA 3T12A 1CJVC 2WVJA 5J40A 2WJJA 2J0VA 2UVQA 5BN3A 3AEZA 2EYUA 3WP0A 3U61B 4RVCA 4B34A 2OM2A 2V6JA 2BOVA 3DM5A 1CP2A 4EJSB 2GHIA 1OH5A 4IOKA 1K5GA 1LTQA 1G6OA 2PBRA 4HAWA 1U8ZA 2NO7A 4Q48A 4IKEA 3K9HA 2WPDA 1RZ3A 3ZQJA 1N6KA 3QKUA 5K8LA 3ASZA 2LKCA 2QPAA 3LO5A 4E22A 3KFVA 1I4LD 1QHHB 2JLQA 3PEWA 1AGPA 2AKYA 1DAFA 1LY1A 2CHVA 3RNLA 4BZQA 2QI9C 3EPHA 4P32A 2ZQ5A 2OCBA 5EXTA 2XXAA 3KZ1E 3OEHD 1SXJE 1XMSA 3UMRA 4DCNA 3L8YA 5FPHA 3CZQA 4M0LA 4BFTA 2BMFA 5BYJA 1E79A 1YJ5A 2NZ8A 3H84A 3KB1A 5AJZA 1OIXA 3MJRA 2IW3A 1WBDA 2V6IA 2CCJA 1BMFA 1W4BA 2HT6A 4RD4A 1Z0DA 4DDUA 2J3EA 1R0WA 5J4YA 3ICEA 5H68A 1JALA 4M22A 2ZRIA 5FI0B 1E9RA 1NRJB 4BZPA 1TU3A 1KJYA 1ZW6A 4V03A 4XWOA 5J4HA 2LKDA 5JJLA 2HYDA 2GA8A 5ELXA 3ADDA 4QM7A 1OHHD 2FN4A 3NKVA 2ZXUA 3MLEA 4DVGA 1N0UA 1G3UA 3QXSA 2ZRLA 4B48A 4ASUA 3T34A 3GJ4A 3P20A 5LB2A 4B2LA 2Z4SA 1EWQA 5JS8A 4GL2A 1K5DA 3ONWA 3SN6A 2QNRA 5E7IA 4C4PA 4DB4A 3BGWA 4NCHA 2ZR7A 4DB2A 2FPMA 3LAWA 1IAQA 4LUCA 4G5QA 4UJ5A 2IHBA 2ORWA 3CRQA 1KO5A 4W7SA 4QKQA 2QQEA 2OFWA 1VIAA 1IY1A 3T1QA 4DLZA 1E6CA 1G4AE 2ZI7A 4YMTA 3QPWA 4TQAA 5CJPA 3D8BA 4P4UA 2YINC 2RGNA 3L0SA 1R8SA 1WF3A 3FMOB 2PLRA 4TLAA 3DMNA 3RS5A 3ZQ6A 1N25A 4AY2A 3MWLA 1KMQA 4WXRA 1HE1C 2ZJ8A 5KPDA 1PLJA 2IYRA 3VR5A 5FR1A 4ERNA 3VR4A 3A6PC 3SR0A 4IVPA 1Z6TA 4LBVA 2O8EB 1UFQA 2XTZA 5E7JA 3V4RA 1JQJC 3THWB 3K8YA 3MWJA 1T3HA 4JVMA 2XX3A 3QF4B 2G83A 3HWSA 1RVDA 3DPUA 4TL8A 3X2SA 2FEOA 2EFCB 121PA 1GRQA 2V8OA 2QT1A 4BFSA 4XJXA 3AGPA 2GVZC 4JVSB 8OHMA 1CJUC 2QP9X 3BFVA 2BBOA 3BB3A 5JFGA 5TB5A 3I3SR 2R6AA 5FL7A 1JR3D 221PA 1M6NA 2KB0A 2J1LA 2FFAA 2HJGA 3CX8A 2WAYA 2QE7A 1IXRC 4V0LA 4POAA 2KWIA 2R62A 4IHQA 1VYVA 4QJ4A 1E2HA 3MAAC 1Z29A 3BORA 1Z28A 5SZJA 3TVDA 3RANA 2B92A 2G1KA 2PX3A 3RS4A 4DT1B 1QVRA 3EIEA 3WBJA 3GLGA 2GCNA 4B2PA 4C2TA 3ZD7A 1C9KA 1JAIA 1SVLA 2QEQA 2QM7A 1KY3A 2HF9A 3K0FB 2CK3D 3SBDA 4NYMQ 3W5IA 2XB4A 2IS2A 5JCZA 1NVWQ 4DCSA 3VHLB 1XNJA 1KDRA 3EARA 1TMKA 4TTQA 1D2NA 1G7CA 2QENA 2F3RA 2XITA 1MO6A 1KMHA 4LWZA 4LV8B 2WTUA 1TTTA 2FG5A 5D3MB 5CM9C 3BAFA 3OFND 3AUXA 3QKSB 4GFDA 3TKLA 1UEJA 1US8A 2G88A 2QRZA 2YOGA 5BW8A 1A7JA 1TQ6A 2C96A 4TLCA 2GJKA 3ZS9A 4RZ3A 3ZZ0A 1DAHA 1AKEA 2C9YA 3F5FA 1KJWA 3KUDA 4NPHA 1E69A 4P3YA 2ZRKA 4CZ2A 1H8EA 4YDHB 4R98A 1EFHA 1NBMD 1T6NA 4I1OA 1G3IA 4GRAA 3BIFA 1DG3A 1G64A 2A5FA 1GKYA 4JBXA 3M0EA 1ZU5A 2XXAB 4WIAA 1EWRA 3NH6A 5DI3A 5HTKA 3IHLA 2JJ2D 1XX6A 4HAYA 1U9IC 5A5GA 2G77B 2A78A 4MYCA 1FMJA 4K46A 3R9IA 3U3RA 4EJSC 4Q7KA 4Z8YA 1VCMA 3BBPA 4D0LB 1TF5A 4D82A 1TU4A 3SYNA 1XMVA 4G0NA 2PCJA 4C7OB 2Q3HA 3AF0A 3TGPA 3NEJA 3KX2A 1K8RA 3LQQA 2XTNA 3P26A 4BLQA 1G3QA 2GEVA 4CYMA 1LF0A 2ZI9A 3VR2A 4RZXA 4XVQA 3SE0A 2NMVA 2NOAA 2Q9BA 3OEHA 4WAUA 1NN5A 2ODNA 3KB2A 4QC2A 2OT3B 1TF2A 2R2AA 3T1OA 2QAGA 1OKKA 1NJGA 2QL6A 3L0IB 3P32A 5DN6A 4Z1MD 1JR6A 3CONA 3C5CA 5AJWA 621PA 2ZAOA 5JZVA 1W0JD 2GJ8A 3IPXA 2J0UA 2JA1A 5LB4A 2OILA 2BEKA 4PZZA 1KO8A 1W36B 721PA 3CH4B 3KQKA 2J41A 4TSFD 2ZRBA 5DO9A 2EWVA 2ZJ2A 4E5UA 1XPOA 3RLFA 4Q4HB 3QSYA 4IEIA 2YYZA 1JI0A 3N5CA 4D0NA 5CJ2A 4CIDA 1G8YA 1BYIA 3HU1A 4RFSA 3RS7A 4TMVA 1E2LA 5J4LA 4Q02A 5IHPA 4A9AA 1RRGA 3SJCA 3FHTA 3I73A 1UEIA 3KFXA 4A6XA 3AVYA 1MO4A 2WMOB 2A5GA 3LD9A 4B76A 5HPYB 4JKYA 2FZLA 3PXGA 5DHFA 1YZKA 5KNDA 2VHCA 4UQOA 4XTCS 5GJCA 3SFZA 4BWYA 1ZD8A 2DWQA 4FW9A 4EPWA 4A2PA 2AL7A 4O25A 4OL0A 2QUZA 2VA8A 1FOEB 3AQ4A 3AGQA 1FP7A 3B2EA 4A0HA 2DY1A 1UF9A 2J0QA 1DAGA 3B9QA 4WZAE 4QBIA 2EFEB 4B32A 1I4DD 2R9VA 3PQCA 1AZSC 1GKIA 4G3XA 5JBQA 1DELA 1ZIOA 3Q7QA 3U60B 1OXSC 1P9WA 3KQHA 2JLZA 2OAQ1 4Q5IA 1G16A 3THOA 3CBQA 1KDOA 1SXJD 5FR2A 4HUTA 5FUYA 4EDHA 1RKBA 1GITA 821PA 4LJ9A 1F6BA 2OBMA 1N0VC 2ZI5A 2BC9A 5AJVB 4AYTA 4TZ0A 3SYKA 4TMZA 1JQLB 4PAOA 1GWNA 1XEWY 3BE4A 3FKQA 4R2HA 3ADKA 5JECA 1UAAA 3GLGB 1N6LA 1JPJA 4QXAA 5CITA 4YONB 4GP7A 4AK9A 2IT1A 4PTLA 4F38A 3BB4A 2ZJOA 4BLSA 1P62B 1XXHB 4JLAA 5CDFA 1VIYA 4B74A 1KK1A 1G1MA 1KMHB 4TLBA 1JBKA 2XSZD 2PJRA 3PV0A 1N6PA 5CYPA 1F5NA 3TUZC 2XOKD 3RRMA 1US8B 1A1VA 4Q9IA 3A1VA 4DSTA 1SVOA 3TLXA 3U5ZB 2GAOA 3PR1A 5BN4A 2EYQA 4JVLA 2JGNA 3E5HA 3UWKA 1S0UA 1CJTC 3SZRA 2N1BA 3SQWA 5FI1B 3BRWD 1XFAA 2ZROA 2VSOA 1X6VA 3REGA 1UJ2A 3B1YA 4H9GA 5EE9A 2R6CA 5DI3B 1MT0A 4M1OA 2AFHE 3AKYA 2XNDD 1O3YA 4M8NE 2D62A 5HR5A 4RKEA 5JHGB 1I2MA 1NI3A 5HCNA 1GNPA 4MUBA 4DSNA 2HLDA 3SFVA 1N5LA 3B1VA 4IFEA 3JVUA 2VHJA 4EKDA 2V3CC 2GESA 3GFTA 4A6PA 1DAKA 1NBMA 2NGRA 2VO1A 3CF6R 3CM0A 3DOFA 5SZIA 2PLFA 4C2UA 4YXWD 1SQ5A 3W8NA 1KK0A 1DO0A 4JJZA 4QNMA 4FIDA 1PV4A 5JCPA 5B2ZA 4V0ME 1GIAA 3R7WA 3LBNA 4OQXA 3SS8A 4ZDKA 4AKGA 2OCYC 3W34A 5FPYA 1T5IA 1YZUA 2BM0A 1LV7A 2QAGB 4RD1A 1F60A 1UDXA 4GZLA 1KI3A 4Q4AA 2J7PD 4NE2A 4PSVA 4C0KA 4LCBA 4CF7A 1D6JA 4GMDA 2J0UB 2RGGA 4L4UA 4U00A 4EPRA 1NLFA 3BOSA 4KJZA 3SOPA 1P73A 4Q19A 1IXSB 1KHTA 4NL4H 2OE2A 5TY0A 1Q22A 5A0FA 4LYAA 2ZRMA 2UKDA 2BM1A 3JZMA 1VCNA 2IYXA 2REBA 4P0TA 2BKUA 4PSKA 3BFXA 4C0LA 4R9UC 4L15A 1AA9A 4EFNA 4IVRA 4DLTA 2AXPA 4PZLA 4HDQB 4DLRA 3I1FA 4G1UC 1FX0B 3FOZA 3EW9A 1K6MA 4JS0A 4U02A 4Z1MA 4KLNA 1YRAA 2ERYA 4Q7JB 2EQBA 1IY0A 4QBFA 4NCIA 4PO9A 1Z06A 4EFLA 2VHUA 2XB2A 4TSFA 1WXQA 4BUJA 4BFYA 2AKAB 2WWIA 1BO6A 2QMOA 2FWRA 3K9LA 2EVWX 2IF2A 3UATA 1YZLA 1XD8A 1KO1A 3C8UA 3GJ3A 5FBVB 1W49A 1Z0KA 3GPLA 3BERA 2FH5B 3BD9A 1U2RA 1E94E 5CK4A 1XD9A 2ODWA 4A92A 1OXXK 1U99A 2WJIA 4AD8A 2BJWA 2RGNC 2FU5C 1G8FA 3GLHA 2ZUDA 5BWMA 2Q21A 1IN7A 2N46A 3MUFA 4Y0AA 3EA0A 1XTQA 4KXFB 4FINA 4X8HA 1FNNA 1IN8A 2CL7X 4M2LA 5JI2E 2QGZA 3I8XA 1GFIA 1G5PA 2J59A 2FFBA 4A8JA 3BS4A 3AF1A 1NLYA 1HQCA 2GDJA 3NG1A 3OE7A 1Z0AA 1Z0FA 5JWHA 2OFXA 2QMEA 3V00A 3W6OA 1Z5ZA 3SQXA 1SGWA 4PHFA 2CCGA 1TQ2A 4LPSA 3HDTA 1X8JA 4IDNA 3EIQA 1DVRA 4D80A 2JDID 1C4OA 1P72A 3KKPA 2IYYA 2NO1A 3Q8XB 5G3ZA 1DG1G 4JLBA 4PSAA 1P3JA 1ZAKA 1E1QD 1R5NA 3H86A 2MMGA 5JMTA 3ZDQA 4TYYA 2BBWA 2ZRNA 2G3YA 3CF2A 5KNBA 4E09A 4DXAA 5L3VA 3WNCA 4A82A 2GCOA 5DLQC 2R6GA 2QTVB 4FWIB 2GK7A 3EX7C 4Q4JA 2X8AA 2ZITA 3CIOA 1KGDA 1KI2A 2XSZA 3RYTC 4B3CA 5IT5A 3TR0A 2IX3A 2HEIA 4V0NA 2XOKA 5KDLA 3E2IA 3GEHA 4LBYA 5EZ6B 1SKQA 4BLPA 1ONBA 2EU8A 2QN6A 1MKYA 2VHTA 4X8MA 3MMPA 2L0XA 1G17A 3PEVA 3FHCB 2Y8EA 1GL9B 5KHOC 5TMPA 2WWHA 4MGIR 2YWEA 421PA 1FTNA 1DTSA 2DR3A 2OLKA 3KXLA 2I1VB 1OIWA 2PT7A 3TJZA 3KXKA 5LPNA 5DIFA 1P9NA 2CJWA 4JIMA 2B8WA 3C41J 2QMUA 4RKFA 1D5CA 4LHZA 3X1WA 3EZFA 4QL3A 3O8CA 1SVSA 1XEFA 3VR6A 1CRQA 5DSZA 4Q4AB 2GEUA 3NH9A 3C4JA 1S2MA 5EE0A 4DCTA 2AR7A 2F55A 1XZPA 1EGAA 2GAAA 3WP1B 2WIAA 4HATA 4V02A 3IIMA 4Q7LA 4UNPA 4YXWA 2NO6A 3B6EA 2ZE7A 4LGMA 3FMPB 4GPTA 4DSUA 2FFQA 5C1BA 1D9ZA 3TRFA 3DL0A 2R6FA 1Q1BA 4LBWA 1KSGA 3DKVA 2LWIA 1XTKA 2ZJAA 2DBYA 2BCGY 1G291 1E9FA 1VYUA 1WQ1R 3ZZUA 2PZEA 3B5JA 3EWAA 3IUYA 4GT1A 2ZJYA 2VH5R 5AWFC 3NBFA 2XAUA 2XEXA 1IJEA 1T0JB 4UKDA 1WBBA 1BIFA 4TL7A 1EFTA 3B1WA 4XTRA 2ODEA 5AK0A 4EFMA 4ZKDA 3O8BA 5KO2A 4IRUB 5B64A 2GXAA 4DLVA 5ANRB 2DPXA 4AURA 4NCKA 1T9HA 2JLXA 3GLIE 4MGYR 5IDVA 1ZUIA 3CWQA 4LJ8A 4PX9A 2QP3A 4MYHA 4RZ2A 4M1YA 1XCGB 3GLHB 2CVFA 4PC6A 3I5YA 1PZNA 1XPUA 3QI2A 3LLMA 4EPTA 4AKHA 2J87A 1AK2A 4BPBA 2D4HA 2B6HA 4P4TA 2AXNA 3GJXC 4L5BA 4Q9KA 1P60A 1OXTA 1G7SA 3WY9A 4A8JB 2JAQA 2PMDA 4TMWA 4UNQA 3CNLA 1L4YA 4HUQA 5LBIA 3RWMB 1MABB 1CLUA 2JCSA 2NTYC 2LCFA 2VP6A 3G5UA 4TT3D 5K8UA 5L3SA 2WKPA 2RCNA 3NBYC 4LBZA 4YLGA 5LDDC 4FMDB 1F48A 4M1TA 2ZRCA 2ZPTX 2DWOA 1P2SA 4GOXA 1IN4A 3NBXX 4KSCA 2H92A 1ZD1A 4PAMA 4GP6A 3ADCA 4Q47A 4J0QA 4GOJA 2P3SA 4LDJA 1G21E 3LX8A 3FKSD 1Q1EA 2C9OA 2HDNB 3HPQA 1J7KA 1U0LA 2GF0A 2VF7A 4DRZA 2H16A 3LNCA 1N6OA 2BIFA 1NIPA 4HB3A 4JBWA 2QU8A 1Z6AA 2HT1A 4JVNA 2GXUA 2IXEA 3TE6A 2OXCA 4DCVA 1ESMA 2HJVA 1KJZA 5TVKA 3AB3A 1N6IA 1BKDR 4KO8A 2ZR0A 2GCOB 4F4JA 1P2UA 2WJHA 5JSZA 5EP2A 2CHQA 2VIIA 2NG1A 1AKYA 3PUVA 3X1ZA 3DHWC 4ABYA 5KSOA 2JDIA 2CLDX 3WYGA 1EFCA 3UG6A 1Z6GA 4XH9B 3LLUA 2ZM5A 5AUQA 4TTPA 1BOFA 2C5LA 3GLFE 3PIRA 1M74A 1JJ7A 4HEJA 1HY3A 2W2TA 3WHLA 1VKJA 3UKDA 1KOFA 3RS3A 4YMUA 3IBYA 4DLYA 1ELOA 3TK1A 1E2EA 3F3YA 2QPOA 1E1RD 2KBFA 2P65A 2QSZA 3KTAB 2FJUA 4LV6A 3KDSE 2OFOA 6Q21A 3B60A 5E7MA 3NTUA 4XVRA 2CJWB 1VPLA 2JIZD 5EE1A 3A1TA 4ACBA 2WSSA 2KE5A 4DUGD 2O8FA 3J81k 2DWPA 2EFHB 2AFIE 1WDTA 3R8CA 1L8QA 2ZSDA 1PUIA 1SVIA 2NQ2C 2QORA 3D6TB 3KL4A 4B3FX 2W83A 3NHAA 4WA7A 1ZNWA 4NU0A 3KJGA 4TLEA 1QHNA 3ZVRA 4D2IA 1KAGA 4IVQA 5FL3A 4NYIR 3ZIAA 3G82C 1MRNA 4UXIA 3EIHA 1ZUNB 3AF4A 3GEEA 3CNOA 2AWOA 3IILA 4QHTA 2P6UA 1VG1A 3QKTA 3K9GA 2CL0X 4M53A 4GI7A 2ZS8A 4Q1FA 4US0R 2IUSA 1DS6A 1ZM9A 4UNRA 2P6RA 4KODA 2O0JA 2ZUBA 1KO4A 1KSHA 1NP6A 1KSJA 4B3DA 2AHOA 3LW7A 2IYTA 1H8HD 3H2YA 3LVRE 4LJAA 2F1RA 2QQ0A 5LD2B 1R4AA 2CNWA 3P1JA 1XJ0A 1EK0A 1U81A 2JATA 3HPRA 3QG5A 1YR8A 4B3XA 3BH7A 4OI0A 4YMSA 1GVNB 1NSTA 3VHXA 3UIEA 3SBEA 1MV5A 4YQFA 4D4MA 1YRBA 1J8YF 4CT4B 3GJ7A 1CRPA 4XWAA 3U3MA 5FFMA 3PEYA 3B9PA 2XNSA 2H1LA 5EUQB 1XMIA 1CBUA 1OE0A 1GSIA 2Q3MA 3EZ2A 5FTJA 3HR7A 5BXQC 2RHDA 3B1XA 1IHUA 1LB1B 4NZYA 2QTFA 4PPFA 1W47A 1EESA 3KQNA 1LW7A 3W3AA 1QF9A 4LSGA 3B7GA 4MRNA 5KTYA 2J45A 5EUMA 4A15A 2OBLA 3IKJA 1CJKC 1II9A 4RD0A 1YU9A 2A5YB 4RD6A 5CK5A 2PL3A 5D3QA 5P21A 3CRMA 4KFTA 4M4SA 2XGJA 1S4QA 3AVTA 3M6AA 5L3SB 521PA 1HYQA 4HZIA 3TR5A 5CIQA 1T4GA 1XEXA 3U3OA 2PEYA 1QHIA 3LDAA 4MYUA 4XVUA 2XZOA 2OHFA 1KI1A 1G5TA 2IEZA 4B6FA 2ZE8A 5SZKB 1V43A 1OF1A 2ZYVX 3TSZA 4R7ZA 2GZHA 3QOFA 2IL1A 1N5KA 1KDTA 4KFUA 1AIPA 1ZC4A 4Q7MB 4DEYA 2RAPA 3L43A 1FZQA 1PVOA 4ITRC 4ARZA 1EFUA 4YC7A 3QXXA 4A8JC 3IQWA 4RJLA 4B47A 1VHTA 4Q01A 2K5UA 1U8AA 1ZM4A 2NZJA 4LYHA 3RRNA 3ADBA 2EW1A 3D3QA 2V1UA 5JSZB 4ZI2A 1NF3A 4URUR 1KI4A 2PCLA 1YE8A 4US1R 3Q7PA 3GJ6A 4JLNA 2PJZA 4QM6A 3EC1A 1RRFA 2DHRA 1XEWX 2YHSA 5DISB 3THXA 2WV9A 3WMFA 1CR0A 2BBSA 2DFLA 1I2DA 1LF5A 4HB2A 4MA4A 4Q1DA 2E1RA 4CEIA 2YV5A 4H1VA 2GJSA 3FYHA 4GZMA 4ACAA 1Q3TA 2QRNA 3VU9A 4BZXA 4V0KA 3I5XA 1HTWA 4ZKEA 1DARA 4HB4A 4Z51A 1X8KA 2C8VA 3QBVA 4G5RA 2GBLC 1NG9A 1NL3A 3CF0A 4ZDJA 1DO2A 2O0KA 1X86B 3CB4A 2RGDA 2W00A 3ND8A 4IDHA 4PHGA 2QBYA 2O8FB 4G5OA 5EXXA 5JRZA 1W4CA 3P27A 5AUOB 1NKTA 1C1YA 2JLYA 1OFHA 3QEJA 5F98A 2ZJ5A 3FDIA 1VHLA 1XCMA 2ZSFA 3RC3A 1FW6A 3QQ5A 1E1RA 2C9CA 1JJVA 3VX3A 2NPIA 5DYIA 1OYYA 5HCIA 1OHHA 3A4NA 5JWOA 1SKYB 2J46A 1ZD9A 1X1RA 3NVAA 3RRYA 2JIZA 4L8GA 1ZRHA 2VQSA 3W3ZB 4DUGA 4BRUA 1R10A 2ZYTX 4ESVA 2WICA 5FOUA 2ATXA 4CRWB 3AVVA 5KDDA 3ZVNA 5KPJA 3P4YA 1F3OA 2IWRA 2RGCA 4KITB 4NBSA 2VP0A 2OEPA 5GADl 1N6HA 2IYVA 3RSLA 3TQCA 1S1CA 4BFXA 5CM8B 3W6PA 1R5OA 4IJMA 4JT4A 3QKRA 3OEED 4RFVA 3WYFA 4BECA 3ZJYA 4LHWA 1NJFA 4MUAA 4BLOA 1P6XA 4DWJA 1KZGB 3NEYA 5G41A 1GZSA 5J4KA 2ZSEA 3I72A 1IM2A 4DJTA 1A82A 1GTVA 4NMMA 1HT2E 2PT5A 1NN3A 3I8SA 4OHXA 4F91B 4HLCA 1S3GA 4HLUA 4R2IA 3TIFA 2OCPA 1OXUA 3K70B 4LOAA 4LX0A 1KKMA 3OHMA 3WNDA 4LHXA 3R20A 1ETUA 4URXR 4BFUA 1IN5A 2B7BA 4HB0A 5LD2C 1VG9B 4IEEA 3SJAA 3BC1A 1R8QA 4IDQA 1FQKA 1FPMA 2RHMA 1ZYUA 1HT1E 3PG5A 2IA5A 5HE9A 1JR3A 1I4TD 4BFVA 4DSOA 1KIMA 1PLLA 5B57C 3DVLA 4NYIQ 1XEXB 4JSTA 3GJ0A 4ILEA 2JLVA 4KI0A 2QROA 4MQBA 4OI2A 4HI0E 1KYIA 1E3MA 1QHYA 3P4XA 2ZRJA 3QY0A 2VHQA 2HCJB 3EZ7A 2IHYA 2VPPA 3IHWA 4M9QA 5KU1A 5FUXA 3R9WA 2VRWA 4LC1A 5EZ5A 1EX6A 5JEEA 2VP4A 1AGRA 1P2VA 2ZU0C 4AYWA 1CTQA 3NHBA 1MH1A 2CK3A 2FOLA 2R44A 3PUYA 4B6EA 4ARZB 5CIWA 2DB3A 2WJGA 4Q9LA 1KZ7B 4AI6A 4O0MA 1LFDB 5FTNA 3X1YA 3X1DA 2ZAMA 1G20E 3K09C 1ZM2A 4WW0A 4EUNA 3KKNA 5CLQA 3S1AA 1FL9A 1KK2A 4MRRA 3NDPA 4OQMA 3OFNA 3ZS8A 2ANCA 5EQTA 2Z5FA 3MSXA 4Q1CA 5C46F 3RRZA 1G3RA 3GLGE 2WWXA 2RGEA 5HZHA 1TL7C 2V7QD 3THXB 2GJ9A 3BB1A 2WWGA 2R8RA 1GL6A 1G3MA 1HA3A 3IO3A 3T5GA 3O8DA 4TMKA 1GILA 1XXHE 1W5SA 2XTMA 3MFYA 4CEIB 1ZMXA 4JLVA 3VX4A 3VU9B 1W4RA 4NCJA 2H8KA 3AF2A 3D7MA 5JWRA 4TTRA 4FMDF 2GNOA 1SVKA 5FBLB 1P75A 4CW7A 2OSBA 2JJ2A 1NVXQ 1R0YA 2W6JD 3Q5DA 2QBYB 4JLKA 4JT2A 3QXJA 2BBTA 3JZAA 1JPNA 1L7VC 1G7TA 3DZDA 3KKQA 1VG0B 4Z8XA 3V9PA 1Z6XA 3RHFA 4BEJA 2CVHA 4PFSA 5EXPA 1YR6A 3KJHA 3MD0A 3GJ5A 2V54A 4F4IA 2DCUA 1GDDA 2QM8A 4KFSA 1AM4D 1CJMA 3W5JA 3CRRA 1FMLA 3L0OA 5E4FA 3BFKA 4B35A 1XTIA 2V9PA 2E9SA 4RFSB 5FOSA 3NBZC 2RGBA 3TAHA 1TUEA 2H57A 4LY6A 5EJEA 3FVQA 4Q9JA 1WMSA 1W0JA 2A9KA 2VP2A 1Q21A 2Z0MA 2CLSA 2OLJA 2CXXA 2EFGA 4QG7A 2F7SA 2D2EA 4Y0VA 4EPVA 2XZPA 3RS0A 1Q44A 4MKGA 4TYNA 1W36C 3QKRB 2ZI6A 1E2KA 1YZNA 1B23P 4DLSA 1LVGA 2JJ1D 4JLOA 3OIYA 2AK3A 4A2QA 3AH8A 1O87A 3CPEA 5JEDA 1HV8A 3AVOA 3MWYW 2ZRGA 2CCKA 1XCPA 4CVNA 1ZM3A 1XBTA 2IYWA 3KKOA 1VECA 2F43A 4F92B 2Q3FA 1RJ9A 1XU4A 1Z07A 1ESNA 2ZRDA 1EX7A 4PC1A 5UKDA 3C14C 2ZJZA 1KDPA 3HU3A 1M34E 3K0SA 1D2MA 1XJCA 1HE8B 3FGNA 3NC0C 4CT5A 3CPJB 4UXJA 2TMKA 4M9ZA 4OHYA 2A5DA 3VR1A 3QNUA 2F6RA 2PZGA 1G41A 4XOIA 1XTRA 5F2EA 2B7CA 1UADA 1EFRD 3AP3A 5DGXA 5FH9A 1Z2CA 2O8CA 3LRPA 4KYIB 5IK2D 1FNMA 2Q9CA 1QDEA 2V1XA 3A36A 4QFMA 4KV9A 3FPAA 1U0JA 4QJ3A 4EAQA 3HR8A 3A4MA 1SXJA 1T91A 2H7VA 4DC9A 2ZEJA 2QSYA 3K0AA 4B75A 2YOFA 2QGNA 4KFRA 3FTQA 3C7KA 1W0KD 4N0EA 2WPDD 3ZD6A 3QXCA 2FSGA 1PJRA 5GJBA 2FGJA 4M1KA 3VKGA 2QMHA 1F2TA 4H1UA 3K70C 4JLJA 4BE7B 3BWDD 3EC2A 2VLIA 1FUUA 2ANBA 4HDCA 1ZIPA 3FE2A 3BH6A 3T15A 4ZPXA 1W48A 4Z54A 1B0UA 3MG9A 3KQUA 4QBHA 5IRCD 1V5WA 4OBEA 5CLLA 4LI0A 3AKDA 1GUAA 4FI3C 3M4YA 1JAHA 3L2OB 3BXZA 1Q12A 4ZCLA 2ZUCA 3F8TA 5CB8A 4L16A 2AWNA 3GJ8A 3IPYA 4NKRA 1Y63A 4M9XA 2REXB 2ZTSA 2ECKA 3GCGA 1UPTA 3W6NA 1JXMA 3AKCA 4WXPA 3QF7A 3SJZA 1E2GA 2YZ2A 1QVAA 3AF3A 5CDFE 3RABA 4AWXA 3C5HA 1XZQA 2GCPA 2X19A 1M2OB 3WHKA 4I81A 1Q20A 5F3WB 4BGDA 3EZ9A 3R7WB 4KSBA 4HZUA 5GJWC 5KSZA 4QJ5A 2F1IA 5F9FA 3OIWA 4S35A 2CMKA 1CKEA 2ORVA 2XNDA 4BASA 3AP1A 4ZIRA 3UMFA 2QG6A 2XJ9A 4N3NA 4U7DA 4PQRA 4AKEA 2QPTA 5HZKA 2VYFA 1W5TA 2WJYA 3GFOA 2VSFA 3SEAA 4C0SA 3U7EB 2QY9A 2BKEA 2KBEA 3GQBA 2D06A 2FE4A 1RYFA 2WAXA 1N0WA 1SHKA 4PPQA 4PQFA 1MRSA 3A1SA 4FN5A 3EPKA 3B13B 1OH7A 3U6BA 3CRW1 3V4FA 3R8FA 3VMFA 3REFA 1BYUA 2W6JA 3VKHA 4JMPA 2I3BA 2QP4A 2J7PA 4GMXA 3UANA 2WKQA 2CBZA 3LA6A 1DBSA 1E9EA 1N2CE 4D4LA 4D81A 3OESA 3QE0A 5BYKA 2HYIC 2QAGC 2IK8A 1ZUHA 1WB9A 3ZVMA 2IXGA 1X3SA 4EPXA 1GAJA 2AD1A 3U44A 5FL7D 2DFKB 1KNQA 5DYGA 3NXSA 3OAAD 3GP8A 1D8TA 5JHHB 5L3RA 3THYA 2O8EA 1N5IA 4P33A 3WRXC 1GKUB 1ZU4A 2W0MA 4D25A 2VEDA 1S1MA 2F43B 5BN5A 3C16C 1A5TA 3NC1C 1AQYA 5EXSA 4MH0R 1E9CA 3KUCA 1DADA 2GWHA 4D4JA 1E99A 2IYZA 2KJQA 1E96A 3PFIA 1G8GA 2FFHA 2O8BA 1KI6A 3PUXA 1AJEA 1XD2A 2WHXA 5M04A 1BS1A 4NDZA 2JJ1A 3HJNA 3QUSA 2OZEA 2FNAA 5JI3E 2NPFA 4JL8A 2IYUA 1JEEA 1Z83A 2BV3A 2O8CB 2J9RA 3JVVA 1CIPA 3L0PA 2WOJA 1G9XA 4Q00A 3T61A 3F0TA 4LC0A 5FTMA 4DDVA 1OSNA 4KLZA 1YR9A 3N2IA 4LV5B 2PEZA 3T06B 5H1YA 1SXJB 1Q0UA 3K0AB 1UBFA 4DT1A 1RPZA 5AR1A 3IQXA 3SI7A 4HSEA 4TWZA 4BFWA 4DIEA 1M7HA 4I4LA 3LXXA 3K1JA 3ZZTA 5E3HA 3D31A 4DLWA 3G0HA 4JYCA 1KAOA 4AKIA 1SVMA 3TMKA 1S9HA 2OG2A 4XIGS 1F2TB 3MJHA 4GOKA 4CEJA 2RH5A 1AN0A 1P9RA 4DDWA 5FUVA 3EWSA 3WBKA 1NMZA 2ZI3A 5B58C 4NHOA 3GLHE 4P31A 4DHEA 4XWKA 1YKSA 1QG2A 3Q85A 1XPRA 2F1HA 5IK2A 2FSFA 4KCGA 4GNKA 5D3MA 5G40A 2I1QA 1AQUA 4Q4JB 4I1VA 3QKSA 1NMXA 4B73A 4OK5A 4G5SA 1W0KA 3DKPA 4KYUA 1AS3A 1E1QA 2YVUA 2FPKA 4M1MA 1OH6A 4LJ4A 4PC7A 3C15C 3U3JA 2FPLA 2ZYWX 3WMEA 3A37A 3VR3A 1E9AA 3CLVA 1DEKA 3KJEA 1NKSA 1KI9A 1U0HC 4EQ6A 2IS6A 2ZJBA 2FA9A 2DYKA 1NN0A 2PZFA 1GL7A 4II7A 5J5CA 3T5DA 3VQTA 4UXHA 1WP9A 4M1WA 1DPFA 1AS2A 2MSEB 1HQYE 3LBHA 2IWHA 4ZV4A 4DLUA 3R9XA 1WA5A 4A1FA 2VF8A 4ZDWA 5FOVA 1TEXA 1OKKD 1ZCBA 3CH5A 5DH9A 4HZUB 4L9WA 5DN6D 1MOZA 4A36A 2ZYUX 1G6HA 3L82B 3LFUA 4MKIA 5H70A 3IBGA 1E2PA 4FMCB 4ZIRB 3RVBA 5KNCA 4NTZA 1P5ZB 4C7OA 1Z2AA 3RWOA 2ZETA 4LJYA 4NONA 3DMDA 4KVAA 3I62A 3M1IA 1GRRA 4QGAA 1MO3A 2F9LA 4QGHA 4XSHA 1M8PA 4PR0A 3QEOA 1RRCA 5EE5B 4PPGA 4LYFA 2GF9A 2ZS9A 1XTSA 3AM1A 1N3BA 4AG5A 2D3WA 1OH8A 1VTKA 4DLXA 4C0BA 5C18A 3AVWA 2Q6TA 1N6RA 2CHGA 2O0HA 4KBGA 2Z43A 1A4RA 4LJ6A 2ONJA 4EPYA 5E95A 2C03A 5FUWA 2G6BA 5DI9A 1N5JA 2FDCA 3OF5A 3NIBA 1NIJA 5KSYA 1XTJA 1E2QA 4MGZR 2PMKA 3PUWA 2FV8A 1UKVY 3CR7A 4Q4HA 1HH4A 1IBRA 4WZBE 3FMFA 1R7RA 1G19A 1II0A 3TSOA 5EE3A 5FPTA 3CW2A 3PUZA 4P4SA 3SYLA 4V0OA 2WBLC 1J70A 3U44B 3Q9LA 3VNUA 1X8LA 4B3BA 4NYJR 4OJQA 1G8PA 2OESA 1TUIA 2A5JA 3MWKA 4A0FA 2QTHA 3THYB 3PENA 3IO5A 3FB4A 5DNYB 4MRPA 4R71A 3ICQB 2RMKA 4A0RA 1SULA 3HP1A 2OO7A 4D26A 3RDPA 4A4DA 3SNHA 3K9NA 3N70A 2QAJA 1XDBA 1QRAA 3TUIC 3Q5EA 1U8YA 1G18A 3QPUA 1R0XA 2WZQA 4QHSA 1UKYA 2O5VA 2O8BB 1KI6B 2WWFA 2GXSA 2YNMA 3NDBB 1XD2B 4M21A 2P67A 4MRSA 2JLUA 3ETLA 1ZJ6A 2AX4A 3HU2A 1FUKA 4PO1A 4MYTA 4BFZA 3OAAA 4HUQB 4E03A 3PVSA 5H8WA 1GNQA 1BH2A 2C04A 2W58A 4CGZA 2BMJA 4LYJA 2ZE5A 1TQDA 4JLDA 4BQSA 3PEUA 3T1TA 3H0KA 4RY2A 3EXAA 4B2IA 1P4SA 1E2DA 1XB2A 1JEDA 2HUPA 3E1SA 4C0JA 3GD7A 4KAXA 1OFIA 4JZKA 4RD3A 4OHZA 3N2EA 1J99A 2W2XA 1A2KC 2WM9B 2ZSAA 3T35A 1R6BX 3A1UA 3EG5A 1FQJA 2ZRFA 3EPJA 2FZ4A 4W9MC 4AYXA 5KYKA 1Q1ZA 3CNNA 1D9XA 1II8A 4QGGA 3VAAA 2HXYA 2OV2A 2ORIA 2HXSA 2F9MA 4CEJB 2JEOA 3AP2A 1IN6A 1XF9A 4G01B 3ECCA 5FPSA 3ZYCA 1E4VA 1PUJA 1XXHA 2MMCA 2GEDA 4TT3A 1ZM7A 3O8RA 2PH1A 4IXMA 2B21A 2ASEA 4N0DA 3AUYA 2JLWA 1YZQA 5FBRB 2O8DA 4V0MA 3X1XA 2J0SA 3VNVA 2BMDA 4JSYA 2BEJA 2AN9A 2DFTA 5AUNB 1RIFA 3DZ8A 2OCAA 1R0ZA 2FMXA 4I99A 3FKSA 2QZ4A 2EFDB 1SXJC 4TMXA 2KSQA 2HLDD 2JLSA 2ERXA 2Z6VA 3KKMA 4EQ6B 3TH5A 1R5BA 1XRJA 2A7QA 2WSMA 1E2MA 2X2EA 2FX3A 1OLOA 3K0CA 5TDHA 3QPVA 5FOTA 5C4MA 5KUTA 2OBNA 3W8RA 2P6NA 4TLDA 5JRJA 4GDFA 4A0GA 3Q3JB 2R6DA 3I32A 1KKLA 2A2ZA 2HCBA 3MCAA 4DCUA 2CDNA 2BDTA 4MRVA 1U90A 2CE2X 2YC2C 4RCYA 2IUUA 4Q4LA 3RSOA 3U7HB 4OQFA 3SHFA 3IDQA 3BH0A 1SHZA 1COWD 4JJKA 1ZNZA 1T8TA 5GVSA 4XSGA 4JYBA 4A2WA 2VP5A 3OIUA 1TF7A 2IYQA 2FSHA 2GJAA 4QGFA 1W1WA 4F4CA 1W2GA 2ZI4A 1OJLA 1KSFX 2WKRA 4WVFA 4G5GA 3CX7A 3IEVA 4KBFA 3H1TA 4BLRA 1TNDA 4HLDA 3U7FB 2GRJA 2IXFA 2RB4A 4C0HA 2YJTD 3TQFA 3HYRA 4CDGA 5TARA 1E9DA 4N1AA 3FWYA 2W0SA 1T0HB 3ND9A 1GP2A 2G0NA 5FPKA 1DOAA 4D4KA 2GILA 2AK2A 4QBGB 3QIAA 5GJVC 5EP4A 1IXZA 1D2EA 2WOOA 4DDTA 2VL7A 1RYHA 2ZVPX 4BLTA 5JJKA 4JL5A 4KU4A 2CLCX 4BEBA 2G1JA 3SHWA 1W2HA 3AKEA 3LV8A 4FCTA 1YZTA 4NCNA 1QHSA 4HDOB 4P4SB 3VTKA 1FFHA 1FX0A 5J47A 4KHZA 1Z63A 4Q03A 5DHAA 1YR7A 4DEXA 5BQ5A 4IW3B 4TYQA 2G9NA 2IS1A 1KI8A 1HEIA 4XD7D 4AC9A 3KJIA 1GM5A 3TAUA 3WYAA 4PC3A 5TXGA 2IYSA 1T5LA 3IEUA 4E07A 3I92A 3IIJA 5B30A 4WBSA 1E2IA 4FCVA 3ZLJA 1L2TA 2NIPA 4RZUA 1H8HA 1TQ4A 1OYWA 3SC3A 4LJ7A 5AUPB 1KTVA 1SKYE 1OT3A 4ON9A 1VMAA 3OE7D 5J4VA 4L9SA 4OI4A 3K0EA 1OIVA 2WJVA 5KSPA 5FTKA 3UPUA 1S8FA 3FFAA 1IQPA 4I1SA 5TV2A 4C3ZA 2J5XA 3QJYA 2MSCB 3DDCA 1YQTA 2KI5A 2P2LA 2A30A 2OUKA 3U3KA 2X1VA 3TSWA 3B82A 4RCZA 5FOWA 2WWYA 1E98A 3OZXA 1VCOA 2P5SA 3LW8A 2JASA 2EWWA 3TW8B 1QHGA 1LS6A 1VYTA 5CYOA 4IXNA 4F7WA 2HV8A 2FEMA 3B85A 1AS0A 5K8IA 1II8B 1W44A 1W46A 1Z6YA 3A8TA 3PCRB 5K8TA 4FXPA 5SZHB 4AG6A 2Z4RA 2YC4C 4YMVA 1E0KA 4TZ6A 1E2NA 3QVVA 5HKKD 1ZVQA 2YWHA 1U98A 1CU1A 2GKSA 5F9HA 1UKEA 4WZ6A 1E4YA 3CO5A 1Q3HA 2N42A 3PJRA 2O8DB 1ZCAA 3QVUA 4C9BA 4NYJQ 3TBKA 3LVQE 5IF9A 1Z0IA 2R65A 1OFUX 1GOTA 1GRNA 2ONKA 1OB2A 1T8UA 1Z8FA 1VG8A 2ZU6A 3KQLA 4TYWA 2H18A 4M9SA 1CS4C 3HYTA 1WRBA 4B43A 1ZP6A 2CEAA 1KY2A 4Q9HA 2G0TA 4PHTA 1E9SA 3TVTA 2D7DA 1JNYA 3FHOA 2YWGA 1NLZA 1E0SA 3LWNA 1NVVR 1P2TA 4QOSA 1DAIA 3ASYA 4YMWA 1OXVA 1JXOA 1PLKA 4OK6A 2B8TA 1WCV1 1Q1QA 4OKSA 3AVXA 1CF4A 1J2JA 1RFLA 4IDPA 4I1UA 1E32A 2IBMA 4PHHA 3CWZA 4HLQB 4OJKA 4JKIA 3I4LA 2W6ID 1TAGA 2YKGA 4LK2A 4Q21A 2F1JA 1TEVA 2QA5A 1IOZA 5G53C 4RD2A 2ZRAA 1NVUQ 2SHKA 4W5WA 5A4JA 2D2FA 3RAPR 2VSXA 1L4UA 3MRSA 5EP3A 4MGKR 1Z0JA 3GLIA 1ZINA 3W90A 1RRPA 1G4UR 1G7RA 3U4QA 3A58B 4LJ5A 4O2RA 3AV0B 4ZDIA 1OV4A 4OYHA 3UK6A 1QHXA 3RC8A 3DEFA 1RW4A 2IYLD 2C2HA 2OXRA 4TN1A 4B3GA 5JJIA 2DFNA 4DIDA 1E0AA 1COWA 1JECA 1UDWA 4PANA 3TW4A 2J7KA 3WMGA 2ZANA 4Q1AA 4HAZA 4NP6A 2GK6A 1UM8A 2Q9AA 2ZVQX 1DE0A 3ZVLA 4JLMA 1M7GA 3EPLA 2RKOA 5L8VA 4S2EA 4Q1EA 1VDZA 5FTLA 4PQYA 4FWTA 1S3SA 2GZDA 1KI7A 4QNRA 1YHNA 1S9DA 1UBCA 4EIWA 2C95A 4FMBB 1RC8A 3K53A 4O2LA 4PXAA 4FMCF 3O47A 4OHWA 3DOEA 1Q57A 1XJQA 1S96A 2H5EA 4HAVA 3LY5A 1NN1A 4URVR 3EAQA 1NMYA 1ZNYA 4DKXA 4URZR 2IS4A 1MO5A 2C78A 2ZSBA 3CKLA 2WIBA 3VKWA 4TMTA 3ZH9B 3U7GA 3OEEA 1NG1A 1EXMA 1SZPA 3NWJA 4IOMA 4OK3A 4AIIA 2CE7A 3BK7A 1UBGA 4MITA 3VFDA 2ATVA 1IONA 1U94A 4CEHA 5EP1A 1Z08A 4M1SA 3U2QA 2I4IA 1N6NA 2D7CA 1QG4A 4U5XA 4XD7A 1E0JA 2VBCA 1SVWA 4JBYA 3RS2A 2IEYA 2VP9A 4IDOA 3AVUA 1P7CA 1F2UA 3SU8A 4KVGA 2ZS7A 3SDZA 2GTPA 4OHVA 5FBWB 3UWOA 3DM9B 3QBTA 2Q0HA 3OIVA 1OPXA 4HAXA 2ZRHA 3UMSA 4TL9A 3GLFA 2V55B 5L3QA 4B44A 1MABA 2XJ4A 2ZE6A 2HF8A 3CR8A 1ZNXA 3H4MA 3LBIA 4TL6A 1G8HA 3PITA 2ZREA 1M1YE 2A3RA 2FGKA 3CPHA 4LRWA 1FP6A 1U9IA 2RGAA 3CZPA 4Q18A 1OW3B 3EASA 2AD5A 5HE8A 4EJSA 1KK3A 4OI1A 5KDOA 4O3MA 1QZXA 2BVNA 4W5JA 4LHYA 1E2JA 2CL6X 5DE3A 4B33A 1E79D 3S1AB 4NH0A 2BMEA 1YZGA 2RGXA 3TNFA 4UNNA 1GNRA 4ZCMA 4PC2A 4ZCIA 3CRVA 1TADA 2QT0A 4YDSA 1BMFD 3KXIA 3QXHA 1IJFA 1JB1A 3EA5A 3QENA 4D0GA 1QHHA 4DZZA 4TYPA 1JR3E 2C77A 2YOHA 4ZI3A
chains in the Genus database with same CATH superfamily
4NBLA 1PR0A 2WF6A 2Y1XA 3BGSA 1T4DA 2FZCA 2C3MA 3G9XA 3PDWA 4IF4A 4Q1BA 5ALGA 2WEKA 4HV4A 2DQZA 4K8OA 4IOLA 3UFBA 1IY2A 3OVMA 1H65A 1ZBDA 2NUTB 2BWJA 3DAPA 3FGOA 1DO8A 4OJNA 4D7AA 1W7AA 1SPXA 5FNZA 4JJFA 4MS1B 2YIDA 1QIJA 2WSSD 4OHMA 3UENA 1V9CA 2C99A 1NSFA 2NTVA 3GUCA 4BO1A 1X38A 4DR2B 2LRHA 3C8DA 3PZBA 5TT0A 2YUTA 2O14A 4X6XA 1IBKB 3DO5A 3GPIA 1Q1NA 3BX1A 2V7QA 2W2PA 2WA1A 3GY0A 4IR7A 1GSAA 3VUFA 5C2JB 1I7QB 4BXOA 4S1TA 3OFKA 1GN8A 3WRYC 3JZIA 4ETMA 2Z8XA 4IIHA 1Z22A 2LZ0A 2XB6A 3FYTA 3VU3A 1J8MF 4ALNA 4P7GA 5KS2A 3K6SA 1P5HA 2IHVA 4HNQA 5ER9A 2A4MA 4H7FA 4R0VA 1QCDA 2OHVA 4HYYA 4WUTA 4UNSA 2JLRA 3V4OA 3FSGA 4TTIA 2HLNA 1D0SA 3L41A 3I9KA 5GZ6A 3O0DA 1DMRA 4RW0A 3K0KA 1RZUA 1TJ4A 2GVDC 1TVEA 1YV9A 4RK7A 5JLJA 3DA8A 3VJMA 3L7NA 3PRKE 3T1VA 1GKKA 4LTDA 2HADA 3VR5D 4X61A 4AFNA 1P45A 3H5AA 5H02A 2AI3A 5FHRA 1VE7A 1TPZA 3AVPA 4GUAA 4NBKA 2X5JO 2GYUA 3DL7A 1NQWA 2W2LA 2ZRPA 4PO8A 3HA5A 1QCYA 5CVJA 4KITB 2G06A 4DMCA 1T3SA 3N2GB 5CFOA 1GVHA 2PX0A 4NYMR 1NBME 2N9UA 4G5FA 3CLSD 4H0FA 5A3VA 5IM5A 3KWJA 3OUUA 2JGDB 1ZVJA 3WWYA 2GAIA 2OV6A 4HQRA 4XEUA 4PCVA 3E5NA 2XMPA 4R2JA 4S05A 3QH4A 5I7EA 1RNLA 2GZMA 2F1KA 2VTKA 5J43A 1GG2A 3IDSA 3MGCA 1OB5A 2H0RA 4MKZA 3Q7IA 3AETB 3EHEA 1BWRA 1LXCA 3LKVA 3PDUA 4OQNA 5DNCA 1G8MA 1SFRA 4K81B 3TUJC 4D9KA 1MPTA 1PJZA 2XKAA 2C94A 2OUIA 4PYOA 2XDQA 3G13A 2WLTA 1Q15A 5E9AA 1LTKA 3PPIA 2NZVG 4YWJA 4Q66C 1RWKA 2IYNA 2XA9A 2G40A 3CUEF 1POWA 3L7CA 4XA8A 5G0SA 2WSBA 4ZC8A 4KLAA 5DX1A 3E03A 3VPSA 2IPOA 1QF6A 3U4CA 1LRLA 1DZ3A 1U2PA 13PKA 2XQVA 5FOXA 4BMDA 4YV1A 5ALMA 1ANKA 4QDJA 1Y9DA 3LXRA 3H1FA 6AT1A 4OX9Y 3L8ZA 1RMTA 1NUHA 2IF0A 5BP7A 3TL6A 3A28A 1EVQA 1KIAA 1XVAA 3V2GA 1HSOA 3DEZA 3H4TA 5DVZA 3EQ8A 2RHHA 2GARA 3BKXA 3ESRA 4CMEA 4AU1A 1U04A 2UVDA 1NXVA 2RJ3A 1IG0A 2W7TA 2QVYX 4C5AA 1FBTA 4D6PA 4KAJA 1E66A 3G85A 4E5KA 5CFRA 5JZOA 3G23A 1NY5A 3KAPA 5GVRA 4JJ7A 5ALIA 4BE4A 3A0RB 1Q7GA 3LCMA 1UAYA 4Y2QA 3WNBA 3O2JA 4EA9A 2XCIA 4R1PA 4TQ9A 1DAMA 1KWKA 1H05A 3F7MA 3D5EA 3IIEA 1QFYA 3COSA 3TINA 4IH9A 3BMCB 3DEHA 4AN4A 3LQRA 5CRIA 5IJ0A 3LT5A 4JGGA 1QAQA 1L5OA 3BMOB 4MKHA 4MX8A 1LNSA 3RODA 5CB6A 3GLFB 3E70C 4HLUC 1A96A 4ID9A 3O0TA 1AB6A 1EFRA 2BGKA 3GRKA 5CFNA 2CFOA 3GIDA 3IMGA 4YRFA 4C5CA 4EEXA 3S8EA 2JKZA 1SPBS 3AEZA 1E6UA 4RVCA 2WTBA 2OM2A 2P1DA 4C4YA 4EJSB 2I2CA 2QRGA 3B20A 3OPYA 1Z74A 4FB4A 3HBAA 3ZWOA 4MV1A 3TQOA 2C57A 3RIMA 1U8ZA 2NO7A 4NDAA 2QZZA 4Q48A 4XIFA 4JWKA 2FWBA 1G0NA 2JVIA 3DDZX 2GCEA 1MD9A 3K9HA 1YSCA 3O90A 3WRVA 4CMGA 2NP7A 5A9SA 4LI3X 3TLYA 4HFJA 4OB6A 4XXHA 5GMOA 1TKRA 3N8GA 5TMEA 1J5EB 3H42B 2Y93A 1QHHB 2NVBA 1JFLA 2AGVA 2XWPA 3KR0A 5K8JB 3PEWA 3ZHUA 5K6AA 1LY1A 4BZQA 4J0KA 2HGZA 3NHPA 4UM9D 1V7ZA 2ZQ5A 3QU9A 3L4JA 3KZ1E 4UTVA 3L8YA 4N18A 4L7QA 2BMFA 3E7XA 5D00A 3FZNA 3OCUA 4B79A 2VA9A 1RWVA 3VR4H 5LMUB 4FFVA 2IW3A 1E92A 3FDZA 4WDQA 3WGGA 1V1MB 2V7BA 4BV3A 3NGXA 1NAIA 3ETEA 2HT6A 1BMFA 2ASVA 2BP7B 2X86A 1V9LA 3K5HA 2ZRQA 3Q40A 4PXYA 2QN8A 4U8HA 1C7RA 1JHXA 1R0WA 2RGYA 2YX1A 5LWHA 3UPTA 4TZKA 3PLNA 1JDSA 4M22A 4BNIA 1ECGA 1OI7A 4BZPA 2AW5A 2Q62A 1ZW6A 2BRUA 5ALXA 1ZA1A 3R76A 4BNNA 4PHCA 5JJLA 3VH2A 3HBMA 2GA8A 2YTZA 3T3EA 5JAIA 1WSAA 4HQ0A 3R4CA 1G3UA 5AJTA 3ZXUB 4B48A 1YC5A 3MEQA 3T34A 1VL1A 5LB2A 3LX4A 1GPJA 2Z4SA 5DJ5A 1BRTA 3T38A 5JS8A 3A4VA 3I4CA 5CP8A 1PTJA 4GL2A 3ONWA 4JC8A 1ST2A 3PNVA 3ZIUA 2CZCA 2PPLA 2QNRA 4C4PA 2ZYIA 5ICSA 4LDAA 3ILSA 1ZN9A 2V7TA 1YS7A 3QVTA 4UW9A 5DEOA 1RWXA 2RE8A 1GZ6A 3LAWA 2PMEA 3SKYA 2WM2A 1QU2A 1X7XA 3CRQA 3FPCA 1JLLA 4REOA 5KU7A 2O8VA 2ZI7A 1G4AE 2G63A 2WWTA 3NMUF 3DBIA 5CJPA 4JQYA 3SICE 5IJWA 2OTCA 1KJIA 3KBBA 1X7WB 1FMFA 4RHCA 1TCAA 5JXHA 1QV9A 2V03A 3QGMA 4DIBA 1OC2A 1T6ZA 4TLAA 1KYXA 3OKFA 3ZQ6A 3EQ9A 1RWPA 4KPEC 3MWLA 1KMQA 3OQ6A 3QUTA 4FSHA 1O2DA 4YUYA 1PLJA 3KVVA 5FR1A 3ZDYB 2FYTA 2I3GA 2P11A 2WNIA 4ERNA 4E88A 3AEYA 4LBVA 4UTRA 2O8EB 1UFQA 2IPMA 2EJCA 4G85A 2XBMA 3HCAA 3K8YA 5ADUS 3MWJA 4KQGA 2G83A 2FQ1A 4JI2B 1BEUB 3P9XA 2JCBA 4XJTA 1ZIYA 3ZKAA 3ZGZA 1GRQA 4W1QA 1R6UA 2V8OA 4RK5A 1EPUA 3PC3A 5EIFA 3MN1A 2GVZC 5AK5A 2DZDA 5CT9A 2VT3A 3BB3A 4DC0A 1P0CA 1EFVA 1VLHA 2PIDA 3AR3A 3UV6A 1SB9A 3AYXB 4J6EA 4GE0A 2F3UA 1JR3D 221PA 1DKQA 2FWNA 4QUHA 1N9GA 3JR7A 4JUDX 4KRYA 4H18A 2HJGA 3MQ4A 2VT2A 2GBCA 1IXRC 2QE7A 1G2IA 4KQFA 4FEYA 3VTAA 3VYWA 1SCQA 3D6VA 1M6WA 4F45A 3WR5A 4BNLA 4POAA 2KWIA 4IHQA 5EVCA 1VYVA 1KYTA 5F76A 3STUA 3FTEA 4AZ3B 2A35A 2J48A 3HO8A 5I9NA 3C45A 5B7PA 3QNWA 4PQGA 2G1KA 3RS4A 2H1VA 2PX3A 2PYDA 2V65A 3ZBUA 3L02A 4C2TA 2V5VA 2XKBA 4BTVA 3ZD7A 1PKEA 1JAIA 1U5CA 4G41A 4HDNA 4EVRA 1BCSB 4QTUB 1CUGA 1KY3A 3KYCA 4RABA 4XDYA 4U8GA 4YLYA 3PX7A 1U3VA 4RTMA 3CLRC 4MW1A 3HJHA 3PT9A 1C7IA 1KMNA 1U2GC 3LS2A 5AI5A 4OATA 1KH3A 2PGXA 3EARA 1D2NA 4IY1A 4FBGA 1KFBB 2XITA 3O75A 4KX3A 4PG6A 1KMHA 4R8LA 1ZI8A 4LV8B 1RQ7A 5DSTA 3BAFA 2ACWA 1S2LA 4GLJA 1LBQA 2I0FA 4PN3A 1FB5A 1L7RA 3O3NB 3QKSB 1BFKA 2WYVA 3A26A 2G88A 4I4IA 5BW8A 2EJVA 4EABA 1TQ6A 2V6BA 1J0EA 1NRWA 4XQGA 2GJKA 3ZZ0A 3AY7A 4DIMA 1AKEA 2IKQA 1ML3A 1TO1E 1KJWA 3A1NA 1I3LA 1NBAA 4MIYA 4RM3A 4KNYA 5IFKA 4CZ2A 4YIKA 1H8EA 2XMSA 2H1HA 4FBLA 4YDHB 1EFHA 1NBMD 4E6EA 1DC7A 1KC1A 1T6NA 1MCZA 1V11A 4I1OA 3ERCA 3GT3A 1H1LB 2X8BA 3BIFA 2VCYA 2VUIB 3IQZA 2PZKA 4R8VA 1KZ9A 4ZT6A 1A5SB 4WIAA 3STXA 3WDMA 2XXAB 1L7MA 4P98A 2BD0A 5HTKA 4ETNA 1DCTA 4HAYA 1EEXB 1QORA 4XD2A 1U9IC 4Y9DA 2NU6B 3WDSA 2G77B 3K0HA 3U3RA 4RU1A 2QMQA 1YRQA 2MSWA 5AW2A 4KH1A 3BBPA 4YN3A 5TS2A 4JEMA 4ENTA 5KNDH 2AOUA 2Y1GA 2JG3A 1XIVA 3SYNA 4B8WA 1J21A 4G0NA 2M6RA 2JKVA 2H65A 2TMGA 2QDXA 3ASUA 5CYGA 4FGSA 3V7WA 1IHXA 2WJPA 2XTNA 1PFKA 5FO1A 4CYMA 1AOXA 3VR2A 1ADYA 3W77A 3FNQA 1Z18A 3HB4X 1G98A 3NGMA 4RZXA 1KAEA 4XVQA 3SE0A 3PX2A 5BV0A 5FV4A 1ZZEA 4WAUA 1NN5A 2ODNA 3H2IA 3ZWVA 4DJ5X 3RUEA 2HNKA 2OT3B 2IZ1A 4BJ6A 2QN9A 1NJGA 2FAXA 3JQ8B 3UXHA 3M6LA 1FYEA 2QR3A 4CUKA 4RE6A 5DN6A 3MVEA 2XTAA 4COKA 4DXHA 4I46A 4EG8A 3A70A 5G1OA 4NWIA 1W0JD 3IPXA 4PGAA 5JZVA 5JMOA 1N32B 4P0PB 1N2XA 2VUHB 3TRIA 2UAGA 5KQLA 4NE9A 4FDAA 4UZFA 3MT7A 2J41A 3E3NA 2ZRBA 4CJXA 5CXUA 2EWVA 2DRIA 3F7OA 2WYHA 2YR0A 3KZNA 4GKVA 3RS8A 4D3DA 4E5UA 3RLFA 1EAMA 3LK6A 3KNZA 4NG4A 3IQEA 4RX1A 4YNBA 3F4KA 4KOEC 4TROA 1R4NB 4OHOA 2YYZA 3N5CA 4I55A 4D0NA 1I24A 1PQYA 5CJ2A 1SHTX 2WU4A 3FNBA 5IVDA 1TJ5A 4FYWA 4TZTA 1KFJB 3HU1A 3B51X 1AN9A 1EVEA 4Q02A 4LE2A 3ROFA 2BF7A 3GHHA 3HB9A 4A9AA 3UH1A 1PT9A 2H59A 3FHTA 1P1HA 3I73A 1F06A 4E2WA 3UHPA 1RAHA 3LD9A 1D6SA 4J0EA 3PXGA 2FZLA 1JN0A 1ZRSA 5JQWA 1SKUA 1RABA 1MPXA 5THQA 2CUTA 2GLUA 5EJFA 5REQB 2Q2WA 3D8SA 5ADVA 4BBJA 5GJCA 1TQ8A 5DU2A 4WN3A 3F2VA 3GXOA 3L6CA 4FW9A 2G9UA 3R9KA 2ZYGA 3SWWA 1NBOA 2PANA 1GFWA 2AL7A 2PWPA 4FKZA 3STHA 3WSVA 2VA8A 3UXYA 3AQ4A 1WD5A 2QW1A 3DBLB 3ESZA 3S1SA 4KR6A 3ML1A 4CLOA 4MQ4A 2J0QA 1DAGA 4P3KA 1RBMA 4ALIA 3DLBA 3ZCVA 1GKIA 1SZJG 1DELA 2VZ9A 3O4GA 1GCAA 3EGIA 3ST7A 3WZMA 4E7OA 3ZHVA 4Z53A 3DEIA 1ADFA 1QR2A 2C31A 2JI6A 2XNKA 4WECA 1D2RA 4Q5IA 2QJTA 4K9KA 1XSEA 1IHOA 2ISQA 2CFSA 5EKSA 1H66A 1KDOA 3THOA 5FR2A 1I6KA 5FUYA 4HUTA 4EDHA 1JH9A 3BQNB 3DV9A 4J3JA 3DL2A 3TRHA 2Q07A 4KQEA 1F6BA 3Q15C 1GAWA 1UK8A 2BC9A 4I5IA 3G2JA 1SD5A 4PAOA 1GWNA 1UDCA 1XEWY 3BE4A 4GEGA 5D1HA 3EF1A 4AIRA 4IIVA 5BVHA 4NV1A 1CVRA 4M1EA 2PKEA 4BEVA 1KAMA 2VHXA 1JPJA 3GLGB 4PSCA 1IY8A 5CITA 1YI1A 2PHZA 1Z75A 1U6JA 4HWKA 4YONB 3U7IA 4DWVA 4F2PA 5KQMA 3T4EA 4ARIA 1FLVA 1I32A 4FR2A 4TQGA 1FTQA 3SEZA 1JBEA 4Y67A 4BUZA 1P62B 3QM1A 1XXHB 2W6OA 1VIYA 1UBOS 2B94A 3IV7A 1FC0A 1G1MA 1TYEB 4R9NA 1D6MA 1LUAA 4CMEC 3IBSA 3PV0A 1N6PA 5CYPA 1W76A 3T9EA 4AZWA 4LTMA 3GVCA 4WEQA 5GGXA 3RRMA 1BE1A 1DEHA 1US8B 2HA6A 3IAS6 4Q9IA 4KXQA 1YJCA 2EBFX 3KS9A 4N3CA 5GV8A 2CXQA 1WDLA 1RD4A 3BF7A 3NIGB 5I3CA 1LNQA 4ESEA 1QK4A 4JBNA 4O8CA 5M3BA 4X5OA 2XGGA 3UWKA 1D6NA 1QYRA 4QFBA 3ZBPA 4EA7A 2N1BA 2B5VA 2OHXA 2OFPA 1L1FA 5D3ZA 4YEDA 3OZCA 1QK5A 2ZDQA 3BRWD 3OCYA 4B3MB 3D54D 1KYZA 2RIPA 2Y77A 4P4GA 5JS2A 3D0QA 3P8ZA 1YQGA 5LBUA 2FPIA 2FKNA 4H1HA 4LRTB 2R7AA 2R6CA 1JQ3A 1TCCA 1UJCA 2VDWB 3BREA 5DI3B 2P68A 1DFHA 1LLCA 2IVZA 1E3LA 3DHEA 1NU8A 3FCEA 4CN8A 1X7ZA 2JRCA 2H8GA 4TXMA 3VVMA 1ZX1A 2IDZA 4NZ9A 4ENVA 4MUBA 1PL7A 3H87A 2L17A 4MGEA 1BVUA 1CEQA 4R5MA 2J9GA 5TVGA 3JVUA 4EKDA 3L06A 5DDIP 3RJZA 4DYVA 5EHNA 2NGRA 3GXBA 4MAMA 3IOCA 1MZVA 4XPIB 3A0UA 2BEVB 2G1PA 1FRNA 1DO0A 1H42A 4PONA 1P1KA 3MAJA 3WWDA 3TRJA 2WMDA 1UOPA 3PT5A 4PVCA 2NSHA 3LHIA 3RVSA 2NVWA 3H9UA 3O38A 4MOWA 3D5QA 5FPYA 3DDOA 5K6AC 1XGKA 1C9JA 1LV7A 3C2QA 1F60A 4OI0A 5BUQA 1KI3A 4HFRA 4Q4AA 1RHRA 2J7PD 3C3PA 2P27A 3O1JC 4NE2A 1OVGA 4LCBA 2Z2JA 3HP7A 4QULA 4GMDA 2RGGA 4U00A 1GJRA 3WLOA 4ARSA 4OO3A 3BOSA 1M2WA 3PL1A 3HP4A 4HH0A 3SOPA 3USES 4BV8A 3UYKA 2G28A 3ZV5A 4DR3B 2Y1OA 1K66A 5LP6B 1Q22A 4R1OA 3S2IA 3RVMA 1IRXA 1X14A 4YUAA 1EWQA 4D3FA 2Q27A 1LLUA 1ZWLA 3RVQA 2XVYA 1MRZA 1JDBC 2FJ0A 3EQ7A 5HILA 4LRQA 3RFFA 2AXPA 4R8MA 4HDQB 5FBKA 1GZVA 5TGTA 4LF9B 2BRUC 1N2JA 3N58A 1LK0A 3RWBA 5BNFA 1YR1A 2Q5JA 1ND5A 2XUDA 1K6MA 1SUCA 5ALKA 3S8MA 2K2WA 1YRAA 4KLNA 4YP5A 5LM3A 3SLKA 2YYYA 1Z45A 4QDTA 3SE7A 3I04M 1E6EA 4EHBA 2D1QA 4HNUA 3N1UA 4QBFA 5T3YA 3M6WA 4PLYA 5CVUA 1XCOA 1WXWA 2VQDA 2VHUA 3RBZA 3V7NA 2IOFK 3VYSB 3WADA 4EFLA 4YAJA 1DRWA 3HKEA 4BFYA 2OFFA 2FWRA 1A9OA 5T4FA 5KMGA 1M8JA 3EDCA 2EVWX 2IF2A 1YB4A 2MU1A 2OHOA 3BL8A 3K20A 1PSWA 5FBVB 5KNBH 1UP4A 1EUZA 1TZBA 4B7AA 4CR8A 1Z0KA 4R5HA 3FWNA 3BERA 4MHOA 1V7CA 2FH5B 5J1TB 2Y9PB 3IT3A 3OIFA 4C0XA 5CD9A 5ITZA 3L6RA 3I01M 1SQ6A 5ALEA 4G4GA 2WJIA 1VSUA 1GYRA 1U9YA 1BXZA 3DGFC 3CW8X 2GHQA 2ZUDA 2C1EA 4G8CA 2B2CA 4OA8A 4X41A 3R8XA 2P5UA 2QTCA 1E5VA 4FE4A 4Y0AA 1K6IA 3ZVKA 2XZDA 1PGOA 4EEKA 5IXSA 1XVLA 2AFRA 3JQGA 4YLEA 1NQVA 4FFWA 5K3SA 4DPLA 1LC0A 2KX7A 2CL7X 5JI2E 2GEFA 4IG9A 2C5EA 1M6VA 2YXDA 3R0IA 3UB2A 1F0NA 1NWHA 2J59A 2QUBA 2R8XA 4HGPA 4MNTA 1WSDA 3DV2A 5K0LA 2I2XB 3FF1A 2P9HA 3EGCA 4AUMA 1GL3A 1WTCA 3LIPA 4RV5A 4CTKA 5JQGA 1Z0AA 3Q0TA 5C1DA 1SUSA 3L7AA 2EJBA 3NWOA 1JAZA 2GBGA 2J3IA 5E3JA 2AOWA 3ONNA 3W6OA 4DV3B 3SQXA 5IS2A 5IXJA 2CCGA 3AUSA 4UD2A 1JHOA 3NNSA 4HCJA 4NV3A 5FTWA 5LCXA 1SCAA 4K6CA 5BV7A 2HHHB 1KAHA 5HF9A 1EVYA 2J0EA 1FSZA 4DZRA 1S89A 1MFPA 5HHTA 1T43A 2V74B 3HDVA 3Q8XB 5G3ZA 2YXPX 1DG1G 3UWDA 4JLBA 4Q82A 5AQEA 4CM5A 1Q77A 3FR7A 2IHNA 5JMTA 4JJIA 2BBWA 3ZBQA 1MJGM 3W2FA 3C3JA 2X40A 2JA2A 4E09A 3GCXA 2EATA 5HIKA 4EG4A 2I99A 4DXAA 1EFKA 3L84A 1TTHA 1QFXA 2HRRA 2OGZA 3GNQA 4A82A 3MERA 2ZAYA 5AKZA 5DLQC 3TCKA 4EA8A 4EGFA 3GPBA 1ULSA 4OMUA 4QFDA 4C7MA 3R6GA 2FX2A 9LDBA 4C01A 2X8AA 2FR0A 3FD8A 4UM8B 3CIOA 4D8YA 1KGDA 1KI2A 2XSZA 3Q6IA 5A7HA 1N36B 1JHPA 2XGOA 4B3CA 4KXXA 4P81A 3TR0A 3ZUPA 2IX3A 3T1HB 1BA3A 3ZJVA 3Q41A 4V0NA 5ALUA 4I08A 2P0AA 4BS9A 3ZDXB 4JZYA 3CSUA 3E2IA 3GEHA 4LBYA 4WCFB 5EZ6B 1SKQA 4HRVA 1P8JA 3IHTA 4O2AA 5C80A 4PLGA 1RKUA 2DC1A 4XX0A 2RBGA 3OSZA 3MMPA 3U40A 3PXBA 1GL9B 1N2CB 3O3OB 2WD9A 5GPBA 4Z3DA 4MVJA 4J76A 5TMPA 2WWHA 4MGIR 2AZXA 1NKVA 2LIPA 1JYSA 2OLKA 3JQEA 3KXLA 2I1VB 4B3SB 5I51A 1C41A 5LPNA 1FSFA 1Q92A 4RWZA 1DOZA 1O77A 3OD1A 3JSXA 3BD6A 2CJWA 4J4HA 3C41J 4JIMA 2DR2A 1UMDA 4RPGA 1SQ0A 3EZFA 3OP4A 4K9SA 3QUBA 4FONA 3O8CA 3KTFA 1KBOA 1XEFA 5AK3A 5KCMA 3VR6A 1V6SA 4IFIA 1JYEA 2V7PA 3GFGA 1JPUA 5AKKA 1CETA 3C4JA 1GCGA 1S2MA 5KEIA 2DH5A 5EE0A 4BCDA 4FZ5A 5H0IA 1DKUA 4X85A 1EGAA 2VYVA 1MQ9A 4JV5B 4HATA 1H2WA 1F7VA 4B4VA 2Y1DA 1Z8HA 3MJDA 1PZEA 2QTBA 4S2UA 1EINA 3FVVA 3LA8A 5H3CA 4YXWA 3AY0A 5DM60 3EJ6A 4L4XA 1T6XA 2ZJ6A 3A6FA 4N49A 3FMPB 5C1BA 1PJBA 1D9ZA 5K6TA 5AVZA 2HBQA 5K4AA 1PZXA 4RMGA 4X64B 1YRLA 1T36A 2Y71A 1DJLA 4F2HA 3ZLBA 5KYWB 5CBPB 2DHDA 1B8VA 1WZIA 2HZBA 3L8MA 3MWEA 4S12A 1WZCA 3LYLA 2ZSJA 2C2XA 3PE4A 4QPZA 4KRFA 1GTRA 1YS9A 1HOTA 2OXFA 2GN1A 2GX6A 5LNK6 1P33A 4TRJA 2ZJYA 3T9AA 3NBFA 3CVYA 2XEXA 3GOHA 1IJEA 5ECYA 3LM8A 3V4SA 4UKDA 1BIFA 1DIAA 2AZTA 3B1WA 5AK0A 4Q1VA 1YMVA 1K4KA 3BJMA 5B4VA 4I9UA 1KVQA 2DPXA 3VNAA 1C9DB 3L05A 1A9PA 2MSNA 4MGYR 5BNTA 2XNHA 1BMQA 4LJ8A 2QP3A 3SHOA 3F6YA 3SQLA 3D6UA 2PGIA 3OG9A 4M1YA 1XCGB 3GLHB 1EZ1A 3GLKA 3VI4B 3FTFA 5IU6A 2PD6A 3B2QA 2MYTA 3BG5A 2YIMA 4FWBA 4RTPA 3H99A 3QQPA 1QQ7A 4FSDA 3RC7A 2HU8A 2B6HA 3CXRA 3P19A 3RYIB 1QU3A 4GXRA 4JJAA 3K2IA 1KPIA 5AT1A 3UQYS 1YB7A 3ZWXA 4LKOA 4XRGA 1WG8A 5BT8A 1E5LA 3VZPA 2OV1A 1YKFA 3DE0X 4J0DA 4A8JB 1JFRA 1A8QA 4UOEA 1SCIA 2VAWA 3A6PC 2DLDA 4JI1B 2JIDA 1L4YA 1DJQA 1MABB 1CUEA 2JCSA 2NTYC 2VP6A 5LU8A 1ZHHA 4GI1A 4M88A 2WKPA 3VYTB 2DQSA 2XVAA 2PZJA 5LDDC 4FMDB 2PS9A 3O74A 4L22A 2ZPTX 2WTMA 3BXEA 4IUBS 4WLVA 1VCHA 1JRLA 4GOXA 4CCWA 1VYHA 2RI6A 4QPJC 1LPSA 4E33A 3G49A 1J6UA 3DVQX 1ZD1A 3R6WA 4M54A 4PAMA 2ZK7A 3GR6A 3FI0A 2WP0A 4Q47A 2ZBQA 1G21E 3LX8A 1GU1A 1HE3A 3A9WA 1VXRA 1GV1A 4CV3A 5C8DA 4DRZA 4RMNA 3QKIA 5T41A 3QVGB 4DAOA 1RRVA 1W29A 4C7JA 1IXKA 3OURA 3MIIA 4ZZ3A 1BVYF 4LOIA 3EYWA 1DTWB 4CQMD 1QE0A 2JCXA 2WJHA 3HXQA 3ZNPA 3R09A 2PUCA 2GCGA 3PUVA 4Z7OB 1K98A 2AX3A 3L7YA 3KPWA 5IKMA 3D1VA 1BS2A 3LQ1A 2ZT7A 2HOQA 1BWSA 2I6UA 3G5TA 4XASA 5DNDA 5MN5A 1EFCA 1TKBA 2PKQO 2PMFA 2QSJA 4WQMA 1C0PA 4TTPA 2CLHB 2EG9A 1TM2A 1C3EA 5AUQA 3RU3A 3WK4A 1QH8A 1Z36A 1M74A 4FFNA 1XZNA 3BMNA 1H5NA 3ITDA 2JH8A 4Z9AA 2W2TA 3ZH2A 2C7OA 1VKJA 3COVA 1K27A 2FWJA 3RS3A 4BX3A 2P5YA 1T5OA 3TK1A 1JKMA 3F3YA 2OCXA 2QPOA 2WHPA 3A9SA 3TEMA 2I4OA 1QP0A 4OAQA 1PGQA 3OJLA 1NNI1 2VFAA 3KDSE 3KYDA 3RU7A 1XKQA 4ZVVA 1ZESA 1HDGO 2PO7A 2QXTA 2A92A 2BFBA 3WV5A 1W8IA 4XVRA 3WVNA 4KZPA 1V5GA 3BM5A 4R3NA 5B12A 1UK9A 3I5UA 4WERA 4DUGD 5C7LO 2PU7A 2Q1SA 5DW0A 5CEEA 4RTRA 2W6QA 3QHQA 2IYEA 4HXFB 1NDHA 4ISBA 1LBEA 3WHLA 3PNQA 4RBNA 1PAUA 4HXGA 5IH7A 3K2QA 4ZVTA 1PUIA 4PAWA 1SVIA 2NQ2C 1EXDA 3KL4A 4IX1A 2H2FA 3SC2B 1ZI6A 3AO0B 1YDFA 4A5SA 4MVCA 3IUBA 3TQTA 4BMPB 3JAMA 3N6XA 4QOEA 1PNVA 1BROA 2AMFA 4D57A 1QIIA 2W8BB 2Z5GA 4ZAVA 1ILEA 1EWVA 1YS2X 2I8AA 3I9LA 3ZVRA 4D2IA 4EB3A 4NYIR 1ZAYA 3ZIAA 3ZU2A 2ZULA 3AFHA 1MRNA 4MW5A 4O4IA 3EIHA 1ZUNB 3JW8A 4YV7A 3TR6A 4GX5A 2NZXA 3CNOA 1TKAA 2AWOA 2J5BA 5K0CA 4DLNA 1PP4A 2P6UA 3IP7A 4HWPA 3Q9NA 1LRKA 3G6WA 3UMCA 1ECCA 4ZYUA 2ZT5A 3STVA 4G9GA 2J33A 2SKEA 4US0R 1XLWA 1A8SA 3U7RA 2QW0X 4UNRA 5C7IO 2O0JA 4EW3A 1NP6A 1OI2A 4D6XA 2HK9A 1AO3A 4J0JA 1H8HD 3REQB 3QEMA 2F1RA 4ZEWA 5JADA 5LD2B 5F4BA 4ABTA 2CNWA 3VXKA 4Y6QA 2JATA 1AGYA 3TLAA 2AUMA 2AE1A 1USWA 1QJCA 3ZR4B 4MTLA 5ALFA 4EB0A 2IEIA 1EB8A 3COZA 1MV5A 1KR5A 4JI3B 1DUIA 2HA3A 3C8HA 3TDMA 3D2BA 4EA6A 2BGWA 3UHFA 3OJXA 1CRPA 1ZQ9A 1BVHA 3PEYA 3UJNA 4P5PA 1E5TA 2BUBA 4RA6A 1CBUA 4E5VA 5SICE 1C7JA 4G97A 2CFRA 2IEDA 2NU8B 2RHDA 3B1XA 1FDIA 5FA6A 1U8UA 2WIJA 1N4DA 1V8BA 1M2NA 4KGXA 3ZGNA 3BWVA 1E4EB 3TNLA 4CLEA 3IP9A 3W3AA 1HXHA 1BDHA 1D4OA 2NUPB 2C0QA 3DYBA 3B9RA 2E4ZA 3C85A 1XNGA 2OBLA 3P2KA 4NMHA 3C1AA 2IRWA 3HA7A 4Y8VA 4U2EA 4QD3A 1ZH2A 3WHPA 1Z2PX 5B3JA 1II9A 1QYVA 1NPYA 2YHAA 2A5YB 1WO8A 3NONA 1OY1A 2PL3A 3QLUA 4IMPA 4MA5A 5CK5A 5I01A 4M4SA 4KE7A 4NZZA 521PA 2DHCA 1BCRB 2IPAB 3N3BC 5A71A 4TTVA 3HLKA 1SUDA 4V24A 3CA8A 1T4GA 4Q15A 3TR5A 2PEYA 4U2FA 4BGUA 4XYMA 1Q17A 1UWLA 1A9QA 3AHIA 1QNLA 1KI1A 3NUQA 1G5TA 2XA1A 1OZGA 3MQ2A 2I55A 4B6FA 4MW0A 1OF1A 1UFRA 2ZYVX 4I6EA 3TSZA 1J1UA 3R3JA 2GZHA 3QOFA 1O54A 5I4IA 2P3OA 2YV1A 1KDTA 4IWNA 4YBRA 4QYTA 4LF5B 2B5WA 4CLRA 2H06A 1ZMRA 3DVAB 3LP5A 4FUTA 4JQOA 4LK3A 3JYLA 3OU7A 5TQJA 1EFUA 2LD4A 4DNOA 1FJ2A 3LTEA 3TD6A 1U4OA 3IQWA 4RJLA 2NQTA 4DPKA 2C7BA 4LYHA 4YQZA 1BKSB 5BRNA 2O7QA 4D02A 3RRNA 4FGWA 2OP0A 3DTVA 5FIUA 2PUWA 1EM8B 1M54A 5JSZB 2V1UA 2VPWA 1EEHA 1J25A 3LCVB 1KI4A 2PCLA 1U7PA 1EVKA 4EMTA 2ZBGA 2WTXA 2VHVA 3Q7PA 4KJXA 3AJDA 5I3ZA 2G82A 3FMVA 1Q5PA 2DHRA 1XEWX 3UB4A 4AP6A 3TGLA 3THXA 2WV9A 3N7AA 4G2TA 4QQKA 4TXLA 1F2VA 3HJGA 3AW8A 3ENQA 1V2HE 2BZSA 3ZHYA 3E81A 2E1RA 4ZVLA 4CEIA 4G0VA 2HA2A 4MUIA 3H7IA 4I4NA 3OQBA 4EHDA 1Y1RA 5EMNA 1BSVA 1U3DA 3V8NA 3I5XA 2WZBA 2P6MA 5FI3A 4IDBA 3WB0A 2IPNA 3P94A 5DXJA 4ZKEA 1DARA 4CM9D 2GBLC 4MQ5A 1TE2A 1X70A 4WEOA 1JBQA 2RGDA 3CB4A 3DVRX 4IDHA 1RQRA 5CBKA 3WDKA 1X42A 1AV7A 1M1UA 3EXEB 3I76A 5EXXA 1W4CA 1S2OA 4M46A 5SV2A 1U7TA 3P27A 2OECA 2FP4B 2GNPA 4GP9A 3SXPA 2A1TS 1OFHA 3EXIB 5F98A 2FPRA 4BNXA 3QQ5A 1E1RA 3TPZA 1M2VA 2Y76A 1JJVA 4BIIA 4EDFA 3VX3A 2NPIA 1BXRA 4RQBA 4CM7A 5KPJA 1U31A 1CUVA 1ND6A 3GEMA 4LXUA 4PTZA 5GY7A 2QX8A 1SOWA 5J3JA 3K16A 4LYGA 4DWOA 4FDMA 5KZMB 1TB4A 1BHO1 2FPUA 1LI4A 4DA6A 2JIZA 2ZTMA 3HV2A 3CZAA 2VQSA 4FLFA 4ESVA 1QG0A 4B6GA 4LNHA 5FOUA 3M3PA 1YMUA 3PDCA 3ZVNA 1TK2A 1F3OA 4ZAWA 3Q0EA 4EH1A 1OLUA 2PNFA 4IIUA 4ROTA 3OKPA 2WUEA 2VP0A 2QR5A 2A67A 3TGWA 1SCDA 3VDQA 2QRLA 2WT9A 2I7DA 1PDVA 1PL0A 1QCCA 2NUAA 2X14A 5L7WA 3CLRD 1OBOA 1RIIA 1DCKA 1P0IA 1R5OA 1U0OC 2XMGA 3DFFA 5CM8B 4NH4A 5DW3A 3CRZA 2Z9BA 3E9RA 4BECA 3O2SB 2HDWA 4O6VA 4MUAA 3LKDA 1P6XA 4H7IA 5JALA 3LOPA 5C3UA 1QGUB 3KTDA 4FS3A 2CDRA 3LL4A 3EZXA 3WJ7A 1O0BA 4CL2A 1RZRD 1B93A 5JARA 4YYEA 2GA9A 4JI0B 3I9OA 2M2IA 3IKVA 1GTVA 5BO5A 4BQEA 4R1SA 4XLZA 3IKMB 4M7WA 4YDRA 4KQ6A 1SUEA 5LWQA 3M7IA 5CD1A 1SG0A 4GX0A 3ZI7A 1QRRA 4XE5A 4HVLA 1PR1A 2F59A 3MJCA 1S3GA 1PEKE 4R2IA 4I0WB 4ZMBA 3K70B 5LZ4A 1RXUA 3BGOS 4J1SA 2AQ8A 1A9ZA 1EP3B 3WNDA 3C6XA 5BOSB 3AFIA 3AZQA 3R20A 5EIHA 1MB4A 3IVAA 2ZUUA 4X0EA 5GONA 5IAEA 1AX9A 4IHJA 4B87A 3PWTA 1EBUA 3BC1A 1GGJA 1KFKB 1HT1E 2XMDA 4G4SP 2ZBFA 3KDAA 4AECA 3ZDCA 2XV1A 1PLLA 3PF8A 3FOWA 2DLCX 3DVLA 2O59A 1FSPA 1XEXB 2JLVA 1RXEA 5ICGA 4KI0A 1VHDA 2QROA 2IUYA 1FP1D 4HI0E 4KQKA 2VVTA 3EA4A 2C4VA 2HSDA 2VHQA 3EEOA 3VDNB 3K32A 3EZ7A 3IHWA 3R9WA 3AOEA 2P69A 5GOZA 1H3FA 4GD3Q 4OHKA 5EZ5A 3JQRA 1EX6A 2VP4A 3H5OA 4N3GA 1AGRA 2AMJA 2RONA 3A6DA 4H3VA 4JUBA 5FWAA 1CTQA 3ZIDA 5DLPA 4WD3A 2CK3A 2R44A 3EMBA 1JE1A 4B6EA 4YAGA 4ARZB 5MFZA 4DV7B 4J6FA 2EP7A 2DB3A 2WJGA 3ILYA 4YJGB 1KZ7B 1N2BA 4AI6A 1UBRS 3EVAA 1NI4A 1HWYA 3BRCA 4YP7A 4IILA 3X1DA 3X2EA 3H9EO 4WW0A 1MZPA 3KKNA 5CNIA 5C8YA 1VOTA 2PN1A 1Q6YA 4MRRA 5FF9A 2PL1A 2QRQA 3OFNA 3O8QA 1REQB 3VHQA 3ZS8A 4GWGA 1GFZA 4ZXPA 2Z5FA 4WGGA 4HRYA 3KQMA 3SAJA 5HQTA 1Y5LA 5LA6B 4Z9FA 2PR2A 1G3RA 4JI6B 4FFDA