2IXIA

Rmlc p aeruginosa with dtdp-xylose
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
184
structure length
184
Chain Sequence
SMSMKATRLAIPDVILFEPRVFGDDRGFFFESYNQRAFEEACGHPVSFVQDNHSRSARGVLRGLHYQIRQAQGKLVRATLGEVFDVAVDLRRGSPTFGQWVGERLSAENKRQMWIPAGFAHGFVVLSEYAEFLYKTTDFWAPEHERCIVWNDPELKIDWPLQDAPLLSEKDRQGKAFADADCFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rmlc, a C3' and C5' Carbohydrate Epimerase, Appears to Operate Via an Intermediate with an Unusual Twist Boat Conformation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Isomerase
molecule keywords DTDP-4-DEHYDRORHAMNOSE 3,5-EPIMERASE
total genus 46
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 5.1.3.13: dTDP-4-dehydrorhamnose 3,5-epimerase.
pdb deposition date 2006-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ixiA00
4ZU4A 3H9AA 2D5HA 1FXZA 3GYDA 3BCWA 4XFHA 5FPXA 3NKTA 1ZRFA 3PLQA 2Z2SB 5FDBA 4A2UA 1PM7A 1L3JA 1YLLA 2GC3A 4JV4A 4LEJA 5LRRA 5BY5A 4KU8A 4MH0E 3SCHA 4RD7A 4XFBA 3NSTA 1J58A 1VJ2A 3IDCB 4AVCA 4I0BA 2BEOA 2XLAA 4XETA 1NZCA 2PTMA 1SEFA 3E5XA 4Q0VA 3RYRA 3S0MA 1RUOA 5KBFA 1ZZ7A 1UD1A 3ETQA 5I8SA 4HLTA 3H50A 1YHFA 4IERA 3NL1A 4QX5A 4EWAA 4EWEA 1ZRRA 4QMAA 4E2GA 3RDIA 3SMHA 5J3UA 1OI6A 3B02A 4XF4A 3FX3A 3ES4A 2PYTA 2GU9A 3LWCA 1J59A 2Q4SA 4N9HA 4WZCA 1PMIA 2ET7A 5EFUA 1UPIA 2IXHA 3U0ZA 4I0AA 5CVRA 3USSA 3WW4A 3MZHA 1QWRA 4FBFA 3OTFA 3ST7A 2I45A 3NW4A 1J3RA 3IIAA 1QXRA 4N9IA 1CAUB 4WBBA 2Q1ZB 4YNIA 4D7TA 3IDBB 1O3SA 2QNKA 4I2OA 1O5LA 4ZU5A 1VR3A 1V70A 3FWEA 2KXLA 1ZZCA 1CX4A 4HSLA 2XLFA 3E6CC 2E9QA 4JTOA 4QXKA 2MHFA 3TNQA 3ZDSA 5JR7B 5FQ0A 4MGYE 4EWDA 1NYWA 5JSRA 2F4PA 4OLLA 2IXKA 4TLFA 3ELNA 3D0JA 3M70A 4X6RB 2GC1A 1O5UA 2IXLA 4XF9A 4MGZE 3H7JA 1O3QA 3HT1A 1Y9QA 4KU7A 2ZKLA 3I54A 3L2HA 2BNOA 2C0ZA 4LLOA 1CAXB 2Q0AA 4B29A 2BGCA 3E5UA 3GBFA 1DGWA 2EVXA 3DL3A 4GULA 1H1MA 4DINB 4IEZA 2WC2A 1GQHA 5KHJA 2BNMA 4I02A 3UKNA 2Y0OA 4HBNA 3DN7A 4OFGA 1Q43A 1DZTA 3PNAA 5K8SA 2QVSB 1OMIA 4IEWA 2PHLA 3HQXA 4KWKA 1I6XA 5AVPA 1HW5A 4LTAA 4XF3A 1EPZA 2ETEA 4AQ2A 2UYBA 1SFNA 4LA3A 4LULA 3ACLA 3KGLA 2CGPA 4E2SA 4QM8A 4FT8A 3SCGA 3UKVA 4META 2MPFA 4Q0PA 5I93A 3LA3A 2CAUA 3H3ZA 2IXCA 2UYAA 1ZRCA 1J3PA 3FHIB 3MPBA 3CF6E 3E6DA 3RNSA 2B5HA 2IXJA 4P9GA 4AQ6A 1YFUA 2D40A 1NE4A 1LKNA 2FQPA 1IPKA 1NXMA 1Q5OA 4XFGA 2VECA 3ROUA 4J1WA 4F8AA 2H6CA 5FLJA 2H6BA 2H0VA 4O9GA 1EY2A 3LAGA 2OZJA 3WW1A 5LEKA 1WA4A 2VPVA 4AXOA 3N4MA 2XLGA 4QM9A 3EQEA 4MZUA 4HN1A 5BUVA 4MGKE 3DKWA 3EHKA 4IEXA 4UBHA 1CAWA 1RTVA 2Q30A 3OD0A 1ZRDA 3RYKA 1TQ5A 3H7YA 4L2NA 2UY9A 1CAUA 2HKXA 4L11A 1J3QA 1O3RA 3D82A 3ES1A 1FI2A 3BALA 4Q0SA 1X7NA 1I5ZA 1ZREA 3DV8A 3IWZA 4KWLA 2EA7A 2QDRA 2XKPA 1OFNA 1UW8A 4EV0A 1ZZBA 2O8QA 4PJYA 4WVZA 4KWJA 1RGSA 4LA2A 3NJZA 4AVBA 4FAHA 3FFQA 2CAVA 3U10A 3KCCA 3JZVA 4R52A 3OF1A 4YARA 1YWKA 4MX3A 4XFIA 3I59B 4XF0A 4H7LA 4XFAA 5JCTA 1YFXA 2EAAA 3C3VA 4I3PA 4IEOA 4Q29A 3CO2A 3CJXA 3H3UA 4KL1A 4QGLA 2GC2A 2BYVE 5E16A 3MDPA 1LRHA 1NE6A 3E97A 4HZFA 5J7MA 4O9EA 2CV6A 4BHPA 5I0TA 4HVQA 2OPKA 5J48A 2MNGA 4D7SA 5JSPA 3H1YA 5JAXA 3FZ3A 4UBGA 1X82A 2ET1A 1O4TA 1CGPA 4Z82A 3BB6A 4BH9A 5C8WA 2VQAA 4FAGA 2FMYA 2B9UA 2OYZA 1ZX5A 1WLTA 4XF1A 4QGNA 2XHKA 4UXAA 4XEZA 5CADA 1CAVA 3S7EA 4HVRA 3LOIA 1ZVFA 2QCSB 4IEUA 1LB2A 5F1RA 5FPZA 4E2QA 1SQ4A 4MUVA 4Q0QA 1X8EA 4IEYA 1DZRA 1YUDA 2D93A 3LA7A 3PVBB 5T3NA 1RUNA 2UY8A 4IEQA 3NVCA 5I8YA 1X8MA 4ONUA 4I09A 3LA2A 3M3IA 5D1IA 3I59A 1IPJA 2GAUA 4ZU7A 3SCFA 4HN0A 1RL3A 2PQQA 3QOPA 5HI0A 2OA2A 3QACA 2XL9A 1ZZ6A 2DCTA 2D5FA 3D0SA 2GZWA 4JVAA 3R6SA 3WW3A 2B8MA 1O7FA 5C6CA 4XFFA 2IXIA 1J1LA 1CAXA 1U12A 2ATFA 2N7GA 3CEWA 3EJKA 4PIZA 5FQ0B 3O14A 3E6BA 4Z07A 1RC6A 4CYDA 1VP6A 4R8HA 2XKOA 4QGMA 3U11A 3I7DA 1XE7A 4PIXA 5LEJA 2HJIA 3EO6A 5KHHA 4EROA 2PA7A 4BYYA 2OZ6A 1FT9A 2PFWA 1ZZ8A 2K9ZA 4IESA 4PIYA 4YRDA 5I8TA 4Q0UA 1GQGA 1UCXA 3WW2A 4XFCA 5KHKA 3OGJA 3H1WA 1EYBA 2V09A 2ZCWA 4YSFA 4AVAA 1DGRA 4JTNA 5I0SA 5CU1A 3KGZA 3TNPB 3IBMA 2XL7A 4HMZA 5KHGA 4K8FA 3RPQA 5BV6A 4I01A 3H8UA 3RZZA 3VHRA 4LUKA 3OCPA 1Y3TA 3HT2A 5KHIA 2QJVA 2P17A 1UIJA 2O1QA 1OD5A 5FLHA 2PHDA 3FJSA 2GC0A 4BIFA 3G7DA 2K0GA 2PAEA 5EZWA 1G6NA 2XGXA 3HIFA 4J1XA 1LR5A 2BNNA 2GH2A 1H1IA 2Z69A 3FE5A 4X6QB 2IC1A 1QY4A 4HVOA 4F7ZA 3LZZA 3MYXA 5I0RA 1CAWB 5FCCA 3RYPA 1JUHA 3H1MA 4HSJA 1ZZ9A 4LUMA 4YYOA 3SXWA 4MV2A 5BPXA 3SHRA 3KSCA 1YFYA 1UIKA 3CL1A 5E1RA 5I91A 3BPZA 5I0UA 1EP0A 5FLIA 3CLPA 2PAKA 3E5QA 5LRSA 5BXXA 1WGPA 3KMHA 4NVPA 1CAVB 1Q3EA 4ORFA 3UKTA 5JSOA 4IEPA 1ZNPA 3S7IA 2PAMA 1QXJA 4IETA 1XE8A 3BU7A 4MGIE 1O3TA 1XRUA 2WFPA 4IEVA 1YFWA 3EBRA
chains in the Genus database with same CATH superfamily
2AR6A 4W6YA 2PN5A 4QU1A 2YBKA 2ADEA 4C1WA 1FMD3 2JG8A 5C5UA 3BCWA 5JXJA 2RM23 5C4WC 4NJ4A 1Y7BA 3ZPYA 4Z8BA 1JN2P 3I3MA 4NMIA 2CGOA 4FVVA 5F3IA 1C1LA 2JG9B 1U5IA 3OGGA 2WBKA 1D4M1 1D4M3 4Q4W3 4LMFA 1GWMA 4LEJA 2BW8A 1OUSA 2QZ2A 1RUH1 3ILNA 1EUUA 4RD7A 4XFBA 4M00A 4XJ9A 5DDJ3 3SEEA 2PLV3 4LKDA 3IDEA 1FOD1 4BXFA 3P3PA 1ULDA 3FBYA 5GZFA 4I0BA 1AYM1 2BEOA 3PDQA 1F8VA 2AEYA 4FQZA 2ZX3A 4Q0VA 3E5XA 3RYRA 1RHI2 1WCUA 4AGRA 2W9XA 1CJPA 2X5IA 1QEXA 1UXXX 5JIUA 3PJQA 1VRBA 2WQ4A 1JU4A 4HLTA 4XBNA 5LA9A 2J22A 3H50A 2WYFA 4AW7A 4K1ZA 1GNYA 1DYKA 5HCAA 5KC6A 2BQPA 4ZZ5A 2VTXJ 1J1TA 4EWEA 1JW6A 4GZ9A 4QMAA 3NV1A 1OI6A 1O6UA 3QH7A 5C9AA 2Z5WA 5FOBB 1UU5A 4JDNA 5B4NA 4XF4A 3VBOA 2E6VA 3M3EA 4XIOA 1S0DA 3PU3A 4BK5A 4OQ9A 4CUGA 2GMPA 1REFA 2Q4SA 1C4RA 4N9HA 2VGDA 1UPIA 1NQJA 3WQ0A 3ENRA 3U0ZA 2NYYA 1RB8G 1XQNA 4GKXA 5E88A 5LBFA 3UL2A 3J9SA 2J1UA 2PHWA 3M2MA 5CVRA 1QMJA 2XQRA 3USSA 2R073 3ZSEA 3GCWA 3W59A 4Q4Y1 1NKGA 3HOBA 1RUF3 1OH3A 1VAMA 1V9U1 4QPIA 4R4XA 1YYNA 3C2UA 4N9IA 4WBBA 4YNIA 4NO4A 3FC0A 1W8UA 2O0OA 3AKQA 4XDQA 4Q4W1 5FJKA 3U14A 3UGFA 2WRAA 3S6PA 5AFBA 3LSEA 2D6OX 2BFUS 3K3NA 2CYFA 5FZ6A 5GKAC 3VBUA 4DEQA 2XLFA 1LGCA 5FUIA 2VNVA 4K3UA 4NPRA 5LY1A 3NJYA 1GNZA 2LW8A 3LCPA 3O0WA 4KG0A 4W4ZA 1AL22 3AP7A 1S0FA 2OXBA 2PXJA 1XU2A 3AKRA 5GLVA 3VL9A 1H9WA 4EWDA 1R093 2C9AA 4LHKA 1ND2C 2X53S 1RUD3 1AYM2 1DBNA 4NIAA 3WQ1A 4EN6B 5IVCA 5C3RA 2F4PA 1GNHA 1MS9A 4QB6A 4DPNA 4FPFA 2CNAA 2YGLA 5DAPA 5K0UC 2BGOA 4X6RB 4PCRA 2GC1A 4JHTA 3OPZA 2EXKA 4S2HA 5EYYA 2VMIA 4MGZE 4DRRA 3HT1A 4FXKB 4QPYA 2ZKLA 1SBDA 5DG1A 1RJ8A 3E1F1 4LLOA 4NIIA 1RXFA 5IK5A 1CAXB 3AZYA 2FDJA 2VU9A 5JMCA 1XSQA 3GBFA 1IS6A 2ZEXA 3WINE 1STMA 1TG7A 2ZGMA 1G7YA 1LODA 2EVXA 2XBO2 5EQUA 1PO23 2Y38A 1VBC3 1QHDA 4QPGA 4TWTA 2A3XA 4DINB 4OI0A 4IV3A 3NNGA 3ON7A 1SMVA 3P5BA 3IM0A 2BNMA 4D6QA 3UKNA 2Y0OA 2YBPA 4YVWC 3U75A 1QF3A 2VXJA 4MXWB 5FO8B 3I3BA 5KXCA 1QJU1 5F2SA 1JUIA 5FZGA 4XC9A 1VBB3 3WF0A 3WNXA 3U07A 2QVSB 3I3EA 4B3NA 1ULEA 3TOJA 1OMIA 2YFZA 3B9CA 5FYVA 1I6XA 1LOGA 4PLNA 1HW5A 5T55A 4XF3A 2ZGQA 2B7YA 1PX3A 4W6WA 3ZXAC 2ETEA 3AP4A 4UW3A 3ZYFA 3ZPOA 5JZGC 4LA3A 4LULA 3D8CA 5J98B 4CEYA 2HWC3 4Q4V1 3T1MA 1OPOA 2P6CA 1QJX2 1JS9A 1XOYA 3AKSA 3LDKA 5FY1A 3ZR6A 2PMWB 4DY3A 5LZ6A 4META 4MLOA 2MPFA 2W0XA 2WFF3 3GJBA 2P4EA 4RYDA 5GZDA 3NKGA 5ABJC 5I93A 4RHV3 3NJXA 5D8AC 3H3ZA 2IXCA 2UYAA 2X8KA 3M7AA 5CIRA 2OIIA 5DABA 5GZEA 1U5XA 1ZRCA 3HVDA 3FHIB 3MPBA 1KXGA 2R1DA 5FZMA 2J1TA 3TAYA 2IXJA 4B4RA 3J7LA 5ABJB 2RS12 1MS1A 4LT5A 5FK8A 1IPKA 4XFGA 1GZCA 1Q5OA 1FX5A 1HV0A 1LOAA 4XMAA 2HWF3 1PGW2 1VB4A 2QQNA 2HWD1 4DEVA 1H9PA 3LE0A 4SBVA 2B39A 5FLJA 4Q1PA 2OPWA 2CHHA 3ECQA 2H6BA 2F17A 3W9AA 1EY2A 3OUIA 3VUOA 3V65A 5AC92 2D6NA 3ACHA 4FPLA 1D2QA 4CDWB 1WCSA 4JZRA 4W6XA 2WS93 5LBBA 1ND3C 1ZM1A 4GXLA 4AXOA 2JE7A 1AR82 5IFTA 3N4MA 4PDWC 4JQRA 4QM9A 2ZS6B 3WDVA 3ZN6A 1BYHA 3EQEA 3VBRA 5ERLA 3OGSA 1KGYA 4MGKE 1Q56A 3ZFGC 5EV7A 3VDDA 2ZHLA 4INDA 2WAAA 1OURA 4FPKA 1RTVA 1W8NA 3RYKA 4P08A 3ZFGB 2UY9A 3MIDA 2VZVA 1R083 2LS6A 2WN2A 2C24A 1NCRB 3INAA 2W1SA 2HYXA 4XMIA 4L11A 2QE3A 2Y0IA 1EPWA 5FYHA 4N53C 3D82A 3FLTA 1FI2A 2BDRA 4LOSA 4XTPA 4XPVA 1VRH3 1AYN2 2GMMA 1AXYA 3POWA 1Y9MA 1DGRN 1X7NA 2FD8A 3QD6A 3WSOA 5C9AC 3WF3A 4E8DA 1QDOA 2W52A 1G9DA 2EA7A 2I2SA 4CEYC 3ZVXA 2X09A 1DFQA 4M3CB 1G9CA 1C28A 4JCKA 4PQ9A 1VBE1 3VBFC 1VBA2 4KH9A 4FAHA 2BV4A 5C4WB 2CAVA 5ANQA 2KD7A 3HNYM 1CX1A 1OXCA 2IVJA 4GA9A 4MX3A 1S1AA 4V2VA 5IATA 2ZGTA 3PIJA 3D6EA 4IV1B 4NROA 3WP5A 1RJ7A 3N7LA 4LXLA 4XF0A 1RUE2 4NPMA 4XFAA 2Q8OA 4TZDA 2B45X 1WW5A 3NRUA 2W3JA 3BODA 1YFXA 1Z7S2 3C3VA 2VZRA 3GZEA 4I3PA 4L92A 3K4AA 4NHYA 4IEOA 4Q29A 4Y5Z0 5FZLA 3H3UA 5ACA3 1OOPC 4KL1A 5F5CA 3WX5A 1PMHX 3TBDA 1KS5A 2YHJA 4Q27A 2YG0A 3AL5A 1K3IA 2HWB2 3USUA 1JOJA 4JGZA 4AVSA 2ZEZA 1ACCA 5T5OA 1LRHA 2SBAA 1HRV2 5FZFA 1O4ZA 3L2YA 1AX0A 3FHAA 2JKXA 4OUEA 5A6ZA 1RMU3 5AFEA 3JBG1 5I0TA 2WL1A 2WNVC 4HVQA 3VBOB 5HCHA 3DXTA 2CTVA 4KBZA 2R16A 3I2GA 4IE5A 4JDMA 4JGYC 1ZRIA 1D0GA 1OPMA 1X82A 3A22A 4UBGA 3VV1A 3S5AA 1HRV1 2R0HA 5JVVA 3BB6A 1X9PA 1MEC3 2VQAA 3FUQA 3KT7A 3QH6A 3Q8AA 1ZX5A 3O1MA 3ZKYA 3MFCA 4UXAA 4YGDA 1W9YA 5AC93 4YZ2A 1RVF1 4AHYA 5A3UA 2FZ1A 2VOXA 3ZOIA 1Q8OA 5FZ9A 1LB2A 4MADA 4ZHNA 1AL0G 3OPWA 1H30A 1I9RA 4M4PA 3LEIA 2ZGRA 4BDVB 1RUE1 2GNMA 4YG3A 1O8SA 2NM1A 2W5FA 4YM2A 2OUJA 2ENRA 3VBRB 4NWVA 3IIIA 1RVF2 3TN93 1A78A 2WT1A 4YFZA 3NVCA 4GWJA 4YG0A 4FPJA 3AMQA 4LBKA 4QKDA 4RGGA 4XCAA 1JZ5A 5GM0A 3TRSB 4I09A 2A71A 1X50A 3LKJA 3I59A 1Z0HA 1T6GC 1ULCA 4Q4V2 3LPFA 4NHXA 4ZU7A 2W68A 2W47A 2R49A 3HN1A 2RG4A 3QOPA 2BRTA 2G9ZA 5A7WB 1MS8A 5F5AA 3WV6A 5A6QA 3P6BA 2WO1A 1ZZ6A 4LHNA 1YQ8A 2BWAA 3Q8CA 2OS2A 3WW3A 1QU0A 5K7PA 2VZUA 1U0AA 3I2FA 1QJU2 1K5MC 1B09A 3A0NA 3Q8EA 3U37A 4DXRA 1BMV1 3VZNA 1KEXA 2R043 4QX2A 4ZS2A 3WP3A 4UOJA 4FOWA 2ATFA 4D6RA 3EJKA 4GH4C 2A3YA 3I2HA 3T0AA 3RMXA 4PIZA 5FQ0B 3D5OA 2ZAAA 3B93A 1Q8SA 3O14A 3POIA 3RZMA 4FOYA 4BPZA 3B3QE 1ENSA 1RC6A 4XUTA 1FATA 4AHXA 1R091 3AMHA 4KWUA 1PVC2 4CA9A 1J84A 3U11A 1UNBA 1XE7A 3NMBA 2WZEA 4J25A 1DYPA 3FFZA 5D8AB 3RJ2X 5SV8A 2RS31 2JE9A 5KHHA 4EROA 3EXUA 4MGQA 3PTRB 4XABA 4FO9A 5A6YA 3CZJA 3M4FA 3AFGA 4QHZA 4DZGA 2K9ZA 2Y64A 3BI3A 3DYOA 4PIYA 3CKHA 3WOGA 1GQGA 1UCXA 4XFCA 4NHKA 3ASIA 1DQ1A 2O14A 3OGJA 2RMU1 3H1WA 4AEKA 4AFAA 5BNPB 2FZ2A 4RGAA 2RS52 2ZCWA 4M01A 4QHOA 4YSFA 1XNAA 4OMCA 5ANNA 3AYEA 4Y20A 2QFEA 5DUUA 3ACGA 2R062 2WO7A 5LBCA 2K46A 4C0HA 4BCUA 5L7OB 2ZHMA 1H8VA 2A70A 1T6BX 1W90A 5CU1A 2JDKA 1W05A 1AYM3 2GN3A 4YW6A 5FY0A 3WG1A 1XB9A 3TNPB 1UXZA 4AR2A 3K51A 3UGGA 4IV1A 2P3JA 1C5IA 1X9TA 4WVWA 3ZXEA 1PM4A 4I01A 5CZKA 3ZN5A 2ZAHA 1C57A 3ETPA 1UY1A 4LUKA 5GALA 4UFMA 4YVSA 1GP6A 5FPUA 5KHIA 4URTA 2QJVA 1S55A 4BQ3A 5C4WA 2P17A 2HWB3 1MS5A 3M3OA 2D3SA 2VUAA 4GH4B 4H2AA 2VZTA 4Y26A 1XBFA 4XVHA 1OD5A 2QQVA 1X36A 4PI0A 2EIGA 1LJ7A 2PHDA 4BIFA 5IHRA 1QOOA 3J7MA 5FP3A 2HYKA 4J1XA 3WUCA 3BVCA 4DNYA 2Q1MA 1PK6A 5LB6A 1RUG2 4X6QB 1JHNA 1QY4A 3FHQA 1MVQA 5IAXA 5EPAA 5LW9A 5BNNC 1RUH3 1H0BA 3LZZA 1QH7A 3KF5A 1LU1A 3BUCA 3IMNA 2IFWA 2BZDA 1VBB1 3CU7A 4QDQA 4YWAA 4E4DX 1JUHA 1FPN2 3H1MA 4UW4A 1CONA 3PUQA 3WQBA 3AKTA 3VBUB 4OUSA 4BQ5A 4P9XA 2DV9A 5BPXA 3NQHA 1XNTA 1YFYA 3KSCA 4QQPA 1UIKA 5FFOC 1UKGA 3NO8A 1IS5A 3ZXDA 1QJEA 2G9GA 3RRDA 1EP0A 5ACA1 2PAKA 4BISA 5LRSA 1KQRA 5BXXA 1FMD2 5J96B 3MW4A 1JYIA 4EQVA 1SLTA 2Y6LA 3MUY1 1CAVB 1M4WA 1Q3EA 1WWYA 1OLQA 2R072 1FOD2 1DCSA 1MS4A 2PAMA 1S2EA 1HX6A 1VMFA 4IETA 3APBA 5CFCB 5F9TA 5JI9A 1W8OA 5BNNA 2VNGA 3EBRA 5IW0A 4ZU4A 4XBLA 4XJUA 5C9AB 4D94A 5LA0A 2D5HA 3POJA 5C8CA 3RS6A 2FDHA 4IW3A 3ZFFB 5FPXA 2ZEYA 4YM3A 3PJYA 3ACFA 3B5LB 4RR3A 2HWF2 4Q4W2 4IGQA 1V6MA 2BWCA 3JUUA 4A2UA 4L97A 1AR92 1VRH1 1YLLA 2CWSA 1BJQA 4J6GA 2GC3A 4YGBA 3LFMA 2TNFA 4BQ1A 4PBOA 2DBNA 3LEGA 4KU8A 3MF9A 4MH0E 4Y3OA 2WT0A 5L9RA 4UFLA 5IFPA 1F2NA 4XACA 5DDJ1 2HBTA 2VC9A 4X8NA 5J1XA 5A1LA 3NSTA 1J58A 4HANA 2AC1A 1VJ2A 3IDCB 4IV3C 1EV12 3WNOA 3CJIC 3IPVA 3BPSA 2E53A 1NZCA 2PTMA 1SEFA 4WZFA 1Y9GA 4EZHA 3S0MA 5JPNB 5L9VA 1ZZ7A 1CIWA 2JEMA 4C0BA 3MW2A 1GOHA 3U78A 1YHFA 4OI1A 2D7FA 2UU8A 2QZ3A 1AYN3 2JB8A 1KFXL 1VIWB 3BYWA 4FFFA 3MGUA 4LBQB 1RUC1 3PL0A 4LO4B 4EWAA 4C8DA 3MFAA 5GLZA 4E2GA 1RHI1 3SMHA 4COUA 5J3UA 4PLOA 2VNOA 4Q4X3 3TYJA 1LEMA 3B02A 3FX3A 1JXNA 3ES4A 4GWMA 1S0JA 5FBJA 1OA4A 2PYTA 2VG9A 2WWUA 2Q8EA 2ZZQA 1KFUL 1J59A 4OZOA 1ZA7A 4WZCA 2ET7A 2WWSA 1SLBA 2ZGSA 3C8XA 2IXHA 1PIV1 4ZKTB 1LOFC 2ES3A 2Y33A 2XXZA 5FMDA 4ARXA 1OQ1A 1ODMA 4P02B 4EN0A 3T4VA 1HRI3 2ZX1A 2WNUB 1YEWA 1NXD1 1E5HA 3ACIA 4AEDA 4QXBA 2I45A 3ST7A 2Q1FA 2B4KA 4K6BA 1QXRA 4D7TA 1CAUB 4DXTA 1BBT2 1MVEA 3IDBB 1ENXA 1O3SA 2QNKA 1OSGA 2VM9A 2HWF1 3ZR5A 4WM7C 1VR3A 3MIFA 2WNUC 1LAJA 5LASA 2UWBA 3PMSA 1CX4A 4HSLA 4S2GA 5FP7A 4AAPA 4CXYA 1QKQA 5HPOA 2JXAA 4LQRA 1UY0A 5JWPA 3T09A 1GKBA 2WFF1 3HBZA 4FP3A 4D69A 4IV3B 2WLPA 3ZDSA 1LGNA 1COV3 5KC5A 2HWC1 4Q4V3 1QNYA 3JXSA 4MGYE 2JDYA 4BE3A 2V72A 3H8OA 2X29A 2OT7A 2QQKA 2RR11 3ITQA 1RINA 3IT8A 3NAPC 5LATA 4LJHA 4ASKA 1GBGA 1LOBA 2IXKA 4TLFA 4BQWA 3JB8A 2EIBA 1YJLA 3ZO0B 4FCAA 2WNOA 3P3NA 4LE4A 5CFCC 1O5UA 4AI1A 5A3NA 4RSUA 4WM8C 3WDXA 1AF9A 4FPHA 5A32B 4GAZA 1FAYA 1HQWA 3GZAA 5DZEA 3VHNA 1JYXA 1JYNA 4KU7A 1NCRC 3WDWA 1AX2A 2HBUA 3I54A 3NNLA 2BNOA 3AM2A 2A73B 1GZ9A 4IE4A 5JOXA 3O1PA 4Y5TA 4YFWA 2TUNA 4QXHA 1EAH1 2XPJA 4AZZA 4AF9A 3ILRA 5FZ1A 2DFBA 2W94A 1DGWA 1S2BA 3MHZA 3AK0A 4QU2A 3FMGA 4GULA 1H1MA 1KDKA 3EMRA 4Y20B 5DAWA 1E5RA 1RHI3 3POEA 2JDZA 3EB7A 2L9LA 3AB0A 4IEZA 3RG0A 3JD71 3NAPA 1I1EA 2ZOEB 1GQHA 3J7HA 3VZKA 1CZSA 1L7RA 4B1LA 5KHJA 4IDZA 1TMF2 4I02A 4FOQA 1UY4A 3MF6A 4OFGA 2XH6A 4CDWA 5EYXA 4LHSA 2DTWA 5GLUA 1Q43A 1Y43B 5FYBA 2BGPA 1DF0A 3U1XA 4HL0A 4GB33 4Y22B 1PZ9A 1OF3A 2YPJA 1MR5A 1CIYA 3HPNA 1N47A 1QJY3 3VBUC 1A3KA 1VAKA 2BJSA 4IEWA 2PHLA 4K21A 4RA0A 4XJWA 1YQ5A 5IUQA 4BJ0A 4NIDA 1YO8A 4MXVA 1JZ6A 2JDNA 3MIGA 3P1IA 4LTAA 4V2WA 5FJHA 1UKRA 4AQ2A 3PHMA 3ACLA 1YI7A 2PELA 3KGLA 5GLWA 5A7NA 4E2SA 4QM8A 4FT8A 2D98A 2D3PA 2VOWA 2WINB 2X05A 4BQ2A 1ENQA 3DECA 3HQRA 2CAUA 3KQRA 3IPVB 4MYEA 5IVFA 1GWKA 4YW2A 2ZHNA 3E6DA 1CESA 2WS92 2X5IC 4AQ6A 4P9GA 1YFUA 2D40A 2V5YA 2FQPA 5M0TA 3NNMA 5LY2A 4XAAA 2R1BA 4QDSA 3HQUA 2RS33 1AHSA 1NZIA 1ZYBA 2CU5A 2QTWB 3PVOA 1REEA 4J1WA 4AQSA 4OQ8A 3DYMA 1BKZA 2H6CA 2J7MA 4DS0A 4BA6A 3D4KA 4G9SB 2ADDA 3LAGA 4OMDA 5HXVA 3V56A 3WW1A 4DXZA 1OLME 5LCWL 4CDXB 1IS3A 1UZ0A 2IVIB 3AMNA 2J1RA 2VPVA 4CDQC 2VMDA 5A7QA 5A7PA 3VBSA 2NN8A 3CJIA 4MZUA 4RHV2 4HN1A 1NA1C 1DG6A 5FPVA 5IWFA 5C33A 3DKWA 2P3KA 1JZ2A 1WCQA 5LK5A 1ZBA3 3VZMA 3PMEA 4IEXA 1KD7A 2RDNA 3KZ4C 4GQ7A 4YW3A 4BQYA 1G8WA 1NLQA 2Q30A 3OD0A 1ZRDA 4YW5A 4YGEA 4L2NA 1SCRA 1N3PA 1GZWB 5J36A 1CAUA 4TN7A 4CP0A 1VPHA 1ASJ1 1J3QA 4D8MA 2OQ7A 2Y6FA 1BQPA 1NLSA 1OOPA 4Q0SA 1GMMA 1W06A 4NIHA 1MZFA 5FXWA 3LEMA 2OQ6A 1K5MA 2XJSA 3B69A 4M4RA 1WKYA 1ALYA 4C91A 3DYPA 3J4UH 4EV0A 1IG3A 1Y4WA 5T54A 4PJYA 1XU1A 1CD3G 1PNFA 4N90A 3TN91 1RGSA 4CCMA 4XOGA 2AENA 4TYSA 1GZTA 2JDHA 1PMJX 1WMFA 3NJZA 3ZFFC 1OH4A 3OBTA 3I3DA 3KCCA 3UJOA 1OBNA 1PNGA 3PVNA 4UFKA 2XUEA 3GXUA 4FTSA 4RQPB 3K75B 4YARA 5K0UA 1PO11 4FPGA 1LULA 5FPLA 1BEV1 1OKOA 2VR4A 4LITA 2YC4A 2E7AA 5A33B 1QJU3 2ERFA 3HBKA 2RVAA 4XIKA 1RIRA 1DLCA 1JMUB 1W6OA 4AL9A 4FI9A 1VMHA 2QQOA 3ZYIB 3CJXA 5FMOL 3A21A 4GKYA 4YZ3A 2GP5A 4Y24A 4QGLA 1RUJ1 2Y34A 1DZQA 1GU3A 3LGRA 4ZS3A 4AGVA 2QQLA 4BB3A 2VUCA 4QKBA 5FZAA 2JICA 4HZFA 2VVDA 4A45A 1HJFA 1H8TA 4FFGA 1G86A 2F4LA 1AR61 1LU2A 2CV6A 1HB1A 2ZMKA 4CP9B 1PX4A 4KBBA 5L7OC 5J48A 3CQOA 5FMOS 4D7SA 4LNVA 3UJQA 3FZ3A 2DUPA 3DKQA 1UZWA 2BOIA 4TTGA 1BXHA 1F35A 1O4TA 1US2A 2WA3A 4I30A 4ZONA 4FAGA 2FMYA 5C8WA 3TN92 3RI8A 1XNDA 1NG0A 1WLTA 2BTVC 3PU8A 4TLGA 4IUGA 3X29B 1JU3A 4IEUA 4JRAA 4P5YA 3WQ7A 5F1RA 5FPZA 4E2QA 1Z7S1 2VZ3A 5DAVA 2VVEA 5FZ3A 1W9SA 2RJLA 1QIQA 2JDUA 1X8EA 4L8QA 3OPTA 4RR3C 3O1OA 5L19A 3AXDA 1R1A2 5T3NA 4EJRA 2YFUA 5JOWA 1RUNA 1SPPA 4YM1A 1CPNA 2XJVA 3M8LA 4GJZA 4IEQA 4E4SA 1EAH3 3FUOA 4CEWA 1TMF3 4G3YC 3THDA 5JUVA 1C3HA 2JIGA 3VLBB 3M3IA 5DAXA 1CN1A 2DTYA 1G9FA 1GQPA 1RUI2 4PF1A 4UFHA 1HXS1 2VVFA 3FBMA 4QX8A 2UWCA 5A70A 5BNNB 5IK4A 2J42A 3WHUA 3DUIA 2PQQA 1V9U3 4QB1A 3GF6A 5G05L 3QACA 4OHWA 4UFIA 2XL9A 3I4IA 3PURA 2AZ5A 5DZGA 3IB3A 1QJFA 2ARBA 2D5FA 3KVAA 3R4DB 3WP6A 1UY2A 2GZWA 5IAVA 5FYTA 2VUJA 1QJY2 2YDEA 3R6SA 1CQ9A 1O7FA 5LA2A 3GJAA 1AR73 2JB4A 3MW3A 3ILFA 1XNCA 2ZJCA 5TSWA 1CZVA 1E57A 2N7GA 4MGTA 1A6CA 4RS5B 2B46X 1AR63 3WR0A 5G04L 2WNVB 3E6BA 1G9AA 4ITCA 2WS91 3VBHB 3WG3A 4Z1VA 1L7QA 2UWAA 4BQXA 3ZXKA 2JG8B 1NX9A 3NV3A 1AR81 1NQDA 1TE1B 2BP6A 3BGAA 4LBMA 2AUYA 5FYIA 1UX6A 3THCA 1BVP1 4NPLA 3VBSC 3ZFEA 4EN8B 4PIXA 3HR9A 5LEJA 1KJRA 1DU3D 1IS4A 2HJIA 4A6SA 5H9RA 4EE2A 5AC91 2ZPXA 1UOFA 1MACA 1W0OA 2JG8C 3O0VA 4NHMA 4ZXEA 5JXHA 3B01A 4UI9L 2PA7A 2OZ6A 3B9IA 3BIEA 4UWDA 4A42A 2PFWA 1ZA4A 1ZZ8A 1R081 4XXAA 3URFA 4IESA 4PF5A 3TEWA 3OYWA 3T08A 3OYWB 2DCKA 4GMP3 1JZ7A 2W2IA 2YYOA 4DXSA 2RMU3 4LR4A 4UF0B 3VHPA 4ES9A 2VCMA 2VMFA 4AEJA 4ZXKA 1F9KA 3NWKA 2QBXA 4AQTA 4UAPA 4PHZA 5CNAA 1E5SA 2ZGPA 3SQOA 3VBFB 4WV8A 5L7OA 4NAOA 2EXHA 4OUMA 4WVMB 1MZ6A 4CUBA 5CKMA 3KGZA 2RJ2A 4EN9B 5FUPA 5GLTA 2XL7A 4HMZA 4HXCA 3AJYA 3RPQA 4EYUA 5BV6A 2VCCA 4HFSA 3RZZA 3B00A 3VHRA 3V0BA 4R9CA 1AJKA 1R1A3 3MIHA 2IWGB 2BUKA 2O1QA 2Z79A 1W8HA 3B7MA 2H0BA 5C5TA 1W6NB 1PGSA 5FYZA 3AKPA 3BOWA 4YVWB 1V6JA 3JCIA 2VULA 3ALQA 4CCJA 3AJZA 4P9YA 3AYCA 1XYPA 3FJSA 2YY1A 1TNRA 1W6MB 1ND2B 2EIEA 2QDNA 1AX1A 2PHXA 4NRMA 5EZWA 1G6NA 3WCRA 2XGXA 5FOJB 3MBWA 4JKLA 1LR5A 3AMMA 1IKPA 2GH2A 5FO9B 1AZDA 3FLPA 3ZYRA 5CB7A 3UK9A 3AVRA 1DQ6A 1LTEA 1GICA 4QPGC 1N3QA 4CEYB 2BBAA 2LTNA 4FTEA 1PIV3 5FXXA 4YW4A 1MS0A 2C1FA 5I0RA 4JGYA 1TZOA 4KQ7A 2HWC2 5F5QA 4N43A 5JXGA 4HSJA 1ZZ9A 4YYOA 3KLSA 1IOAA 5FXZA 3M1HA 2FBEA 2VMEA 2R042 2OUHA 3LPGA 5FPAA 3S30A 5C7GA 1C8M3 3SHRA 1AXKA 2G4IA 4GMP1 4WM7A 2Z42A 4CU7A 5BYNA 4XAEA 5I91A 3WNKA 5I0UA 1RUC3 1W0PA 1SPPB 3GALA 3HJRA 2YC0A 4IGPA 1IZ3A 1W2AX 1WGPA 2GSYA 1W6NA 3AXEA 3KMHA 2IUWA 4QDRA 2A6YA 4HT1T 4HOOA 4CUAA 3UKTA 3WNPA 1APNA 4FPCA 1ZNPA 3S7IA 4QD2A 5A7WA 4XQWA 3ZM8A 4PT6A 2GMEA 2KR2A 5HV4A 1XRUA 2XHNA 1YFWA 3LSDA 1SG3A 2EICA 3VDDC 4O65A 2ZGLA 1YJKA 2WLQA 1UL9A 3WT3A 1YQ2A 5FY4A 4XFHA 4AFMA 4Q4Y3 3DEMA 3RI9A 4OYUA 4QX0A 2Z2SB 5E89A 4PLMA 1F4HA 4CCCA 4Q8LA 5JZGA 3KV5A 1UWWA 4UT5A 2Q8CA 1IQAA 3AP6A 4OHXA 4Y4RA 1J83A 1POQA 1W8WA 4JX0A 4RQPC 1XPWA 5CFDA 4JV4A 1NY71 4RR3B 1MEC2 4FOVA 1OT5A 2QQIA 4MSVA 2JDMA 3SCHA 4N53B 1O91A 1FV2A 3OGVA 4HPKB 5FK7A 3SKVA 3J8F1 5FAXA 5F3CA 1PHMA 2VAUA 3ZYHA 5IT6A 4C90A 2RDSA 3VBRC 5IVVA 1B35B 2XLAA 3PUSA 1WZXA 5EIYB 3I49A 4GD4A 1RUOA 4H7MA 5BNOA 5KBFA 1OQEA 4NWWA 1UD1A 2P5BA 3IAQA 4HKLA 1JH5A 1W8ZA 4YZ4A 3U4SA 5I8SA 5FZIA 3WVJA 5C3PA 1GSLA 1R64A 1ULOA 4IERA 2I07B 3POGA 3POYA 2CWMA 4CDQB 1C8NA 3OBAA 3ZXGA 1UAIA 2WNUA 2ZBJA 1AR93 4PBPA 1LHWA 2F6BA 2XDVA 4A41A 2BVBA 2DUOA 2YMZA 2A6XA 3DXUA 4W50A 2GNTA 3SLIA 1V00A 1KRIA 3HD8B 4AK3A 1RUF2 1POV3 4KGQA 1COV1 3RZJA 3VKLA 4YZ5A 5L36A 1AJOA 3KWVA 2GU9A 4EN7B 4YZ1A 4HKWA 1RUG3 1LHUA 5A1FA 1RUI3 5B4XA 5HV0A 5DZFA 4XHXA 4KGGA 4OCTA 1RUH2 2DYCA 4CPBD 1URXA 2A6VA 4I0AA 1JI6A 5FMCA 3C7FA 3RZLA 1S0BA 3MZHA 1D4M2 1QWRA 5CKQA 2R071 4QPGB 1UX7A 3VBSB 1AL23 3HMYA 4DY5A 2VE1A 1COV2 3OTFA 3K4DA 3W5NA 2ORXA 3OSDA 1S0IA 3IIAA 3L9JT 1NCRA 3ZXFA 2DFCA 5CFDB 3WF2A 3UNPA 4ZU5A 1V70A 1SDWA 2JX9A 1UY3A 1WUVA 1L7LA 3IKWA 3E6CC 2CY6A 1N3OA 3LIHA 2E9QA 2A6WA 1BLZA 1W6PB 3KM5A 4QXKA 2Q8DA 3KB5A 2R041 2WNEA 2MHFA 3TNQA 4YVSB 3U4XA 2E26A 4P00B 1OQDA 2LROA 5CISA 4Q4X1 4LPLA 2DCJA 2WSUA 2ZTNA 1LEDA 3AL6A 5EJZB 5DUWA 2DVBA 4RFRB 4Y1XA 4IV1C 3SH5A 4XTMA 1VLNA 1WLCA 3F2ZA 1RUG1 4BOWA 1CWPA 2P37A 5DG2A 3WUDA 3KV6A 2DURA 2IXLA 5F5IA 1US3A 2NQYA 2ZXQA 3I2DA 5CG9A 3LB9A 4TXWA 4B8EA 2DVGA 3GBWA 1HIXA 4ZY9A 2C0ZA 4MOAA 3NV2A 1W2OA 3WP4A 5FMBA 1VE0A 3K48A 1NOVA 2Q0AA 2HEVF 2JKBA 4B29A 4Y5SA 1SCSA 2BGCA 2OVUA 2VO5A 3E5UA 5GJ6A 5JR2A 2BBVA 1OVSA 4LBNA 4W65A 3GNEA 5KWRA 1PVC3 4QPIB 3AMPA 5IK8A 2FCVA 2VJXA 1W03A 4NRQA 2WC2A 3MPPG 4QWNA 5FY7A 1JBCA 2E32A 4HBNA 4ES8A 4CDUB 3AP9A 2CL2A 1XNKA 5EHDA 5AVAA 4BXSV 5F3GA 2RS51 4GMP0 5HCBA 5KXDA 1O59A 1YIFA 1CR7A 1OF4A 3I2KA 5JOZA 4KWKA 1WLWA 3A4UA 4FXGB 5AVPA 1R1ZA 1FNYA 5T5PA 4AG4A 1PGL1 1UF2C 3MI8A 3VZJA 1EPZA 2JG9C 1CJDA 1SFNA 2DWRA 2DDUA 4N7IA 4QHBA 2HEWF 1QQP2 1QDCA 3R0RA 4PDWA 4S2DA 2CSGA 1WD3A 3SCGA 3UKVA 1NA1A 1UN1A 4Q0PA 5FZHA 3NNFA 2R7EB 1V6IA 4H55A 5T52A 4MHRA 4ASMB 4EZ4A 1DLLA 1F5FA 2XJRA 4TSVA 3V0BB 1RYYA 4R9BA 1F5JA 1RVF3 2VTXA 4NRPA 4AWDA 4BMEA 5A3LA 3ZIXA 1MQTC 2ZZJA 1MPXA 1OHFA 1FV3A 2RHPA 4WVVA 4YG6A 3WDYA 1NXMA 3KT1A 5FV3A 2VECA 2E51A 3ROUA 1MZEA 4C1XA 4GWIA 5F6KA 4F8AA 5FZ8A 1N1VA 2K2SA 4LKSA 4RQPA 2WO3A 4QQ2A 1OVPA 1JZ4A 3ZFEB 5JLVA 5LEKA 1UZYA 4XURA 2CDOA 1GP4A 3GCXA 3TEXA 1WA4A 1PO21 1ZBA2 5DUVA 2VXRA 1AVBA 2XLGA 3OUJA 4CCEA 3LIGA 1LHVA 5FYMA 4CPBA 4AI2A 3NV4A 4QQLA 3ZSLA 4CP1A 5BUVA 1OLRA 4SLIA 1PK6C 3WD5A 1HXS2 4UBHA 1CAWA 2WYSA 5FXVA 3VBHA 4BM8A 5E8AA 1GOGA 4YW1A 2WZR1 5FZEA 3VHOA 2HKXA 2AH2A 3AZZA 3CZUA 1HQNA 1SBEA 2WKKA 3UESA 3ES1A 4JGZB 2DUQA 1HDKA 4K40A 3I2JA 4URAA 5BNPC 1GWLA 5C3OA 1WBLA 5IJRA 1SDDB 1R082 2D43A 3DV8A 3FN9A 3N9OA 4D7YA 4Q5OA 5FY9A 4IE7A 1Q8QA 1OFNA 3A0KA 1UW8A 4AI9A 4DUVA 1OOPB 1ZZBA 5FYYA 2O8QA 4FPYA 4KWJA 3I2OA 5FZ0A 3OD4A 4B7EA 1JTZX 2R30A 4JC1A 4LO5B 1ODNA 4CDXA 5FY8A 2ORZA 1SHWB 1GR3A 1VBD1 3CIHA 2AEZA 3U10A 1MQTB 2G19A 2QUOA 4DB5A 4D3WA 2VZ1A 3JZVA 3O12A 4R52A 3OF1A 1K5JA 2XVKA 1YWKA 2RR13 3GZUC 4XFIA 2J1EA 5GZCA 3ZXLA 3NJVA 4IE0A 3T1LA 3MO4A 3SNMA 1WCDJ 2XVLA 5CKNA 3I59B 3O1UA 5T5JA 3RMYA 3OUHA 2DCYA 3VD3A 4AOCA 5JCTA 3ZYPA 2PQSA 4L9BA 1ASJ2 3CO2A 4CCLA 3VKFC 1H6YA 5C8CB 3JQXA 4CSWA 5A3WA 4R9DA 5E16A 3UT0A 3BTZA 1K12A 2YBSA 3MDPA 3T2TA 4B4QA 2WR9A 1GLHA 4AHWA 2RJKA 5J7MA 2GP3A 4XYXA 4B1MA 4YW7A 3POBA 4MG2A 3VZLA 1LESA 2ILMA 5FTTC 4Z92B 1UQXA 1DP0A 2Q5TA 5JAXA 3MIEA 2JWPA 2BERA 3WDTA 1HRI1 1W2NA 1W2TA 3CMGA 1CGPA 1POV0 5ISLA 4BH9A 1VBA1 1WMDA 3W21A 2OYZA 1MQTA 4LIVA 5IK7A 5J37A 3C7GA 2JENA 4K7JA 2XHKA 1XYNA 3WNLA 1CAVA 2XJPA 2R0FA 1ZVFA 3LOIA 2BOJA 3DCQA 4CCOA 1IPSA 1JZ3A 1SQ4A 4NN0A 4MUVA 4Q0QA 3VKOA 1H8TB 1H4HA 2VOTA 5A3OA 5FYCA 4IEYA 1DZRA 5BNOB 2RDQA 1IQDC 5DQ0A 1AYN1 4A44A 2DU0A 2YPDA 4IE6A 1C5HA 4OZXA 5C3SA 2VTFA 2UY8A 3HEIA 2ZGKA 2VW0A 3BN6A 1ND2A 1X8MA 2UURA 4ONUA 1VAVA 4NE9A 1W6OB 1BEV3 4N43B 2W1UA 4QQHA 3T2PA 3OY8A 3N9PA 1HXS3 1UU6A 2Y8KA 4LBOA 4COZA 1XYOA 1IPJA 5FRAA 1CPMA 1ULPA 1WCKA 4RHV1 1PK6B 4D6SA 1M06G 4HN0A 1RL3A 3QBQA 5C8CC 2OA2A 4N43C 3HNMA 1QOSA 4YLZA 5F3EA 4A6OA 1PGL2 3OY8B 2P1BA 1DQ4A 5D21A 5A32A 4YVSC 4LO7A 3ME2A 4P14A 4LBLA 5FYUA 4JVAA 5FZ7A 5HXMA 5LBEA 5IVBA 1RUJ2 3HNBM 1GANA 2P3IA 1Q8VA 2GH8A 1QNWA 5FO7B 5L73A 3TWIA 4XJ8A 3N9LA 1W9TA 1PGW1 2WJSA 5DUXA 1WLDA 4E4ZA 2Y6GA 2RS11 5FYSA 4O61A 1BEV2 4LKEA 1UU4A 4Z07A 4MGSA 1RITA 4UF0A 1ND3B 2W87A 3ZFGA 1OA3A 1DHKB 5FBZA 4R8HA 2P34A 5DN2A 4HG6B 1ZBA1 3J26N 1PO22 3I7DA 4LBQD 1VBD2 2W08A 3SEPA 3DGTA 1G9BA 2W1WA 3TEYA 5BNOC 1JODA 1U5YA 4P9LA 1IKQA 1QH6A 1UOGA 1UZZA 3LOBA 1UYYA 4QB2A 2JJ6A 2VMGA 5SV5A 3VDCA 1DQ2A 1NCQA 4QPIC 3C7OA 4CXXA 4XQDA 5EJ1B 2YB7A 4U36A 2WT2A 1SLLA 5D2AA 1RXGA 5I8TA 2JDAA 3WW2A 3GM8A 3GBGA 5KHKA 1V6LA 3BTYA 5BNPA 2VBPA 1W3VA 4XZUG 1LECA 2VZPA 3OJBA 4OHZA 2VH9A 1RUE3 1VMJA 1HN0A 3BTAA 3O1TA 5I0SA 4N7UA 5D8AA 3LDRA 1QJZA 1BZWA 1TNFA 5T50A 1JYVA 3V64A 2Z4FA 3I97A 3IBMA 2ZX2A 3JD72 4HK8A 4CDXC 4E27A 3O5SA 2ID4A 4K8FA 2ARAA 5E6HA 3H8UA 1KDMA 2YXSA 2WN3A 3OBRA 5EWSA 1HRV3 2VBBA 1ENRA 2DVFA 2W1QA 3GHMA 1DDLA 1DQ0A 3H3LA 2A5ZA 4DMIA 4HONA 2VNRA 1I5PA 2XMLA 2OKXA 4LO6B 2C26A 2A6ZA 2JD4A 3I8TA 3QCWA 5DMYA 4BLIA 1FPN3 4BMBA 3G7DA 1C1FA 1F31A 2QQJA 4DRVA 3RSJA 1PZ7A 2LUWA 3WEZA 2PHUA 3N9NA 1HV1A 1SFYA 3ZXJA 5FZKA 5JIAA 4ZZ8A 4BU2A 4CZSA 1H1IA 1T2XA 3C7EA 3FE5A 4OI4A 5I0DA 4UW5A 1W6QA 1V6NA 3ABZA 4HVOA 4O7XA 4F7ZA 3VKMA 2MEV3 1OLMA 3MYXA 3ORJA 1CAWB 5FCCA 3TB0A 3RYPA 1W0NA 1ULGA 4QAWA 3ZMOA 4HK9A 4LUMA 3SXWA 2VZSA 4JRLA 5EP9A 5F6LB 4A3XA 3KHBA 4KI5M 2VQUA 2D6PA 2AACA 1PZ8A 2QQWA 2ZEWA 3OG2A 1ASJ3 3Q9OA 5E1RA 3DF0A 3KCXA 1LOEA 2I74A 3BPZA 1UMZA 1MS3A 3N35A 2HWE3 1B35C 4XUOA 2BVVA 2VQTA 5FLIA 3N7MA 3E5QA 4XUPA 2JIJA 5IVYA 1BBT1 2E31A 1JHJA 3MLKA 4CTEA 5L9BA 1NLRA 1V9U2 4NVPA 3RZKA 2VOVA 1W9WA 2OW4A 1SLIA 1EV11 4CUCA 1UMIA 3POSA 1ND3A 4AVTA 3OOXA 5FZBA 5JMOA 3MLJA 3RJRA 4P5HA 5FZ4A 5DDJ2 4R4ZA 1XE8A 2ZKNA 1POV1 2FMDA 3M3QA 3Q8FA 4MGIE 4BK4A 2W95A 1WW4A 2XQXA 4IEVA 5JOYA 3H9AA 1O4YA 1W8FA 1YQ6A 2R6QA 1LOCA 1FXZA 3GYDA 3KV4A 4JKMA 1AR91 4ATEA 2ZX4A 3HN3A 3NKTA 3MV01 3RWKX 1AR72 1W04A 4IQPA 1ZRFA 3PLQA 4A7ZA 3CBNA 4RGKA 3ZKUA 2C4XA 2ZACA 5FP9A 2VL4A 5FDBA 2VW1A 2XWBB 2YV8A 5FP4A 3KVBA 1PM7A 2JG9A 4Z2WA 2XONA 1L3JA 1WW7A 1XC6A 2HH9A 1TME3 1HB3A 2VMCA 3J7NA 4A3ZA 4CXWA 4L99A 3GZTB 3QLQA 1DGLA 2EF6A 3AP5A 1H8TC 3W5MA 3USUB 4CCDA 2AYHA 5LRRA 2JDPA 5BY5A 1YI9A 2RM22 3R4SA 4COWA 1VBD3 2C5DA 2EXJA 3LDBA 4YM0A 3WXPA 2WQZC 5LA1A 4OHYA 2NP0A 3JD73 4AVCA 3I2IA 1LCLA 5HBAA 4XETA 4Q4X2 2E7QA 4I0WB 2CGNA 3FL7A 4LBQA 5FREA 4CU9A 1JYCA 3H42B 1H1AA 4M0NA 3BKZA 4E8CA 1MZ5A 3ETQA 4Q26A 4RL7A 3O7OA 1XE0A 1JOPA 3NL1A 1ZBE3 5APAA 2W46A 4XJZA 2GN7A 3KHCA 4QX5A 2E7TA 4DFSA 3VGIA 4CEWB 2WIIB 1XSRA 4NHLA 1ZRRA 2YZ4A 1LGBA 1AUYA 1FPN1 3G6JB 1VBB2 3RDIA 3WG4A 4AFBA 5IYYA 5KXBA 1BK0A 5JPMB 2ZMLA 1HQLA 3T2QA 3SC7X 3IN9A 3UETA 4AFCA 4A4AA 3LWCA 2HLEA 4PDWB 1LHNA 1W3XA 1CVNA 3BOPA 5CAZA 3MV11 3J8F2 1PMIA 3AVSA 4LK7A 4XXPA 5EFUA 2RM21 2XJUA 3VDDB 1MEC1 4CE8A 4ET7A 5A7SA 1NY72 4XE9A 3AZXA 3WW4A 2VY0A 1SBFA 4FBFA 3ZN6B 4GALA 3RGBA 2PHRA 4HKOA 3OGRA 1RUF1 2HEYF 2LALA 3NW4A 1J3RA 5JI7A 3ZYGA 1JOBA 1C8M1 1ZBE2 2Q1ZB 1SLCA 4GIQA 2ZABA 2X5IB 1O5LA 4COYA 1DQ5A 1AR71 4I2OA 4OHVA 1OD3A 3FWEA 1WA6X 1ONAA 1ZZCA 2KXLA 3CDZB 3LF7A 1JYTA 1V6OA 5K0UB 2NZ9A 4JTOA 2KA3A 1PVXA 2J1AA 4H14A 2XWJB 3ZLIA 4BLJA 2FDFA 3ZFFA 2TEPA 2E33A 1EV13 4Y1ZA 3DPRC 3FLRA 5JR7B 3KQ4B 5FQ0A 1GP5A 2JE8A 3Q8BA 3ZSKA 1NYWA 3AYDA 1WW6A 3RWNA 4X8PA 2EALA 4Y1UA 5JSRA 4F3JA 3UYJA 2VUDA 3JBG3 4OLLA 2R061 5F2WA 4XHBA 2ZA9A 5K4LA 3ELNA 1H2MA 2A75A 1NAEA 3D0JA 2W39A 5FZOA 3M70A 4QXCA 3H8RA 1OKQA 4P9WA 4WM8A 4XF9A 3UGHA 2DCZA 2P2KA 1HN1A 3H7JA 4QKNA 2FDIA 1O3QA 3O1VA 1Y9QA 2QQUA 1JZ8A 4XZPA 4QX3A 3L2HA 3VD5A 4KG8A 2R32A 2VQ0A 4LBJA 5DAQA 5A6XA 4B7KA 1VRH2 2WAOA 4MXWA 1S0EA 4S2FA 3WF4A 1B35A 2KM2A 1Z7S3 2FCUA 2QKDA 2RS32 4Y4YA 4FP2A 2ZMNA 3W58A 5A7OA 3ZX7A 4BWOA 4AHZA 4U2AA 3SH3A 4DO0A 1PVC1 2NMOA 3DL3A 4CDQA 4ATFA 3CNAA 3THPA 1BHGA 1PO13 1S4CA 3OEAA 3V0AA 2IZWA 1GUIA 4LLFA 4XDOA 4AGGA 4CU8A 3MLLA 1RMU2 3BTXA 1W8TA 2VZQA 2VZOA 2XBO3 3DN7A 4F83A 1N1SA 4QPWA 3RVHA 5A3MA 1UO9A 1H2NA 3N7JA 1DZTA 3VBHC 3PNAA 3VB9A 5FWJA 1FMD1 3C7HA 2A1XA 2XUMA 3EYPA 3N9QA 5K8SA 2RMU2 5ACA2 3M3CA 3K4ZA 4N53A 2SLIA 3HQXA 5H9PA 4K20A 4CP2A 4CVUA 3PIGA 4GB32 4CEWC 5DXDA 2D6MA 2UYBA 2LRPA 3POFA 3V0AB 4W8JA 2B42B 2JD9A 2PHFA 3PVEA 2CGPA 2HWE1 2FHRA 2XVGA 3ZDVA 3LQCA 1P8JA 1WBFA 4L0PA 4FQ4A 3WHTA 5HCFA 3ZSMA 4AYUA 2Y6JA 3LA3A 3OEBA 5FZDA 1J3PA 1N1YA 2PLV2 4Q1RA 4QT6A 3CF6E 3RNSA 5FZCA 2B5HA 4WM7B 2WZ8A 3AZVA 3WNNA 1NE4A 1LKNA 1NA1B 1R1A1 2DF7A 2R063 2ZGUA 3ZYBA 4UW6A 2G1MA 2VOKA 5H9QA 4Z2AA 4CDUA 1A8MA 3K3OA 1LNSA 1XXNA 2HWD3 2WO2A 3R05A 3WZ1A 3T0BA 2DBIA 1EUTA 1LHOA 3ATGA 5FKCA 2JECA 1NCQC 1I3HA 2H0VA 4NAMA 2VD7A 3PUHA 4JKKA 4O9GA 2OZJA 4XW3A 5FZOB 3RFRA 3T0DA 2ARXA 1DYOA 3H8XA 4Q2FA 3NAPB 1UOBA 1OC1A 3LFIA 4CCKA 2A3WA 5C70A 2XJTA 4XDPA 4KMQA 2MEV2 1A8DA 2VMHA 4AEDB 4XQ4A 2D97A 1TEIA 5ABJA 1YNAA 3JBG2 4NUBA 4WM8B 1W6MA 3AX4A 2WQ8A 3EHKA 3ZN4A 4JDOA 1UZVA 4JGYB 3ZFEC 5LWBA 2FDGA 5F7UA 4OVEA 2IFRA 1LOFA 2ZGNA 4AEDC 3HWJA 1TQ5A 2XB6C 3H7YA 5JDBA 1D2SA 1Z78A 4JAAA 2QQPA 2W92A 3WLUA 4K9SA 4UYBA 1O3RA 2OX0A 1DGWX 4YGCA 3CHXA 2D44A 5GZGA 4M3CA 2WUHA 3BALA 4LE3A 1GV9A 1D0HA 3B94A 1I5ZA 3MEPA 1GYKA 4LK6A 1ZREA 4H3WA 3SKJE 3IWZA 4LKFA 1S0GA 4ISQA 3JQWA 4KWLA 3VL8A 2W91A 2QDRA 2XKPA 5FUNA 4CCNA 1K42A 3KCYA 4M3CE 1WMXA 2V73A 4QQOA 3T3YA 4V1PA 4A7KA 1XJAA 4WVZA 1RUI1 2QQMA 4IL7A 4LA2A 4OULA 3VBFA 3O1RA 3NNJA 4XUQA 1YCIA 4AVBA 3BU0A 2RV9A 3FFQA 3J8F3 4RS5C 4YPJA 1VBE2 2TBVA 3N36A 4NOTA 1VBC1 1KITA 3VD4A 3ZIWA 1R092 2J1VA 1RUD1 1BK1A 1W6PA 4IGOA 4ZPIA 3AFKA 4K8RB 3BIWE 3KD4A 3ZYJB 5EJ3A 4D0QA 1IGOA 4H7LA 3SISA 1WD4A 4CP9A 2A7AA 1TME2 2Y60A 2EAAA 2AREA 1X33A 3UV9A 2HWB1 4DQAA 1H2LA 1H4GA 1BMV2 1SLAA 4LO8A 2G9FA 2EAKA 2RS13 5FWEA 2GC2A 3A7QA 1QJY1 2BYVE 3LEKA 4RFT0 3WCSA 1TME1 1YRZA 1NE6A 3E97A 2BPA2 1HRI2 2PHTA 5CFDC 1AXZA 2GNBA 4O9EA 4FTBA 4BHPA 1FNZA 2YU1A 4UFJA 5F39A 4XCBA 1NT0A 2OPKA 2MNGA 1UOJA 4AVVA 1RUD2 5A33A 5JSPA 3H1YA 4RS5A 2E63A 2LM3A 2O8OA 2X10A 3WDUA 1VBC2 1IHMA 1E5IA 2WA4A 2ET1A 3SITA 1BCXA 2CDPA 3O1SA 4Z82A 3N3HA 4XUNA 3S5QA 4NR1A 2B9UA 4M3CF 5A3TA 1Q8PA 4N8MA 4XF1A 4P9IA 4FPEA 4QGNA 4XEZA 3T2OA 5CADA 5CEHA 3D3AA 3S7EA 3VN4A 4DUXA 4HVRA 2QCSB 5KXEA 3H0OA 3PTYA 5C3QA 2HWD2 4PI2A 2NLRA 1REDA 4COVA 1BVVA 4E4HA 3WY6A 1F15A 4AEMA 1YUDA 3LA7A 2D93A 3PVBB 3VDBA 1JYWA 1YC61 2RE9A 5FIXA 2WDBA 3CJIB 1NCQB 4FFIA 5K9YA 3GDBA 2EIDA 3T30A 3VD9A 3WG2A 5I8YA 1O8PA 4K1YA 1VB2A 5J09A 4R9AA 3LA2A 4GJYA 3VDAA 5D1IA 4KNCA 2Y26A 3A23A 4IXLA 5JZGB 4I3GA 2WSVA 1IG0A 1S0CA 3AC0A 3KT4A 1FOD3 4LORA 2GAUA 4DOUA 4CRQA 1UMHA 4XILA 2MEV1 3SCFA 1K45A 1QXPA 1VBA3 3VD7A 5HI0A 1AR62 2YU2A 3KV9A 4G4FA 2V5DA 3JU9A 2YGMA 5CA6A 4HPKA 5FR3A 4OI2A 2DCTA 1HB2A 3KS7A 3D0SA 2Y6KA 3OB8A 2B8MA 1QOTA 1YXWA 2DVAA 5C6CA 2WZR2 4XFFA 4FPOB 4BIOA 4CDUC 2IXIA 1GOFA 1J1LA 1HKDA 4LIUA 4A7YA 2BU9A 3I3QA 5T5LA 1W99A 4JQTA 1CAXA 4QX7A 3THTA 4ASLA 1U12A 4BZ4A 2P3YA 3CEWA 5B2GB 4GH4A 2WWJA 4B4PA 3T4HB 1XNBA 2VW2A 1GFF2 2D3RA 3IDAA 2GNDA 2XR4A 3DPRA 4CYDA 3MUZ1 3K2OA 1PO12 2PLV1 1D4VB 1VP6A 3GGLA 4AI8A 2XBO1 1AR83 2RDRA 2XKOA 4QGMA 1OUXA 4CDWC 4Q8KA 1V6KA 2GALA 3EO6A 1W9FA 3ZSJA 5IVEA 1EAH2 2ZHKA 2HWE2 5CFCA 3IMMA 4BYYA 1FT9A 4P9JA 1YIPA 4GB31 2V4AA 1UYXA 3LD8A 2WZR3 3JB4C 4Y22A 2XJQA 5CBLA 3R4UA 1W39A 4YRDA 4Q0UA 1S2KA 2GDFA 3AYAA 5A3PA 3TEZA 1SFPA 2P6HA 1EYBA 2V09A 3GHNA 4AVAA 1DGRA 1F4AA 1W2UA 4JTNA 4M0HA 5FPBA 3VBOC 4Y1VA 4LHLA 2RR12 2Y6HA 3KF3A 1RMU1 2DU1A 1ST8A 1QJX3 1QQP1 1OA2A 2D6LX 3PUIA 3ZMNA 2YUEA 1AL21 1K5MB 4BQ4A 3SH4A 4DUWA 5DPNA 1U5ZA 3W20A 5KHGA 1SACA 2WFF2 2V4VA 3MIBA 5CG8A 5KR7A 1HJGA 2VBDA 3AZWA 4Y1YA 4NIGA 4YVWA 1W28A 2RS53 5A1AA 3RQ0A 1QGLA 1UYPA 3OCPA 3HAGA 1TVGA 1Y3TA 3HT2A 4AI0A 4QKFA 1OFSA 1UIJA 3N7KA 3DPRB 1N1TA 3RZHA 3F95A 3OBZA 5F8PA 3WF1A 1NUKA 5LK7B 2FCTA 1CZTA 4Q4Y2 4XJAA 5FLHA 4E9KA 4WVMA 4MVTA 2GC0A 3MICA 1FYUA 2K0GA 2PAEA 4JGZC 3O0XA 1PIV2 3HIFA 2VCAA 1A34A 4PQQA 2BNNA 2C9KA 1WMEA 4FFHA 1YQCA 2NMNA 3RZGA 2XG3A 1UPSA 2VCBA 2BFUL 2WABA 2Z69A 3IZOA 3S57A 1GZWA 2IC1A 4MHUA 1H2KA 4ISRA 4HETA 2DVDA 5FY5A 1DIWA 4LOTA 4RN5A 5JXIA 5IVJA 5H9SA 5C71A 2YROA 1QJX1 1QQP3 1KS4A 3IAPA 4DIQA 1D7PM 2J1SA 4MV2A 5EXOA 1RUC2 5FP8A 4AFDA 4CU6A 2FDKA 2AGSA 1RUJ3 4Y33A 3WNMA 4MO3M 3CL1A 4FSJA 2ZGOA 3N9MA 2WZPP 1KJLA 2B9VA 5F32A 3K77A 3CLPA 1HB4A 1ULFA 4AI3A 1BBT3 4GWNA 3VZOA 1C8M2 1ZBE1 4AE2A 2ARCA 1H6XA 2WNVA 4QX1A 1V0AA 1W6QB 3VKNA 4ORFA 3K46A 5JSOA 1LENA 1UYZA 4ARYA 1SZBA 1VALA 2ZX0A 4IEPA 5CYYA 5FKBA 5F37A 2C6SA 4JHZA 2XOMA 4XBQA 1QXJA 1VBE3 2YC2A 5A80A 5BNQA 3PUAA 1TMF1 2EXIA 3BU7A 1O3TA 2NPIA 2D6KA 2WFPA 4AAXA 1HLCA
chains in the Genus database with same CATH topology
2AR6A 4W6YA 2PN5A 4C1WA 1FMD3 2JG8A 3BCWA 2RM23 5C4WC 3ZPYA 1Y7BA 4Z8BA 1JN2P 2CGOA 4FVVA 1C1LA 2JG9B 1U5IA 3OGGA 1D4M1 1D4M3 4Q4W3 4LEJA 2BW8A 2QZ2A 1RUH1 3ILNA 4RD7A 4XFBA 4M00A 4XJ9A 5DDJ3 2PLV3 3IDEA 1FOD1 3P3PA 1ULDA 3FBYA 5GZFA 4I0BA 1AYM1 2BEOA 1F8VA 4FQZA 2ZX3A 4Q0VA 3E5XA 3RYRA 1RHI2 4AGRA 1CJPA 2X5IA 5JIUA 3PJQA 2WQ4A 4HLTA 4XBNA 4AW7A 3H50A 4K1ZA 1DYKA 5HCAA 5KC6A 2BQPA 1J1TA 4EWEA 1JW6A 4QMAA 3NV1A 1OI6A 5C9AA 3QH7A 2Z5WA 5FOBB 1UU5A 4JDNA 4XF4A 3VBOA 2E6VA 3M3EA 4XIOA 1S0DA 2GMPA 1REFA 2Q4SA 1C4RA 4N9HA 2VGDA 1UPIA 1NQJA 3WQ0A 3ENRA 3U0ZA 2NYYA 1RB8G 1XQNA 4GKXA 5E88A 3UL2A 3J9SA 2PHWA 3M2MA 5CVRA 1QMJA 3USSA 2R073 3W59A 4Q4Y1 4QPIA 1RUF3 1VAMA 4R4XA 1V9U1 1YYNA 3C2UA 4N9IA 4WBBA 4YNIA 4NO4A 3FC0A 4XDQA 2O0OA 3AKQA 4Q4W1 5AFBA 3S6PA 3LSEA 2D6OX 2BFUS 2CYFA 5GKAC 3VBUA 2XLFA 1LGCA 4K3UA 4NPRA 1GNZA 3LCPA 3O0WA 4KG0A 1AL22 3AP7A 1S0FA 1XU2A 3AKRA 5GLVA 3VL9A 1H9WA 4EWDA 1R093 2C9AA 4LHKA 1ND2C 2X53S 1RUD3 1AYM2 1DBNA 3WQ1A 4EN6B 2F4PA 1GNHA 1MS9A 4DPNA 4FPFA 2CNAA 2YGLA 5K0UC 4X6RB 4PCRA 2GC1A 3OPZA 2EXKA 4S2HA 5EYYA 2VMIA 4MGZE 4DRRA 3HT1A 4FXKB 4QPYA 2ZKLA 1SBDA 5DG1A 1RJ8A 4LLOA 5IK5A 1CAXB 3AZYA 2VU9A 5JMCA 3GBFA 1IS6A 3WINE 2ZGMA 1G7YA 1LODA 2EVXA 2XBO2 1PO23 2Y38A 1VBC3 1QHDA 4QPGA 4TWTA 2A3XA 4DINB 4OI0A 4IV3A 1SMVA 3IM0A 2BNMA 3UKNA 2Y0OA 4YVWC 1QF3A 4MXWB 5FO8B 5KXCA 1QJU1 1JUIA 1VBB3 3WNXA 3U07A 2QVSB 4B3NA 1ULEA 3TOJA 1OMIA 3B9CA 1I6XA 1LOGA 4PLNA 1HW5A 5T55A 4XF3A 2ZGQA 2B7YA 4W6WA 3ZXAC 2ETEA 3AP4A 4UW3A 5JZGC 4LA3A 4LULA 3D8CA 5J98B 4CEYA 2HWC3 4Q4V1 3T1MA 1OPOA 1QJX2 3AKSA 4DY3A 4META 4MLOA 2MPFA 2W0XA 2WFF3 5ABJC 5GZDA 3NKGA 5I93A 4RHV3 5D8AC 3H3ZA 2IXCA 2UYAA 2X8KA 3M7AA 5CIRA 2OIIA 5GZEA 1ZRCA 1U5XA 3FHIB 3MPBA 1KXGA 2R1DA 3TAYA 2IXJA 4B4RA 5ABJB 2RS12 1MS1A 4LT5A 1IPKA 4XFGA 1GZCA 1Q5OA 1FX5A 1HV0A 1LOAA 4XMAA 2HWF3 1PGW2 1VB4A 2HWD1 1H9PA 4SBVA 2B39A 5FLJA 4Q1PA 3ECQA 2H6BA 3W9AA 1EY2A 3VUOA 3V65A 5AC92 2D6NA 4FPLA 1D2QA 4CDWB 1WCSA 4W6XA 2WS93 1ND3C 1ZM1A 4GXLA 4AXOA 2JE7A 1AR82 3N4MA 4PDWC 4JQRA 4QM9A 2ZS6B 3WDVA 3ZN6A 1BYHA 3EQEA 3VBRA 4MGKE 1Q56A 3ZFGC 5EV7A 3VDDA 2ZHLA 4INDA 4FPKA 1RTVA 3RYKA 3ZFGB 2UY9A 3MIDA 1R083 4XMIA 3INAA 1NCRB 3ZSEA 4DNYA 4L11A 2QE3A 2Y0IA 1EPWA 4N53C 3D82A 3FLTA 1FI2A 4XTPA 4XPVA 1VRH3 1AYN2 2GMMA 1AXYA 3POWA 1DGRN 1X7NA 3QD6A 5C9AC 1QDOA 2W52A 1G9DA 2EA7A 2I2SA 4CEYC 3ZVXA 1DFQA 4M3CB 1G9CA 1C28A 4JCKA 4PQ9A 1VBE1 3VBFC 1VBA2 4KH9A 4FAHA 5C4WB 2CAVA 4GA9A 4MX3A 1S1AA 2ZGTA 3D6EA 4IV1B 3WP5A 1RJ7A 3N7LA 4XF0A 1RUE2 4TZDA 4XFAA 2Q8OA 2B45X 1WW5A 3BODA 1YFXA 1Z7S2 3C3VA 4I3PA 4L92A 2NP0A 5ACA3 4Y5Z0 4IEOA 4Q29A 3H3UA 1OOPC 4KL1A 3WX5A 3TBDA 1KS5A 2YHJA 4Q27A 2HWB2 3USUA 1JOJA 4JGZA 4AVSA 5T5OA 1LRHA 2SBAA 1HRV2 1O4ZA 3L2YA 1AX0A 1RMU3 5AFEA 3JBG1 5I0TA 2WL1A 2WNVC 4HVQA 3VBOB 2CTVA 2R16A 4JDMA 4JGYC 1D0GA 1OPMA 1X82A 4UBGA 3VV1A 1HRV1 2R0HA 5JVVA 3BB6A 1MEC3 2VQAA 3FUQA 3KT7A 3QH6A 1ZX5A 3MFCA 4UXAA 4YGDA 5AC93 4YZ2A 1RVF1 4AHYA 2FZ1A 2VOXA 1Q8OA 1LB2A 1AL0G 1H30A 1I9RA 2ZGRA 1RUE1 2GNMA 4YG3A 2NM1A 4YM2A 2OUJA 2ENRA 3VBRB 4NWVA 1RVF2 3TN93 1A78A 2WT1A 4YFZA 3NVCA 4YG0A 4FPJA 3AMQA 4LBKA 4RGGA 5GM0A 3TRSB 4I09A 2A71A 1X50A 3LKJA 3I59A 1Z0HA 1T6GC 1ULCA 4Q4V2 4ZU7A 2W68A 2R49A 3HN1A 3QOPA 1MS8A 3WV6A 1ZZ6A 4LHNA 2BWAA 3WW3A 1QU0A 5K7PA 1U0AA 1QJU2 1K5MC 1B09A 3A0NA 1BMV1 3VZNA 2R043 3WP3A 4FOWA 2ATFA 3EJKA 4GH4C 2A3YA 3RMXA 4PIZA 5FQ0B 3D5OA 2ZAAA 3B93A 1Q8SA 3O14A 4FOYA 4BPZA 3B3QE 1ENSA 1RC6A 4AHXA 1FATA 1R091 3AMHA 1PVC2 3U11A 1XE7A 1DYPA 3FFZA 5D8AB 3RJ2X 5SV8A 2RS31 2JE9A 5KHHA 4EROA 3EXUA 4FO9A 3M4FA 3AFGA 4DZGA 2K9ZA 4PIYA 3WOGA 1GQGA 1UCXA 4XFCA 4NHKA 3ASIA 1DQ1A 3OGJA 4AEKA 2RMU1 3H1WA 4AFAA 5BNPB 2FZ2A 4RGAA 2RS52 2ZCWA 4M01A 4YSFA 3AYEA 4Y20A 2QFEA 5DUUA 4C0HA 2R062 5L7OB 4BCUA 2ZHMA 1H8VA 2A70A 3WG1A 5CU1A 1AYM3 2GN3A 3TNPB 3K51A 4IV1A 2P3JA 1C5IA 4WVWA 3ZXEA 4I01A 3ZN5A 2ZAHA 1C57A 4LUKA 5GALA 4YVSA 5KHIA 4URTA 2QJVA 1S55A 5C4WA 2P17A 2HWB3 1MS5A 3M3OA 2D3SA 2VUAA 4GH4B 4Y26A 1OD5A 1X36A 2EIGA 1LJ7A 2PHDA 4BIFA 1QOOA 2HYKA 4J1XA 3WUCA 2Q1MA 1PK6A 1RUG2 4X6QB 1JHNA 1QY4A 1MVQA 5BNNC 1RUH3 1H0BA 3LZZA 1QH7A 1LU1A 3IMNA 2IFWA 1VBB1 3CU7A 4E4DX 1JUHA 1FPN2 3H1MA 4UW4A 1CONA 3AKTA 3VBUB 4OUSA 4P9XA 2DV9A 5BPXA 3KSCA 1YFYA 4QQPA 1UIKA 5FFOC 1UKGA 3NO8A 1IS5A 3ZXDA 2G9GA 3RRDA 1EP0A 5ACA1 2PAKA 5LRSA 1KQRA 5BXXA 1FMD2 5J96B 3MW4A 1JYIA 1SLTA 1M4WA 1CAVB 1Q3EA 1OLQA 2R072 1FOD2 1MS4A 2PAMA 1HX6A 4IETA 3APBA 5CFCB 5F9TA 5JI9A 5BNNA 2VNGA 3EBRA 4ZU4A 4XBLA 4XJUA 5C9AB 4D94A 2D5HA 5C8CA 3RS6A 3ZFFB 5FPXA 4YM3A 3PJYA 3B5LB 4RR3A 2HWF2 4Q4W2 1V6MA 2BWCA 3JUUA 4A2UA 4L97A 1AR92 1VRH1 1YLLA 2CWSA 1BJQA 4J6GA 2GC3A 4YGBA 2TNFA 4BQ1A 4PBOA 4KU8A 3MF9A 4MH0E 2WT0A 1F2NA 5DDJ1 4X8NA 3NSTA 1J58A 4HANA 1VJ2A 3IDCB 4IV3C 1EV12 3CJIC 3IPVA 2E53A 1NZCA 2PTMA 1SEFA 4WZFA 3S0MA 5JPNB 1ZZ7A 1CIWA 2JEMA 4C0BA 3MW2A 1YHFA 4OI1A 2D7FA 2UU8A 2QZ3A 1AYN3 1KFXL 1VIWB 4LO4B 4EWAA 3MGUA 4LBQB 1RUC1 3MFAA 5GLZA 4E2GA 1RHI1 3SMHA 4COUA 5J3UA 4PLOA 2VNOA 4Q4X3 3TYJA 1LEMA 3B02A 3FX3A 1JXNA 3ES4A 4GWMA 1S0JA 1OA4A 2PYTA 2VG9A 2ZZQA 1KFUL 1J59A 4WZCA 2ET7A 2WWSA 1SLBA 2ZGSA 2IXHA 1PIV1 4ZKTB 1LOFC 2ES3A 1OQ1A 4EN0A 1HRI3 2ZX1A 2WNUB 1NXD1 4AEDA 3ST7A 2I45A 4K6BA 1QXRA 4D7TA 1CAUB 1BBT2 1MVEA 3IDBB 1ENXA 1O3SA 2QNKA 1OSGA 2HWF1 4WM7C 1VR3A 3MIFA 2WNUC 2UWBA 3PMSA 1CX4A 4HSLA 4S2GA 1QKQA 2JXAA 5JWPA 1GKBA 2WFF1 3HBZA 4FP3A 4D69A 4IV3B 2WLPA 3ZDSA 1LGNA 1COV3 5KC5A 2HWC1 4Q4V3 1QNYA 4MGYE 4BE3A 2X29A 2RR11 3NAPC 1RINA 3IT8A 1GBGA 1LOBA 2IXKA 4TLFA 3JB8A 1YJLA 3ZO0B 4FCAA 3P3NA 4LE4A 5CFCC 1O5UA 4AI1A 4RSUA 4WM8C 3WDXA 1AF9A 4FPHA 5A32B 1FAYA 1HQWA 3GZAA 5DZEA 3VHNA 4KU7A 1NCRC 3WDWA 1AX2A 3I54A 2BNOA 3AM2A 2A73B 1GZ9A 5JOXA 4YFWA 2TUNA 1EAH1 2XPJA 4AF9A 3ILRA 2DFBA 1DGWA 1S2BA 4QU2A 3AK0A 3FMGA 4GULA 1H1MA 1KDKA 4Y20B 1RHI3 2JDZA 3AB0A 4IEZA 3RG0A 3JD71 3NAPA 2ZOEB 1GQHA 5KHJA 3VZKA 1TMF2 4I02A 4FOQA 3MF6A 4OFGA 2XH6A 4CDWA 5EYXA 2DTWA 5GLUA 1Q43A 1Y43B 1DF0A 4HL0A 4GB33 4Y22B 1PZ9A 2YPJA 1MR5A 1N47A 1QJY3 3VBUC 1A3KA 1VAKA 4IEWA 4K21A 2PHLA 4RA0A 4XJWA 5IUQA 1YO8A 4MXVA 3MIGA 4LTAA 1UKRA 4AQ2A 3PHMA 3ACLA 1YI7A 2PELA 3KGLA 5GLWA 4E2SA 4QM8A 4FT8A 2D98A 2D3PA 2VOWA 2WINB 1ENQA 2CAUA 3KQRA 3IPVB 4MYEA 4YW2A 2ZHNA 3E6DA 1CESA 2WS92 2X5IC 4AQ6A 4P9GA 1YFUA 2D40A 2V5YA 2FQPA 2R1BA 2RS33 1AHSA 4J1WA 1ZYBA 4AQSA 3PVOA 1REEA 1BKZA 2H6CA 4DS0A 4BA6A 3D4KA 4G9SB 3V56A 3LAGA 5HXVA 3WW1A 4DXZA 4CDXB 1IS3A 3AMNA 2VPVA 4CDQC 3VBSA 2NN8A 3CJIA 4MZUA 4RHV2 4HN1A 1NA1C 1DG6A 5C33A 3DKWA 2P3KA 5LK5A 1ZBA3 3VZMA 3PMEA 4IEXA 1KD7A 3KZ4C 4GQ7A 4YW3A 1G8WA 2Q30A 3OD0A 1ZRDA 4YW5A 4YGEA 4L2NA 1SCRA 1N3PA 1GZWB 5J36A 1CAUA 4CP0A 1ASJ1 1J3QA 1BQPA 1NLSA 1OOPA 4Q0SA 1MZFA 3B69A 1K5MA 2XJSA 1ALYA 4C91A 3J4UH 4EV0A 5T54A 4PJYA 1XU1A 1CD3G 1PNFA 4N90A 3TN91 1RGSA 4XOGA 2AENA 4TYSA 3NJZA 3ZFFC 1WMFA 3UJOA 3OBTA 3KCCA 1PNGA 3PVNA 4FTSA 4RQPB 4YARA 5K0UA 1PO11 4FPGA 1LULA 1BEV1 2E7AA 5A33B 1QJU3 2ERFA 4XIKA 1RIRA 1W6OA 3ZYIB 3CJXA 5FMOL 4GKYA 4YZ3A 4Y24A 4QGLA 1RUJ1 1DZQA 3LGRA 4AGVA 2JICA 4HZFA 2VVDA 1H8TA 1G86A 1AR61 1LU2A 2CV6A 2ZMKA 4KBBA 5L7OC 5J48A 5FMOS 4D7SA 4LNVA 3UJQA 3FZ3A 2DUPA 1BXHA 1O4TA 2WA3A 4I30A 4FAGA 5C8WA 2FMYA 3TN92 3RI8A 1XNDA 1NG0A 1WLTA 2BTVC 3X29B 4IEUA 4JRAA 3WQ7A 5F1RA 5FPZA 4E2QA 1Z7S1 2VVEA 4RR3C 2RJLA 4L8QA 1X8EA 5L19A 3AXDA 1R1A2 5T3NA 4EJRA 5JOWA 1RUNA 4YM1A 1CPNA 2XJVA 3M8LA 4E4SA 4IEQA 1EAH3 3FUOA 4CEWA 1TMF3 4G3YC 1C3HA 3VLBB 3M3IA 1CN1A 2DTYA 1G9FA 1RUI2 1HXS1 2VVFA 3FBMA 2UWCA 5BNNB 5IK4A 3WHUA 3DUIA 2PQQA 1V9U3 3GF6A 3QACA 4OHWA 2XL9A 3I4IA 2AZ5A 5DZGA 3WP6A 2ARBA 2D5FA 3R4DB 2GZWA 2VUJA 1QJY2 2YDEA 3R6SA 1CQ9A 1O7FA 1AR73 3MW3A 3ILFA 1XNCA 2ZJCA 5TSWA 1E57A 2N7GA 1A6CA 4RS5B 2B46X 1AR63 3WR0A 2WNVB 3E6BA 1G9AA 4ITCA 2WS91 3VBHB 3WG3A 4Z1VA 2UWAA 3ZXKA 2JG8B 3NV3A 1AR81 1NQDA 1TE1B 4LBMA 3VBSC 2AUYA 1UX6A 1BVP1 4EN8B 3ZFEA 4PIXA 3HR9A 5LEJA 1KJRA 1DU3D 1IS4A 2HJIA 5H9RA 5AC91 2ZPXA 3O0VA 1MACA 1W0OA 2JG8C 4NHMA 3B01A 2PA7A 2OZ6A 3B9IA 2PFWA 1ZA4A 1ZZ8A 1R081 4XXAA 3URFA 4IESA 4PF5A 3OYWA 3OYWB 2DCKA 4GMP3 2YYOA 2RMU3 4LR4A 3VHPA 4ES9A 4AEJA 4ZXKA 1F9KA 3NWKA 4AQTA 5CNAA 2ZGPA 3VBFB 4WV8A 5L7OA 2EXHA 4OUMA 4WVMB 1MZ6A 3KGZA 4EN9B 5GLTA 2XL7A 4HMZA 3AJYA 3RPQA 3V0BA 5BV6A 4HFSA 3RZZA 3B00A 3VHRA 4R9CA 1AJKA 1R1A3 3MIHA 2IWGB 2BUKA 2O1QA 2Z79A 3B7MA 2H0BA 1W6NB 1PGSA 3AKPA 3BOWA 4YVWB 1V6JA 3JCIA 2VULA 3ALQA 3AJZA 4P9YA 3AYCA 1XYPA 3FJSA 2YY1A 1TNRA 1W6MB 1ND2B 2QDNA 1AX1A 2PHXA 5EZWA 1G6NA 3WCRA 2XGXA 5FOJB 1LR5A 3AMMA 1IKPA 2GH2A 5FO9B 1AZDA 3FLPA 3ZYRA 5CB7A 3UK9A 1DQ6A 1LTEA 1GICA 4QPGC 1N3QA 4CEYB 2LTNA 4FTEA 1PIV3 4YW4A 1MS0A 2C1FA 5I0RA 4JGYA 4KQ7A 2HWC2 5F5QA 4N43A 4HSJA 1ZZ9A 4YYOA 3KLSA 1IOAA 3M1HA 2FBEA 2R042 2OUHA 3S30A 1C8M3 3SHRA 1AXKA 2G4IA 4GMP1 4WM7A 2Z42A 5BYNA 5I91A 5I0UA 1RUC3 1W0PA 3GALA 2YC0A 1IZ3A 2GSYA 1WGPA 1W6NA 3AXEA 3KMHA 2A6YA 4HT1T 3UKTA 1APNA 4FPCA 1ZNPA 3S7IA 4QD2A 4XQWA 2GMEA 1XRUA 1YFWA 3LSDA 3VDDC 2ZGLA 1YJKA 2WLQA 1UL9A 3WT3A 4AFMA 4XFHA 4Q4Y3 3RI9A 5E89A 2Z2SB 4PLMA 4Q8LA 5JZGA 1IQAA 3AP6A 4OHXA 4RQPC 5CFDA 4JV4A 1NY71 4RR3B 1MEC2 4FOVA 4MSVA 3SCHA 4N53B 1O91A 1FV2A 4HPKB 3J8F1 5FAXA 1PHMA 5IT6A 4C90A 3VBRC 1B35B 2XLAA 1RUOA 4H7MA 5BNOA 5KBFA 1OQEA 4NWWA 1UD1A 4HKLA 1JH5A 4YZ4A 5I8SA 3WVJA 1GSLA 4IERA 2I07B 3POYA 2CWMA 4CDQB 1C8NA 3ZXGA 1UAIA 2WNUA 2ZBJA 1AR93 4PBPA 1LHWA 2F6BA 2BVBA 2DUOA 2YMZA 2A6XA 2GNTA 3SLIA 1V00A 1KRIA 3HD8B 4AK3A 1RUF2 1POV3 4KGQA 1COV1 3VKLA 4YZ5A 5L36A 1AJOA 2GU9A 4EN7B 4YZ1A 4HKWA 1RUG3 1LHUA 1RUI3 5DZFA 4XHXA 4KGGA 1RUH2 2DYCA 1URXA 2A6VA 4I0AA 1S0BA 3MZHA 1D4M2 1QWRA 2R071 4QPGB 3VBSB 1AL23 3HMYA 4DY5A 1COV2 3OTFA 1S0IA 3IIAA 3L9JT 1NCRA 3ZXFA 2DFCA 5CFDB 4ZU5A 1V70A 1SDWA 2JX9A 1WUVA 3IKWA 3E6CC 2CY6A 1N3OA 2E9QA 2A6WA 4QXKA 1W6PB 3KM5A 3KB5A 2R041 2WNEA 2MHFA 3TNQA 4YVSB 3U4XA 1OQDA 4Q4X1 2DCJA 2WSUA 2ZTNA 1LEDA 5DUWA 2DVBA 4Y1XA 4IV1C 3SH5A 4XTMA 1VLNA 1WLCA 1RUG1 4BOWA 2P37A 5DG2A 3WUDA 2DURA 2IXLA 2NQYA 3I2DA 5CG9A 3LB9A 4B8EA 2DVGA 3GBWA 1HIXA 2C0ZA 3NV2A 3WP4A 3K48A 1NOVA 2Q0AA 2HEVF