2IXJA

Rmlc p aeruginosa native
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
184
structure length
184
Chain Sequence
b'SMAMKATRLAIPDVILFEPRVFGDDRGFFFESYNQRAFEEACGHPVSFVQDNHSRSARGVLRGLHYQIRQAQGKLVRATLGEVFDVAVDLRRGSPTFGQWVGERLSAENKRQMWIPAGFAHGFVVLSEYAEFLYKTTDFWAPEHERCIVWNDPELKIDWPLQDAPLLSEKDRQGKAFADADCFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DTDP-4-DEHYDRORHAMNOSE 3,5-EPIMERASE
publication title Rmlc, a C3' and C5' Carbohydrate Epimerase, Appears to Operate Via an Intermediate with an Unusual Twist Boat Conformation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Isomerase
total genus 44
structure length 184
sequence length 184
ec nomenclature ec 5.1.3.13: dTDP-4-dehydrorhamnose 3,5-epimerase.
pdb deposition date 2006-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ixjA00
4NVPA 1PM7A 3H50A 3HT1A 4UXAA 4HZFA 4Z82A 5JAXA 1UIJA 4ZU5A 2C0ZA 1FT9A 1O7FA 1V70A 4HSLA 5JSOA 2OZJA 1CAVA 2EA7A 3MYXA 4I0AA 1YFYA 5LEKA 3IWZA 1DGRA 3U11A 4IEWA 1OMIA 1Q3EA 2EVXA 2XL9A 3CLPA 4LLOA 3U0ZA 3NL1A 1ZZCA 4LULA 4MH0E 1RC6A 1O3SA 3E5UA 5J7MA 4MX3A 4KU8A 5HI0A 3O14A 1CAXB 4O9EA 4XFIA 3NSTA 1UD1A 3I54A 3FWEA 4KWLA 2XHKA 1ZZ7A 2N7GA 3B02A 1WGPA 2B8MA 3CEWA 3CO2A 1YFUA 4E2QA 1TQ5A 1YFXA 4N9HA 3HT2A 2H6CA 4I2OA 3ETQA 4IEZA 2Y0OA 2EAAA 5JSPA 3U10A 4IETA 3RYRA 4HMZA 2BNOA 2IXJA 3H1MA 1FI2A 4IEQA 4PIZA 1CAVB 2FQPA 2IXLA 4JVAA 1U12A 1ZRCA 4O9GA 3TNPB 1DZRA 3M3IA 3KSCA 5CVRA 5FPXA 1ZZ6A 2PHDA 5K8SA 1LB2A 1I5ZA 4I01A 3KCCA 4HVQA 4QXKA 1LKNA 1RGSA 3BALA 3ACLA 5LRRA 3E6CC 2XGXA 3EBRA 4B29A 2IC1A 3S7EA 4I0BA 1O3TA 1YWKA 3FFQA 4HBNA 4FAHA 4R8HA 4UBGA 3GBFA 4KWJA 2PAMA 4EROA 1ZRDA 5FLJA 5FQ0A 1UIKA 2GC0A 2PAKA 4Q0VA 1NZCA 3MPBA 4HSJA 2BEOA 5J48A 4QGNA 4MGYE 3RZZA 3FE5A 4XFGA 5KHKA 5T3NA 3OCPA 4F7ZA 5I0SA 3IDBB 1H1MA 1RUOA 2CAVA 4HN0A 3HIFA 3JZVA 4XF4A 1QXRA 2QJVA 4LUKA 4PIXA 1YUDA 2Q0AA 3OGJA 2HJIA 1J59A 5I8SA 4D7TA 4QM8A 4EWDA 1JUHA 5FPZA 1X82A 4ZU4A 1SFNA 2P17A 5CU1A 4IEOA 3EHKA 4EWEA 1RTVA 4IERA 2B9UA 4I02A 3TNQA 4IESA 2OZ6A 3C3VA 5FQ0B 3RPQA 4ORFA 4N9IA 4FT8A 2OA2A 3BU7A 3LWCA 4QGLA 5FCCA 5KHJA 4L11A 4EWAA 2GC2A 1YHFA 1CAUA 5LEJA 2QCSB 4BH9A 3SCGA 5BY5A 2ATFA 1ZZ8A 3RNSA 1OFNA 2PFWA 1UPIA 1EP0A 4WZCA 1VR3A 5CADA 5JCTA 2I45A 2FMYA 4MGIE 4BIFA 2H0VA 2GAUA 2VECA 5I0TA 3EO6A 3UKTA 4LA3A 4BYYA 3E97A 4D7SA 5I0RA 4AQ6A 2IXCA 1Y3TA 1NXMA 4XF1A 3LA3A 3QOPA 4J1XA 4MGZE 3IIAA 3KGLA 4JTNA 1CAWA 4QMAA 4R52A 2K9ZA 4META 5FLIA 2GH2A 3WW1A 2BGCA 1CAUB 3I59A 4F8AA 3PVBB 5I8YA 2KXLA 3ES4A 3I7DA 1I6XA 4QM9A 2PQQA 3WW3A 4A2UA 3DN7A 4XF9A 3S7IA 2XLFA 2IXIA 3PLQA 1IPKA 4XFCA 3M70A 4XFBA 2GZWA 1ZZBA 4E2SA 2PAEA 1J58A 5BPXA 3WW4A 2XKOA 3KGZA 2UY8A 1VJ2A 2ZKLA 3FJSA 3VHRA 5AVPA 4IEXA 2UYBA 4WBBA 2CV6A 4IEYA 4Z07A 2XLGA 1YFWA 2GC3A 5FLHA 2XL7A 1O5LA 4OLLA 3OTFA 3NVCA 3ZDSA 5I91A 2ET1A 1RUNA 5FDBA 4YYOA 1CAWB 2CGPA 1EYBA 2PHLA 5J3UA 5C6CA 5C8WA 3RYPA 3ELNA 3ES1A 2CAUA 3BB6A 3ROUA 1X8MA 3I59B 3NJZA 3IDCB 1H1IA 4YNIA 3E6DA 3SMHA 1CGPA 4LA2A 3FZ3A 1LRHA 3USSA 4JTOA 1X8EA 2BNNA 4OFGA 4CYDA 1J3QA 1NE6A 1QY4A 1YLLA 4YARA 1J3PA 4X6QB 5BUVA 3N4MA 4WVZA 4X6RB 3LA7A 2BYVE 4BHPA 3SCHA 4HLTA 2D40A 3OD0A 5JR7B 3H7JA 2XLAA 2MNGA 3E5QA 1Q5OA 3KMHA 2D5FA 4I09A 4ONUA 3ST7A 2MHFA 4Q0PA 4MZUA 1UW8A 3EQEA 4HVRA 4JV4A 3UKNA 4HN1A 4KL1A 4LTAA 4P9GA 1L3JA 4XEZA 3CJXA 1WLTA 1DZTA 1SEFA 1O3RA 4IEVA 4H7LA 4DINB 5EZWA 1O5UA 5F1RA 2B5HA 3MDPA 4I3PA 1O3QA 2QDRA 2O1QA 1O4TA 3OF1A 1SQ4A 5LRSA 1ZVFA 5BV6A 2BNMA 2MPFA 1QXJA 5KHGA 3GYDA 1OD5A 4FBFA 4ZU7A 4L2NA 1QWRA 3DV8A 3CF6E 4XFHA 1VP6A 2WFPA 4HVOA 1FXZA 3L2HA 1LR5A 1J3RA 5KHHA 3H8UA 3E5XA 3H1YA 2H6BA 3G7DA 2IXHA 2QNKA 2V09A 2Q1ZB 3SCFA 3FX3A 4PJYA 3LAGA 1XE7A 1ZRRA 3DL3A 4XETA 4XFFA 5BXXA 1Q43A 4AXOA 2QVSB 3D0JA 3EJKA 3LZZA 2UYAA 1WA4A 1XE8A 4E2GA 4MV2A 3NKTA 2ZCWA 5JSRA 2HKXA 3H3UA 1EY2A 2D93A 4KWKA 2XKPA 4Q0SA 4UBHA 2DCTA 2F4PA 2OYZA 1J1LA 1NE4A 1NYWA 3LOIA 2PYTA 4LEJA 4IEUA 2WC2A 3SXWA 4YSFA 1OI6A 3H9AA 2GC1A 2IXKA 1HW5A 2K0GA 1PMIA 1ZRFA 3HQXA 1CX4A 3RDIA 1G6NA 4AVCA 2O8QA 4XF0A 2ET7A 5E16A 5I93A 1RL3A 2PA7A 3QACA 4TLFA 5D1IA 2ETEA 4Q0UA 4AQ2A 2UY9A 5KBFA 2D5HA 2VQAA 4QGMA 3R6SA 4AVBA 3D82A 3H1WA 4Q0QA 1ZREA 2Q30A 3H7YA 3LA2A 3WW2A 2E9QA 3BPZA 1UCXA 2GU9A 3IBMA 4AVAA 4Q29A 3UKVA 1GQGA 1IPJA 4LUMA 4EV0A 4QX5A 3NW4A 4YRDA 3D0SA 3SHRA 4XF3A 5I8TA 5E1RA 4KU7A 4PIYA 2OPKA 3DKWA 3MZHA 2VPVA 1ZZ9A 1DGWA 1EPZA 2Z69A 4RD7A 1X7NA 1Y9QA 5I0UA 3CL1A 1CAXA 4MUVA 3E6BA 2Z2SB 2Q4SA 1GQHA 4MGKE 3H3ZA 1ZNPA 1XRUA 4GULA 3RYKA 3BCWA 4XFAA 3PNAA 1ZX5A 5KHIA 3S0MA 5EFUA 4FAGA 4IEPA 3FHIB 4J1WA 2PTMA 4K8FA
chains in the Genus database with same CATH superfamily
4XZUG 3CBNA 3LCPA 4NVPA 3F95A 3T2TA 1JYCA 3H50A 4XDPA 4BM8A 3KF5A 5GJ6A 2HBUA 3T2QA 4BXSV 3W9AA 1JZ2A 2YDEA 3OGGA 2ZAHA 4GJYA 4GMP3 4B4RA 1KDMA 2C0ZA 1O7FA 2DTWA 3OY8B 4FPOB 2JD4A 1UPSA 1CAVA 2QQNA 1GUIA 2FMDA 3MYXA 3VBFA 1YFYA 2D3SA 4E9KA 4E8CA 2VW1A 3OEAA 3W58A 2FBEA 2VBBA 4IGPA 2IZWA 3AP4A 4GWIA 1C57A 2QZ2A 1W6OB 3U0ZA 3AKPA 2HEWF 1LGCA 1JI6A 1RC6A 3MF9A 1O3SA 4RS5C 1NUKA 1YEWA 1R093 3O1TA 1ND2B 3L2YA 2GN7A 2C5DA 5A7PA 1BBT1 1W2OA 2X10A 1F4AA 1HB1A 2AENA 2QQIA 1UD1A 2X5IC 3FWEA 4KWLA 2VG9A 3VBHB 4CUAA 4YVWB 1F4HA 3EYPA 4Z8BA 1M06G 1ACCA 2CHHA 3GCXA 1DGRN 1YFUA 3KB5A 5FZOB 1YIPA 1KS4A 4AR2A 3MIHA 3VZOA 5CFDB 1AZDA 2Y6LA 1HB3A 4AGVA 2E63A 1QJU2 2FCTA 3MFAA 1VAKA 3ETQA 3MGUA 3N7MA 3ZYJB 3DF0A 5A70A 5HBAA 3U10A 4DIQA 4FCAA 3OYWA 4YVSC 3RYRA 4LK7A 2D6KA 3WG4A 3TN91 1PVC2 1S4CA 2IXJA 3N7LA 5E89A 4P5YA 3IMNA 1IOAA 1B09A 3LB9A 3PMEA 1CAVB 3I2FA 4OCTA 4XUTA 2Q8DA 3ZXGA 4JVAA 2VCCA 3VBFB 3WEZA 2R32A 2VCMA 1H1AA 4O9GA 3ZLIA 1E57A 3N9MA 1F31A 2NP0A 2DBNA 4LO8A 3FLPA 1UXZA 1NZIA 1WCUA 2WA3A 5FPBA 3UL2A 3M3IA 3M3OA 3CKHA 1BBT3 4AYUA 2X05A 4CXWA 1FYUA 1KFXL 1ZZ6A 2PHDA 5K8SA 5T5PA 4AWDA 1XNDA 2JIJA 3B01A 1Z7S2 4YW2A 2QQOA 2CGOA 1X33A 1LKNA 1UY1A 4CEWA 3J7NA 4QKFA 5E88A 3WNXA 5FZ3A 1W6NA 3E6CC 2ZMNA 1G8WA 1QNYA 1J1TA 2WZR2 4LKEA 1C8M2 2A6XA 4B29A 2G19A 4FFHA 4ZPIA 3FFQA 1URXA 4YWAA 3NAPA 4R8HA 4R4XA 2FDJA 1LENA 1S0GA 4XDQA 5FLJA 3TN93 1UWWA 2GC0A 2PAKA 2YY1A 4AEJA 1EAH1 5F7UA 5DUUA 4DY3A 4HSJA 3PURA 1UOJA 3D3AA 4Y4RA 3AL6A 3OYWB 4ATFA 5EV7A 5CAZA 1LOFA 2VL4A 4JGYA 4MGYE 3O1VA 1EUTA 3ZYRA 2W1UA 1BVP1 1ZBA1 2D6LX 3FE5A 3LE0A 4LITA 4NRMA 3K48A 4XFGA 2WQZC 1RUE1 3POFA 5DZEA 3O1OA 1LAJA 3NV2A 1RMU2 2GNBA 5T3NA 4PLMA 5FP7A 4AQTA 3Q9OA 1QJX2 4PLNA 1MVQA 3DECA 2CAVA 4RGKA 3T1LA 1N1YA 2VZTA 3ZSMA 5DDJ1 5GLWA 5FIXA 1YUDA 4QXCA 2Q0AA 1AJOA 2QQMA 3KCXA 3M7AA 1XQNA 3N36A 4CSWA 3OGJA 4CEYC 4FTBA 1Q56A 4QQHA 4QM8A 4GALA 1HQWA 2V73A 2YHJA 4XBQA 5DAWA 2RS51 4ZU4A 4CEWB 3W5NA 1PZ8A 3IT8A 1W6NB 4KG0A 1VMJA 4PHZA 4GWJA 2YBKA 1RTVA 2VR4A 3VBSC 4LO7A 1EAH3 5D8AA 3NAPB 1OKOA 3MIEA 1VPHA 4UAPA 1OXCA 1JU3A 1ULEA 1V9U2 4Z2AA 5IVFA 2HWD1 2OZ6A 4PQ9A 5FMCA 4KI5M 2LALA 1IKQA 3OBZA 2ZGKA 4LBQA 1ZBA3 1YQCA 4N9IA 3DCQA 2G9FA 1RUE3 2ZAAA 3GZUC 4QGLA 3T0DA 2P3IA 4JGYB 1RJ7A 5FZ6A 1SACA 4O61A 4L11A 2QQKA 4WM8C 4BDVB 3FLTA 5CZKA 5LW9A 4IV1C 3KV4A 2R041 5A1AA 1LGBA 2PQSA 3AB0A 4UFHA 4JRLA 1UZZA 1HQLA 1YHFA 5DDJ3 2Y8KA 5F5QA 2XOMA 1RUF1 4JKKA 1W0PA 1SDWA 1AX2A 5AFBA 2ZX1A 1YQ8A 4Y24A 2OIIA 4BIOA 4YM2A 1OFNA 2J1EA 4CDQA 4Z2WA 2RS53 4A6SA 1NCRB 2EIGA 1A8DA 3WDYA 4FOYA 2FHRA 4WVWA 1OLQA 3RZKA 2RDQA 1MACA 2JDAA 4FP3A 1MR5A 2FMYA 2R061 1TME1 4QKBA 1RHI2 2JX9A 1XNKA 2WZ8A 1GU3A 5I0TA 4LHKA 3K4AA 2HWD3 3WXPA 4EN6B 4CDUA 5D8AB 1DP0A 1JZ4A 3UKTA 1MZ5A 1HRV3 5I0RA 1GMMA 2IXCA 5FPAA 4RFRB 3O1RA 1GKBA 4LBQB 1TMF2 3LA3A 3QOPA 3HWJA 3GDBA 5H9SA 4OHZA 3AYAA 2ZX3A 2G1MA 1RUG2 1GWMA 4CCKA 1G9FA 2WWJA 1JYWA 3FHAA 4B4QA 1EV12 2WLQA 4UFJA 1RUF3 5LBEA 1C1LA 2ADDA 1LOGA 2BWCA 1QOOA 3DXUA 3R4UA 1PO11 4AI3A 5T5JA 3MO4A 3UESA 2RS12 4MVTA 1VALA 5C4WA 2BPA2 2ZEXA 4QQPA 2BERA 5AVAA 3ES4A 4QM9A 4TN7A 3AZVA 5GLTA 1DQ0A 2WO7A 2IXIA 2R063 4R9BA 4W6XA 3U4XA 1TME3 1ZBE1 2EF6A 1OVPA 4B3NA 4CDQB 4Y1UA 1SG3A 3MV11 5K7PA 3LSDA 4D8MA 3ASIA 1N1SA 3TEYA 2BGOA 4YLZA 4M3CA 2R16A 2AREA 4LT5A 1S2BA 2CYFA 2NYYA 2XKOA 5B2GB 5LK5A 2ZACA 4Q4W1 1FOD2 4M3CF 1GNHA 1ASJ1 3URFA 3N9NA 1D4VB 1GNYA 3WQ7A 3BKZA 1WCSA 3GM8A 4R9DA 4FQZA 1OD3A 1PNGA 3VHRA 4CDUB 4IEXA 1UOFA 4UW3A 2UYBA 4IEYA 3ZFFA 2XLGA 1ULOA 4NIHA 4UF0A 2JDPA 1QJU1 1DFQA 1O5LA 1GZCA 3NVCA 1W3XA 1CJDA 1UYYA 1UYXA 3DYMA 3EXUA 3AMMA 3I2GA 5FDBA 2LRPA 4D0QA 1PO13 4AL9A 2ZBJA 1PO21 5C6CA 2ADEA 2UURA 2DDUA 2DUQA 2VTXA 4GJZA 4ZZ8A 3ZMNA 2EIDA 4Y5SA 5C4WB 1X8MA 2C9KA 1ZBE3 1DDLA 2J22A 3MF6A 4R9CA 4AAPA 5LB6A 1SLIA 3GJBA 3NNJA 4MOAA 3ZXLA 3AZYA 4Y1XA 3VB9A 3ZFGC 3SMHA 2WNUC 4QPGC 4JZRA 4NE9A 4FPHA 1AR92 3FZ3A 5FZ0A 3ZXKA 4Q4W3 3W59A 3LFMA 1ASJ3 4OFGA 4RQPC 5GALA 3B5LB 5F3IA 4M3CB 2VMCA 4XE9A 3VD3A 1Z7S1 3OEBA 4MSVA 1RUC2 4AG4A 1YLLA 2BBVA 1XU2A 4NROA 1LTEA 4JGZA 1C8M1 1QJU3 4X6RB 4BK5A 4AZZA 3SEEA 4BHPA 1QQP2 3KQRA 1OVSA 4HLTA 3ZFFB 2D40A 1W6PB 3OD0A 5JR7B 5CFCC 2IFWA 5L9RA 4UF0B 1RB8G 5BNPC 1GWLA 2GN3A 2QQUA 1PO23 5JXIA 2V5DA 2VULA 1XB9A 2IUWA 5C33A 3S57A 2NM1A 4IDZA 2RV9A 2D5FA 4ZKTB 2MEV1 1DQ6A 2ZGTA 4CUGA 2JIGA 2W87A 4L8QA 4W6WA 2HWB1 1D4M2 4YW6A 1F5FA 4M4PA 4W65A 1XSQA 4P5HA 1SLLA 2R6QA 1QJX1 4UFMA 5FPLA 2Q8EA 1UX7A 2PHUA 4HANA 4XHXA 3UKNA 2WO3A 1XYPA 5FYCA 4P9GA 2HEYF 1Z7S3 1RUJ2 1RUH1 1QEXA 1O3RA 1C8M3 1JH5A 4C91A 4OZXA 1VIWB 4K21A 3MUY1 4YG6A 1IZ3A 1UL9A 5GZDA 4AVTA 2B5HA 3MDPA 2I07B 2O1QA 1BJQA 1O4TA 2DFBA 2QDRA 4JGZB 5GZGA 3HN3A 3U4SA 2ZX2A 5L73A 3RRDA 2D6NA 2VOKA 4Z92B 5BV6A 1V00A 4HK8A 2DCJA 4I0WB 4MLOA 4C1XA 5FY8A 1YI9A 2KM2A 5DG1A 1JUIA 2PHWA 4L2NA 3QH7A 1JW6A 1C5IA 2ZMKA 5ACA1 4XFHA 4XIKA 2MEV3 3VUOA 2DCZA 1VP6A 4OQ9A 2WFPA 3HNYM 5KR7A 1OF3A 4MG2A 2HWB3 3IZOA 5KHHA 3E5XA 3H1YA 1WMFA 1R082 5JDBA 1QJX3 1SHWB 3WZ1A 3KHCA 1LCLA 2WO1A 4PJYA 5DAPA 3CJIC 5IVJA 4KG8A 3PJYA 1N1VA 1VBE2 1RUH3 2B9VA 3ZSJA 4N53A 3WDXA 2YFUA 3EJKA 1PGL2 3DYPA 5FZEA 5FO9B 5IVEA 3AC0A 1NCQC 1OHFA 3ETPA 4E2GA 1CZVA 1MZFA 4RL7A 3DYOA 4WVMA 5GZFA 3GHNA 4X8PA 3MHZA 5JSRA 1AR62 1ZYBA 1JODA 2CDPA 3H3UA 2WWUA 3WT3A 5BNNC 2GMPA 4XIOA 3OBRA 4KWKA 4LPLA 4MYEA 4QXHA 5F6LB 3HBZA 3MIGA 4Q0SA 4TWTA 2VZOA 2W2IA 4UBHA 3H8RA 1SFPA 3DUIA 2JE8A 3CQOA 4PF5A 2OYZA 1J1LA 3AKSA 2AC1A 4EN9B 2XH6A 3NV3A 1BMV1 2ZGSA 3VD5A 5ACA3 5F9TA 4QKNA 3WVJA 1MEC1 5JVVA 4K20A 2WSUA 1E5IA 3SXWA 1OI6A 2HBTA 2GC1A 2P37A 3N9OA 1PX3A 3CMGA 1HB2A 1SFYA 2WZEA 3ZFEA 2HWE1 2OS2A 1RUG1 5T5OA 3KHBA 5IK7A 2PTMA 2JKXA 1ZRIA 2P6HA 1EV11 2ZGPA 3I3EA 2VZVA 1H9WA 2XR4A 4HL0A 4AVCA 4BQWA 3AFKA 4DPNA 4XHBA 4DZGA 2ET7A 5E16A 4BLJA 3JBG1 1N47A 4A7ZA 4D6QA 5D1IA 5FZKA 4N53B 2OQ6A 5KBFA 2BBAA 2D5HA 4FFFA 2VQAA 3H8OA 4FFGA 3R6SA 1KEXA 3H42B 4Q0QA 2J1TA 1U5XA 3J7HA 2P3KA 1DBNA 4WVMB 5F3CA 3WW2A 4ET7A 1JU4A 4ZS3A 2WNVC 2GNMA 2WS92 3BI3A 1QJY2 3VDBA 1CVNA 1OSGA 1QDCA 2J1SA 4AVAA 3POYA 2ZS6B 4ZS2A 4DOUA 1SCRA 4L99A 4QX5A 4FXKB 4QU2A 1MEC3 3SHRA 3NMBA 4CCDA 5I8TA 3BPSA 1I9RA 2VJXA 1CWPA 1S0EA 2OPKA 4PIYA 5FOBB 4CDWA 1E5RA 2DVDA 1ZZ9A 3NJVA 1YI7A 3TBDA 3OUJA 1IS5A 2HWE3 1RUG3 3OPWA 1A78A 2VNVA 2C26A 4V1PA 1BBT2 2ZGOA 2ORZA 3ZFEB 4BQ1A 1ZA4A 2LUWA 2VMDA 2WA4A 2Z2SB 3Q8AA 1XNAA 3JBG3 5FKCA 5A3PA 4K8RB 1A8MA 1ZNPA 2E53A 2E26A 2JEMA 1RJ8A 1W8HA 5KHIA 1FV3A 3VHNA 1WA6X 3ZXJA 1OFSA 4NPLA 3FHIB 4AEMA 1WCDJ 3HT1A 1RIRA 4KGQA 1XPWA 5JAXA 3WSOA 2W46A 3OPTA 2QZ3A 3I3BA 1FT9A 1V70A 4CCLA 4HSLA 1YO8A 4V2WA 5FXWA 1W28A 1JZ3A 1GP4A 1UU4A 2YPDA 1JZ6A 3BUCA 1OOPA 4Y20A 5BYNA 1GOHA 4MHUA 4CA9A 1OMIA 1Q3EA 2XL9A 1APNA 3CLPA 4LLOA 5FP8A 3ZPYA 4CDWB 1QQP1 4HETA 4P02B 3FBMA 1ULPA 5FPVA 3WP4A 3WG2A 3PL0A 1ENSA 4KU8A 1QJFA 3O14A 2VZRA 4XPVA 3RI9A 4C90A 4AHXA 4XFIA 5DXDA 2IWGB 4MGTA 1BVVA 4RR3A 2G4IA 4YZ4A 1K42A 1SBDA 1WGPA 3CEWA 3T30A 1T2XA 3HAGA 3PHMA 4HOOA 3H8XA 1HX6A 1D4M1 2W94A 3VBRC 2WT1A 4GXLA 4E2QA 1TQ5A 4N9HA 4M0HA 4P9IA 3LEMA 2OW4A 2H6CA 2IVJA 1WUVA 3WDVA 1EAH2 4R9AA 4QPIC 3KT1A 2ZHKA 2EAAA 4GKXA 3RZJA 3PMSA 2GSYA 1C1FA 5LA1A 3H1MA 1VRBA 1ZBA2 5KXDA 1FI2A 2RVAA 4CTEA 1JZ8A 4EN0A 3VDCA 2IXLA 4P9LA 4OHXA 3X29B 1GP5A 4JX0A 4XJAA 2XJTA 1U12A 1JXNA 1QQP3 3UGGA 1OOPB 4BQYA 3E1F1 3TWIA 5G05L 2VNGA 4KGGA 1JTZX 5DDJ2 4DUWA 3KSCA 3VL9A 4SBVA 4D3WA 4AW7A 3AP7A 4CP2A 2VUCA 3WG3A 1I5ZA 3W20A 3PTYA 1OF4A 4JDOA 5B4XA 2RS52 4L97A 1RGSA 3KQ4B 4RR3B 2JDUA 1AX1A 1D4M3 3RZGA 1OBNA 1R081 3BALA 3ACLA 3WUCA 1C3HA 4R4ZA 4UT5A 1W2NA 3EBRA 3KV9A 5C9AA 5IFPA 2IC1A 2XHNA 1L7RA 4I0BA 5G04L 4PT6A 4FAHA 2VUDA 3MPPG 4IXLA 3WQ0A 1G9DA 4UFKA 1DG6A 2HWD2 3ZM8A 2YU1A 1WW5A 2Q8CA 4EROA 3THTA 4Q0VA 4Q5OA 3MPBA 1HRV2 1W2TA 1S0IA 4NPMA 4YG3A 5J48A 1C4RA 2DFCA 1K3IA 3RZZA 3KVBA 2Y6GA 1AR61 3UV9A 5SV8A 4XJ9A 1YQ2A 3EMRA 4NAMA 4PDWA 4XQWA 5KHKA 1NLQA 1ST8A 5C3QA 4F7ZA 5CKNA 3MLLA 4B7KA 2ORXA 1RUF2 5C3SA 1H1MA 1PK6C 1SLTA 2WABA 1RUOA 4OYUA 5A3NA 4V2VA 5FV3A 2BVVA 4XF4A 2TEPA 4LUKA 2QJVA 5J09A 4PIXA 4FO9A 1Q8PA 3JUUA 2ERFA 3AXDA 2ZGLA 2DURA 1XC6A 2VE1A 2E6VA 1MZEA 2GMMA 4LQRA 2HJIA 1MQTA 4NOTA 1R083 1J59A 2R062 1AR71 3VDAA 1JUHA 4FOWA 1NQDA 1GYKA 1SDDB 1X82A 4GWMA 5FPZA 3VKOA 1SFNA 3A0NA 4XTPA 5LA2A 2K2SA 4IEOA 1QKQA 2HWF1 3EHKA 2ZGMA 2QTWB 5C5TA 1WLWA 5C9AB 4WM7C 2B9UA 2Y0IA 5J37A 3GJAA 2WT0A 4NHLA 4CCOA 3TEWA 1ND3A 3TNQA 4IESA 5L9VA 5C8CC 5EIYB 1WMEA 4QQ2A 3RPQA 5LWBA 1W99A 1PMJX 1AR63 5A6QA 2ZA9A 5F2SA 4PLOA 4LR4A 3QD6A 4FT8A 1SBEA 1BK0A 1GANA 3N7JA 5FBJA 5FCCA 3FUQA 2BGPA 1QIQA 2WS91 4PBPA 1SLBA 1QJY1 3JD72 2OPWA 4EWAA 2DTYA 4PDWB 1PO12 3DPRC 5DPNA 1Q8VA 2QQJA 1K5MC 1S0CA 3J7MA 3LPFA 3MW4A 2A6ZA 4OUSA 5JLVA 4O65A 3CHXA 4GQ7A 4OI1A 4BH9A 2E7TA 1AYN2 3C8XA 1S2EA 3NNFA 4UYBA 1AR73 1QH6A 1ZBE2 1ZZ8A 5DABA 3U1XA 5FY1A 4D7YA 4Q4V2 1MQTB 4DS0A 1UO9A 2D3RA 3N7KA 1V0AA 2HWF3 3UETA 2I45A 5LA0A 3I2DA 1HJFA 2GAUA 4Q4W2 2QUOA 1ASJ2 3V65A 4LBLA 1H9PA 3ENRA 5EYXA 3KZ4C 2XVGA 4ISRA 5F37A 2AZ5A 3MV01 4XTMA 5FOJB 3JCIA 1SLAA 2A70A 4MGQA 5K0UC 1FMD2 2YFZA 1ND3B 4LA3A 3E97A 5CNAA 5APAA 5IHRA 5CG9A 4OHWA 1LECA 1V6LA 1UOBA 3ZOIA 2FDGA 1Q8OA 3IIIA 2WS93 4N90A 1QJY3 4W50A 4HPKA 4CDXC 1ODNA 2JICA 3HNBM 4YZ1A 5A1FA 1V6KA 2HEVF 2JG8A 3IIAA 1GFF2 3QBQA 4MGZE 4G3YC 2RDRA 1PO22 1P8JA 1HB4A 4XBNA 4R52A 4QWNA 4META 4GD4A 4RS5A 5JPNB 3WG1A 1G7YA 5C3PA 1D0GA 3U75A 4TLGA 1W9SA 1KJLA 2CY6A 5I8YA 2KXLA 1AL23 1I6XA 3ITQA 2DU1A 2KA3A 2X5IA 4CEWC 2Q8OA 4XF9A 1OLME 3PLQA 1IPKA 3A4UA 2E32A 3KF3A 3VD4A 3ILRA 4H55A 4XFBA 4A6OA 1HXS1 2RE9A 3GCWA 3NAPC 2PAEA 1J58A 4OUEA 2DUOA 5H9PA 1XU1A 3PVEA 3BOWA 4J6GA 3AMHA 3RWNA 1WD4A 2JE9A 3RMYA 1WCQA 4IV3A 1W90A 1KRIA 4YVSA 2JDHA 2QE3A 1JYTA 1LOFC 4JGYC 2CV6A 4Z07A 1G86A 3VBOC 1YFWA 2GC3A 2W1SA 4YM0A 4BB3A 2XL7A 3JB8A 4L92A 4OLLA 1ULDA 1XJAA 5A3MA 5I91A 4HPKB 3VHPA 4W6YA 3ZMOA 4JKLA 4LLFA 2JG8B 2MEV2 2WNEA 1Q8QA 5J3UA 4AHWA 4ZONA 2GH8A 2HWB2 4RS5B 3ELNA 1TG7A 3ES1A 1NCRC 3ROUA 2YV8A 3THCA 2WWSA 1QJZA 3IDCB 1DYKA 3ZDVA 1HXS3 1H4GA 5IK4A 1FPN1 2X5IB 3POWA 4H2AA 4YNIA 1IS6A 5JXGA 2PHFA 3KM5A 1RUH2 1PGSA 3A7QA 4FPJA 2BW8A 5FRAA 5FP3A 4Q1PA 2A6WA 5GZEA 1BCXA 4JTOA 2BNNA 2Q1MA 4AI9A 1J3QA 3WNLA 5FZDA 5IW0A 3NKGA 4YARA 5FO8B 1LESA 3T2PA 1OQEA 1STMA 1VMFA 3K77A 2A73B 3PUQA 2NN8A 3K75B 4IV3B 2O8OA 4YVSB 5HPOA 3LA7A 2B7YA 3A23A 4GWNA 3ZYHA 1IGOA 2PN5A 3OPZA 4LBJA 3ACHA 2JENA 2P5BA 3SCHA 2PHXA 4IE5A 1GZTA 1MS3A 1O8PA 2XB6C 5FWJA 2XLAA 2C24A 3AYCA 5ACA2 3KS7A 1V6IA 2D7FA 3LQCA 4B1LA 1HRV1 3SH3A 3PUIA 3E5QA 1FAYA 3BIWE 1Q5OA 2YBSA 2NZ9A 4B7EA 5JOWA 3KMHA 4XQ4A 2ARCA 4CRQA 4ASLA 3POIA 4CXYA 4CDQC 1FPN3 1UW8A 5FXXA 4HVRA 1OQ1A 4JV4A 1WKYA 2W91A 4HN1A 2GDFA 2ZJCA 1BK1A 3FLRA 2XPJA 2ARBA 4XEZA 4CU8A 3CJXA 1QU0A 1WLTA 2NQYA 2PHTA 2EXIA 1DZTA 2QQVA 1PZ9A 1H2NA 1SEFA 4NWVA 3UK9A 4CDUC 4XJUA 4Y26A 2Y26A 3VKNA 4A4AA 1MVEA 3HNMA 2AEYA 1REEA 2JECA 4I3PA 1O3QA 4EYUA 2VMEA 5FWEA 1BMV2 2BU9A 3N35A 3PU8A 1H2LA 1A6CA 2VZQA 2XQXA 2BNMA 1MEC2 1GZWA 2MPFA 2RDSA 5KHGA 4WM8A 5FZ8A 2BOIA 2RJ2A 2XG3A 3GYDA 4I30A 2Y6FA 1K5JA 4ZU7A 4DRRA 1QWRA 5LZ6A 3DV8A 3OUHA 3AZXA 1N1TA 5C4WC 4HVOA 1FXZA 2HWE2 2DWRA 2BTVC 4LOTA 1J3RA 2KD7A 3G7DA 1AYM2 2F17A 2IXHA 3SH5A 2EAKA 4GAZA 1XYNA 2X53S 2V09A 3JD71 3Q8FA 4N7IA 1LOAA 2Q1ZB 2VCAA 2Y34A 3FX3A 3O5SA 4LK6A 2VW2A 3AXEA 3LAGA 4J25A 1SCSA 1US3A 4FI9A 4UWDA 2F4LA 3JBG2 4IUGA 3VV1A 3VN4A 2CNAA 4OQ8A 1LODA 4AXOA 1WBLA 2E33A 2UWCA 1V6OA 3D0JA 3SLIA 4AI2A 4IGQA 2A1XA 5FYYA 1AYN1 1LEMA 1DF0A 5DAQA 1GLHA 4Y5Z0 2Y6JA 3IAPA 2ZCWA 3UNPA 5A3WA 4P9WA 2A3XA 3MW3A 3T2OA 1NA1C 4UW6A 3ZFFC 1EY2A 2D93A 3QH6A 4ZZ5A 3UJOA 1KDKA 4FPGA 5F5CA 3AL5A 1U0AA 5FP4A 2DV9A 3HQUA 1F2NA 2F4PA 4BLIA 4M00A 1OURA 1LOBA 2CTVA 2QKDA 2VOVA 3LOIA 4KBZA 5B4NA 4HK9A 1FMD1 3VDDA 4WM8B 5LBBA 3RZHA 1FX5A 1GP6A 4IEUA 2JKBA 5J96B 4IGOA 4BMBA 3NQHA 1R1ZA 1OKQA 2AEZA 2BV4A 3HN1A 3NNMA 4YSFA 4XILA 5LA9A 2RG4A 3AMQA 2ZXQA 1ZA7A 2OVUA 2K0GA 3JD73 3KD4A 1PMIA 4IE4A 1GQPA 4QKDA 1CX4A 3WF1A 4XXAA 1Y7BA 1PZ7A 4AHYA 4NUBA 1ULFA 2VOXA 1LOEA 1UN1A 2VO5A 3ZN5A 2FDFA 2ZGQA 4Y33A 4AI0A 4TXWA 3Q8CA 1AYN3 2VOTA 5H9QA 5LATA 4DXTA 5I93A 1RL3A 2WYSA 3QACA 4HKWA 5IVVA 4KWUA 2ETEA 4AQ2A 4Q27A 1VAVA 4P14A 2CU5A 4XVHA 4CP9A 4DUXA 4AVBA 3H1WA 3P6BA 4LJHA 3U14A 1OC1A 2HLEA 1HQNA 2P1BA 1DLCA 3D4KA 5EYYA 2NMNA 2Q5TA 4QB1A 3ALQA 4MXWA 5K4LA 3BPZA 4BJ0A 1NT0A 2GU9A 4AOCA 4Q29A 3I49A 1FMD3 3EB7A 1YQ5A 1YXWA 2ZHNA 4XF3A 4NRQA 3QLQA 1Y43B 1YJKA 4AFMA 3T1MA 1O8SA 2VUAA 5FUIA 3WR0A 1WD3A 1K12A 4LO4B 4MGSA 2YU2A 2VPVA 3VDDB 2AH2A 2Z69A 3I3QA 4BMEA 4I3GA 5FZFA 4DFSA 1X7NA 5K9YA 4C0BA 3LOBA 3WP3A 3WNKA 4U36A 5L19A 5JOXA 3FHQA 2UWAA 3E6BA 1H8TA 2Q4SA 4ISQA 3AFGA 4EZ4A 2PLV3 2ZMLA 2WFF2 1GQHA 4K1YA 4DXZA 2WNUA 5ABJC 3H3ZA 1AXYA 4AQSA 3AMNA 1S0JA 3BOPA 4C0HA 5BNQA 4FPCA 4E8DA 4M3CE 4XFAA 3PNAA 1ZX5A 4X8NA 2EIEA 1YNAA 2QFEA 3LIGA 1DLLA 3AK0A 4JKMA 4CP9B 5F5IA 5F8PA 1PM7A 3WY6A 4AAXA 5TSWA 4AEDC 2UWBA 4HZFA 4Z82A 1WW6A 1X9PA 4MXWB 4ZU5A 5JZGA 2DCKA 1ULCA 2OZJA 4A7YA 1L7QA 5CFCA 2EA7A 2Y38A 5KWRA 1W9WA 1S2KA 2A3WA 5DUXA 4GH4A 2XDVA 3JU9A 5FXZA 3LDRA 1DGRA 3AMPA 3U11A 1DCSA 2VNRA 2I2SA 1H30A 1HKDA 4E4ZA 2GMEA 2R073 3GXUA 5JOYA 3NL1A 1ZZCA 1YQ6A 2VY0A 3BGAA 4LULA 2JDNA 4BQ5A 1I1EA 1TZOA 2DU0A 3E5UA 5C3OA 4LHSA 2DVAA 4MX3A 4SLIA 2VTXJ 2FCVA 3B7MA 3I3DA 5FYTA 1QNWA 1WW4A 4JHZA 4O9EA 5FP9A 1VLNA 2Z4FA 1H8TB 3VBUA 2XHKA 1ZZ7A 2JG9C 2N7GA 3B00A 3POJA 3B02A 3INAA 2WNUB 4LIVA 3CO2A 1OQDA 2AYHA 1W2UA 3N3HA 1VBA2 5HV0A 4EE2A 1LHUA 1YFXA 4NIGA 3WDWA 1JBCA 3HT2A 4MHRA 4UOJA 2DVGA 4Y4YA 3JXSA 4IEZA 5F2WA 2DCYA 5A7WA 5KXEA 5JSPA 1XE0A 4IETA 4YW5A 2FD8A 2WIIB 2BNOA 4LHLA 3NO8A 4XUQA 4Q4X3 4DB5A 5JZGB 1Y9GA 3J4UH 4AF9A 1QOSA 4IEQA 1IPSA 3RFRA 5CFCB 2FQPA 2LM3A 5T5LA 2E31A 5F3EA 2WSVA 5IVYA 2WAAA 4GH4B 1ZRCA 2A3YA 4XW3A 3IPVA 1O4ZA 5DG2A 1RUI2 2GP3A 3RQ0A 5C7GA 5DAVA 4E4DX 2VMGA 2ZEYA 1DZRA 1JZ5A 5F32A 5FPXA 4XQDA 4YFWA 1ODMA 1RINA 1UYZA 4AGRA 1K45A 3CJIA 3ECQA 1LB2A 1AR72 4I01A 1OT5A 3KCCA 1D7PM 2V72A 4HVQA 1Q8SA 1KITA 3C7FA 4CZSA 4BK4A 3VBUB 3MLJA 2HWF2 1AYM1 2ZKNA 3KWVA 4QHBA 1X50A 4RN5A 4Q4V1 4XZPA 3AYDA 2JDMA 1O3TA 4HBNA 1C5HA 3MIBA 1AXKA 1ENQA 4PCRA 4P9JA 5JIAA 2VAUA 4NHKA 2ID4A 4KWJA 1UYPA 5BNNA 2PAMA 3CDZB 4U2AA 2VZUA 4FOQA 3POBA 2J1AA 5A7WB 1NZCA 5CIRA 4F83A 3I2OA 2VZ3A 2XBO1 3C7EA 4QX3A 1WCKA 3LDKA 3RGBA 4P00B 1YC61 4DO0A 2CWSA 4CDWC 1V6JA 3O1MA 2CL2A 1MS9A 1WLDA 3NNLA 3T4VA 1UY3A 4FPFA 1R1A3 3OCPA 5ANNA 1B35A 2WQ8A 3DGTA 3IPVB 2RR12 2ZX0A 3O0VA 1IHMA 4ARXA 4BQ3A 5E6HA 3WNOA 1REDA 4HN0A 4XC9A 3POEA 3D5OA 3JZVA 1QXRA 5IWFA 4YZ5A 2HYKA 1HV1A 5F5AA 1AL22 1W8TA 1KJRA 5I8SA 4FP2A 1AYM3 2Y64A 4EN8B 3MBWA 4LE4A 4EWDA 4Q4V3 1NG0A 1RUD2 4Y5TA 2JWPA 4ITCA 1GV9A 2B42B 1SPPA 2H0BA 4NPRA 1CPMA 3HR9A 4H14A 4EWEA 4IERA 1UOGA 3V0BA 2HWC1 4OMDA 2VGDA 5KC5A 2QQWA 4QHZA 4S2DA 2XBO3 4AVSA 4ES9A 4N43C 5BNNB 4XUNA 5BNOC 3C3VA 4JAAA 4IW3A 4LKFA 4QAWA 5GLUA 5CB7A 3PIGA 5CEHA 4ORFA 1OOPC 5IK8A 5CYYA 4LBNA 4FFIA 5C71A 4BQ4A 2OA2A 3BU7A 3CU7A 4LMFA 5JR2A 5KHJA 4JDMA 2W52A 1U5YA 1GZ9A 2Q1FA 5L7OC 5JI7A 4K9SA 4AK3A 3TYJA 2GC2A 5A3OA 2YYOA 1B35B 4XJZA 1HN1A 5IVCA 3VZKA 1CAUA 5FJHA 5LEJA 2QCSB 2ZOEB 2BOJA 2E7QA 3MIDA 1HN0A 3MUZ1 4QHOA 3SCGA 3ACIA 4IE7A 5FY4A 5FBZA 1GOGA 5BY5A 1CIWA 1WMDA 3GALA 4NAOA 1HXS2 4WZCA 1VR3A 5JCTA 5FK8A 3DXTA 4Z1VA 2Z5WA 1MZ6A 4CU9A 3B94A 4BIFA 1RYYA 3THDA 1UX6A 2HWC3 2OT7A 1W04A 5FYMA 2Y33A 1SPPB 4C8DA 2VECA 3AJYA 2WFF1 1CESA 1W9YA 3SISA 3MLKA 1QGLA 3V0BB 3EO6A 5KXBA 1RVF2 1KD7A 1POQA 3POSA 4FTEA 1VBD1 3AVSA 5FMOL 4OVEA 3TEXA 3ZN4A 4B1MA 4D7SA 1Y3TA 3PUHA 2C4XA 4YGDA 1ALYA 5FZHA 4HKLA 4PQQA 1TE1B 4J1XA 2JDZA 1HV0A 3KGLA 3M3QA 2VQTA 1GR3A 1XOYA 4QMAA 1UU5A 4RYDA 3SITA 1AUYA 2RMU2 4BZ4A 3WF3A 2XJVA 5FLIA 4CCJA 2VMFA 4ZXKA 1UXXX 1BZWA 4A3ZA 1JZ7A 1KGYA 1MS8A 4Y20B 2VVFA 3D8CA 2BGCA 3GBGA 1CAUB 2AUYA 3PVBB 2W3JA 1H2MA 3HPNA 1FPN2 1UMZA 2GALA 3NJXA 3I7DA 3WW3A 1DGWX 1W3VA 2XUEA 1W39A 5KXCA 2XLFA 3WD5A 1T6GC 3KLSA 4QX0A 5FFOC 2GZWA 5C9AC 2WFF3 2DYCA 3VBRA 1VB4A 3HOBA 4E2SA 5A1LA 2DVFA 1GICA 2RJLA 3WW4A 1XNBA 4Y1VA 1J83A 1REFA 1O4YA 4HFSA 4COZA 4URAA 1VRH2 2DVBA 3A21A 4XJ8A 5EJZB 4C1WA 2J1RA 1VBD3 4URTA 2P6CA 3U07A 1VJ2A 2ZKLA 1OPOA 3T08A 1LGNA 2O0OA 1VBA1 2W5FA 4WBBA 2VZSA 5GM0A 3APBA 4CU6A 5FY7A 4KNCA 2YGLA 5FLHA 4ATEA 2R30A 3ZYPA 4P9XA 3HBKA 3ZDSA 5FUNA 4YW7A 2ET1A 1RUNA 1UNBA 4A44A 3ZXFA 3K51A 1KS5A 3PJQA 1EYBA 2GNDA 3TOJA 4QDRA 2VNOA 2VC9A 3NJYA 3J9SA 1ND2C 2CAUA 3BB6A 1MQTC 3HVDA 4AVVA 1BYHA 5CG8A 2BFUL 3NJZA 5FYZA 3OSDA 1RUI1 3JQWA 2WNOA 2C1FA 5T50A 2YZ4A 1H1IA 4LO6B 3VBHC 4NHMA 3E6DA 2VH9A 4YVWC 1Z0HA 2WL1A 4HXCA 4LA2A 2NMOA 4QB2A 1NAEA 4BQXA 1EUUA 2WJSA 3NNGA 1W8NA 3VBRB 4AFCA 3CIHA 3HJRA 3ACFA 5CFDC 1LHOA 4TZDA 1NE6A 2RS32 3LDBA 3T0AA 2W08A 1J3PA 4FQ4A 1VBA3 5DZFA 3WQ1A 1JYVA 1OA2A 3R4SA 4DRVA 2GNTA 3C7GA 4NMIA 5BUVA 3N4MA 1W9TA 1LEDA 2XWJB 3I2JA 5ISLA 2BYVE 2NPIA 5GKAC 1ENRA 3DKQA 3PDQA 3O7OA 4CCMA 2FZ1A 1CIYA 2ARAA 3H7JA 2QBXA 5J98B 3VBFC 3J26N 1E5SA 4COWA 5IATA 1SMVA 1XSRA 2X09A 4DNYA 1I5PA 5FZMA 1PNFA 1H4HA 4GB32 1RXGA 2J42A 3HEIA 1CQ9A 3VZLA 1LNSA 3ZR6A 1PK6A 5A6XA 3ZKYA 1YIFA 4LBMA 4I09A 2MHFA 1RUI3 4ASMB 3USUA 1WLCA 3M4FA 5FZ4A 1H6YA 3MW2A 1MS5A 3ON7A 3VD9A 3VZMA 3EQEA 2RR11 1PM4A 1US2A 5ANQA 5JOZA 1CONA 2W1WA 4KL1A 1O6UA 5M0TA 4LTAA 5LY1A 2TUNA 2RDNA 4A45A 4TSVA 4FVVA 1IKPA 3WUDA 2A5ZA 2Z42A 1H8VA 3AM2A 1AL21 4WM7A 2EICA 3V56A 4IEVA 5FO7B 4LOSA 4K1ZA 2A6VA 2AACA 3WV6A 2VU9A 2RM21 1RUD1 1BKZA 1OH3A 2VVDA 4H7LA 4NRPA 1O5UA 2JE7A 5C8CA 4WV8A 2RHPA 3ZXEA 2EXKA 4KMQA 1AXZA 1WW7A 3OF1A 4LBOA 4NHXA 2ZEWA 3VLBB 2JG8C 1DZQA 2SLIA 1JMUB 4FPYA 4LIUA 5DUWA 3BU0A 1QXJA 3RG0A 5T52A 1V6MA 1HJGA 1OD5A 4FBFA 2VVEA 3AP5A 3DPRA 1GNZA 3R0RA 2R0HA 3BYWA 1K5MA 3RS6A 5LBCA 2NLRA 1JYXA 1HRI1 3AZWA 3P3NA 5A7OA 1PK6B 1ENXA 1COV3 1CZSA 1X9TA 2BZDA 1TVGA 3H8UA 3HD8B 4LBKA 2H6BA 1JOJA 2QNKA 2WINB 2RR13 2XJRA 2XJPA 3R4DB 4XYXA 3ZYGA 5FJKA 3SCFA 3USUB 3WDTA 1UZ0A 1XE7A 3C7OA 2KR2A 3GHMA 2PLV2 3M3CA 4MO3M 4OMCA 5FYHA 3RJRA 1ZRRA 1W8FA 4XETA 5BXXA 1Q43A 1RITA 3ZO0B 3LZZA 2UYAA 1D2SA 2FCUA 2G9GA 3IKWA 2WN3A 4IV3C 5A7NA 1WWYA 1SBFA 1CJPA 2P2KA 1DYOA 1OPMA 4MV2A 2RM23 1RUD3 3N9LA 4WM7B 3AKQA 2VBDA 5A3UA 5K0UA 2ZGUA 2ZZQA 2D3PA 4INDA 4RFT0 4NWWA 4PF1A 4D94A 1PGW1 3L9JT 5C8CB 2XKPA 3UGFA 3W5MA 2DCTA 3J7LA 1OH4A 2X29A 1PHMA 3WF0A 2CDOA 2L9LA 4CDXA 3CNAA 4FOVA 4K40A 5A6YA 1QXPA 5IUQA 1NE4A 1NYWA 5FYIA 3IN9A 2D97A 3MI8A 1IG0A 1RVF1 4LEJA 3RSJA 4S2HA 1HRI3 3VZNA 2PMWB 2P4EA 4UFIA 4A3XA 3WNPA 2WC2A 2HYXA 1JHJA 2QQLA 2R072 3DPRB 3H9AA 1V6NA 2OKXA 5FYVA 1K5MB 3ZIWA 1W6QA 5FZIA 4D69A 1HLCA 1LHVA 1MS1A 1J84A 1TEIA 4NIIA 3HQXA 4IE0A 4QDQA 3VGIA 3OGVA 1POV1 2XONA 2RMU1 3AVRA 1W9FA 1S0BA 3ZX7A 4Q26A 4QB6A 4XF0A 1NY72 5FYUA 3SKVA 2JD9A 2PA7A 1S1AA 4TLFA 3RMXA 2UY9A 1EPWA 4XDOA 4IE6A 4QGMA 3J8F1 1UKGA 3I2KA 5CBLA 3D82A 2A75A 4CPBD 1ULGA 1BLZA 1JHNA 3H7YA 4QQOA 3AP6A 3BTZA 3RWKX 5D8AC 4BA6A 1CN1A 2E9QA 2FDHA 4BWOA 1UAIA 5K0UB 5IYYA 3VBOA 3SQOA 1UCXA 3I97A 4UW4A 3SNMA 3ZYIB 1RVF3 1GQGA 1LULA 1VRH1 1XXNA 3FL7A 2YPJA 4WVVA 4YGEA 2D98A 3D0SA 4CDXB 4YZ3A 5E1RA 4KU7A 1LHNA 3KT7A 3MZHA 2ZGRA 3Q8BA 2ENRA 1LOCA 2XMLA 3POGA 2D44A 3FFZA 5AC91 1DGWA 3ME2A 4MXVA 3ZSKA 3BN6A 2YC2A 5GLZA 3KV5A 2ZX4A 1NCRA 5EPAA 5FKBA 4AHZA 3WHTA 1POV3 1W6QB 5I0UA 2UU8A 2RMU3 1F35A 3CL1A 1CAXA 1PMHX 1UU6A 2OQ7A 3GZEA 3N9QA 4FPKA 4OZOA 4PBOA 2VTFA 5FZCA 2XJSA 2LW8A 1M4WA 1JS9A 4UW5A 5C5UA 4TTGA 3TEZA 4MGKE 2BUKA 4M01A 3WF2A 1UQXA 5LCWL 1W8WA 4GULA 4QDSA 4CEYA 4FSJA 3J8F3 4XAAA 1VBC1 5CKQA 4CP0A 4Q4X2 3BCWA 3VKLA 3S0MA 3BODA 1SZBA 3AYEA 5EFUA 1F8VA 4FAGA 1NOVA 2FZ2A 3O12A 3S30A 4A7KA 3AZZA 5JI9A 3VD7A 4UXAA 2R1BA 2YROA 4LNVA 4GA9A 3VBSA 1UIJA 1VRH3 1R64A 5L36A 5JSOA 3VBOB 4IL7A 2XJQA 4EJRA 3A0KA 2JXAA 4S2GA 3W21A 4I0AA 2RS31 3ABZA 3P3PA 5J36A 3O1UA 1VBB1 4HT1T 1OUSA 5FXVA 5LEKA 4Q8KA 5AC93 2W9XA 3IWZA 1ONAA 5IK5A 1PX4A 1AR81 4IEWA 2EVXA 1R1A2 1BEV2 4HKOA 2OX0A 3I3MA 1UMHA 4Q8LA 3OD4A 1D0HA 4AFBA 4MH0E 4UI9L 4YGBA 3ILNA 4IV1A 1I3HA 5JPMB 1F5JA 5T55A 5J7MA 5HI0A 4YW1A 3ACGA 4QT6A 1WZXA 5IAXA 3GNEA 1CAXB 2BQPA 2R0FA 4GB31 3DEMA 3NSTA 3ZKUA 5FUPA 3JQXA 3I54A 1VBC3 2ZGNA 2B8MA 3ZVXA 5DAXA 1PIV2 2ZTNA 4JHTA 4ZY9A 4CEYB 5FMDA 4Y3OA 1DIWA 3ZXDA 1W05A 1VB2A 1DQ1A 3KV6A 1QF3A 4OI0A 3FN9A 4COUA 4PI2A 4I2OA 1SLCA 2GP5A 3IB3A 5EP9A 2Y0OA 2V4AA 2WRAA 2A6YA 4XBLA 5EJ1B 2XBO2 5FTTC 3PVOA 2RS33 3VBSB 1VBB3 3FMGA 2R043 4HMZA 3B93A 4BXFA 3WHUA 4PIZA 3VDDC 1MPXA 3FUOA 1AR83 1Y4WA 4L0PA 5HCHA 1HIXA 1QMJA 5C3RA 1YJLA 1W0OA 4LE3A 4CXXA 5LK7B 1FV2A 3OBAA 4FPLA 1F15A 1UZVA 5FREA 3PVNA 4DY5A 1QOTA 1W2AX 3TNPB 3PUAA 4DQAA 4CP1A 1C8NA 1GZWB 2B4KA 4FPEA 5CVRA 4S2FA 1IS3A 4GB33 4IV1B 3VZJA 4YM3A 1FNZA 1JN2P 1O91A 4CUBA 1O59A 2JB8A 1FNYA 1A3KA 4QXKA 3S5AA 4JQTA 4LKDA 3TB0A 4COYA 2EALA 5LRRA 2VMHA 4RGAA 1DQ4A 2XGXA 3LEIA 5JWPA 5FZ9A 2FDIA 2HWC2 2IFRA 3G6JB 1XNTA 3S7EA 3RVHA 1YWKA 2FDKA 2PLV1 1N3OA 1W8OA 4UBGA 1NA1A 4XXPA 3GBFA 4NIDA 1W6PA 4PI0A 4TYSA 4Y1ZA 4B8EA 1ZRDA 5FQ0A 4QX2A 1UIKA 5JMOA 4D6SA 4CVUA 2F6BA 1QJEA 4NHYA 5CKMA 2P34A 3JB4C 4XAEA 2V5YA 2BEOA 4JGZC 4YG0A 4DEVA 1JOBA 1T6BX 2RJKA 3B69A 4QGNA 2R1DA 3ZXAC 3IM0A 1PVC1 2W1QA 5FZ7A 4OHVA 3KT4A 4ZXEA 4JRAA 5LASA 2VD7A 1AL0G 4H7MA 4Q4Y2 2W47A 5I0SA 3BTYA 1BHGA 2CGNA 3IDBB 2X8KA 2XJUA 4XJWA 1UMIA 1H8TC 3HIFA 2VQ0A 1L7LA 1NLRA 4Y22A 1Y9MA 3LSEA 3QCWA 4CE8A 2J1VA 1FATA 3PUSA 2R071 3U37A 3S5QA 4D6RA 4D7TA 5J1XA 5DZGA 1OA3A 4G4FA 4JQRA 1AHSA 4ZHNA 4H3WA 3WINE 2B39A 2P17A 2I74A 3K3OA 3ZFGA 5CU1A 5F3GA 4B4PA 1AF9A 1UF2C 4QPGA 4EZHA 3OOXA 4QPWA 1F9KA 3WLUA 2WZR1 1UY0A 1TNFA 4I02A 4RQPA 4BE3A 1NY71 1VBD2 4KQ7A 5JZGC 1NA1B 4AE2A 1U5IA 2ARXA 3T3YA 4BCUA 2VCBA 4GIQA 3GBWA 5FQ0B 4GH4C 1LU2A 4E4SA 1PVC3 3FBYA 2WZPP 2WKKA 4RHV2 3LWCA 3B9CA 4EN7B 5FZAA 2ES3A 2OUHA 2W68A 2JDYA 1KFUL 1DQ5A 4CPBA 3TAYA 5BNPA 3I8TA 4QX1A 4XOGA 5JXJA 3LIHA 1RMU1 1IG3A 3F2ZA 5L9BA 2WO2A 3H3LA 3UT0A 2K46A 1DHKB 3PU3A 1QDOA 5GZCA 2E51A 2J7MA 5FR3A 3UYJA 3MICA 1DYPA 5SV5A 1UZYA 3VBUC 1G9BA 2LS6A 2ATFA 4XUOA 3SKJE 4Y22B 3RNSA 5ABJA 2W95A 2PFWA 3AP9A 1UPIA 2EIBA 1EP0A 4BQ2A 5CADA 2A71A 2JDKA 3HQRA 1W03A 3ZYBA 3LPGA 1UY2A 3VKMA 2VOWA 2C9AA 2H0VA 2WZR3 4MGIE 4N53C 5E8AA 3WNNA 4ASKA 4COVA 2VMIA 1DGLA 2EXJA 3ZFGB 4QPGB 2LROA 1MS4A 4AEDA 4NO4A 2VZPA 3V64A 1XNCA 1MS0A 1YYNA 1H2KA 1CR7A 4RQPB 3M3EA 1LU1A 3LF7A 4BYYA 4Q4X1 3VHOA 1V9U1 5HCAA 3NV4A 4AQ6A 2IVIB 4CU7A 5JIUA 4OI4A 1NXMA 2PELA 1GOFA 1NX9A 4XF1A 1VE0A 3ZYFA 2DUPA 5DUVA 3WCRA 3P5BA 4JTNA 1RMU3 3M8LA 4AI1A 1CAWA 4GKYA 2ZABA 4JCKA 1OLRA 1CX1A 1BXHA 3HMYA 1AJKA 4BPZA 1H0BA 2K9ZA 5BNPB 4YM1A 2WUHA 5I0DA 2GH2A 2HH9A 3WW1A 5C70A 2YXSA 5CA6A 3I59A 3ZSLA 4F8AA 3MEPA 3ZFEC 5T54A 1R1A1 1BEV1 2W39A 4A2UA 4HG6B 2PQQA 4QPYA 5A7SA 2R7EB 4EQVA 3DN7A 2JG9A 2JJ6A 3S7IA 3N9PA 4XFCA 3GF6A 3RJ2X 3SC7X 5ABJB 1W8ZA 3OG2A 3K3NA 3M70A 2EXHA 2E7AA 1ZZBA 1KQRA 5FY0A 3A22A 4A41A 5BPXA 3ZR5A 5A7QA 3ZSEA 4BU2A 1S55A 1RHI1 3OGSA 4XCBA 3WQBA 1NCQA 5A33A 3KGZA 2UY8A 2YC0A 3AX4A 2XVKA 1V9U3 2Y60A 1OA4A 1H6XA 3FJSA 5FZGA 4NJ4A 4AEDB 3D6EA 1PIV1 5AVPA 4XMIA 3LEKA 3RI8A 4QD2A 3K4ZA 5A6ZA 3I2HA 5FYBA 4FTSA 4XCAA 4E4HA 3SH4A 5IT6A 4AEKA 2XWBB 3OTFA 1TMF1 1PVXA 1B35C 3BVCA 2WT2A 5EQUA 3WX5A 4KH9A 2J1UA 1R092 4Y1YA 4YYOA 1CAWB 2CGPA 2PHLA 3K46A 5C8WA 5EHDA 3MFCA 3RYPA 1COV2 3TRSB 4BOWA 2BP6A 1BEV3 3ATGA 3LGRA 1UZWA 4LXLA 1NQJA 2YB7A 3I59B 2RS11 3GZTB 4A42A 4BISA 1G9CA 4Q2FA 2VW0A 2JG9B 2BJSA 2YC4A 3Q8EA 1CGPA 3OUIA 1CPNA 4K6BA 4O7XA 2ZHMA 5D21A 3BTXA 4P9YA 3H0OA 3CJIB 1LRHA 4N8MA 1RHI3 3NV1A 1X8EA 4UFLA 2PXJA 3USSA 3WF4A 5EJ3A 1W8UA 3WOGA 4CYDA 4F3JA 3LFIA 1Z78A 4GMP0 2RM22 4K7JA 3WNMA 1QY4A 1PIV3 2VXJA 2SBAA 4L9BA 5FYSA 3LEGA 3BIEA 1WMXA 1NCQB 2ILMA 5A33B 1FOD1 2W0XA 4X6QB 1DU3D 5A32A 3C7HA 4WVZA 2VUJA 4CCCA 4YPJA 2WYFA 2WNVA 2D43A 4K3UA 1TMF3 1C28A 1VAMA 2XXZA 1DQ2A 2WBKA 2MNGA 3K2OA 1HRI2 4LORA 4AFDA 1YCIA 2Y6HA 1EV13 5FMOS 3T09A 4CCEA 1IS4A 4RA0A 3ILFA 1CZTA 2A7AA 3OB8A 1D2QA 4ONUA 3ST7A 2RS13 2TBVA 2WAOA 2WDBA 4Q0PA 4YW3A 4CUCA 4MZUA 1A34A 5A3TA 4IQPA 1IQAA 1XYOA 2ZEZA 3OJBA 4Q4Y1 5FZLA 1JYIA 3M1HA 4RR3C 5EWSA 2LTNA 5JMCA 4W4ZA 3AJZA 1GWKA 1L3JA 2ZPXA 2VQUA 4W8JA 1QH7A 4AGGA 4LO5B 1LJ7A 3GGLA 3RZLA 1AR91 3TN92 2BWAA 1FOD3 4Q1RA 3C2UA 3NWKA 2C6SA 4KBBA 1PGW2 2ZZJA 5HCBA 3O0XA 2D6OX 4N43A 5BNOA 1RUC1 4NIAA 4DINB 5FPUA 5EZWA 3O1PA 4XACA 5F1RA 2OUJA 5HXMA 2DBIA 3NRUA 3V0AA 2B45X 4LKSA 5A32B 1SQ4A 5LRSA 3IAQA 1ZVFA 4RSUA 1UY4A 2WNVB 5FK7A 1U5ZA 3IMMA 3SEPA 5CISA 5L7OA 2D6PA 3FC0A 4G9SB 4XURA 2Z79A 3CF6E 4GZ9A 4N7UA 3M2MA 2P3JA 2XUMA 5HCFA 3B3QE 3S6PA 4RHV1 4LHNA 3L2HA 1LR5A 4QU1A 4M4RA 4Q4Y3 2VXRA 2R49A 2QDNA 1E5HA 3T4HB 1JYNA 3LD8A 3LKJA 2DF7A 2YUEA 1ZM1A 3UGHA 3CZUA 5A80A 4DXSA 3O1SA 3T0BA 1WBFA 3VKFC 3BTAA 2BVBA 5D2AA 5H9RA 4MADA 1N3QA 3DL3A 4YGCA 3UJQA 2WQ4A 4XFFA 2WR9A 4OUMA 1AR93 2QVSB 2WLPA 3J8F2 3ZIXA 1S0FA 1W6MA 1GBGA 1WA4A 4XMAA 3THPA 1XE8A 2BFUS 3O0WA 1NLSA 1TNRA 2YMZA 1RUJ1 1RUC3 2O14A 3NKTA 5JUVA 5F39A 1KXGA 4CCNA 2XVLA 2XQRA 2HKXA 4RGGA 4OI2A 4QX7A 1RUE2 4JC1A 4N43B 5BNOB 1W0NA 1OUXA 3ZN6A 4OHYA 2YBPA 4QPIA 4ARYA 3MIFA 1N3PA 1HDKA 3V0AB 4NN0A 4YZ2A 3PTRB 5ERLA 5AFEA 2JB4A 3AKRA 1IQDC 3ZPOA 2PYTA 4HONA 5AC92 4XUPA 2CWMA 4RHV3 1XBFA 3KVAA 5LY2A 5L7OB 4PDWC 5JXHA 4DUVA 3OBTA 2IXKA 4AI8A 1HW5A 5HV4A 1BQPA 2CSGA 1POV0 3R05A 5IAVA 4YFZA 1ZRFA 3P1IA 5IJRA 2AR6A 3RDIA 2TNFA 3WP5A 1G6NA 1GSLA 2QQPA 4M0NA 5FY9A 2BDRA 1VBC2 5FZBA 4LBQD 2O8QA 3KCYA 4XABA 2D6MA 5LBFA 2YGMA 1RUJ3 2V4VA 2G9ZA 2ZHLA 1VBE1 3I2IA 4Q0UA 2VZ1A 1W6MB 2B46X 4FXGB 5FY5A 5DN2A 1PGL1 1CD3G 2Y6KA 5F6KA 3U78A 4DMIA 4E27A 1ZREA 2Q30A 3IDEA 3RZMA 1YRZA 3CZJA 3LA2A 1S0DA 1UKRA 3AKTA 5DQ0A 5EXOA 1NKGA 1ND3C 3OY8A 2PHRA 1QHDA 3WCSA 1VBB2 3IBMA 2R042 5HXVA 3ZN6B 2P3YA 4QPIB 3UKVA 4WZFA 5FZ1A 2WN2A 1IPJA 4LUMA 4EV0A 4GMP1 5DMYA 3NW4A 4P08A 4YRDA 4DEQA 1AR82 5GLVA 4NR1A 2BRTA 3DKWA 3GZAA 4OULA 1W6OA 2W92A 3B9IA 4JDNA 3IDAA 5IVBA 5A3LA 3K4DA 1EPZA 4RD7A 1W06A 4QQLA 1ND2A 3I4IA 5KC6A 3OGRA 4DXRA 1Y9QA 4QX8A 2OXBA 1AX0A 1TME2 4MUVA 4QXBA 1R091 1AVBA 3VL8A 4ES8A 2AGSA 3WP6A 3VBHA 4AFAA 1OLMA 4YVWA 1COV1 1VBE3 1XRUA 5FAXA 5IFTA 5FZOA 5FMBA 3RYKA 1JOPA 1X36A 1NXD1 2VM9A 1G9AA 5CFDA 2YG0A 2VBPA 3ORJA 4YW4A 3WDUA 1RXFA 1VMHA 4IEPA 4J1WA 1LHWA 4K8FA 3PIJA
chains in the Genus database with same CATH topology
4NVPA 3LCPA 3T2TA 1JYCA 3H50A 4BM8A 5GJ6A 3W9AA 2YDEA 3OGGA 2ZAHA 4GMP3 4B4RA 1KDMA 2C0ZA 1O7FA 2DTWA 3OY8B 4FPOB 2JD4A 1UPSA 1CAVA 3MYXA 2FMDA 3VBFA 1YFYA 2D3SA 4E9KA 2VW1A 3W58A 2FBEA 2IZWA 3AP4A 1C57A 2QZ2A 1W6OB 3U0ZA 3AKPA 2HEWF 1LGCA 1RC6A 3MF9A 1O3SA 4RS5C 1R093 1ND2B 3L2YA 2GN7A 2C5DA 1BBT1 2AENA 1UD1A 2X5IC 3FWEA 4KWLA 2VG9A 3VBHB 4YVWB 4Z8BA 1M06G 1DGRN 1YFUA 3KB5A 1YIPA 1KS4A 3MIHA 3VZOA 5CFDB 1AZDA 4AGVA 2E63A 1QJU2 3MFAA 1VAKA 3ETQA 3MGUA 3N7MA 3ZYJB 3DF0A 5HBAA 3U10A 4FCAA 3OYWA 4YVSC 3RYRA 2D6KA 3WG4A 3TN91 1PVC2 2IXJA 5E89A 3N7LA 3IMNA 1IOAA 1B09A 3LB9A 3PMEA 1CAVB 3ZXGA 4JVAA 3VBFB 2R32A 1H1AA 4O9GA 1E57A 1F31A 2NP0A 4LO8A 3FLPA 3UL2A 2WA3A 3M3IA 3M3OA 1BBT3 4AYUA 1FYUA 1KFXL 1ZZ6A 2PHDA 5K8SA 5T5PA 4AWDA 1XNDA 3B01A 1Z7S2 4YW2A 2CGOA 1X33A 1LKNA 4CEWA 5E88A 3WNXA 1W6NA 3E6CC 2ZMNA 1G8WA 1QNYA 1J1TA 2WZR2 1C8M2 2A6XA 4B29A 3FFQA 1URXA 3NAPA 4R8HA 4R4XA 1LENA 1S0GA 4XDQA 5FLJA 3TN93 2YY1A 2GC0A 2PAKA 4AEJA 1EAH1 5DUUA 4DY3A 4HSJA 3OYWB 4ATFA 5EV7A 5CAZA 1LOFA 4JGYA 4MGYE 3ZYRA 1BVP1 1ZBA1 2D6LX 3FE5A 3K48A 4XFGA 2WQZC 1RUE1 5DZEA 3NV2A 1RMU2 2GNBA 5T3NA 4PLMA 4AQTA 3Q9OA 1QJX2 4PLNA 1MVQA 2CAVA 3T1LA 1N1YA 3ZSMA 5DDJ1 5GLWA 1YUDA 2Q0AA 1AJOA 3KCXA 3M7AA 1XQNA 3N36A 3OGJA 4CEYC 4FTBA 1Q56A 4QQHA 4QM8A 4GALA 1HQWA 2V73A 2YHJA 4XBQA 4ZU4A 2RS51 4CEWB 1PZ8A 3IT8A 1W6NB 4KG0A 1RTVA 3VBSC 4LO7A 1EAH3 5D8AA 3NAPB 3MIEA 1ULEA 1V9U2 2HWD1 2OZ6A 4PQ9A 2LALA 1IKQA 4LBQA 2ZGKA 1ZBA3 4N9IA 2G9FA 1RUE3 2ZAAA 3GZUC 4QGLA 2P3IA 4JGYB 1RJ7A 1SACA 4L11A 4WM8C 3FLTA 4IV1C 2R041 1LGBA 3AB0A 4JRLA 1UZZA 1HQLA 1YHFA 5DDJ3 5F5QA 1RUF1 1W0PA 1SDWA 1AX2A 5AFBA 2ZX1A 4Y24A 2OIIA 4BIOA 4YM2A 1OFNA 4CDQA 4Z2WA 2RS53 1NCRB 2EIGA 1A8DA 3WDYA 4FOYA 2FHRA 4WVWA 1OLQA 1MACA 4FP3A 1MR5A 2FMYA 2R061 1TME1 1RHI2 2JX9A 1XNKA 5I0TA 4LHKA 2HWD3 3WXPA 4EN6B 4CDUA 5D8AB 3UKTA 1MZ5A 1HRV3 5I0RA 2IXCA 1GKBA 4LBQB 1TMF2 3LA3A 3QOPA 3HWJA 5H9SA 4OHZA 3AYAA 2ZX3A 1RUG2 1G9FA 4B4QA 1EV12 2WLQA 1RUF3 1C1LA 1LOGA 2BWCA 1QOOA 3R4UA 1PO11 4AI3A 5T5JA 2RS12 4MVTA 1VALA 5C4WA 2BPA2 4QQPA 5AVAA 3ES4A 4QM9A 3AZVA 5GLTA 1DQ0A 2IXIA 2R063 4R9BA 4W6XA 3U4XA 1TME3 1ZBE1 2EF6A 4B3NA 4CDQB 5K7PA 4Y1UA 3LSDA 3ASIA 1N1SA 4YLZA 4M3CA 2R16A 2AREA 4LT5A 1S2BA 2CYFA 2NYYA 2XKOA 5B2GB 5LK5A 2ZACA 4Q4W1 1FOD2 4M3CF 1GNHA 1ASJ1 3URFA 3WQ7A 1D4VB 1WCSA 4R9DA 4FQZA 1PNGA 3VHRA 4CDUB 4IEXA 4UW3A 2UYBA 4IEYA 3ZFFA 2XLGA 1QJU1 1DFQA 1O5LA 1GZCA 3NVCA 1CJDA 3EXUA 3AMMA 5FDBA 1PO13 2ZBJA 1PO21 5C6CA 2UURA 2DUQA 3ZMNA 5C4WB 1X8MA 1ZBE3 1DDLA 3MF6A 4R9CA 1SLIA 3ZXLA 3AZYA 4Y1XA 3ZFGC 3SMHA 2WNUC 4QPGC 4FPHA 1AR92 3FZ3A 3ZXKA 4Q4W3 3W59A 4OFGA 1ASJ3 4RQPC 5GALA 3B5LB 4M3CB 4XE9A 2BBVA 1Z7S1 4MSVA 1RUC2 4AG4A 1YLLA 1XU2A 1LTEA 4JGZA 1C8M1 1QJU3 4X6RB 4BHPA 1QQP2 3KQRA 4HLTA 3ZFFB 2D40A 1W6PB 3OD0A 5JR7B 5CFCC 2IFWA 1RB8G 5BNPC 2GN3A 1PO23 2VULA 5C33A 2NM1A 2D5FA 4ZKTB 2MEV1 1DQ6A 2ZGTA 4L8QA 4W6WA 2HWB1 1D4M2 1F5FA 4W65A 4P5HA 1SLLA 2R6QA 1QJX1 2PHUA 4HANA 4XHXA 3UKNA 1XYPA 4P9GA 2HEYF 1Z7S3 1RUJ2 1RUH1 1O3RA 1C8M3 1JH5A 4C91A 4OZXA 1VIWB 4K21A 4YG6A 1IZ3A 1UL9A 5GZDA 4AVTA 2B5HA 3MDPA 2I07B 2O1QA 1BJQA 1O4TA 2DFBA 2QDRA 4JGZB 5GZGA 2ZX2A 5L73A 3RRDA 2D6NA 2VOKA 4Z92B 5BV6A 1V00A 4HK8A 2DCJA 4I0WB 4MLOA 4C1XA 1YI9A 2KM2A 5DG1A 1JUIA 2PHWA 4L2NA 3QH7A 1JW6A 1C5IA 2ZMKA 5ACA1 4XFHA 4XIKA 2MEV3 3VUOA 2DCZA 1VP6A 2WFPA 2HWB3 5KHHA 3E5XA 3H1YA 1WMFA 1R082 5JDBA 1QJX3 3WZ1A 1LCLA 4PJYA 3CJIC 4KG8A 3PJYA 1N1VA 1VBE2 1RUH3 3ZSJA 4N53A 3WDXA 3EJKA 1PGL2 5FO9B 1NCQC 1OHFA 4E2GA 1MZFA 4RL7A 4WVMA 5GZFA 3GHNA 4X8PA 5JSRA 1AR62 1ZYBA 3H3UA 3WT3A 5BNNC 2GMPA 4XIOA 3OBRA 4KWKA 4MYEA 5F6LB 3HBZA 3MIGA 4Q0SA 4TWTA 4UBHA 3DUIA 2OYZA 4PF5A 1J1LA 3AKSA 4EN9B 2XH6A 3NV3A 1BMV1 2ZGSA 5ACA3 5F9TA 3WVJA 1MEC1 5JVVA 4K20A 2WSUA 3SXWA 1OI6A 2GC1A 2P37A 1SFYA 3ZFEA 2HWE1 5T5OA 1RUG1 5IK7A 1EV11 2ZGPA 1H9WA 4HL0A 4AVCA 3AFKA 4DPNA 4XHBA 4DZGA 2ET7A 5E16A 4BLJA 3JBG1 1N47A 4A7ZA 5D1IA 4N53B 5KBFA 2D5HA 2VQAA 3R6SA 4Q0QA 4WVMB 1U5XA 2P3KA 1DBNA 3WW2A 2WNVC 2GNMA 2WS92 1QJY2 1CVNA 1OSGA 1QDCA 4AVAA 3POYA 2ZS6B 4DOUA 1SCRA 4L99A 4QX5A 4FXKB 4QU2A 1MEC3 3SHRA 5I8TA 1I9RA 1S0EA 2OPKA 4PIYA 5FOBB 4CDWA 2DVDA 1ZZ9A 1YI7A 3TBDA 1IS5A 2HWE3 1RUG3 1A78A 4V1PA 1BBT2 2ZGOA 3ZFEB 4BQ1A 1ZA4A 2LUWA 2WA4A 2Z2SB 3JBG3 1A8MA 1ZNPA 2E53A 2JEMA 1RJ8A 5KHIA 1FV3A 3VHNA 3ZXJA 1OFSA 3FHIB 4AEMA 1WCDJ 3HT1A 1RIRA 4KGQA 5JAXA 2QZ3A 1FT9A 1V70A 4HSLA 1YO8A 1UU4A 1OOPA 4Y20A 5BYNA 1OMIA 1Q3EA 2XL9A 1APNA 3CLPA 4LLOA 3ZPYA 4CDWB 1QQP1 4HETA 3FBMA 3WP4A 3WG2A 1ENSA 4KU8A 3O14A 4XPVA 3RI9A 4C90A 4AHXA 4XFIA 5DXDA 2IWGB 1BVVA 4RR3A 2G4IA 4YZ4A 1SBDA 1WGPA 3CEWA 3HAGA 3PHMA 1HX6A 1D4M1 3VBRC 2WT1A 4GXLA 4E2QA 1TQ5A 4N9HA 4M0HA 4P9IA 2OW4A 2H6CA 1WUVA 3WDVA 1EAH2 4R9AA 4QPIC 3KT1A 2ZHKA 2EAAA 4GKXA 3PMSA 2GSYA 1C1FA 3H1MA 1ZBA2 5KXDA 1FI2A 4CTEA 4EN0A 2IXLA 4P9LA 4OHXA 3X29B 4XJAA 2XJTA 1U12A 1JXNA 1QQP3 1OOPB 3TWIA 2VNGA 4KGGA 1JTZX 5DDJ2 3KSCA 3VL9A 4SBVA 4D3WA 4AW7A 3AP7A 4CP2A 3WG3A 1I5ZA 3PTYA 4JDOA 2RS52 4L97A 1RGSA 4RR3B 1AX1A 1D4M3 1R081 3BALA 3ACLA 3WUCA 1C3HA 4R4ZA 3EBRA 5C9AA 2IC1A 4I0BA 4FAHA 4IXLA 3MPPG 1G9DA 3WQ0A 1DG6A 2HWD2 1WW5A 4EROA 3THTA 4Q0VA 3MPBA 1HRV2 1S0IA 4YG3A 5J48A 1C4RA 2DFCA 3RZZA 1AR61 3UV9A 5SV8A 4XJ9A 4XQWA 4PDWA 5KHKA 4F7ZA 3MLLA 4B7KA 1RUF2 1H1MA 1PK6C 1SLTA 1RUOA 2BVVA 4XF4A 2TEPA 4LUKA 2QJVA 4PIXA 4FO9A 1Q8PA 3JUUA 2ERFA 3AXDA 2ZGLA 2DURA 2E6VA 1MZEA 2GMMA 2HJIA 1MQTA 4NOTA 1R083 1J59A 2R062 1AR71 1JUHA 4FOWA 1NQDA 1GYKA 1X82A 4GWMA 5FPZA 3VKOA 1SFNA 3A0NA 4XTPA 2K2SA 4IEOA 1QKQA 2HWF1 3EHKA 2ZGMA 5C9AB 1WLWA 4WM7C 2B9UA 2Y0IA 5J37A 2WT0A 4NHLA 1ND3A 3TNQA 4IESA 5C8CC 1WMEA 4QQ2A 3RPQA 1AR63 2ZA9A 4PLOA 4LR4A 3QD6A 4FT8A 1SBEA 1GANA 3N7JA 5FCCA 3FUQA 2WS91 4PBPA 1SLBA 1QJY1 3JD72 4EWAA 2DTYA 4PDWB 1PO12 3DPRC 1Q8VA 3MW4A 1K5MC 1S0CA 2A6ZA 4OUSA 5JLVA 4GQ7A 4OI1A 4BH9A 1LHWA 2E7TA 1AYN2 1AR73 1QH6A 1ZBE2 1ZZ8A 4D7YA 1MQTB 4DS0A 2D3RA 3N7KA 2HWF3 2I45A 3I2DA 2GAUA 4Q4W2 2QUOA 1ASJ2 3V65A 4LBLA 1H9PA 3ENRA 5EYXA 3KZ4C 2XVGA 4ISRA 2AZ5A 4XTMA 5FOJB 3JCIA 1SLAA 2A70A 5K0UC 1FMD2 1ND3B 4LA3A 3E97A 5CNAA 5CG9A 4OHWA 1LECA 1V6LA 1Q8OA 4N90A 2WS93 1QJY3 4HPKA 4CDXC 2JICA 4YZ1A 1V6KA 2HEVF 2JG8A 3IIAA 1GFF2 3QBQA 4MGZE 4G3YC 1PO22 4XBNA 4R52A 4META 4RS5A 5JPNB 3WG1A 1G7YA 1D0GA 1KJLA 2CY6A 5I8YA 2KXLA 1AL23 1I6XA 2DU1A 2KA3A 2X5IA 4CEWC 2Q8OA 4XF9A 3PLQA 1IPKA 3A4UA 3ILRA 4H55A 4XFBA 1HXS1 2RE9A 3NAPC 2PAEA 1J58A 5H9PA 2DUOA 1XU1A 3PVEA 3BOWA 4J6GA 3AMHA 3RWNA 1WD4A 2JE9A 3RMYA 4IV3A 1KRIA 4YVSA 2QE3A 1LOFC 4JGYC 2CV6A 4Z07A 1G86A 3VBOC 1YFWA 2GC3A 4YM0A 2XL7A 3JB8A 4L92A 4OLLA 1ULDA 5A3MA 5I91A 4HPKB 3VHPA 4W6YA 3ZMOA 4LLFA 2JG8B 2MEV2 2WNEA 1Q8QA 5J3UA 4AHWA 2GH8A 2HWB2 4RS5B 3ELNA 3ES1A 1NCRC 3ROUA 2YV8A 2WWSA 1QJZA 3IDCB 1DYKA 1HXS3 1H4GA 5IK4A 1FPN1 2X5IB 3POWA 4YNIA 1IS6A 2PHFA 3KM5A 1RUH2 1PGSA 4FPJA 2BW8A 5FRAA 4Q1PA 2A6WA 5GZEA 1BCXA 4JTOA 2BNNA 2Q1MA 1J3QA 4YARA 3NKGA 5FO8B 1LESA 1OQEA 2A73B 4IV3B 2NN8A 2O8OA 4YVSB 3LA7A 2B7YA 4GWNA 1IGOA 2PN5A 3OPZA 4LBJA 3SCHA 2JENA 2PHXA 1MS3A 2XB6C 2XLAA 3AYCA 5ACA2 3KS7A 1V6IA 2D7FA 1HRV1 3SH3A 3E5QA 1FAYA 3BIWE 1Q5OA 5JOWA 2NZ9A 4B7EA 3KMHA 4XQ4A 4CRQA 4ASLA 4CDQC 1FPN3 1UW8A 4HVRA 1OQ1A 4JV4A 4HN1A 2GDFA 2ZJCA 1BK1A 3FLRA 2XPJA 2ARBA 4XEZA 3CJXA 1QU0A 1WLTA 2NQYA 2PHTA 2EXIA 1DZTA 1PZ9A 1H2NA 1SEFA 4NWVA 3UK9A 4CDUC 4XJUA 4Y26A 2Y26A 3VKNA 1MVEA 1REEA 2JECA 4I3PA 1O3QA 1BMV2 3N35A 1H2LA 1A6CA 2BNMA 1MEC2 1GZWA 2MPFA 5KHGA 4WM8A 2XG3A 3GYDA 4I30A 4ZU7A 4DRRA 1QWRA 3DV8A 3AZXA 1N1TA 5C4WC 4HVOA 1FXZA 2HWE2 2DWRA 2BTVC 1J3RA 3G7DA 1AYM2 2IXHA 3SH5A 2EAKA 2X53S 1XYNA 2V09A 3JD71 4N7IA 1LOAA 2Q1ZB 3FX3A 3O5SA 4Q4V2 2VW2A 3AXEA 3LAGA 1SCSA 3VV1A 3JBG2 3VN4A 2CNAA 1LODA 4AXOA 1WBLA 2UWCA 3D0JA 1V6OA 3SLIA 4AI2A 1AYN1 1LEMA 1DF0A 1GLHA 4Y5Z0 2ZCWA 4P9WA 2A3XA 3MW3A 1NA1C 4UW6A 3ZFFC 1EY2A 2D93A 3QH6A 3UJOA 1KDKA 4FPGA 1U0AA 2DV9A 1F2NA 2F4PA 4BLIA 4M00A 1LOBA 2CTVA 2QKDA 2VOVA 3LOIA 4HK9A 1FMD1 3VDDA 4WM8B 1FX5A 4IEUA 2JKBA 5J96B 4BMBA 1R1ZA 1OKQA 3HN1A 4YSFA 4XILA 3AMQA 3JD73 2OVUA 3KD4A 2K0GA 1PMIA 1CX4A 4XXAA 1Y7BA 1PZ7A 4AHYA 1ULFA 2VOXA 1LOEA 1UN1A 3ZN5A 2ZGQA 4AI0A 1AYN3 5H9QA 5I93A 1RL3A 3QACA 4HKWA 2ETEA 4AQ2A 4Q27A 1VAVA 4P14A 4AVBA 3H1WA 1HQNA 3D4KA 5EYYA 2NMNA 2Q5TA 3ALQA 4MXWA 3BPZA 2GU9A 4Q29A 1FMD3 1YXWA 2ZHNA 4XF3A 3QLQA 1Y43B 1YJKA 4AFMA 3T1MA 2VUAA 3WR0A 1WD3A 4LO4B 3VDDB 2VPVA 2AH2A 2Z69A 4BMEA 4I3GA 4DFSA 1X7NA 5K9YA 4C0BA 3LOBA 3WP3A 4U36A 5L19A 5JOXA 2UWAA 3E6BA 1H8TA 2Q4SA 4ISQA 3AFGA 2PLV3 2ZMLA 2WFF2 1GQHA 4K1YA 4DXZA 2WNUA 5ABJC 3H3ZA 1AXYA 4AQSA 3AMNA 1S0JA 3BOPA 4C0HA 5BNQA 4FPCA 4M3CE 4XFAA 3PNAA 1ZX5A 4X8NA 1YNAA 2QFEA 1DLLA 3AK0A 1PM7A 3WY6A 5TSWA 4AEDC 2UWBA 4HZFA 4Z82A 1WW6A 4MXWB 4ZU5A 5JZGA 2DCKA 1ULCA 2OZJA 4A7YA 5CFCA 2EA7A 2Y38A 5KWRA 1S2KA 2A3WA 5DUXA 4GH4A 3JU9A 1DGRA 3AMPA 3U11A 2VNRA 2I2SA 1H30A 1HKDA 4E4ZA 2GMEA 2R073 5JOYA 3NL1A 1ZZCA 4LULA 2VY0A 1I1EA 2DU0A 3E5UA 2DVAA 4MX3A 4SLIA 3B7MA 1QNWA 1WW4A 4O9EA 1VLNA 1H8TB 3VBUA 2XHKA 1ZZ7A 2JG9C 2N7GA 3B00A 3B02A 3INAA 2WNUB 3CO2A 1OQDA 2AYHA 1W2UA 3N3HA 1VBA2 1LHUA 1YFXA 3WDWA 1JBCA 3HT2A 2DVGA 4Y4YA 4IEZA 5KXEA 2DCYA 5JSPA 4YW5A 4IETA 2WIIB 2BNOA 4LHLA 3NO8A 4DB5A 5JZGB 3J4UH 1QOSA 4IEQA 5CFCB 2FQPA 2LM3A 5T5LA 2WSVA 4GH4B 1ZRCA 2A3YA 4XW3A 3IPVA 1O4ZA 5DG2A 1RUI2 3RQ0A 4E4DX 2VMGA 1DZRA 5FPXA 4XQDA 4YFWA 1RINA 4AGRA 3CJIA 3ECQA 1LB2A 1AR72 4I01A 4HVQA 3KCCA 1Q8SA 1KITA 4CZSA 3VBUB 3MLJA 2HWF2 1AYM1 2ZKNA 4QHBA 1X50A 4Q4V1 4XZPA 3AYDA 1O3TA 4HBNA 1C5HA 3MIBA 1AXKA 1ENQA 4PCRA 4P9JA 5JIAA 4NHKA 4KWJA 5BNNA 2PAMA 4U2AA 4FOQA 1NZCA 5CIRA 4F83A 2XBO1 1WCKA 2CWSA 4CDWC 1V6JA 2CL2A 1MS9A 1WLDA 4FPFA 1R1A3 3OCPA 1B35A 3DGTA 3IPVB 3O0VA 2RR12 2ZX0A 1IHMA 1REDA 4HN0A 3D5OA 3JZVA 1QXRA 4YZ5A 2HYKA 1HV1A 1AL22 1KJRA 5I8SA 4FP2A 1AYM3 4EN8B 4LE4A 4EWDA 4Q4V3 1NG0A 1RUD2 4ITCA 1GV9A 2B42B 2H0BA 4NPRA 1CPMA 3HR9A 4H14A 4EWEA 4IERA 3V0BA 2HWC1 2VGDA 5KC5A 4S2DA 4ES9A 5BNNB 2XBO3 4AVSA 4N43C 5BNOC 3C3VA 4JAAA 5GLUA 5CB7A 4ORFA 1OOPC 5IK8A 4LBNA 2OA2A 3BU7A 3CU7A 5KHJA 4JDMA 2W52A 1U5YA