2IXJA

Rmlc p aeruginosa native
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
184
structure length
184
Chain Sequence
SMAMKATRLAIPDVILFEPRVFGDDRGFFFESYNQRAFEEACGHPVSFVQDNHSRSARGVLRGLHYQIRQAQGKLVRATLGEVFDVAVDLRRGSPTFGQWVGERLSAENKRQMWIPAGFAHGFVVLSEYAEFLYKTTDFWAPEHERCIVWNDPELKIDWPLQDAPLLSEKDRQGKAFADADCFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DTDP-4-DEHYDRORHAMNOSE 3,5-EPIMERASE
publication title Rmlc, a C3' and C5' Carbohydrate Epimerase, Appears to Operate Via an Intermediate with an Unusual Twist Boat Conformation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Isomerase
total genus 44
structure length 184
sequence length 184
ec nomenclature ec 5.1.3.13: dTDP-4-dehydrorhamnose 3,5-epimerase.
pdb deposition date 2006-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ixjA00
5HI0A 5LEKA 3LAGA 3H1YA 1YFYA 1XE7A 5T3NA 3ES4A 1PM7A 3BB6A 2QCSB 3GBFA 1Q5OA 3KCCA 2VECA 4KWJA 2GC0A 5BY5A 1ZZ6A 4QX5A 1Y9QA 3MZHA 2B5HA 5BUVA 1LRHA 2D93A 4AVCA 2BNMA 4KU7A 3H7JA 3NVCA 3BALA 1RL3A 3CO2A 4IEOA 3EQEA 3S7EA 4I09A 3G7DA 3FFQA 4Q0VA 3ST7A 1ZNPA 1RUNA 2UYAA 5F1RA 2XKPA 5AVPA 4HZFA 3H3ZA 3IDCB 4QGNA 3WW3A 2OZJA 2B9UA 2CAUA 2FQPA 4XFCA 2IXLA 5FDBA 1XE8A 4RD7A 4Q0UA 1ZREA 4Z82A 1SFNA 4ZU5A 1DZTA 1YFWA 2KXLA 2E9QA 3CJXA 5BXXA 5LRSA 2HKXA 4HMZA 2GC3A 4MGYE 2ETEA 2Z69A 1YWKA 4K8FA 5JCTA 1EPZA 4L2NA 1ZZ9A 2MHFA 1ZRCA 1UPIA 3FJSA 4IEZA 5BPXA 3E6DA 4J1WA 1O3RA 1X7NA 2Q30A 3RDIA 4P9GA 2XLAA 4F7ZA 4MV2A 1Y3TA 3ELNA 5E1RA 3I59A 2ZCWA 4WVZA 5LEJA 3LA2A 3GYDA 2ET7A 4R52A 1VR3A 4IEPA 1FT9A 3RZZA 3TNQA 3H1WA 4LUMA 2CAVA 3VHRA 4BH9A 4XF0A 1UCXA 4HN1A 3O14A 3H50A 2QVSB 2N7GA 2ZKLA 4FAGA 1ZZCA 4J1XA 1X82A 4IEXA 4IERA 4ZU7A 2PHLA 1ZVFA 4MH0E 1O5UA 3C3VA 4AVAA 4D7TA 4AVBA 3I59B 4X6QB 2DCTA 3E5QA 1O5LA 4IEUA 1L3JA 3S0MA 2Q4SA 3D0JA 1CAWA 5E16A 4DINB 3ETQA 3ZDSA 4EV0A 3D0SA 5FLHA 4HVQA 1OMIA 1O4TA 1YFXA 2GU9A 4OLLA 4N9IA 3WW4A 5FPZA 1CAVB 3FX3A 3SMHA 4O9GA 1H1IA 1QXRA 2IC1A 4LULA 2GZWA 3NKTA 2HJIA 5CU1A 5I93A 4I0BA 4AQ6A 1GQHA 3RYKA 3MDPA 4JV4A 5CVRA 4LLOA 3D82A 5LRRA 1IPKA 2V09A 2FMYA 4IEVA 4BIFA 1UD1A 1SEFA 4MX3A 1CAWB 4QM9A 1JUHA 2GC2A 4MGKE 1QWRA 4XFIA 3MYXA 2OA2A 3N4MA 1QXJA 3U10A 2CV6A 4META 4MUVA 1HW5A 3QACA 1O7FA 1WA4A 1DZRA 4EWAA 2EVXA 1ZZ7A 3S7IA 4LA3A 2PFWA 3LA7A 3SHRA 3IDBB 4Q0SA 2XL7A 1Q43A 3IWZA 3OF1A 2VQAA 4HVOA 2IXHA 1SQ4A 3UKNA 4QGLA 4A2UA 4HSLA 1O3QA 4CYDA 4EWDA 2IXKA 1NXMA 4KU8A 3H1MA 5EFUA 3CF6E 3LA3A 1GQGA 2Z2SB 4XFAA 4TLFA 1PMIA 3I7DA 2MNGA 1VP6A 1I6XA 2H0VA 3L2HA 4HBNA 1ZZ8A 2H6CA 1OFNA 3FZ3A 4XFGA 2D5HA 5BV6A 2XHKA 3LOIA 4LEJA 4I2OA 3ROUA 4QMAA 4BHPA 4QGMA 1UIJA 2EA7A 5JSOA 4L11A 4HVRA 3HIFA 2BYVE 3CL1A 1V70A 1J58A 5I0RA 5I8YA 1ZRFA 1CAXB 3H7YA 4XFBA 5KHJA 3UKTA 1EP0A 2QNKA 2B8MA 1RC6A 3EO6A 1RUOA 2BEOA 2EAAA 1QY4A 2PA7A 3IBMA 4HLTA 2IXIA 4LTAA 3WW2A 1FI2A 1CAVA 1ZRRA 4I02A 2CGPA 1H1MA 4XF9A 1DGRA 4YYOA 2O8QA 3MPBA 5KHIA 1NE6A 3KGZA 5FLIA 4WZCA 4IEWA 4JTNA 3IIAA 3FWEA 5J3UA 1J1LA 5J7MA 2OZ6A 1LKNA 5EZWA 4OFGA 4F8AA 5FPXA 4N9HA 2K0GA 1ZX5A 3SCFA 1FXZA 4BYYA 4IEQA 5JAXA 5K8SA 1EY2A 4PJYA 4JVAA 5I0TA 3PNAA 1UW8A 1O3TA 4QM8A 2GH2A 5D1IA 1UIKA 2BNOA 2P17A 3B02A 4YRDA 4AXOA 2PAMA 3I54A 3CLPA 4KWLA 4I3PA 4I0AA 1YHFA 5JSPA 2UY9A 4E2SA 4EROA 4I01A 3NW4A 2XLGA 4X6RB 2UY8A 3RYPA 5J48A 4ORFA 1XRUA 3JZVA 2Q0AA 5I8SA 4FBFA 2PQQA 4E2GA 4D7SA 2I45A 4Z07A 5I0SA 1ZRDA 3U11A 4MGIE 2D5FA 3OD0A 4ZU4A 2ATFA 2MPFA 3CEWA 3ES1A 3TNPB 2D40A 3NJZA 4EWEA 3OGJA 3E97A 4QXKA 4XF4A 3SXWA 2XLFA 2WFPA 4FAHA 3HT1A 2F4PA 3H3UA 4Q0QA 4XFFA 1O3SA 4KWKA 4AQ2A 4LUKA 2BGCA 3BCWA 2K9ZA 2XL9A 2XKOA 1RGSA 5FQ0A 4O9EA 5FCCA 2UYBA 3PVBB 2OYZA 4GULA 4E2QA 5FLJA 5I91A 5JR7B 3R6SA 1J3QA 4Q0PA 4UBGA 4XETA 1CAXA 2PTMA 4IETA 1LR5A 3E5UA 2BNNA 2Q1ZB 4PIXA 1WLTA 5KHHA 3ACLA 3DN7A 2Y0OA 4MGZE 4XF3A 2QJVA 5CADA 1CGPA 3DV8A 3SCGA 1U12A 4PIZA 2VPVA 3E5XA 2OPKA 1X8MA 1J3RA 3QOPA 4WBBA 4IEYA 3U0ZA 3EJKA 5FQ0B 1YFUA 2PAEA 1G6NA 2GC1A 3FE5A 4YSFA 3BPZA 3LWCA 5KHGA 1OI6A 3NL1A 3DL3A 4YNIA 2PYTA 2IXJA 3H9AA 1LB2A 3OTFA 2QDRA 4FT8A 5KBFA 3E6CC 1NZCA 1OD5A 2IXCA 1ZZBA 1IPJA 3M3IA 4B29A 2XGXA 3KGLA 4PIYA 3RNSA 3PLQA 5I8TA 4H7LA 1YUDA 3USSA 2H6BA 2WC2A 4ONUA 2ET1A 5I0UA 2GAUA 4XEZA 4IESA 3M70A 1DGWA 1NE4A 3KMHA 3FHIB 4HN0A 1YLLA 5JSRA 1X8EA 1TQ5A 4R8HA 1RTVA 3HT2A 3LZZA 1I5ZA 5C6CA 1CAUA 3SCHA 1J3PA 1J59A 4KL1A 3E6BA 1EYBA 4UXAA 3OCPA 5C8WA 3UKVA 2PHDA 3EBRA 2O1QA 3WW1A 1WGPA 2PAKA 4Q29A 2C0ZA 3HQXA 3RPQA 3KSCA 4HSJA 1Q3EA 3DKWA 4NVPA 1VJ2A 1CX4A 3H8UA 3BU7A 1NYWA 4UBHA 4MZUA 4YARA 3EHKA 5KHKA 4XFHA 4LA2A 4JTOA 4XF1A 1CAUB 3NSTA 3RYRA
chains in the Genus database with same CATH superfamily
1GZTA 2UU8A 3DXTA 5A32A 1XE7A 1W8NA 2VZQA 4RGKA 4A41A 3DXUA 4AW7A 4CDWC 2WN3A 2DBIA 4PLOA 2DVDA 3LEMA 4PHZA 2AENA 1D0HA 2HBUA 5J09A 4CA9A 1AR92 2WNUC 1HN0A 3KCCA 2GC0A 3AXEA 4W6WA 1S1AA 1SFYA 3WHUA 4L97A 3IAQA 4KU7A 4QXHA 4LBMA 4ASKA 1RL3A 1UYPA 2EAKA 3WNMA 4CXYA 4BQ4A 1MZ5A 3R4UA 3MW4A 2FDHA 4C0HA 2J1VA 3Q8BA 3WNKA 2YU1A 1ZNPA 2BWCA 2WS93 4NIAA 1RUNA 3OGSA 4XCBA 1NCQA 5IAXA 2XKPA 1BBT1 3I3EA 4UW3A 4JGYA 2JDUA 2JD9A 1UNBA 1GWKA 3A0NA 1W2TA 3CJIB 3LIHA 3OUJA 4QGNA 3K4DA 1BQPA 1BVP1 4M3CE 4Y5TA 5FZMA 2VMCA 3ABZA 2R063 2Z5WA 2CAUA 4Q1RA 1QJY3 1DIWA 1OFSA 1XQNA 5LASA 5FO7B 3WLUA 4BM8A 1LU1A 1NY71 1QJFA 2JDNA 4RD7A 2C5DA 5J37A 2MEV1 1KS5A 3ZYGA 1SFNA 3VKNA 4LKSA 3ZYFA 2BP6A 3GBWA 3MUZ1 1AUYA 4BDVB 2W52A 1AYM2 1YFWA 2E9QA 4P9JA 3UETA 2VY0A 2ZEZA 1C8M2 2OPWA 5E8AA 1E5HA 1TNRA 4HMZA 4COZA 1W8UA 5FO8B 3LD8A 2AEZA 2Z69A 1WLCA 3G6JB 4FPJA 1YWKA 4GMP1 4M3CA 3VL9A 1Y43B 2YV8A 1XNCA 2ZEXA 3OYWA 3OB8A 1EPZA 4JX0A 5JCTA 4L2NA 4N43B 1PX3A 4MLOA 4RR3B 4L92A 4RSUA 4A6OA 4QQHA 4DUVA 3DYOA 1ZRCA 3C7HA 1YYNA 4CEWB 5JXIA 1OQDA 4J1WA 4YVWC 3IB3A 1PO11 1XBFA 2Q30A 4A42A 4XXPA 2D3RA 3WQ1A 1Q8SA 1XNBA 3KV4A 4BK5A 1Y3TA 3N9LA 4TZDA 5T50A 2JIGA 1W3VA 4XUNA 2GMPA 1E5IA 5JWPA 4B4PA 3BIEA 2YXSA 2Y64A 5GM0A 3WNPA 1VAKA 3GYDA 4R52A 3C8XA 3MF9A 1BBT2 2E51A 3HN3A 3TNQA 2PHXA 3H1WA 2I74A 5CNAA 5KXBA 5FYCA 4BH9A 1AL0G 1S0DA 1UZWA 4BQ1A 3NQHA 4BWOA 4M4PA 1YC61 1XYPA 2RM21 3O14A 1JN2P 3QD6A 2GNDA 4KGGA 4D0QA 4W6YA 4D6QA 2AC1A 5F5QA 4FAGA 4OHYA 1QF3A 3O1MA 1NY72 4NHKA 3VBRB 4EE2A 1VBB3 5LK5A 1AYM3 1GNHA 1W03A 4ES9A 3BODA 4Q4V3 5IYYA 4IERA 2BTVC 4PDWA 1JZ8A 1C8M3 2V5DA 5C3PA 1HQWA 2ORZA 4HKOA 4XUTA 1LAJA 4FPGA 3V0BB 4H14A 1VPHA 4D7TA 4AVBA 3K4AA 3N9PA 1F15A 2AACA 4IW3A 2VTFA 3ZXLA 5F3GA 2GP5A 2JWPA 3USUA 2P3YA 3PTRB 1OA2A 4BXFA 4CXXA 2LALA 3S0MA 3F2ZA 1W8TA 3D0JA 4YW2A 4AVTA 4CTEA 2WAAA 5DMYA 2NPIA 3ETQA 1X50A 2FCVA 3LPGA 2VZRA 5LA1A 1PO12 3HQUA 5JMOA 3ASIA 5LWBA 3VDBA 4HVQA 1PGL1 4R4ZA 5FP8A 4B1MA 1AX0A 1VAVA 2VQTA 2ARAA 5FY1A 4Z92B 2DVGA 4JHZA 3ZFEC 4OLLA 1RUH1 2PHRA 4COUA 1JZ6A 2QQNA 1ZA4A 3CHXA 2VU9A 1SLCA 4A3XA 5FPAA 1LGNA 5L9RA 3AMMA 5EV7A 2JIJA 5FUIA 3KQ4B 3WG2A 2B9VA 2F4LA 3WG4A 2JKBA 2WWJA 5CU1A 1JTZX 4AQ6A 5KXEA 3RYKA 1RXFA 4KMQA 1U5YA 1W9FA 2C4XA 5CVRA 2RM22 2PLV1 4XPVA 1WUVA 1SPPA 2ZX3A 4OQ9A 1GP5A 2FMYA 2PMWB 2VJXA 4DY3A 5T55A 3WDUA 1CAWB 3BYWA 1AR73 1JUHA 1LGBA 4QM9A 3GXUA 2CV6A 2WL1A 4NIIA 5D8AB 5EPAA 3FBYA 3V64A 2X5IB 1CIWA 3SH4A 4ISRA 4ZPIA 4BIOA 2Y6LA 2XJSA 3AMNA 4YGBA 2E33A 4UAPA 3U37A 4P9YA 3RMYA 3LA7A 2ZS6B 1CN1A 1PNFA 3IDBB 1PO13 1QKQA 5HCFA 5A6YA 1CONA 3SITA 1NCQC 2XQRA 2DCZA 3KV6A 1KQRA 4KBZA 3AM2A 4JGYC 1XNKA 4YM0A 4Y20A 1YIFA 4YGCA 2RJ2A 3FFZA 3UL2A 3N3HA 4DFSA 1PGL2 2A71A 1V6MA 4A2UA 1K3IA 3D6EA 1O3QA 1RIRA 1RUH2 2CDOA 1OQ1A 1AJKA 4RYDA 1G9FA 3LA3A 4GWJA 4LR4A 1GSLA 1VBE1 3HOBA 3AP4A 3TRSB 5AC91 2F17A 3QCWA 2B46X 3JQXA 3SQOA 5FJHA 3UJQA 3EXUA 1S2KA 1DZQA 1YEWA 5JOWA 1VP6A 4NO4A 2W0XA 5JLVA 3O1PA 1I6XA 4Y22B 3L2HA 4HKLA 5GZEA 4ET7A 4HBNA 4URAA 5A1AA 1S2BA 5T54A 4UWDA 3PL0A 5KBFA 5FY7A 1DBNA 3MW3A 1OSGA 2PLV2 3KV9A 3MW2A 3FZ3A 1POV3 3M4FA 4UW5A 3V0BA 1GR3A 3IPVB 4FFGA 3AFKA 5BV6A 3LOIA 4ISQA 1BHGA 1OC1A 4UFKA 4OMCA 3S5QA 1H8TB 1X36A 3RJRA 3POBA 4KI5M 3AB0A 2RS51 3NAPA 3ACGA 4K21A 2SLIA 3AJZA 3VBFB 2VOXA 1RUF3 3NJVA 3WNXA 4CU9A 3K3NA 2R1BA 1S0EA 1ENXA 1ZRFA 4CP2A 5C3SA 1CAXB 1ASJ1 4Y1UA 4ZXKA 3WD5A 4M0HA 4RFT0 2DTYA 4PBPA 4DXTA 2DUQA 2VZPA 1RUH3 1W6MB 1N1SA 2PHWA 3IBMA 2IXIA 5C8WA 2JDHA 1CAVA 4I02A 4K7JA 3ZM8A 2XMLA 2ZX4A 1QH6A 5KHIA 3MPBA 3VN4A 2YB7A 5FZ7A 4S2GA 2WWSA 4BISA 3LEIA 3QLQA 5BNQA 4BB3A 1WZXA 1VBE2 2BUKA 3AJYA 3FUOA 3IIAA 4JTNA 4NJ4A 4YM1A 1US3A 4LQRA 4PDWC 3U78A 5AC92 5J3UA 1J1LA 4QT6A 5J7MA 1NCRB 1ULGA 1MS1A 2WUHA 1SBDA 3OBAA 5G05L 2XJUA 2ZJCA 4FI9A 4N53A 5A70A 3J8F1 4F8AA 5IFPA 2ZBJA 4LO8A 2VGDA 2ZHMA 3BUCA 1GWMA 2A3XA 4XHBA 1IOAA 4AOCA 1FXZA 5FZ1A 4IEQA 3U75A 1JS9A 4CEYA 5C3QA 1EY2A 4JVAA 4UF0B 3PNAA 3O0WA 3PVEA 5D1IA 4GZ9A 4BQ2A 4B4QA 1T6GC 2J7MA 3OBTA 2E63A 3ZXDA 4ES8A 5C5UA 4Q27A 4LXLA 2ADDA 2RS52 1GICA 5IVYA 1AL23 1WW5A 1UZZA 1NOVA 1XSQA 1AF9A 1RVF3 2P17A 3A21A 3B02A 3R4SA 3CLPA 4CCNA 5JOXA 2WNEA 5FBZA 1ZA7A 1PHMA 4ZS3A 1MEC3 4LIUA 2FCUA 1MVEA 3AZYA 1UY4A 3GGLA 4XW3A 2OW4A 1HRI1 4XZUG 4FO9A 1ASJ2 1Q8VA 4Q8KA 4EROA 1VALA 4QKBA 4I01A 3NW4A 5FMOS 1K5MA 2XLGA 1IG0A 1JH5A 1W2OA 3PVNA 2O0OA 1YIPA 2QFEA 5EJ1B 5FPLA 1UQXA 1R1ZA 3O7OA 2CL2A 2D6LX 1VBE3 2DCYA 5I8SA 1VRBA 5AC93 1ULDA 4R9BA 4YZ1A 5H9QA 1SCRA 4OCTA 2I45A 4MGTA 4Z07A 1VBA3 2WQZC 4PF5A 5A7PA 5I0SA 4DY5A 2VQUA 4MGIE 4QPGB 4ZU4A 3S57A 1GBGA 1GNYA 3B69A 3ES1A 1HN1A 3CBNA 4E4DX 5GLWA 3ZKUA 3SXWA 4QXKA 1JZ2A 2EIDA 3VZOA 5DUUA 3J8F2 1VRH1 2JG9B 1WMDA 1AYN1 1YQ6A 2WSUA 2VOVA 2F4PA 3H3UA 4OI2A 2V5YA 4Q0QA 5A3PA 4LUKA 3BCWA 5C3OA 2IUWA 2K9ZA 1G86A 3ZSKA 4AQSA 5FQ0A 2RS53 1KXGA 4B1LA 3ILFA 3N9MA 4JAAA 3P3PA 1KRIA 2W2IA 1FMD1 1W6PA 2W47A 2FCTA 1PVXA 5FLJA 5JR7B 2A73B 3T4VA 5I91A 1R1A3 2FZ1A 4PQ9A 1ASJ3 3RRDA 1BYHA 1OURA 3JBG1 4GIQA 3ACFA 1RUG1 2Q1ZB 3WY6A 1JODA 4QHBA 1JYVA 3VDDA 1CZTA 1HRI2 3LFIA 4PIXA 2BOIA 3THDA 4GH4B 5DDJ3 5KC6A 1TE1B 4BOWA 3MLKA 2VCCA 3VD3A 2WN2A 3KQRA 1AR62 1FNZA 1NAEA 2Y0OA 2YZ4A 1QDOA 5FXWA 3VD9A 1DQ6A 4XTPA 3ZXFA 1QIQA 1H0BA 4CPBA 4MYEA 1JUIA 2OPKA 1F4AA 2VOWA 4QPIA 5KXCA 5JIAA 3RS6A 4AI9A 4WV8A 5FPUA 1IQAA 3LCPA 1L7RA 4FPFA 4W6XA 1UZVA 1SBFA 2XJTA 4NPLA 2CWSA 5FZ8A 4FPLA 5A3TA 2PAEA 4XUPA 5GZGA 1DYKA 2KA3A 3FE5A 5FYIA 3WCSA 3N7LA 3GZUC 3LWCA 2AGSA 2WZ8A 2XVKA 3NAPC 5DAQA 5F5AA 4CP9A 3HN1A 1OI6A 5DG2A 1VRH2 5A7WB 3T2QA 3KS7A 2K46A 1AYN2 2IXJA 5K9YA 2Y6FA 2ZMLA 4YG0A 2Q1FA 3RZHA 3CU7A 1W6NA 3KCXA 4RS5B 5F6LB 3THPA 4BK4A 2BGOA 2QDRA 4FT8A 4MOAA 4RQPB 2EIGA 1XOYA 4Y33A 3HAGA 1OD5A 2CGOA 4A44A 2DV9A 3M3IA 3KGLA 3RNSA 1FMD2 1TMF3 2NLRA 2NQYA 3B00A 2X29A 1HRI3 3MV11 3AMQA 1LOAA 1BEV3 2ET1A 3VV1A 5I0UA 4DEQA 1PGSA 3JBG2 3O1TA 1BKZA 1RUG2 3H3LA 3WCRA 1TZOA 3NV2A 1JYIA 1AR63 2DVFA 4IESA 3UESA 1DG6A 1NE4A 4NROA 4MXWB 4OULA 3RWKX 4GAZA 4YW4A 2W3JA 1JXNA 2VUJA 3TEXA 2VZOA 4N53C 4Q2FA 4QAWA 1UKRA 1I5ZA 3FLRA 1CAUA 5C6CA 3O1RA 4CP1A 3T0AA 4MGSA 2VTXA 2BZDA 2YC4A 3E6BA 2WLPA 1UZYA 4CEYC 5JPMB 5JR2A 3SEPA 1N1VA 4AGRA 5F32A 2WZEA 2Y60A 2O1QA 4XZPA 1H8VA 3WW1A 3RSJA 4LE4A 5FYSA 1WGPA 1AYN3 4Q29A 3UGGA 2C0ZA 2RS11 2VG9A 4QQ2A 5EYYA 1U5IA 2CYFA 4HSJA 1Q3EA 2NMOA 4INDA 1C3HA 4PI0A 1CX4A 2DYCA 3J7LA 3DPRB 2WFF1 4AAPA 1NKGA 3BU7A 2ZZJA 1MR5A 3PVOA 1UYXA 2DUOA 3MBWA 5T5LA 1MS4A 4YARA 1RXGA 3EHKA 3KM5A 5FY5A 5TSWA 1A78A 1K5MC 1Q8OA 1JYXA 4IE6A 1JHNA 2BVVA 3VKFC 2HWC3 4JTOA 1J83A 1HXS1 3ZIXA 4LHSA 2ES3A 3RYRA 4CDUB 2BRTA 3P6BA 1PNGA 3VBHC 2WT1A 3CJIA 3SKJE 1OOPB 3X29B 3LAGA 1HIXA 3H1YA 1DLLA 1YFYA 2WNUA 5EHDA 1H6XA 4XDPA 1W9YA 3WZ1A 3K77A 2P6HA 4A45A 3CDZB 4E9KA 3A7QA 3VZMA 5KWRA 1DGLA 1V9U1 2A1XA 2E6VA 2VOKA 2RR11 2J1TA 1UOJA 4QX5A 3TWIA 3WF0A 2B5HA 2D93A 2HH9A 2BNMA 4FQ4A 5L19A 3H7JA 3NVCA 4FPHA 5F2WA 4WVMA 3NNJA 5FKCA 2B4KA 3CO2A 5FUNA 5IJRA 5FYMA 3EQEA 4GQ7A 4I09A 3G7DA 2WYFA 1QJZA 5DAVA 4D8MA 2YFUA 1HRV1 1CJDA 1ZBA1 4Q0VA 2Y6HA 3I2IA 2P3IA 2AREA 1YQCA 2VMHA 2XXZA 4N43A 2XWBB 1W0PA 4LOTA 4RHV1 4CCCA 3AMPA 5T52A 2RJKA 4CEWA 4BMEA 5GZCA 2L9LA 2VBDA 4V2WA 1MPXA 2RS12 5AVPA 2C1FA 3WEZA 1QQP1 3MIHA 4L0PA 4OUMA 2WFF2 3VDDC 3BTZA 2ZZQA 3B9CA 3RFRA 4KQ7A 4XFCA 4NPRA 2CU5A 2FDJA 3V65A 3OBRA 4Z82A 3BPSA 4NR1A 4ZU5A 5L7OB 1HXS2 2BERA 1RMU1 1WA6X 1DZTA 4QD2A 5FZ0A 2FBEA 4W8JA 4EN0A 1QU0A 5BXXA 2D3PA 2HKXA 3LKJA 1L7LA 3KWVA 2Q1MA 5C8CB 4QPIC 3UV9A 3C7GA 5LB6A 2ETEA 4DIQA 4QQPA 3AYEA 3VBOB 2JECA 5FR3A 5FZLA 5AVAA 4EYUA 3VBRA 1QJU1 1V9U2 5JXHA 4WM8A 1WCQA 2RR12 2NM1A 4P14A 3LE0A 5CZKA 2GDFA 4RA0A 4YZ5A 4P9GA 2WT2A 3B93A 3MV01 4F7ZA 5BNOB 1OHFA 3ETPA 1ODMA 5IHRA 3ELNA 3VD5A 3RQ0A 1LNSA 4PQQA 1W0NA 3C7OA 1PZ9A 5LEJA 4FFFA 1ZBA2 2RS13 4RHV2 1R081 2ET7A 1FT9A 3N36A 1QJX3 3H8RA 3IM0A 4OZXA 3OSDA 2WFF3 4LUMA 3OPZA 3POYA 2CAVA 2E7TA 3VHRA 1UL9A 1QQP2 3GF6A 3LB9A 1UCXA 4AI3A 2ZGSA 3H50A 4QKFA 2Q8CA 4C1XA 1HXS3 1W06A 3OY8B 2QE3A 1AXKA 1X82A 4HK8A 2Y6KA 1WMFA 1BCXA 4YGDA 4ZU7A 3R05A 3IDAA 1RMU2 5FTTC 4MH0E 4QKDA 1O5UA 5FZEA 4IGPA 5GJ6A 4Y24A 2XVLA 2P4EA 4LHLA 2QZ3A 4XJZA 2WINB 4XFIA 2DF7A 4FXGB 4X6QB 1R64A 2J42A 3U4SA 1G9BA 2AH2A 4EN8B 1NLQA 1S4CA 4IEUA 1V9U3 4XJUA 1QXPA 2WABA 5C70A 1D7PM 1LULA 1QJU2 1CAWA 5EQUA 5GLUA 4Z2WA 3DYPA 4DINB 1CPMA 1D0GA 1FAYA 1HB1A 4U2AA 4YLZA 5FLHA 4Z2AA 5CB7A 5D8AA 2DVAA 4M0NA 4IQPA 1W8OA 1O4TA 1WD3A 4P9LA 4Y1XA 2X5IA 3WW3A 1ZBA3 2GU9A 2W1UA 4A3ZA 4N9IA 1H6YA 1OPOA 1XXNA 3BOWA 5FPZA 5FPBA 1ULFA 1LHWA 1YI9A 3N7JA 4AI0A 3ZOIA 2JDKA 1OH3A 4Y4YA 1HB3A 2BOJA 3W9AA 4O9GA 4ZZ8A 3OUHA 2IC1A 4LULA 1RUI1 1K42A 3PUSA 1QQP3 2WNVB 5A7OA 4CUAA 2J1SA 3NKTA 2JEMA 3GHNA 5I93A 2OS2A 1PMHX 2WYSA 3CJIC 3CNAA 2GN3A 4JV4A 2EICA 3EB7A 3D82A 3VKOA 1CX1A 3L2YA 1RUD1 4XQDA 1O6UA 1H4GA 3ZSMA 5FXZA 1COV2 5DAPA 2Q8OA 1UU5A 4MX3A 4DRVA 1UY1A 3W5MA 1F9KA 1ND2B 1WW4A 1HW5A 4META 4MUVA 5DZEA 2VVDA 1TME1 4JQTA 5GLZA 1DZRA 1S0GA 2ZGQA 4Y22A 3ZYBA 1X9TA 2EIBA 2OQ7A 1LOGA 2XUEA 3M3CA 3A0KA 2HEYF 4WM7B 2ZHLA 4LK7A 4MO3M 4LA3A 1FATA 4N43C 5D21A 4RR3C 3POGA 3SHRA 3PURA 3GZTB 3KVAA 4AFCA 1B35B 3KCYA 3TBDA 2GALA 1LOEA 3WNOA 3AZXA 1W0OA 4CEWC 1AZDA 3B7MA 3PUAA 4BLJA 1JHJA 5IK7A 3ZPOA 2IXHA 1SQ4A 5JI7A 3UKNA 3I8TA 1ND3B 3WINE 3ZN6B 1C5IA 5EP9A 3HEIA 5LBFA 1W6OB 1GZWB 3N9OA 5BNNB 5EFUA 4YZ2A 3CF6E 3SNMA 4QB1A 1G7YA 5E6HA 3BOPA 1YI7A 2ZEYA 4HFSA 4XFAA 3QBQA 2WJSA 4G4FA 4IL7A 3UT0A 1RUI2 1ENSA 1UN1A 5CYYA 1H9WA 4AHXA 4AGVA 3N35A 4RGGA 1AR93 2E7AA 2D7FA 4XABA 5FZIA 4CDWB 5CKQA 1W6MA 5KC5A 1YRZA 1F35A 4E27A 2Q8DA 2H6CA 2D98A 1COV3 1LOFA 1YJKA 1H1AA 3JD71 2XQXA 3LFMA 3ZXEA 5JZGB 3UGHA 3WUCA 3VBRC 1RUD2 2WO2A 3VZKA 3ILNA 2D5HA 1UXXX 5GALA 4GB31 5GZDA 1SACA 3CZJA 3ROUA 3KT4A 3ZKYA 4BHPA 4CU7A 5IVBA 4WM8C 4HPKB 1NCRA 1LESA 2SBAA 4O65A 1O8SA 3C7EA 1TME2 2D6NA 4XIKA 3GNEA 4HVRA 3W21A 2VAUA 3KHBA 4QX3A 3KHCA 3CL1A 5HBAA 4FTBA 3GALA 5I0RA 2YC0A 5T5OA 1JMUB 2HWB1 5DN2A 4XC9A 4NE9A 1RHI1 2R041 4UT5A 1JOBA 2VZ3A 2B45X 5FP3A 3RGBA 3VBUB 5KHJA 4UF0A 4BQ5A 4YW5A 1HX6A 2E53A 1JU4A 2QQOA 4JKLA 4F3JA 2QNKA 5M0TA 3EO6A 3U14A 1RUOA 4QX8A 2BEOA 2PA7A 3AP7A 3HVDA 3VUOA 1FI2A 4QQLA 1KS4A 1QEXA 5EJZB 4XE9A 1UMZA 4QB2A 3WP5A 1GU3A 4B4RA 2MEV2 3GZEA 5EXOA 4YYOA 3S30A 3ZIWA 2JKXA 3SH3A 3ZSLA 4Z1VA 5FLIA 4WZCA 2WIIB 3I4IA 1WW7A 2X05A 3DYMA 3WP3A 1XC6A 4UFMA 4YVSB 4YZ3A 5C7GA 2OZ6A 1V6KA 1GNZA 3M2MA 4MVTA 5EZWA 4OFGA 5FPXA 1NX9A 2W87A 4SLIA 1G9AA 1S0IA 2ZGUA 1RUJ1 1VAMA 1W99A 4YVWB 3JD72 5IVJA 4BYYA 2JDAA 4NAOA 4PLNA 4ARXA 4OYUA 4YFWA 1V6JA 4GWIA 1UW8A 4QQOA 5FYVA 4OI1A 4COVA 2OXBA 1TME3 3ZYPA 4UI9L 3RZJA 3GCXA 1NG0A 3KB5A 4LO4B 4CVUA 3PUIA 5FYHA 1MZ6A 5F9TA 5D8AC 3HBKA 3AL5A 4CDXB 4QX2A 4A7YA 2OVUA 4YRDA 2X5IC 1BBT3 2B42B 2VMFA 1LODA 1G8WA 5ABJA 3KZ4C 4UW4A 4XACA 2HWB2 3HD8B 1QNYA 4I3PA 3TN91 3ZLIA 1RHI2 2R042 4NIHA 3WF3A 1YHFA 4BQXA 5JSPA 2RVAA 2UY9A 4Y26A 4ZY9A 4E2SA 1C8NA 3ZFFB 1XNDA 3DECA 1LHNA 4J25A 3I2GA 4MHRA 3Q8FA 2MEV3 4XXAA 1DDLA 1Y4WA 3JZVA 3VBSB 2V73A 3OGVA 3OG2A 4FBFA 4QB6A 2RHPA 3RJ2X 4E2GA 4XDQA 3NV1A 1HQNA 1VMJA 2D5FA 2R30A 3OD0A 2ATFA 4GMP3 2FDKA 5F5CA 2LTNA 5FZGA 4IV1B 4Q26A 3OGJA 5J98B 2KD7A 4RR3A 5DUWA 4OMDA 4FPCA 2OUJA 3CIHA 1U0AA 1CESA 1ULOA 2J1AA 4AQ2A 1RUJ2 4Y5Z0 1O3SA 1EUTA 2Z4FA 4DXRA 3NO8A 2VXRA 4IV3B 3DGTA 4V1PA 2UURA 2XL9A 2XKOA 5JOZA 3TEZA 2BPA2 1DQ1A 4LORA 1RGSA 4BPZA 4YM3A 5FV3A 4O9EA 2ZACA 2VD7A 3JB8A 4Q8LA 1DQ4A 2RDQA 4E2QA 1C4RA 4NN0A 3RMXA 4C0BA 2HWB3 3ON7A 3VBFC 1VLNA 2RS31 5A7WA 4UBGA 3BU0A 1BLZA 1SLLA 3LOBA 2QQIA 4DUWA 2BNNA 4AEJA 1NA1A 4W50A 1PK6A 4TLGA 4RS5A 2XH6A 2VVFA 4X8NA 5FUPA 1EPWA 4RQPA 1VB2A 3IMNA 4XUQA 3SEEA 2RM23 4H7MA 3IMMA 5LW9A 5A32B 2AEYA 5BNPA 2W92A 3EYPA 3INAA 4MGZE 3ZXJA 1OBNA 1GOGA 2ZX1A 2QJVA 5H9PA 1SLTA 2TNFA 3DV8A 5B4NA 1FOD1 1U12A 3ZDVA 4LO5B 1NQDA 3HJRA 1LOFC 1VIWB 1X8MA 1J3RA 1YJLA 2VCAA 1GYKA 4MGQA 4B8EA 2VUAA 1D2SA 1HQLA 4WVWA 5FRAA 4AEKA 4NPMA 2G9GA 1G6NA 1NCRC 5LCWL 5FO9B 3WUDA 4YSFA 1UOBA 2ID4A 2YG0A 2WSVA 2A6XA 4J6GA 5FP4A 5KHGA 3ZXGA 2JDMA 3T2TA 4H3WA 2A5ZA 1F5FA 3K3OA 1RUC1 3WNLA 2QUOA 1LB2A 3OTFA 4UFIA 1OUSA 4AF9A 3MLLA 4ASMB 3E6CC 2C26A 4P00B 2VW1A 2QQKA 3ZYIB 5JXGA 1LECA 2VVEA 4B29A 4M3CF 1STMA 3AYDA 3PLQA 2ZGTA 3I2HA 1L7QA 4H7LA 4YFZA 3NNLA 5C5TA 1YUDA 2VE1A 1DQ0A 3T08A 2RS32 2Y8KA 2Y38A 3WDXA 3V56A 3VHNA 1NLSA 3POWA 1MZEA 2GNTA 4COWA 4ZHNA 1DYOA 2P3KA 4CU6A 3VKMA 5JOYA 4XEZA 5CA6A 3M70A 2I07B 1DGWA 3J7NA 3KMHA 4GA9A 2PLV3 5DAWA 1S0JA 3FHIB 4NWVA 4CDQA 1YLLA 4ZKTB 5K0UA 3K4ZA 4M3CB 1KJRA 1JYCA 3LZZA 4C8DA 1OT5A 1FOD2 2LW8A 1JYWA 1DGRN 1J59A 1F31A 1MQTA 1OOPA 3GBGA 1EYBA 3WF4A 5FZDA 4UXAA 4XDOA 4AEDB 4LKDA 3NKGA 1C1FA 2BFUS 2OKXA 4UFLA 5CFDB 2VOTA 1W2NA 1OLQA 4S2DA 2GMMA 2D6OX 4HT1T 1WLDA 5HXMA 2TUNA 5IK8A 3DKWA 5A33B 5A3MA 3MIDA 5FZOB 4L9BA 5ABJC 1G9DA 3ACHA 2ZGMA 3TN92 3BI3A 1RUC2 3H8UA 1U5XA 3ILRA 2HWE1 4CSWA 4YW1A 2CHHA 2BBAA 2QQPA 3FLTA 4FTEA 1SHWB 3ZPYA 2PHTA 4IE0A 3VD4A 5FYYA 4YZ4A 4G3YC 2RMU1 2WQ4A 3WVJA 2PELA 5FYZA 4XF1A 3VBHA 4K9SA 2XDVA 3RZLA 3O1SA 1W8HA 3NV4A 1PIV1 4IXLA 3NSTA 3NJYA 5CKMA 1RYYA 1QNWA 4PDWB 3ZYJB 2OUHA 1YQ5A 3GZAA 5LEKA 5FWJA 1RJ8A 4LO6B 5T3NA 5A3NA 2EXIA 3OEBA 1PM7A 2IVJA 1K45A 4GH4C 4Q4X1 5FPVA 1H2LA 3NMBA 3VZJA 5ACA1 4AYUA 2ADEA 2D6MA 2QCSB 3FBMA 4FFIA 1Q5OA 2WR9A 2VECA 4KWJA 4BCUA 5BY5A 4CXWA 4UYBA 2ENRA 1KITA 1Y9QA 4I3GA 3MZHA 4LBQB 4GWNA 3OGRA 1LCLA 2GN7A 4FOVA 4XIOA 3B01A 5BUVA 3BALA 1NXD1 3LDKA 5C8CA 4LKEA 4XJAA 4AL9A 4JZRA 2Y34A 2NN8A 2J22A 3QH6A 3VBOA 2BDRA 1Z7S1 1FX5A 2VMEA 1M06G 3ST7A 4RGAA 5H9RA 4EQVA 5F1RA 3MFAA 4QPWA 4HXCA 3WOGA 3PDQA 2VNOA 4XBLA 1H2NA 1LU2A 3H3ZA 3O0XA 3IDCB 2E32A 4E4ZA 1GQPA 1VBC1 3WG1A 2HLEA 3BTAA 4P9XA 2VMIA 1NA1C 4LHNA 1PK6C 2HWE2 1K12A 2C9KA 4FOQA 1DFQA 4P9IA 4RS5C 2W95A 1QOTA 3AKTA 4RQPC 3TEYA 1LGCA 2C24A 3IDEA 1UY2A 4XTMA 5FIXA 1SDWA 1XE8A 5FDBA 4LT5A 3BN6A 3PU8A 5FJKA 3ZSJA 5JPNB 5BNPC 2RMU2 3M1HA 2E26A 4CRQA 3JQWA 3PJQA 4H2AA 1REDA 1H2KA 1EAH1 2KXLA 1PIV2 3CJXA 2P2KA 5LRSA 2Y26A 1ACCA 2GC3A 1OF4A 2V72A 3H8OA 1XU1A 3J8F3 2P6CA 5E88A 2YMZA 1I3HA 4Q4X2 3OY8A 4JDOA 5ACA2 4UOJA 2OIIA 1QOSA 1YO8A 3PIJA 3K75B 4MHUA 2BVBA 2MHFA 1UPIA 4D94A 4SBVA 1RINA 5BPXA 1O3RA 1X7NA 5LBCA 5HCAA 3MGUA 4JDMA 1CIYA 2EXJA 2QQMA 4LE3A 5IK4A 4MV2A 3M8LA 1IKQA 3PMSA 3BIWE 4XJWA 4NIDA 4JCKA 1Z7S2 2QQVA 1IPSA 2XB6C 2ZCWA 5DZGA 1IS3A 1HB4A 2XWJB 3FHQA 3A23A 5C9AB 1DP0A 2G9ZA 2QKDA 5CG9A 1S0BA 5FOJB 1ST8A 1LHUA 1ZRIA 2HWE3 3I2DA 3SISA 3TYJA 4LJHA 1VBC2 2DFBA 3DPRC 1UY3A 4CCDA 2VCBA 2VZUA 3KF3A 2B39A 2RMU3 2QVSB 1OLMA 4FP2A 4D69A 1ZZCA 1AX1A 4BQWA 4CDQC 3JB4C 3TEWA 5K0UC 1V6NA 4NHYA 1LEMA 2XONA 1GMMA 2Y6JA 1ZVFA 1GFF2 2VULA 3FHAA 2WNVA 1HV0A 1BVVA 3HQRA 2VM9A 2X53S 1TG7A 4KG8A 1EAH2 4OUSA 4Y4RA 3ZR5A 3C3VA 2W1WA 3R4DB 4AVAA 4EZHA 1PM4A 2XG3A 5FREA 2B7YA 1MQTC 1UU6A 1OOPC 4Q4X3 4AFAA 5ACA3 2P5BA 2JG8B 1FV3A 3I59B 4XURA 2IFRA 1GP6A 1VRH3 3MO4A 3NAPB 3Q9OA 3IZOA 3UK9A 3VGIA 1L3JA 3I3BA 3M3EA 2Q4SA 3Q8AA 4K20A 3PUHA 4RL7A 3ZFGB 4CU8A 1W2AX 3B9IA 2YROA 3TAYA 2JDZA 3KT1A 4R9AA 1ND2A 3D0SA 3ZDSA 4EV0A 3CMGA 5FZHA 1OMIA 2UWAA 5EYXA 1Z78A 1FMD3 1Z7S3 2I2SA 2G9FA 2AZ5A 4YG3A 3WW4A 4DXZA 1XU2A 3THCA 4WM7A 4XMAA 4GWMA 4HOOA 4I0WB 3JXSA 1CAVB 3JBG3 2QQUA 3SC7X 1RUG3 1YQ8A 5KR7A 1SZBA 2ZGPA 1S2EA 4QDRA 5G04L 1B35A 4F83A 3I49A 5FP7A 3FC0A 1PGW1 2BQPA 1K5JA 1YQ2A 2BGPA 2HJIA 3OPTA 1GQHA 1VBD1 3ZXKA 4XMIA 2FHRA 1W6OA 5BNNA 4WVVA 4LLOA 4QDQA 2BWAA 4D6RA 5FZ4A 1FNYA 4JGZB 1UD1A 3J4UH 1SEFA 2UWBA 4XJ9A 3N4MA 2GC2A 4DOUA 1QGLA 1UWWA 3U10A 3OBZA 1XSRA 5F3CA 3AVRA 4ATEA 3S6PA 3I2JA 3AVSA 5C8CC 1D4VB 2YBSA 1FPN1 1ZZ7A 5FZFA 3S7IA 5E89A 1UPSA 2PHUA 3VBOC 3TB0A 2FD8A 5JZGA 2RV9A 5A3LA 3EMRA 4ATFA 5FMBA 4B3NA 2ZABA 4Q0SA 2XL7A 1Q43A 3IWZA 4AAXA 1CPNA 3KD4A 3OF1A 1Z0HA 2G19A 4TN7A 3WNNA 3A4UA 3OUIA 2UWCA 3FMGA 5F5IA 1WCUA 2ZAHA 2NMNA 4QGLA 4HSLA 3HNBM 4CYDA 4EWDA 4OHWA 1F2NA 2IXKA 2Q5TA 4P02B 2QQLA 5ANNA 5HXVA 2PHFA 5A1LA 4C1WA 1GQGA 3POSA 3VBUA 1RB8G 2BJSA 1PO21 1APNA 4AVSA 3ENRA 4UFJA 1PMIA 2MNGA 5IT6A 1HLCA 2ORXA 3K2OA 3W20A 3WX5A 2AUYA 3F95A 1J1TA 3TOJA 1VBD2 1OQEA 2H0VA 2ZX2A 4LNVA 5LK7B 3GCWA 1OLRA 1OFNA 1W8FA 2VW2A 1R091 2ZHKA 4LBJA 1DF0A 4LIVA 5DZFA 2O14A 4O61A 1SLAA 5A1FA 2ZTNA 4LEJA 2YU2A 4QMAA 4PBOA 1O4ZA 1WWYA 1POV0 4YVSA 3WXPA 4PI2A 2EA7A 1MS9A 2VC9A 3P3NA 3HBZA 4Q4Y1 5FYTA 5A7QA 5F7UA 5FMOL 4AZZA 2WQ8A 4H55A 3HIFA 5FKBA 2BYVE 1HRV2 1LHVA 1V70A 4LBQD 4K1ZA 1J58A 5F37A 5C4WB 4OQ8A 1IG3A 4LBOA 4XUOA 3ZO0B 2WS91 2XJPA 3H7YA 2DFCA 4CCKA 4E8DA 2LS6A 5CAZA 4QKNA 2FDGA 4R9CA 4EN7B 2P1BA 2CDPA 2B8MA 1RC6A 2JXAA 2WA4A 2EAAA 4HLTA 1QY4A 4QX1A 4A7ZA 4CDXA 4CCOA 4DO0A 5ANQA 2JE9A 3OJBA 5L73A 2CGPA 1H1MA 2GH8A 3MF6A 4R4XA 5LY1A 5SV8A 1GZ9A 1RITA 1BMV1 3AZVA 2HYKA 3POEA 1BXHA 1IHMA 3K51A 3M7AA 4Y1VA 4URTA 3FWEA 3N9QA 2WO7A 5DG1A 3ZFFA 1W39A 1TVGA 1MS0A 1IQDC 2WNVC 5FY4A 3VLBB 3ZMOA 4N90A 3LDRA 4EN9B 4K8RB 4TSVA 3P1IA 4Q5OA 2IZWA 4N9HA 5IVCA 1W90A 1ZX5A 2RR13 1ULEA 2VCMA 3KV5A 4KWUA 5L9BA 1W9SA 1S0CA 1R092 1US2A 3T0DA 4CP9B 5JAXA 1M4WA 2YPDA 5IVVA 2YFZA 5K8SA 4XYXA 1E57A 2VMGA 4PJYA 5I0TA 1N3PA 5AFBA 1UX6A 5J1XA 2EF6A 1HDKA 2X09A 2XHNA 5EWSA 1NZIA 1HRV3 4LMFA 1ND2C 2BNOA 4IV1A 2AYHA 1REFA 4RHV3 1WMXA 1UX7A 4MADA 3KLSA 4Q4Y2 5LA0A 3V0AB 4JQRA 4AXOA 4M00A 3BGAA 1UOFA 1HJFA 4KWLA 2XR4A 2Z42A 3MIBA 1R082 4WM7C 4BXSV 4V2VA 1JYTA 1GANA 2NP0A 3VD7A 2O8OA 3UYJA 4I0AA 2EALA 4K1YA 3THTA 3IN9A 5APAA 4DS0A 4RN5A 3MIEA 1B35C 5GLTA 3VDCA 2XBO1 1DQ2A 4C90A 5IVFA 1KEXA 3DUIA 4ORFA 3OEAA 2OT7A 2R49A 3O5SA 1W6QB 1T6BX 5FZBA 1RMU3 3T3YA 2G1MA 5A7NA 1A8DA 4CZSA 5BNNC 2Q0AA 3PUQA 2YYOA 4QXBA 1AVBA 2WA3A 1VBB1 3N7KA 5CKNA 2QQJA 3AZWA 1BMV2 4Q4V1 1FV2A 1T2XA 1ZRDA 1SLIA 3LSEA 1GV9A 2JD4A 2DDUA 2MPFA 2RJLA 3TNPB 4X8PA 3VKLA 1I5PA 1KGYA 3NJZA 4EWEA 3DF0A 1I9RA 3E97A 3FL7A 1QJU3 2HEVF 1V6LA 2XLFA 5IW0A 2WFPA 1R093 4NAMA 3HT1A 3IPVA 1X9PA 4GALA 5FBJA 4FTSA 5CFCB 5FZ9A 1ULPA 1WD4A 1JOJA 2BGCA 5A3OA 5JZGC 3WF2A 4AFBA 1H8TA 4NWWA 4C91A 2ARCA 3W59A 4Q4Y3 1UYYA 3AKPA 4QXCA 4AHYA 3BTXA 5LBEA 1DGWX 3VBFA 3JCIA 5FCCA 5FY8A 3VB9A 1JZ5A 4Y5SA 3PVBB 2XUMA 5DQ0A 2OYZA 1R083 3LEKA 3U4XA 4LK6A 2H0BA 3AP5A 4S2HA 3PMEA 1CAXA 2PTMA 3DEMA 1HKDA 3OOXA 2A3YA 3E5UA 1A34A 1A8MA 4IE7A 3VBUC 3ZMNA 2HYXA 1N1TA 3N7MA 4AFDA 2G4IA 3O1UA 2XBO2 2WNUB 5FXXA 3KF5A 3ACLA 4KBBA 5JMCA 4XF3A 2VW0A 3J26N 5CADA 3WF1A 5JDBA 3SCGA 4O7XA 4PIZA 3E5XA 1XYOA 3FN9A 3A22A 1WBFA 5A6QA 1VB4A 1VBB2 2WKKA 3QOPA 3T0BA 4Q4V2 1AR71 5JI9A 1D2QA 2CGNA 4WVMB 3EJKA 5IK5A 4YVSC 2IFWA 2R6QA 2GC1A 3LQCA 2WO1A 3OD4A 4FP3A 1IS6A 3BPZA 5FFOC 4LOSA 5BYNA 4N7IA 3NL1A 4G9SB 4AI1A 2PYTA 4FFHA 1H30A 2W46A 4XOGA 3WG3A 3UNPA 1SDDB 1WCSA 2EXKA 1XYNA 1DYPA 2RE9A 1LOCA 4HANA 4AEDA 2IXCA 4QHOA 1IPJA 3WP4A 2XGXA 3DKQA 4PIYA 5I8TA 1AHSA 2P37A 2WAOA 2QBXA 2YBPA 5CFDA 4CE8A 4CDXC 5CG8A 2VTXJ 3E1F1 3USSA 2H6BA 1RUI3 4ZONA 4KG0A 5LA9A 5A33A 4AE2A 5FZOA 1WMEA 4TYSA 1IKPA 3MHZA 1UF2C 2A6VA 1MS8A 2XBO3 3HNYM 4LPLA 1J84A 1REEA 1D4M1 2V4AA 5F3IA 2HBTA 3ZFFC 4HN0A 4COYA 1DU3D 2AR6A 1X8EA 1RUD3 1TQ5A 2WBKA 4AWDA 4PT6A 4HETA 2WZR1 3HT2A 1Y7BA 2R0FA 4B7KA 3FLPA 3ZN4A 5SV5A 3VBSC 1POV1 4GB32 4QPGA 4KL1A 4WM8B 1ZBE1 5B4XA 2KR2A 5LY2A 2ARBA 2BBVA 3NNFA 1AR72 2DU0A 3T2OA 4YM2A 3OCPA 4B7EA 3UKVA 2PHDA 4AI2A 4MG2A 2JG9A 2KM2A 1NLRA 3POJA 2FZ2A 4IV1C 2PAKA 5CIRA 1W9TA 2JICA 1DCSA 1RUF1 2CY6A 2ZGNA 3HQXA 1OF3A 3KSCA 4LBQA 4UW6A 3GHMA 1F5JA 1JU3A 1LHOA 4NVPA 4AR2A 1VJ2A 1QH7A 4JRLA 1XE0A 1NUKA 3ZX7A 4IE4A 4IV3C 2LRPA 4DZGA 4UBHA 1YNAA 1GOFA 4A4AA 4IE5A 1KDKA 4MZUA 3BKZA 3ORJA 4PF1A 1BZWA 2D6KA 2ZOEB 3ME2A 3H42B 2ZA9A 4YG6A 1UXZA 1QJEA 1ENQA 1WW6A 4OHVA 5DUXA 4A7KA 1AJOA 5JUVA 5FMDA 5FXVA 5K4LA 5T5PA 4GH4A 1X33A 4FCAA 4FOYA 5HI0A 3OGGA 3V0AA 2RDRA 4Y1ZA 2IVIB 1OKOA 3ES4A 3B3QE 4XHXA 4Q1PA 2BV4A 2DCKA 2Y0IA 3NWKA 5A6ZA 1D4M2 3BB6A 3JD73 3VHPA 3GBFA 2ZMNA 1AR81 1WLWA 1GZCA 3POIA 2ZEWA 4GJZA 4CCMA 1F4HA 2YBKA 4CPBD 4IDZA 3WDTA 1ZZ6A 4UFHA 4GB33 2WZR2 4GKXA 4A6SA 1KFXL 1LRHA 4AVCA 4MXVA 1ALYA 4IEOA 2XVGA 3ZFEB 1CD3G 1OPMA 1H8TC 1ZBE2 4QX7A 3S7EA 1U5ZA 3FFQA 3ECQA 4AHZA 3WQ0A 2A70A 4QU2A 2DBNA 1RHI3 2R043 3HR9A 1JZ7A 1AL21 2UYAA 3AK0A 2HEWF 1PX4A 5HCBA 1RVF1 2ZGKA 2VO5A 1EUUA 5I0DA 1RUF2 4E4HA 4XAEA 3VZNA 4OI4A 1PMJX 2WWUA 4HZFA 5JVVA 1MEC1 3H0OA 4N8MA 1DLCA 3NV3A 2OZJA 2B9UA 4JKKA 4DXSA 2P3JA 3HNMA 4N7UA 2D3SA 2FQPA 2IXLA 4Q0UA 1IS5A 5C9AA 1QHDA 1ZREA 1IZ3A 4I30A 2D97A 3LDBA 3ZSEA 3MIGA 2PXJA 4M4RA 4BU2A 3NRUA 3T2PA 2GNBA 4NHLA 4D3WA 3O1OA 1JBCA 1OA3A 1W28A 2E31A 5IVEA 4MXWA 4XAAA 4ITCA 1D4M3 1VBA1 2VZVA 4MGYE 3J7HA 5T5JA 3CKHA 1W3XA 2QDNA 1V6OA 1JI6A 1W04A 4K8FA 3LIGA 1CZVA 1RUJ3 2WZR3 4TWTA 4BZ4A 5CISA 1EV11 3PIGA 1ZZ9A 2YY1A 1AR82 3N9NA 3FJSA 1NCQB 1Q8PA 3D5OA 1RJ7A 4IEZA 4NRMA 5FZ3A 3E6DA 4ZS2A 4AEMA 4JGYB 2WZPP 1JZ3A 3I3DA 4LHKA 1ZBE3 3RDIA 4XCAA 2XLAA 2V4VA 4CUBA 3BTYA 5E1RA 2JG8A 3I59A 5F39A 1W9WA 2XJVA 3RZGA 4AEDC 3H8XA 1NT0A 4WVZA 3LA2A 3TN93 1N3QA 5IFTA 4FPEA 3ZFGA 1AL22 1VR3A 4E8CA 4IEPA 5CFDC 1A6CA 1RVF2 3RZZA 1BJQA 3DPRA 5GZFA 3AL6A 1R1A1 1BK1A 2FDFA 3U07A 2HWD1 1VE0A 4XVHA 1JOPA 1MEC2 3ZYRA 1BK0A 1UZ0A 4AVVA 2OX0A 1N1YA 4XF0A 1QMJA 4GJYA 5DDJ1 1SG3A 4HN1A 2ZGOA 2WDBA 2EIEA 2ZHNA 3AZZA 3K46A 2N7GA 3OYWB 2ZKLA 1A3KA 4TXWA 4DPNA 4ASLA 4J1XA 1C57A 1UKGA 2Y33A 4IEXA 4CDUA 5JXJA 1YXWA 2PHLA 2VUCA 2ZXQA 5FZKA 2HWF1 1IS4A 5A6XA 4DB5A 4QPGC 1OUXA 1SBEA 1VBA2 1AR83 2CNAA 2VQ0A 4AGGA 2DCTA 3E5QA 1O5LA 2YGLA 2Q8EA 1NQJA 1EV12 2JG9C 3B5LB 4JGZA 2A3WA 3RZMA 5E16A 5JIUA 2R071 2CWMA 3FUQA 1YFXA 2JJ6A 4XQ4A 2RS33 1LENA 3ALQA 2JB4A 2VZSA 2A6WA 4PCRA 5DXDA 4BQ3A 3FX3A 3SMHA 1TMF1 1V6IA 2W1SA 3GJBA 1H1IA 3LGRA 1Q56A 1QXRA 2GZWA 1C5HA 4P9WA 2GMEA 1BEV1 1R1A2 2HWD2 1UAIA 4I0BA 4Y1YA 4CCJA 5C33A 5EJ3A 1AR61 3MDPA 5DDJ2 2BU9A 2ZMKA 1FOD3 5L7OA 2WLQA 3USUB 2DU1A 1UMIA 5LRRA 1O4YA 3IAPA 3I3MA 2J1UA 1IPKA 2V09A 2W68A 1OXCA 4IEVA 4LLFA 4BIFA 2E7QA 1UMHA 3MEPA 3WR0A 4JRAA 2F6BA 3D8CA 3GDBA 1QWRA 3J7MA 1WCKA 2OA2A 3MYXA 1QXJA 4MGKE 4R9DA 2DURA 4K40A 5GKAC 2PQSA 3NNGA 3QACA 1O7FA 2HWF2 1WA4A 4EWAA 2EVXA 1N3OA 3AKRA 1EV13 2GSYA 4W4ZA 4QWNA 5FYBA 5C71A 1RUC3 2PFWA 3WDWA 1CQ9A 4FPYA 4HK9A 4BLIA 5ABJB 1HB2A 5K7PA 3MUY1 4Q4W1 4YW3A 2GP3A 4FPKA 1JZ4A 4IGOA 2VQAA 2R072 4HVOA 4P5HA 2VNVA 3IIIA 5BNOA 1ZYBA 4OHZA 5F6KA 2PN5A 3SKVA 4K3UA 5LBBA 1XB9A 3B94A 5C4WA 1NXMA 4KU8A 2YC2A 3H1MA 1W8WA 3RG0A 5J96B 2R16A 3ZVXA 1F8VA 1LEDA 1SPPB 3SLIA 4EZ4A 2HWC1 5C9AC 1GOHA 4XBQA 3DCQA 1TMF2 2Z2SB 4YW7A 4BA6A 2HWD3 1FYUA 3UJOA 2ZKNA 4NMIA 5B2GB 2R1DA 3MIFA 4TLFA 4OI0A 3I7DA 2XJQA 1BEV2 5J36A 5FY0A 1ZM1A 3JU9A 3LEGA 1ZZ8A 4NRPA 1KDMA 1UO9A 4W65A 3HMYA 4XFGA 3RVHA 1JW6A 4CCEA 2XHKA 4LITA 1LTEA 4I2OA 3GM8A 3POFA 2HWF3 3AXDA 2P34A 4QGMA 1UIJA 3JUUA 2JDYA 1OLME 2TBVA 4LBKA 3MLJA 5JSOA 4L11A 4Y20B 2C9AA 2VNRA 2R32A 2Y6GA 4D6SA 4OHXA 4NIGA 4EJRA 1KD7A 2JG8C 1JYNA 5I8YA 4QX0A 5FZ6A 1ODNA 2JX9A 4GKYA 2IWGB 4LKFA 1POQA 4XFBA 1MS3A 1ENRA 2R073 3LPFA 3UKTA 3ZFGC 5DAXA 2QTWB 2W39A 3IKWA 4Q4W2 1NA1B 1W2UA 1PK6B 5H9SA 1EP0A 2JDPA 3I2OA 2LUWA 2ARXA 3O1VA 4LTAA 3ZR6A 3WW2A 5DUVA 4CUGA 1ZRRA 1UOGA 1Y9MA 5BNPB 2D6PA 3LSDA 4KH9A 2W94A 1PIV3 4GD4A 4XF9A 1DGRA 5F2SA 5LATA 2O8QA 3R0RA 1HV1A 3NNMA 4BE3A 1NE6A 3KGZA 2QQWA 4IEWA 2HWC2 3C2UA 3ZYHA 4AFMA 3L9JT 4CDUC 3KVBA 4P08A 1UY0A 4KGQA 1QDCA 3AFGA 2VNGA 1XNAA 4FVVA 2X10A 1LKNA 4IGQA 3MI8A 3AP9A 1W6QA 2FDIA 2K0GA 3VL8A 3SCFA 2NZ9A 2VL4A 5FOBB 1E5RA 4HKWA 3CZUA 4L8QA 3AKQA 1OA4A 4JGZC 2JB8A 5D2AA 4LO7A 1DHKB 5FWEA 5FY9A 4TTGA 1O3TA 4QM8A 1PVC1 3CQOA 2GH2A 3RWNA 3T09A 4YW6A 1UIKA 4Z8BA 3PU3A 1S55A 4KNCA 2A7AA 4M01A 5HCHA 5FP9A 1PZ8A 1TEIA 3T1MA 3IT8A 2XPJA 2PAMA 3I54A 3WQBA 2WNOA 5LZ6A 2J1EA 3BVCA 1GP4A 4U36A 3RI9A 3MFCA 4WZFA 2K2SA 2VR4A 5CFCA 2OQ6A 1UYZA 1SCSA 3AKSA 4Q4W3 3K48A 1DQ5A 4CCLA 1VBC3 3LF7A 3WDYA 1VMHA 3AYAA 1SLBA 3U1XA 1QJX1 5FMCA 1RUE1 3I97A 2A6YA 4FXKB 3I2FA 3S5AA 2W1QA 4JHTA 1ND3A 3UGFA 3ZN6A 4X6RB 2UY8A 4QDSA 1W8ZA 3WT3A 4DMIA 5L36A 3RYPA 4JKMA 3M3QA 1GZWA 5J48A 1MACA 1W05A 1XRUA 4N53B 4CDQB 4DEVA 5L9VA 5K0UB 2JENA 1XJAA 1EAH3 2VZTA 3AMHA 5L7OC 1OH4A 4PLMA 2VBPA 5A3WA 2PQQA 5CEHA 3RZKA 4CEYB 2VUDA 3HPNA 4D7SA 4DUXA 4IUGA 3O12A 5FYUA 3P5BA 3U11A 3ZN5A 4CDWA 4JC1A 5CBLA 1AXZA 1MQTB 2YDEA 3OPWA 4S2FA 5C3RA 2RG4A 3CEWA 2D40A 1UU4A 2JE8A 4ZXEA 4XF4A 4GMP0 3W5NA 2TEPA 4FSJA 4FAHA 1Y9GA 4AHWA 1ULCA 2VBBA 4NHXA 4KWKA 3ACIA 4XFFA 4YWAA 4OVEA 4HPKA 2DCJA 3AC0A 3D3AA 3QH7A 3T30A 4FOWA 2VXJA 1PVC2 3ZXAC 1CR7A 1K5MB 2UYBA 4NHMA 3KT7A 5IAVA 1C28A 4GULA 4DNYA 1AX2A 2W08A 5AFEA 1H2MA 5BNOC 1GKBA 4NRQA 3R6SA 4XILA 1J3QA 4Q0PA 4XETA 4CUCA 3J9SA 3PTYA 3PHMA 4IETA 2WRAA 2WO3A 1LR5A 4K6BA 3VBHB 3WHTA 5C4WC 5FAXA 1O59A 2ZAAA 5HPOA 1CZSA 1PGW2 3AP6A 2YUEA 4XBNA 4AG4A 1WLTA 2D43A 1WKYA 1TNFA 1QJX2 1RUE2 1IGOA 2W5FA 4OUEA 5KHHA 2ILMA 2EXHA 4P5YA 4OZOA 3WDVA 1V0AA 3DN7A 4QPYA 2BFUL 4HONA 1KJLA 4NUBA 1CGPA 3ATGA 1URXA 5FZAA 4L99A 5GLVA 4MSVA 2VPVA 4FPOB 5DABA 1G9CA 5EIYB 4WBBA 4IEYA 3U0ZA 5FQ0B 1WCDJ 4LBLA 3T1LA 1KFUL 1YFUA 2WT0A 4AQTA 2X8KA 1FPN2 1W6PB 1Q8QA 1C1LA 1P8JA 2D44A 4YVWA 3URFA 2A6ZA 2QZ2A 2A75A 1XNTA 5A3UA 3DL3A 4GXLA 4YNIA 4EN6B 1ONAA 4D7YA 5IATA 4E4SA 1MS5A 1PVC3 3AYCA 3H9AA 1N47A 2ZPXA 5ERLA 3VDDB 1I1EA 2ZX0A 1CVNA 2LM3A 1GWLA 2ERFA 3NJXA 1NZCA 2DVBA 5A7SA 4Y3OA 3VZLA 3WV6A 3AX4A 1ZZBA 5F8PA 2C6SA 2R061 3C7FA 2R0HA 2VZ1A 1QJY1 5LA2A 5HV0A 3SH5A 4HG6B 4LBNA 3Q8CA 5A80A 3VHOA 1E5SA 2WC2A 4RFRB 4ONUA 1AXYA 2GNMA 2FMDA 2GAUA 1PO22 1RUE3 2VMDA 4QPIB 5FK8A 3RI8A 3WP6A 1VBD3 3MPPG 4YPJA 4BMBA 2CTVA 3GJAA 1V00A 3WSOA 3W58A 2DWRA 1H9PA 4AI8A 5KXDA 4CP0A 1AR91 3D4KA 4NOTA 5JSRA 3T4HB 1B09A 1S0FA 3ITQA 3VBSA 4R8HA 1RTVA 2LROA 3O0VA 2NYYA 4AK3A 3SCHA 1J3PA 1COV1 2XJRA 4BJ0A 2YHJA 1VMFA 1OVSA 2YPJA 1H4HA 2ZGLA 4HL0A 1W6NB 1XPWA 2BW8A 1FPN3 4ARYA 1GUIA 2DUPA 4XQWA 1YCIA 1SMVA 3APBA 4ZZ5A 2W9XA 3EBRA 4QU1A 5HV4A 4JDNA 5F3EA 2CSGA 1QOOA 2XOMA 2R7EB 3RPQA 2WS92 5ISLA 4BQYA 4IV3A 2RDSA 1CJPA 1O91A 2J1RA 3Q8EA 3I2KA 2RDNA 5IWFA 1SFPA 1WBLA 5CFCC 4FQZA 4QHZA 3ZFEA 1GLHA 1MZFA 1NYWA 4DRRA 1LOBA 3WQ7A 5FK7A 3M3OA 5IUQA 3I3QA 4DQAA 5DPNA 2Z79A 3PJYA 1ND3C 2W91A 3VDAA 5KHKA 2R062 4XFHA 4XJ8A 4LA2A 1QJY2 4YGEA 1OD3A 5FZCA 1PZ7A 1O8PA 2ZGRA 3HWJA 1PO23 1CAUB 1AYM1 1OKQA 2JE7A 3MICA 2YGMA 1HJGA 1OVPA 1MVQA 1C8M1 2VH9A 2DTWA 1CWPA 1LJ7A
chains in the Genus database with same CATH topology
2UU8A 5A32A 1XE7A 4AW7A 4CDWC 4PLOA 2DVDA 2AENA 1D0HA 5J09A 1AR92 2WNUC 3KCCA 2GC0A 3AXEA 4W6WA 1S1AA 1SFYA 3WHUA 4L97A 4KU7A 4LBMA 1RL3A 2EAKA 1MZ5A 3R4UA 3MW4A 4C0HA 1ZNPA 2BWCA 2WS93 1RUNA 1NCQA 2XKPA 1BBT1 4UW3A 4JGYA 3A0NA 4QGNA 3CJIB 3WW3A 4M3CE 1BQPA 1BVP1 2R063 2Z5WA 2CAUA 4Q1RA 1QJY3 1DIWA 1OFSA 1XQNA 3WLUA 5FO7B 4BM8A 4E4SA 1LU1A 1NY71 4RD7A 2C5DA 5J37A 2MEV1 1KS5A 3ZYGA 1SFNA 3VKNA 3GBWA 1AUYA 2W52A 1AYM2 1YFWA 2E9QA 4P9JA 2VY0A 1C8M2 5E8AA 1TNRA 4HMZA 4COZA 5FO8B 2Z69A 1WLCA 3G6JB 4FPJA 1YWKA 4GMP1 4M3CA 3VL9A 1Y43B 2YV8A 1XNCA 3OYWA 5JCTA 1EPZA 4L2NA 4N43B 4RR3B 4MLOA 4RSUA 4L92A 1ZRCA 4QQHA 1YYNA 4CEWB 1OQDA 4J1WA 4YVWC 1PO11 2Q30A 4XXPA 2D3RA 3WQ1A 1Q8SA 1XNBA 1Y3TA 4TZDA 5T50A 2GMPA 5JWPA 4B4PA 2YXSA 5GM0A 1VAKA 3GYDA 4R52A 3MF9A 1BBT2 2E51A 3TNQA 2PHXA 3H1WA 2I74A 5CNAA 4BH9A 1AL0G 1S0DA 4BQ1A 4BWOA 1XYPA 2RM21 3O14A 1JN2P 3QD6A 2GNDA 4KGGA 4W6YA 4OHYA 5F5QA 4FAGA 1QF3A 1NY72 4NHKA 3VBRB 1VBB3 5LK5A 1AYM3 1GNHA 4ES9A 3BODA 4Q4V3 4IERA 2BTVC 4PDWA 1C8M3 1HQWA 4HKOA 4FPGA 4H14A 4D7TA 4AVBA 3ZXLA 3USUA 1OA2A 2LALA 3S0MA 3D0JA 4YW2A 4AVTA 4CTEA 2NPIA 3ETQA 1X50A 1PO12 3ASIA 4HVQA 1PGL1 4R4ZA 1AX0A 1VAVA 4Z92B 2DVGA 3ZFEC 4OLLA 1RUH1 2PHRA 4COUA 1ZA4A 2VU9A 1SLCA 4A3XA 1LGNA 3AMMA 5EV7A 3WG2A 3WG4A 2JKBA 5CU1A 1JTZX 4AQ6A 5KXEA 3RYKA 1U5YA 5CVRA 2RM22 2PLV1 4XPVA 1WUVA 2ZX3A 2FMYA 4DY3A 5T55A 3WDUA 1CAWB 4QM9A 1AR73 1JUHA 1LGBA 2CV6A 2WL1A 5D8AB 3FBYA 3V64A 2X5IB 1CIWA 3SH4A 4ISRA 4BIOA 2XJSA 3AMNA 4YGBA 4P9YA 3RMYA 3LA7A 2ZS6B 1CN1A 1PNFA 3IDBB 1PO13 1QKQA 5HCFA 1CONA 3SITA 1NCQC 2DCZA 1KQRA 3AM2A 4JGYC 1XNKA 4YM0A 4Y20A 1YIFA 4YGCA 3UL2A 3FFZA 4DFSA 3N3HA 1PGL2 2A71A 1V6MA 4A2UA 3D6EA 1O3QA 1RIRA 1RUH2 1OQ1A 1AJKA 1G9FA 3LA3A 4LR4A 1GSLA 1VBE1 3AP4A 3TRSB 5AC91 3QCWA 2B46X 3JQXA 3UJQA 3EXUA 1S2KA 1DZQA 1VP6A 4NO4A 2W0XA 5JLVA 1I6XA 4Y22B 3L2HA 4HKLA 5GZEA 4HBNA 1S2BA 5T54A 1DBNA 3MW3A 1OSGA 2PLV2 3MW2A 4UW5A 3FZ3A 1POV3 3M4FA 4E27A 3V0BA 1GR3A 3IPVB 3AFKA 5BV6A 3LOIA 4ISQA 1H8TB 1X36A 3RJRA 3AB0A 2RS51 3NAPA 4K21A 2SLIA 3AJZA 3VBFB 2VOXA 1RUF3 3WNXA 2R1BA 1S0EA 1ENXA 1ZRFA 4CP2A 1CAXB 1ASJ1 4Y1UA 4ZXKA 3WD5A 4M0HA 4RFT0 2DTYA 4PBPA 2DUQA 1RUH3 1W6MB 1N1SA 2PHWA 3IBMA 2IXIA 5C8WA 1CAVA 4I02A 4K7JA 2ZX4A 1QH6A 5KHIA 3MPBA 3VN4A 4S2GA 2WWSA 3QLQA 5BNQA 2BUKA 1VBE2 3AJYA 3IIAA 3FUOA 4JTNA 5AC92 4YM1A 5J3UA 4PDWC 1J1LA 4QT6A 5J7MA 1NCRB 1ULGA 1MS1A 1SBDA 2XJUA 2ZJCA 4N53A 3J8F1 4F8AA 2ZBJA 4LO8A 2VGDA 2ZHMA 2A3XA 4XHBA 1IOAA 1FXZA 4IEQA 4CEYA 1EY2A 4JVAA 3PNAA 3O0WA 3PVEA 5D1IA 4B4QA 1T6GC 3OBTA 3ZXDA 2E63A 4ES8A 4Q27A 2RS52 1GICA 1AL23 1WW5A 1UZZA 1NOVA 2P17A 1AF9A 1RVF3 3B02A 3R4SA 3CLPA 5JOXA 2WNEA 5FBZA 1PHMA 1MEC3 1MVEA 3AZYA 4XW3A 2OW4A 1HRI1 4FO9A 1ASJ2 1Q8VA 4Q8KA 4EROA 1VALA 4I01A 3NW4A 5FMOS 1K5MA 2XLGA 1JH5A 3PVNA 2O0OA 1YIPA 2QFEA 1R1ZA 3O7OA 2CL2A 2D6LX 1VBE3 2DCYA 5I8SA 5AC93 1ULDA 4R9BA 4YZ1A 5H9QA 1SCRA 2I45A 4Z07A 1VBA3 2WQZC 4PF5A 5I0SA 4DY5A 4MGIE 4QPGB 4ZU4A 1GBGA 3B69A 3ES1A 4E4DX 5GLWA 3SXWA 4QXKA 5DUUA 3J8F2 1VRH1 2JG9B 1WMDA 1AYN1 2WSUA 2VOVA 2F4PA 3H3UA 4OI2A 2V5YA 4Q0QA 4LUKA 3BCWA 2K9ZA 1G86A 3ZSKA 4AQSA 5FQ0A 2RS53 1KXGA 3ILFA 4JAAA 3P3PA 1KRIA 1FMD1 1W6PA 5FLJA 1PVXA 5I91A 5JR7B 2A73B 1R1A3 2FZ1A 4PQ9A 1ASJ3 3RRDA 1BYHA 3JBG1 4GIQA 1RUG1 2Q1ZB 3WY6A 4QHBA 3VDDA 1HRI2 4PIXA 4GH4B 5DDJ3 5KC6A 1TE1B 4BOWA 3MLKA 3KQRA 1AR62 1FNZA 2Y0OA 2YZ4A 1QDOA 1DQ6A 4XTPA 3ZXFA 1H0BA 4MYEA 1JUIA 2OPKA 2VOWA 4QPIA 5KXCA 5JIAA 3RS6A 4WV8A 1IQAA 3LCPA 4W6XA 4FPFA 2XJTA 1SBFA 2CWSA 4FPLA 2PAEA 5GZGA 1DYKA 2KA3A 3FE5A 3WCSA 3N7LA 3GZUC 3LWCA 2AGSA 2XVKA 3NAPC 3HN1A 1OI6A 5DG2A 1VRH2 5K9YA 3KS7A 1AYN2 2IXJA 2ZMLA 4YG0A 3CU7A 1W6NA 3KCXA 4RS5B 5F6LB 3THPA 4RQPB 2QDRA 4FT8A 2EIGA 3HAGA 1OD5A 2CGOA 2DV9A 3M3IA 3KGLA 3RNSA 1FMD2 1TMF3 2NLRA 2NQYA 3B00A 2X29A 1HRI3 3VV1A 3AMQA 1LOAA 1BEV3 2ET1A 5I0UA 1PGSA 3JBG2 1BKZA 1RUG2 3WCRA 1JYIA 3NV2A 1AR63 2DVFA 4IESA 1DG6A 1NE4A 4MXWB 4OULA 4YW4A 1JXNA 2VUJA 4N53C 4Q2FA 1UKRA 1I5ZA 3FLRA 1CAUA 5C6CA 4CP1A 3E6BA 2WLPA 1UZYA 4CEYC 1N1VA 4AGRA 2O1QA 4XZPA 1H8VA 3WW1A 3RSJA 4LE4A 1WGPA 1AYN3 4Q29A 2C0ZA 2RS11 2VG9A 4QQ2A 5EYYA 1U5IA 2CYFA 4HSJA 1Q3EA 2NMOA 4INDA 1C3HA 1CX4A 2DYCA 3DPRB 2WFF1 3BU7A 2ZZJA 1MR5A 3PVOA 2DUOA 5T5LA 4YARA 1MS4A 3EHKA 3KM5A 5TSWA 1A78A 1K5MC 1Q8OA 1JHNA 2BVVA 3VKFC 2HWC3 4JTOA 1HXS1 3ZIXA 2ES3A 3RYRA 4CDUB 3VBHC 1PNGA 2WT1A 3CJIA 1OOPB 3X29B 3LAGA 1HIXA 3H1YA 1DLLA 1YFYA 2WNUA 3WZ1A 4E9KA 5KWRA 3VZMA 1DGLA 1V9U1 2E6VA 4QX5A 2VOKA 2RR11 3TWIA 2B5HA 2D93A 2BNMA 4FQ4A 5L19A 3H7JA 3NVCA 4FPHA 4WVMA 3CO2A 3EQEA 4GQ7A 4I09A 3G7DA 1QJZA 1HRV1 1CJDA 1ZBA1 4Q0VA 4N43A 2P3IA 2AREA 2VMHA 4RHV1 4RR3A 2XWBB 1W0PA 3AMPA 5T52A 2RJKA 4CEWA 4BMEA 5GZCA 2RS12 5AVPA 2C1FA 1QQP1 3MIHA 4OUMA 2WFF2 3VDDC 2ZZQA 3B9CA 4KQ7A 4XFCA 4NPRA 3V65A 3OBRA 4Z82A 4NR1A 4ZU5A 5L7OB 1HXS2 1RMU1 1DZTA 4QD2A 2FBEA 4EN0A 1QU0A 5BXXA 2D3PA 2HKXA 3LKJA 2Q1MA 5C8CB 4QPIC 3UV9A 2ETEA 4QQPA 3AYEA 3VBOB 2JECA 5AVAA 3VBRA 1QJU1 1V9U2 4WM8A 2RR12 2NM1A 4P14A 2GDFA 4RA0A 4YZ5A 4P9GA 2WT2A 3B93A 4F7ZA 1OHFA 3ELNA 3RQ0A 1PZ9A 5LEJA 1ZBA2 2RS13 4RHV2 1R081 2ET7A 1FT9A 3N36A 1QJX3 3IM0A 4OZXA 2WFF3 4LUMA 3OPZA 3POYA 2CAVA 2E7TA 3VHRA 1UL9A 1QQP2 3GF6A 3LB9A 1UCXA 4AI3A 2ZGSA 3H50A 4C1XA 1HXS3 3OY8B 2QE3A 1AXKA 1X82A 4HK8A 1WMFA 1BCXA 4YGDA 4ZU7A 3R05A 1RMU2 5FTTC 4MH0E 1O5UA 5GJ6A 4Y24A 2XVLA 4LHLA 2QZ3A 4XJZA 2WINB 2DF7A 4FXGB 4X6QB 1G9BA 2AH2A 4EN8B 4IEUA 1V9U3 4XJUA 1QXPA 1LULA 1QJU2 1CAWA 5GLUA 4Z2WA 4DINB 1CPMA 1D0GA 1FAYA 4YLZA 4U2AA 5FLHA 5CB7A 5D8AA 2DVAA 4M0NA 4IQPA 1O4TA 1WD3A 4P9LA 4Y1XA 2X5IA 1ZBA3 2GU9A 4N9IA 1OPOA 1XXNA 3BOWA 5FPZA 1ULFA 1LHWA 1YI9A 3N7JA 4AI0A 4Y4YA 3W9AA 4O9GA 2IC1A 4LULA 1RUI1 1QQP3 2WNVB 3NKTA 2JEMA 3GHNA 5I93A 3CJIC 3CNAA 2GN3A 4JV4A 3D82A 3VKOA 3L2YA 1RUD1 4XQDA 1H4GA 3ZSMA 1COV2 2Q8OA 1UU5A 4MX3A 4DRVA 1F9KA 1ND2B 1WW4A 1HW5A 4META 4MUVA 5DZEA 2VVDA 1TME1 5GLZA 1DZRA 1S0GA 2ZGQA 4Y22A 1LOGA 3M3CA 3A0KA 2HEYF 4WM7B 2ZHLA 4LA3A 1FATA 4N43C 4RR3C 3SHRA 3GZTB 4AFCA 1B35B 3KCYA 3TBDA 2GALA 1LOEA 4CEWC 3AZXA 1W0OA 1AZDA 3B7MA 4BLJA 5IK7A 2IXHA 1SQ4A 5JI7A 3UKNA 3I8TA 1ND3B 3WINE 3ZN6B 1C5IA 1W6OB 1GZWB 5BNNB 5EFUA 4YZ2A 3CF6E 3SNMA 1G7YA 3BOPA 1YI7A 4HFSA 4XFAA 3QBQA 2WJSA 4G4FA 4IL7A 1RUI2 1ENSA 1UN1A 4AHXA 1H9WA 4AGVA 3N35A 4RGGA 1AR93 2E7AA 2D7FA 4CDWB 5KC5A 1W6MA 1YRZA 2H6CA 2D98A 1COV3 1LOFA 1YJKA 1H1AA 3JD71 3ZXEA 5JZGB 3WUCA 3VBRC 1RUD2 3VZKA 3ILNA 2D5HA 5GALA 4GB31 5GZDA 1SACA 3ROUA 3KT4A 4BHPA 4WM8C 4HPKB 1NCRA 1LESA 4XIKA 1TME2 2D6NA 3GNEA 4HVRA 4FTBA 3CL1A 5HBAA 3GALA 5I0RA 2YC0A 5T5OA 2HWB1 1RHI1 2R041 2B45X 3VBUB 5KHJA 4YW5A 1HX6A 2E53A 4F3JA 2QNKA 3EO6A 1RUOA 2BEOA 2PA7A 3AP7A 3VUOA 1FI2A 4QQLA 1KS4A 4XE9A 1UMZA 3WP5A 4B4RA 2MEV2 5EXOA 4YYOA 3S30A 3ZIWA 3SH3A 3ZSLA 4Z1VA 5FLIA 4WZCA 2WIIB 3I4IA 1WW7A 3WP3A 4YVSB 4YZ3A 2OZ6A 1V6KA 1GNZA 3M2MA 4MVTA 5EZWA 4OFGA 5FPXA 4SLIA 1G9AA 1S0IA 2ZGUA 1RUJ1 1VAMA 4YVWB 3JD72 4BYYA 4PLNA 4YFWA 1V6JA 4QQOA 1UW8A 4OI1A 4COVA 1TME3 3ZYPA 1NG0A 3KB5A 4LO4B 1MZ6A 5F9TA 5D8AC 4CDXB 4A7YA 2OVUA 4YRDA 2X5IC 1BBT3 2B42B 1LODA 1G8WA 5ABJA 3KZ4C 4UW4A 2HWB2 3HD8B 1QNYA 4I3PA 3TN91 1RHI2 2R042 1YHFA 5JSPA 2UY9A 4Y26A 4E2SA 1C8NA 3ZFFB 1XNDA 1LHNA 2MEV3 4XXAA 1DDLA 3JZVA 3VBSB 2V73A 4FBFA 2RHPA 3RJ2X 4E2GA 4XDQA 3NV1A 1HQNA 2D5FA 2R30A 3OD0A 2ATFA 4GMP3 2LTNA 4IV1B 4Q26A 3OGJA 5J98B 5DUWA 4FPCA 2OUJA 1U0AA 1CESA 1O3SA 4AQ2A 1RUJ2 4Y5Z0 3NO8A 2VXRA 4IV3B 3DGTA 4V1PA 2UURA 2XL9A 2XKOA 5JOZA 2BPA2 1DQ1A 1RGSA 4BPZA 4YM3A 4O9EA 2ZACA 4Q8LA 3JB8A 1DQ4A 4E2QA 1C4RA 4NN0A 3RMXA 4C0BA 2HWB3 3VBFC 1VLNA 2RS31 4UBGA 1SLLA 3LOBA 2BNNA 4AEJA 1NA1A 3TN92 1PK6A 5KXBA 4RS5A 2XH6A 2VVFA 1EPWA 4RQPA 1VB2A 3IMNA 2RM23 4H7MA 5A32B 5BNPA 3INAA 4MGZE 3ZXJA 2ZX1A 2QJVA 5H9PA 1SLTA 2TNFA 3DV8A 1FOD1 1U12A 4LO5B 1NQDA 1LOFC 1VIWB 1X8MA 1J3RA 1YJLA 4B8EA 1GYKA 2VUAA 1D2SA 1HQLA 4WVWA 5FRAA 4AEKA 2G9GA 1G6NA 1NCRC 5FO9B 3WUDA 4YSFA 2WSVA 2A6XA 4J6GA 5KHGA 3ZXGA 3T2TA 4H3WA 2A5ZA 1F5FA 1RUC1 2QUOA 1LB2A 3OTFA 4AF9A 3MLLA 4ASMB 3E6CC 3ZYIB 2VW1A 1LECA 2VVEA 4B29A 4M3CF 3PLQA 3AYDA 2ZGTA 4YFZA 4H7LA 1YUDA 1DQ0A 2RS32 2Y38A 3WDXA 3V56A 3VHNA 1NLSA 3POWA 1MZEA 2GNTA 4COWA 2P3KA 3VKMA 5JOYA 4XEZA 5CA6A 3M70A 2I07B 1DGWA 3KMHA 4GA9A 2PLV3 1S0JA 3FHIB 4NWVA 4CDQA 1YLLA 4ZKTB 5K0UA 4M3CB 1KJRA 1JYCA 3LZZA 1FOD2 1DGRN 1J59A 1F31A 1MQTA 1OOPA 3GBGA 1EYBA 4UXAA 4AEDB 3NKGA 1C1FA 2BFUS 5CFDB 1OLQA 4S2DA 2D6OX 2GMMA 4HT1T 1WLDA 5IK8A 2TUNA 3DKWA 5A33B 5A3MA 3MIDA 5ABJC 4L9BA 1G9DA 2ZGMA 1RUC2 3H8UA 1U5XA 3ILRA 2HWE1 4YW1A 2QQPA 3FLTA 4FTEA 3ZPYA 2PHTA 4YZ4A 4G3YC 2RMU1 2WQ4A 3WVJA 2PELA 4XF1A 3VBHA 4K9SA 3NV4A 1PIV1 4IXLA 3NSTA 1QNWA 4PDWB 3ZYJB 2OUHA 3GZAA 5LEKA 1RJ8A 4LO6B 5T3NA 2EXIA 1PM7A 3VZJA 4GH4C 4Q4X1 1H2LA 5ACA1 4AYUA 2D6MA 2QCSB 3FBMA 1Q5OA 2VECA 4KWJA 4BCUA 5BY5A 2ENRA 1KITA 1Y9QA 4I3GA 3MZHA 4LBQB 4GWNA 1LCLA 2GN7A 4FOVA 4XIOA 3B01A 5BUVA 3BALA 1NXD1 5C8CA 4XJAA 2NN8A 3QH6A 3VBOA 1Z7S1 1FX5A 1M06G 3ST7A 4RGAA 5H9RA 5F1RA 3MFAA 3WOGA 2VNOA 4XBLA 1H2NA 1LU2A 3H3ZA 3O0XA 3IDCB 4E4ZA 1VBC1 3WG1A 3BTAA 4P9XA 2VMIA 1NA1C 4LHNA 1PK6C 2HWE2 4FOQA 4P9IA 4RS5C 1DFQA 3V0AB 3AKTA 1QOTA 4RQPC 1LGCA 3IDEA 4LT5A 4XTMA 5FDBA 1SDWA 1XE8A 5JPNB 3ZSJA 5BNPC 2RMU2 3M1HA 4CRQA 3JQWA 3PJQA 1REDA 1H2KA 1EAH1 2KXLA 1PIV2 3CJXA 2P2KA 5LRSA 2Y26A 2GC3A 1XU1A 3J8F3 5E88A 2YMZA 1I3HA 4Q4X2 3OY8A 4JDOA 5ACA2 2OIIA 1QOSA 1YO8A 2BVBA 2MHFA 1UPIA 4D94A 4SBVA 1RINA 5BPXA 1O3RA 1X7NA 5HCAA 3MGUA 4JDMA 2EXJA 5IK4A 4LE3A 4MV2A 3M8LA 1IKQA 3PMSA 3BIWE 4XJWA 4JCKA 1Z7S2 2XB6C 2ZCWA 5DZGA 1IS3A 2XWJB 5C9AB 2QKDA 5CG9A 1S0BA 5FOJB 1LHUA 2HWE3 3I2DA 3SISA 3TYJA 1VBC2 2DFBA 3DPRC 2B39A 2RMU3 2QVSB 4FP2A 4D69A 1ZZCA 1AX1A 4CDQC 3JB4C 5K0UC 1V6NA 1LEMA 1ZVFA 1GFF2 2VULA 3V0BB 2WNVA 1HV0A 1BVVA 4KG8A 2X53S 1EAH2 4OUSA 3C3VA 3R4DB 4AVAA 2XG3A 5FREA 2B7YA 1MQTC 1UU6A 1OOPC 4Q4X3 4AFAA 5ACA3 5JPMB 2JG8B 1FV3A 3I59B 2IFRA 1VRH3 3NAPB 3Q9OA 3UK9A 3VGIA 1L3JA 3M3EA 2Q4SA 4K20A 4RL7A 3ZFGB 3B9IA 2YROA 3TAYA 2JDZA 3KT1A 4R9AA 1ND2A 3D0SA 3ZDSA 4EV0A 1OMIA 2UWAA 5EYXA 1Z78A 1FMD3 1Z7S3 2I2SA