2IXKA

Rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
184
structure length
184
Chain Sequence
b'SMSMKATRLAIPDVILFEPRVFGDDRGFFFESYNQRAFEEACGHPVSFVQDNHSRSARGVLRGLHYQIRQAQGKLVRATLGEVFDVAVDLRRGSPTFGQWVGERLSAENKRQMWIPAGFAHGFVVLSEYAEFLYKTTDFWAPEHERCIVWNDPELKIDWPLQDAPLLSEKDRQGKAFADADCFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DTDP-4-DEHYDRORHAMNOSE 3,5-EPIMERASE
publication title Rmlc, a C3' and C5' Carbohydrate Epimerase, Appears to Operate Via an Intermediate with an Unusual Twist Boat Conformation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Isomerase
total genus 47
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 5.1.3.13: dTDP-4-dehydrorhamnose 3,5-epimerase.
pdb deposition date 2006-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ixkA00
4O9GA 3KGLA 1CAVA 4R52A 2Q0AA 2Z69A 1O3RA 2OZ6A 3S7EA 2PAKA 5E1RA 1SQ4A 4FBFA 4XFCA 4K8FA 2KXLA 1UD1A 2H0VA 4EV0A 4IEVA 4MGIE 4I02A 4N9HA 3ZDSA 3ELNA 1VP6A 1GQGA 2PQQA 2Q4SA 3H7YA 3RDIA 4IESA 5I8YA 3OD0A 1DZRA 3KSCA 1QY4A 5J7MA 3E6CC 3U11A 3TNQA 3MDPA 4KWKA 4UXAA 4D7TA 2UYAA 4HZFA 5F1RA 3H3ZA 4LA3A 2MHFA 1ZRFA 2UY8A 3OTFA 2PA7A 5FLJA 3ROUA 4JTNA 5BV6A 2BYVE 1NXMA 5LRRA 2QDRA 2UYBA 1DGRA 4QGNA 3NL1A 2XL9A 4KWJA 1CGPA 3ACLA 4YARA 3DN7A 3E5QA 4IEYA 5FDBA 3SCFA 1VR3A 3NKTA 1ZZ7A 3LA7A 4YSFA 3NJZA 1QWRA 1O3QA 3BU7A 3H9AA 3FWEA 3IBMA 3HT2A 5JAXA 3U0ZA 3EHKA 3CJXA 3N4MA 3WW3A 2IXKA 3LA2A 3IIAA 1CAUB 4HSJA 2BNMA 2GAUA 3CF6E 3ES4A 1WGPA 3E6DA 3E97A 4LUKA 3SMHA 4LLOA 2MNGA 4BYYA 1J3QA 2HJIA 1ZZ6A 4X6RB 4HVOA 1PMIA 1YFYA 1J3PA 1J1LA 4WZCA 4XFBA 3D82A 3PLQA 1CAXA 2XHKA 2WC2A 4XFIA 1X8MA 1YLLA 2H6CA 1Q43A 3CEWA 5JSRA 3DKWA 4XF3A 5FLHA 5KHIA 2HKXA 2ATFA 3M3IA 5LEJA 1NYWA 1O4TA 3QACA 2IXIA 2IXLA 2Q30A 3OGJA 1WLTA 2D93A 3HIFA 3BPZA 3M70A 4IEUA 5KHHA 2PHLA 3ST7A 1FXZA 3SHRA 2MPFA 1J59A 1VJ2A 1G6NA 3H3UA 3KGZA 3RYKA 1YFUA 3IWZA 4MGZE 4X6QB 2WFPA 4QMAA 4GULA 1J3RA 4XEZA 3PVBB 2EA7A 4XFGA 3D0JA 3E5XA 3H7JA 5JR7B 2K0GA 1Q5OA 2V09A 2EVXA 3KCCA 4MGKE 1QXRA 3FE5A 2GH2A 3VHRA 1HW5A 5J48A 1NE6A 4HLTA 4I09A 1FI2A 1NE4A 2OPKA 3LWCA 1RUOA 5KHKA 5I0TA 2FMYA 3U10A 1CAXB 1DZTA 5FLIA 2IXHA 1CAUA 2XKPA 4BH9A 4F8AA 2XL7A 4AVAA 1CAWA 1LR5A 1WA4A 4EWEA 4XFHA 5K8SA 4XF9A 4H7LA 4QX5A 1U12A 4EWDA 2EAAA 2Y0OA 4FT8A 4Z07A 4IEOA 4E2GA 1NZCA 4Q0UA 1LKNA 2XLAA 2VPVA 2BGCA 1H1IA 4LTAA 4ORFA 1IPJA 2PHDA 1J58A 4Q29A 3WW2A 1ZZ8A 1H1MA 4YRDA 2OA2A 3SCGA 2BEOA 2ET7A 1FT9A 4XFFA 4IEQA 1L3JA 4IERA 1ZZBA 3H1WA 5JSPA 3S7IA 2VECA 2P17A 3E5UA 1TQ5A 3HQXA 4HN1A 4LEJA 4LULA 2O8QA 2PFWA 2XKOA 4FAGA 2C0ZA 4AQ6A 4CYDA 4IEZA 2QVSB 3C3VA 2XLFA 3I54A 3OCPA 4L11A 1X8EA 3LOIA 4I01A 4BIFA 4KWLA 1ZRCA 2ET1A 5KHJA 3SXWA 1EYBA 4MV2A 5E16A 3RZZA 2GZWA 4Q0QA 1O3SA 1CAWB 1UCXA 3FFQA 2XGXA 3CL1A 4OFGA 1ZRRA 5BY5A 1UPIA 2B9UA 2Q1ZB 2PAMA 3R6SA 3FJSA 4ONUA 1X82A 3H50A 2QJVA 5LEKA 4Q0SA 5J3UA 4I0AA 2ZCWA 4IEPA 3DL3A 4ZU5A 5I91A 5I0RA 4XF0A 3LA3A 3H8UA 5I0UA 1YHFA 3FHIB 4A2UA 4WVZA 5KBFA 2I45A 4AVBA 2H6BA 5I93A 3D0SA 4QM8A 3RYRA 1CX4A 3NW4A 5LRSA 4E2QA 4O9EA 4KL1A 1YWKA 2GC3A 5FPZA 4PIYA 1ZNPA 1EPZA 3FX3A 3I59B 3EQEA 4WBBA 4LUMA 4HVRA 4B29A 3GYDA 4J1WA 1ZZ9A 4ZU7A 5BUVA 3FZ3A 4Q0VA 3BB6A 3QOPA 1GQHA 2B8MA 3B02A 1Q3EA 3RYPA 4MGYE 4QGMA 4TLFA 4MX3A 2CV6A 2FQPA 4IEWA 1PM7A 4META 4XF1A 1YFWA 1JUHA 3EO6A 2QNKA 3LAGA 1Y9QA 3MYXA 1UIJA 4I0BA 1I6XA 1SFNA 4JVAA 3KMHA 2BNNA 3L2HA 4XF4A 4J1XA 3CLPA 1ZVFA 4HBNA 4I3PA 3RPQA 4MZUA 5CU1A 4PIXA 1DGWA 4YNIA 5BPXA 4PJYA 3LZZA 1ZREA 3E6BA 4F7ZA 5AVPA 2B5HA 3O14A 5I8SA 1ZX5A 4HSLA 5EFUA 2QCSB 2IC1A 1YUDA 3EBRA 3BALA 4KU8A 5CADA 4QGLA 3SCHA 3BCWA 1EY2A 1UW8A 3UKVA 2CAUA 4KU7A 1XRUA 3H1YA 3WW4A 2DCTA 2D5HA 5CVRA 1RTVA 3UKNA 1OFNA 3G7DA 1RUNA 5C8WA 1O7FA 1OMIA 4Z82A 3ETQA 3IDBB 4HVQA 3I59A 4UBHA 2ETEA 2GC0A 5FPXA 4QM9A 4XFAA 5FQ0A 2IXJA 2VQAA 1V70A 4N9IA 2CGPA 3PNAA 1IPKA 2GC1A 5JSOA 1CAVB 3MPBA 4DINB 1RGSA 2OZJA 1EP0A 2PAEA 3IDCB 1O5LA 3ES1A 1ZZCA 1RC6A 1QXJA 1XE8A 2E9QA 1O5UA 3CO2A 4IETA 1YFXA 4R8HA 4E2SA 2UY9A 2GC2A 2XLGA 4JTOA 3H1MA 2IXCA 2ZKLA 4FAHA 3JZVA 2Z2SB 2D5FA 2N7GA 3MZHA 3RNSA 4AXOA 3UKTA 4XETA 4ZU4A 3USSA 2CAVA 4NVPA 4LA2A 5C6CA 1O3TA 3HT1A 4MUVA 2GU9A 4AVCA 5FCCA 4D7SA 2K9ZA 5I0SA 1Y3TA 3DV8A 5T3NA 3NSTA 5HI0A 3I7DA 3GBFA 4PIZA 4UBGA 3WW1A 1LB2A 4YYOA 5KHGA 3TNPB 4Q0PA 3EJKA 4P9GA 5JCTA 5FQ0B 4L2NA 5BXXA 1XE7A 2O1QA 4HMZA 5I8TA 3S0MA 4JV4A 2BNOA 1RL3A 3OF1A 4I2OA 5EZWA 4OLLA 5D1IA 4IEXA 4EWAA 1LRHA 2D40A 4HN0A 4AQ2A 2OYZA 1SEFA 4MH0E 3NVCA 1ZRDA 4BHPA 4RD7A 1OD5A 1X7NA 1I5ZA 2F4PA 2PTMA 1OI6A 4EROA 1UIKA 4QXKA 2PYTA
chains in the Genus database with same CATH superfamily
3I2OA 1Z7S2 1BZWA 5F37A 4CU9A 2DWRA 2W52A 2XJVA 3MV11 4R52A 1E5IA 1R083 4EYUA 4Z2WA 4A41A 4CDXA 2OZ6A 1NZIA 3RRDA 3V64A 3PIJA 1XNDA 4RR3B 4NIIA 4N43A 4AEDB 5K4LA 1FATA 5LBBA 4ZPIA 2KXLA 2VM9A 5AFEA 2VCMA 2K46A 4N9HA 3USUB 3ZDSA 1R081 1LOFC 2DUQA 4M3CB 5F32A 5HPOA 4XCBA 1GNYA 3IPVB 1UXZA 4IESA 4MXVA 2G1MA 3VZJA 4E27A 3KSCA 3LFMA 4CU6A 1DU3D 1QY4A 2X5IC 4FOWA 1WLCA 1BQPA 3VKMA 1K5MB 3TNQA 5FYYA 2ZGNA 3GZEA 4D7TA 4ZY9A 2YGMA 2UYAA 1WCQA 3ZN6A 2P5BA 1EAH3 4LK7A 3WG2A 4FTEA 2BFUL 2XUEA 3OPWA 4RGAA 4DUXA 4SLIA 5JI7A 2UY8A 3OTFA 2R063 4ATFA 5FLJA 4QAWA 3ROUA 3T30A 2VMEA 2BYVE 4J25A 5BV6A 1OOPB 1XYOA 2GP5A 4NO4A 1PGW2 2ERFA 3T08A 2OUJA 3AP7A 3O1UA 2Y6JA 1EAH1 2XL9A 1CGPA 1KDKA 3WEZA 5JXHA 1BHGA 1OHFA 2R061 3VBFC 2FDJA 2YUEA 4XDPA 4CEWA 2FDIA 2ZGOA 5FYHA 4IEYA 5DDJ2 2J1RA 4WV8A 1W05A 1ULPA 2VZQA 3N7JA 3ZLIA 3AMPA 1KD7A 3I2IA 3ON7A 1OA3A 3JD73 5FY7A 1GOHA 3PDQA 1GQPA 4XVHA 5A3LA 2DUOA 5JXGA 3ETPA 1D7PM 3E1F1 3FWEA 1V6NA 4NWWA 4PT6A 1A3KA 3IBMA 4RR3C 4UF0A 3U0ZA 4Q4X3 4QX2A 2AR6A 1KJLA 3CJXA 1X33A 2IXKA 5JLVA 3ACFA 3N4MA 1AL22 1UL9A 1CAUB 3A23A 4TSVA 5ABJB 2GH8A 1RUJ2 1RUE3 1FPN3 3JD71 4OYUA 5FO7B 3TRSB 4XUNA 1NAEA 4XYXA 3ZSMA 3ZR5A 4W6YA 2XMLA 1WGPA 1RIRA 2OPWA 3E97A 3JBG1 3OPZA 2ZGRA 4LUKA 5JZGA 2WNUB 4Q4X1 2VBDA 4ZXKA 3M3CA 1W8NA 2ZX2A 4NN0A 4LBNA 3B00A 1FNZA 1NXD1 3I3DA 3WNKA 2LUWA 2C9KA 1Q8OA 5DAXA 4MHRA 4AEJA 4LOSA 1LU2A 2WS93 3PVEA 4Q4W2 1FPN1 4COWA 1NLQA 1YFYA 3AFKA 3UESA 4QDQA 1AYN3 3TBDA 3GJBA 5J1XA 3D82A 2RS13 2UWBA 5FY8A 2EIEA 1JYNA 1YQ8A 1R092 3PTRB 2WC2A 3BU0A 1OH4A 4NUBA 3B9IA 3I2GA 1PGL1 4IE7A 4MXWB 3K48A 3RZLA 3BVCA 5K7PA 1V6LA 4NAMA 2HYKA 2WS91 1NYWA 1OF3A 1PIV2 1PX4A 3N7KA 1O4TA 3QACA 4P9WA 1AYN1 2WA3A 3W59A 1PHMA 2RS11 1OH3A 2IXLA 5F3IA 2AEZA 3BPZA 5KHHA 1QJY2 2BOJA 3UJQA 3NAPA 3PUIA 4PLMA 5DPNA 1ASJ3 1NQDA 1ULCA 1VAKA 3WY6A 3ZXGA 4FFHA 2W92A 4UFJA 3IIIA 3KGZA 3RYKA 1AX1A 4Q5OA 1J84A 2D3PA 2R072 2ZA9A 3PHMA 1J1TA 4K3UA 3POBA 3RQ0A 4ITCA 3TEYA 1IG3A 2VVEA 1NCRB 2Y0IA 4XEZA 3EB7A 5F2WA 2J1SA 2YU2A 3APBA 3LD8A 4GKXA 1ASJ1 2VCBA 1BMV1 4AW7A 5DABA 3T2TA 1C8M3 2BWAA 1DGRN 4RS5B 3ZYPA 3KCCA 4XCAA 5AFBA 5A32A 1HQLA 2Z42A 3FE5A 5EHDA 2YBSA 4BXFA 1JS9A 3M8LA 4BQ5A 4ZZ5A 2JX9A 3FC0A 3HMYA 3MGUA 4QB1A 3HJRA 4OI4A 2VNGA 1K12A 3H42B 2QBXA 1C8M1 1Q56A 3LWCA 5FZ0A 3RZGA 1W03A 2RG4A 2DU0A 3R05A 1CAXB 1QJZA 5GZFA 3WF4A 3LPGA 1DZTA 2BZDA 3ZFGB 1RB8G 4FPYA 2D6NA 1VPHA 4Y24A 4FPGA 4BH9A 4F8AA 2XJTA 1VBA2 5HCFA 2R1BA 4COZA 4L9BA 1XNAA 1L7LA 5CFCA 5JOXA 1KFXL 4HK8A 5IJRA 1ALYA 4QX5A 1U12A 1RXFA 4K9SA 4FT8A 2TUNA 4P9IA 3LE0A 3VBSB 3T4HB 4C0BA 1DLLA 4CZSA 4DOUA 5KXCA 2WZ8A 4FFIA 5E89A 4NRMA 5EYYA 3WDVA 1JI6A 1H2LA 2UURA 2VUCA 3M2MA 4EE2A 3QLQA 3WDTA 2Q8OA 1LGNA 2ZGSA 1M06G 1AX0A 1A8DA 2JWPA 5T55A 1ZBA3 2E7QA 3MF6A 1H1MA 2JDHA 5FPAA 1WUVA 3WUDA 2E26A 2W95A 2BEOA 5IAVA 1GKBA 1CZTA 4OCTA 4QKFA 5FZ3A 4B4PA 3SISA 4URAA 2XJQA 5A3TA 3H8XA 1VMHA 2KR2A 4IERA 4IGPA 4UFLA 5A6XA 4Y26A 3ZIWA 2VECA 2DDUA 1NCRC 4HN1A 2C5DA 1R1A2 4LEJA 1ZBA1 5D2AA 1AYM2 5FY5A 3MI8A 3SNMA 4ARYA 2VTXA 2XKOA 5FZHA 1ODNA 4CYDA 4RFT0 3HPNA 2EALA 2QVSB 2XXZA 3LKJA 1X36A 1SLIA 3C3VA 5FY4A 3VBHB 1AX2A 4BQ4A 1PVXA 2VC9A 1X8EA 1UOGA 3ABZA 5CAZA 1U5ZA 4KWLA 4E8CA 4GB31 3MLKA 4CXXA 3GXUA 4JDMA 4LPLA 1GZTA 2AUYA 2WIIB 1RUI2 1N47A 3OBAA 2VMCA 4Y5Z0 2KD7A 4MV2A 2W68A 4RQPA 3RZZA 3VGIA 2GZWA 4Q0QA 1RUD2 1VRBA 2WR9A 5LZ6A 5FKCA 1DBNA 3MEPA 1AL0G 3WR0A 2BJSA 3SQOA 3NNGA 3K75B 5EP9A 4H3WA 5BY5A 1UPIA 2W47A 2Q1ZB 1MQTB 1POQA 5FZMA 3K3NA 5FPBA 3R4DB 5C4WA 2AGSA 5A6QA 3WF0A 2XQXA 4ONUA 2D6MA 1A8MA 3POIA 4PI0A 4XPVA 5C5UA 5LW9A 1X82A 5F2SA 2GMPA 2Y34A 3THDA 3DECA 4LMFA 1OKQA 1GANA 3TWIA 1NLRA 2VBPA 5LEKA 5IK4A 2VGDA 4UFMA 5J3UA 1F15A 3VBSC 3DL3A 5I0RA 4LBKA 1RINA 1LTEA 4D6RA 1W28A 1Y7BA 2AENA 1RUH2 4XUTA 5D21A 4W8JA 5IK8A 4MHUA 5IW0A 1QDOA 4YM1A 3TYJA 3I8TA 1XPWA 3NWKA 5H9PA 3RGBA 4A2UA 4EZ4A 4NHMA 4R4XA 4QPYA 1OQDA 2DCZA 2WWUA 4WVZA 5EQUA 3LSEA 5HXMA 4AOCA 4Y4YA 4LKFA 2BGOA 4FPFA 4HL0A 5CNAA 5JOWA 2R6QA 3LEIA 4XURA 1KS5A 2JKBA 3H0OA 1Z0HA 2VG9A 4Y4RA 1POV0 1YQ5A 2CU5A 5CBLA 3I3QA 1UYXA 2WQ8A 4E2QA 4LBQA 2WABA 1W6NB 4WZFA 3M7AA 5FPZA 4LHNA 1EPZA 1G9FA 2HWE3 3G6JB 3N9NA 3HWJA 3DPRC 4WBBA 1CX1A 2CNAA 2D7FA 3J8F2 4CDWC 5GZGA 2WZPP 2XJPA 4DNYA 3GYDA 1MS8A 1N1YA 2HEYF 3MF9A 1ZZ9A 1ENXA 1AZDA 1CR7A 1TNFA 2RS51 1C4RA 3VBHC 3D8CA 3MW4A 4W6WA 4Y33A 1E5RA 4UYBA 4S2DA 1NA1B 1GQHA 3R4SA 2B8MA 3WF2A 2HWE1 1R093 4XQWA 3SH3A 1ND2B 3THTA 4COYA 4TXWA 3VKNA 5FY0A 4GH4B 4QQOA 3UYJA 2W46A 4C8DA 3RYPA 3ATGA 1NG0A 4Q2FA 2QZ3A 2JD4A 2JEMA 4MGYE 3WDXA 1YIFA 4NOTA 5ACA2 3C7HA 2JDYA 4GWMA 4S2HA 3I3MA 1JH5A 2CV6A 3AKSA 1BEV2 1YQ2A 3M3OA 4CDXC 5A3UA 2D6LX 5FZ6A 3POEA 4XF1A 2X09A 1V9U2 4N43C 1PO22 1WLWA 2ZGPA 1N3PA 1QJY3 2QNKA 3BODA 3IZOA 4KGQA 3RS6A 3U78A 4F3JA 1G9AA 1XJAA 1X50A 3URFA 3O1TA 1NCQA 3OBTA 4AFMA 5EPAA 1SFNA 2NN8A 1WKYA 4BCUA 3JQXA 2R073 1DQ1A 2VVFA 1S55A 1UWWA 4A3XA 3PURA 5CIRA 4YVWB 3MUY1 3GNEA 2EXJA 2IUWA 4Q4Y3 1ZVFA 4FQZA 4XDOA 1W6OA 1AR73 1I3HA 2A7AA 3UT0A 3GZUC 1QJY1 1RXGA 1QGLA 1W0OA 4PIXA 2EXHA 5DUVA 4XJUA 5FMOS 3RZHA 4YNIA 1JU4A 2W1UA 4JC1A 3LZZA 5FZOB 4BU2A 1VBD3 2R071 3KV5A 3E6BA 4NPRA 5DZFA 3VBUB 4AVVA 1PZ9A 4F7ZA 4Q4Y1 5I8SA 3GCWA 4HSLA 2QCSB 1AR71 3VZKA 4NWVA 4XMIA 4KNCA 2WO7A 5GLWA 4K21A 1URXA 1YEWA 4AI2A 4JDOA 2PXJA 3BCWA 3DXUA 4Y22B 2VH9A 1MEC2 1LCLA 1VBD1 2CAUA 2WA4A 1XRUA 1XNKA 4HETA 4KU7A 4XBQA 3WW4A 2ZZQA 2HBUA 3P3NA 4P9YA 2D5HA 1OXCA 1RTVA 1OFNA 2W5FA 2R32A 4GJYA 3HQUA 3ACHA 1JYCA 1NY71 4AGVA 1O7FA 1MS1A 1VAVA 4DMIA 3IMNA 2BP6A 2WDBA 4JAAA 2CHHA 2VZRA 3VKLA 3U37A 1NA1C 3MFAA 2J7MA 4Y1UA 5HXVA 2A1XA 2QE3A 3SKVA 3RMYA 4HVQA 4CEWC 4UBHA 5JPNB 1LOCA 2ARXA 5H9RA 2VOXA 4UW3A 5BNNB 2ZKNA 5FPXA 4LQRA 1LHUA 5L7OB 1OT5A 4CP1A 2LROA 3N9LA 3ILFA 3UGFA 2IXJA 1V6IA 2B46X 4XMAA 5FZFA 4IUGA 3HNMA 1V70A 3V0AB 1P8JA 1VRH3 2JDKA 2ADDA 2WN2A 4Q4V2 2P6CA 1CAVB 3MPBA 1RGSA 3JQWA 1E57A 1EP0A 3OJBA 3IDCB 3KV4A 3BIEA 2JD9A 1KQRA 4I3GA 2JB4A 3HD8B 2PHWA 1HB4A 4OULA 3AYCA 4FXKB 3AYDA 2E31A 2GDFA 2IXCA 4WM8B 3WHTA 5CZKA 1VRH1 2UWCA 1S1AA 1TG7A 3WDWA 4JRAA 4NHKA 2NMNA 4OHXA 1GSLA 3RNSA 5A1FA 2VU9A 4XETA 3THCA 3VBOA 3ZMOA 1PK6B 5F5QA 4BQ1A 1KEXA 2ENRA 1WMDA 3OGVA 3K4AA 1ONAA 2RV9A 3VBUC 4P9XA 4Q8KA 3PL0A 3EXUA 3OOXA 3ZFEA 5BNOA 5K0UA 4B3NA 2QFEA 5FCCA 2NMOA 1GBGA 5DAWA 4CDUB 2ZABA 1GZWB 2K9ZA 3F2ZA 3ZPYA 5FBZA 5CISA 1RUD3 3MV01 3WUCA 3ZN5A 4LO8A 5HI0A 3I7DA 3GBFA 4UBGA 5J98B 3WW1A 4D7YA 4XXAA 1QOSA 2Y60A 5FUPA 2A75A 4GA9A 3H8RA 1SCRA 4YYOA 1LB2A 3S30A 1OPOA 4YFWA 4R4ZA 3IPVA 5FUIA 1LESA 1AR93 2W2IA 3TOJA 2V4AA 3CJIA 3FLTA 4HMZA 1F2NA 2LTNA 3VD4A 1SG3A 1KS4A 1YI9A 5EV7A 3S0MA 5FY1A 1AHSA 3RI9A 2RHPA 3AZXA 4GWNA 5A7SA 5BNNC 5C3SA 4K20A 3OF1A 3NNMA 5DG2A 1UMZA 5EZWA 3WDUA 1U5XA 5L7OC 1KXGA 4A7ZA 2KA3A 1OFSA 4ARXA 2ARBA 2A6WA 2WO3A 3PTYA 2QQPA 4IEXA 1BBT3 4H14A 1AR91 3SITA 1CIWA 1QNYA 2GNDA 2W9XA 1S0IA 2ZZJA 3NVCA 5EIYB 1OD5A 2DBNA 2WO1A 2X53S 1ULOA 4N53B 3KHCA 4DO0A 1H2MA 4D0QA 4AI8A 2VTXJ 4IE0A 4WM8C 4IGQA 1BBT1 2PYTA 2DCJA 4PQ9A 4B1LA 3KGLA 5JMOA 4LITA 2J22A 4BK4A 1OLME 2Z69A 5JOZA 1PK6C 4JQRA 4YWAA 3TN91 3POSA 3GZTB 1K5JA 2ZHLA 2ZXQA 3P5BA 3P3PA 5DMYA 3ZXLA 4AEKA 1IOAA 1UY4A 4FBFA 4K8FA 5D8AB 2G9GA 1IGOA 3RWNA 3ACIA 4I02A 5FPUA 4QDSA 4BOWA 2A3XA 2XB6C 5FTTC 1H30A 4CDUC 1CPNA 2BUKA 2VZTA 1KJRA 5T5OA 1FOD3 1GQGA 2YBKA 4OHYA 3RDIA 3LEMA 4E4ZA 3WD5A 3OD0A 4HT1T 1ZBE3 1COV2 3NV3A 1DZRA 1LOAA 4FPKA 5AVAA 2J42A 3VHPA 1LGBA 5JDBA 1UU6A 2ZX0A 4GIQA 3N36A 5FY9A 3MDPA 1VAMA 4UXAA 3DUIA 1FOD1 2VQUA 4CA9A 4HZFA 5F1RA 1H8VA 4YG6A 1AXYA 1ZBE1 3U14A 1SACA 2MHFA 2VCAA 2JG8B 4AHZA 4CCJA 5BNPC 1YXWA 2DTYA 3C2UA 3GALA 2PA7A 4BB3A 4R9AA 2W1QA 5FXXA 2ZX1A 5LRRA 1HJFA 4LT5A 3NNLA 5G04L 1PX3A 4NRQA 2HLEA 5FKBA 3LEGA 3A7QA 3N35A 4M00A 3ZOIA 4A6OA 1VBE2 1Z78A 4WM7A 1GMMA 4AGRA 1QOOA 2Q1FA 4E4SA 4TZDA 1W8TA 2VNVA 1S0DA 3DN7A 3IAPA 4A3ZA 2WWJA 4JGYB 4MGSA 4CP9A 1GYKA 5T5JA 3VDCA 4CXWA 4M0NA 1UY0A 2D97A 4LO7A 5IFPA 5F3GA 3LA7A 1MS0A 1QWRA 1RJ8A 1W9TA 1O3QA 3BU7A 1QF3A 2R0HA 3ZSKA 1SDWA 5A33A 5IVEA 3IIAA 1CPMA 1IS6A 4HSJA 2FDHA 4XC9A 4Y20B 5EJZB 1CIYA 1PM4A 1RHI2 2BNMA 2GNMA 3LEKA 5TSWA 2GAUA 3CF6E 4RS5A 3W9AA 4NHXA 3ES4A 3VKFC 1GLHA 2QQOA 1O6UA 2BFUS 2XWBB 4AYUA 1PVC2 2WZEA 2JECA 4LLOA 2RJ2A 3RI8A 1UF2C 5HCAA 2ZHNA 4K40A 1J3QA 1F31A 3ZMNA 2HJIA 4JZRA 4LBLA 1ZZ6A 4X6RB 3T2PA 1FMD2 5FMDA 4Z8BA 1J1LA 5FZ7A 2X5IB 2QTWB 2VZPA 4YLZA 3CQOA 2FHRA 2V5YA 1CAXA 2VUJA 2XHKA 1W6PA 4PBPA 5FREA 2DVDA 2P1BA 3VZOA 3MIFA 1YLLA 2WZR2 1RUF3 2JG8C 3ZYBA 1LEMA 1Q43A 2A3YA 3AKQA 5JSRA 3DKWA 3N7MA 2WRAA 5FLHA 2HKXA 1FYUA 1D4M3 3M3IA 4Q27A 2FDKA 4R9BA 1W6MA 3U75A 2Q30A 3OGJA 4B4QA 2XQRA 1AF9A 2PHLA 3ZFFB 3KCYA 1RUF1 3ST7A 1XSQA 2MPFA 4OVEA 1VJ2A 1W99A 4IE6A 4PBOA 4CEYA 1QJX2 2A6XA 1D4M1 3DF0A 3IWZA 3PJYA 2WFPA 3KF5A 4AFCA 4XILA 3WNNA 2OKXA 3VBFB 4LBJA 2D3RA 4JGZC 1XYPA 3WV6A 3DCQA 3AB0A 2E51A 4RHV2 1HXS3 2D98A 2EA7A 2HWD2 2WSVA 3D0JA 4OHVA 4QT6A 1W3XA 1XNTA 5FZ1A 5KXDA 1RUG2 4QB6A 3FHQA 4URTA 1QJU2 3UJOA 1Q5OA 3I3BA 1GP4A 1OA2A 1KFUL 1NCQC 2GNTA 4MGKE 4OI2A 2RJKA 5FZLA 2W1SA 4YW5A 4PLOA 3PMEA 3FL7A 5C8CC 5J48A 4HLTA 5CB7A 4H2AA 1HXS1 4A45A 5T54A 1FI2A 2VW2A 2FCUA 4K8RB 3OUJA 1RUOA 1CESA 2ZMNA 1UOFA 1QOTA 3OPTA 4N90A 1O8PA 4W4ZA 4ZKTB 2WKKA 2OQ7A 2IXHA 2XKPA 3TB0A 1ST8A 1W2UA 1TMF3 1LR5A 3GHNA 3U4SA 1WA4A 1PMHX 2W0XA 2ZHKA 3J7HA 4XFHA 4UOJA 1QQP2 5K8SA 2VO5A 1QIQA 3L9JT 4EWDA 3ME2A 3U1XA 2EAAA 4Z07A 5F5IA 3RFRA 4IEOA 1NZCA 2DVGA 2BRTA 4OUEA 3GCXA 1CD3G 4WVMB 2VD7A 2IVIB 1H1IA 1TMF1 2DVAA 5F39A 4OI1A 4ISQA 5FP8A 1IPJA 2QQUA 2PHDA 2P4EA 4HKOA 3ZYGA 1GR3A 3AJYA 1V6MA 2C4XA 3ZFFC 4YRDA 2DURA 2OA2A 5IHRA 3SCGA 2P3KA 2TNFA 2VMFA 4ZS3A 4XFFA 2HWC3 3ORJA 1ZZBA 1S0CA 5CKMA 5JSPA 1PO13 3IN9A 4D69A 3WSOA 4Y5TA 4GZ9A 3AZZA 1D0GA 4TN7A 2RM22 4CPBA 2O8QA 4UW5A 4G9SB 5L73A 4DEVA 1FX5A 1DGWX 3D6EA 1TME2 2X8KA 5JIAA 4AQ6A 5HBAA 4J6GA 1AR82 1POV3 5FK7A 2HWC1 1KDMA 1W6QA 1HRI2 2XLFA 3I54A 4IV3C 4I30A 4XUQA 2JDNA 3LOIA 1PO11 2AREA 2R16A 2BBVA 1XE0A 2BOIA 4AGGA 2ET1A 5F3EA 5KHJA 1MR5A 1W2TA 2F17A 1BK0A 3JUUA 5KR7A 1FNYA 1HQNA 4RGKA 3TEZA 2XBO2 1XU2A 1HN0A 2I74A 1UCXA 1POV1 3VBOC 2QQKA 4FP2A 4S2GA 1SBEA 3AL5A 2B9UA 2Q8EA 3AP6A 2XH6A 5DAVA 1J83A 4PCRA 2WNOA 4JHZA 4QKBA 1YQCA 1WBFA 4COVA 3AJZA 3VBRB 2IVJA 3ZFEC 4FOQA 4LHLA 2HBTA 1XC6A 3X29B 1RUE1 1JODA 5IT6A 2VW0A 5F6KA 5G05L 5L9VA 1BVVA 2D6OX 4QHBA 1B35A 1JOPA 1MVQA 1DYOA 2WWSA 1YHFA 1JYWA 3FHIB 4FPJA 3J7LA 3R4UA 1D4VB 2WO2A 5FYCA 1JOBA 4XXPA 4HFSA 4K1YA 3ZIXA 4JKLA 4AVBA 2ARCA 1LAJA 5GM0A 1RVF2 4Y1ZA 4CUCA 4Y5SA 2VQTA 1RHI3 1X9TA 5JOYA 3CNAA 4PIYA 5LA9A 3FX3A 3AMHA 3I59B 2XPJA 1DFQA 1HX6A 1RMU3 2P3YA 3GDBA 5A3OA 1HJGA 1BJQA 3FHAA 3PU3A 2HEVF 1ZYBA 4ZU7A 2VMHA 3KV6A 4GWIA 1RHI1 3RWKX 4DIQA 5BUVA 5IVCA 4YW6A 3QOPA 4DY5A 5C9AA 5EYXA 3BKZA 2I07B 3WX5A 1S4CA 2PHXA 1QJFA 4AHXA 1RMU1 1LENA 1Q8PA 4CUAA 4K6BA 3OB8A 4O65A 5GLUA 3N9MA 4AI1A 3O7OA 4CP2A 1YRZA 1FV2A 4PF5A 3ZKYA 4UI9L 5C3PA 4GQ7A 4U36A 2ID4A 5GALA 5T5LA 5CFDA 4META 1W8UA 5C70A 5FO8B 4L97A 4EN9B 5H9QA 1UZZA 5BNQA 1JUHA 3I97A 3EO6A 4WVWA 2DF7A 1YC61 3MYXA 3FN9A 1X9PA 1M4WA 1MS5A 3FFZA 5HCHA 2PLV2 3VBRC 4CPBD 2OX0A 3UGGA 1RJ7A 3FLRA 4XF4A 4XHXA 4J1XA 2D44A 3CLPA 4LXLA 2VY0A 4R9DA 1NKGA 5LY1A 5EXOA 2PMWB 4HBNA 2RMU2 2Z79A 4I3PA 1OLRA 1RUC3 4IGOA 4PF1A 2G9FA 4UW6A 3WP5A 5LWBA 4XW3A 1LECA 4GXLA 3KQ4B 1JTZX 4B8EA 1W9WA 4DUWA 4LE4A 1Z7S3 1DQ4A 4QPGA 4MGTA 3MW3A 3VHNA 1PNFA 5SV8A 4LBMA 4LHKA 3CMGA 1UZYA 4IV1A 3WNLA 3AKPA 3BOWA 2GALA 1RUC1 5KC6A 2IC1A 4ZONA 5A7WA 5IVFA 1YUDA 2W94A 3EBRA 4P9JA 3FUQA 2JG9B 2LM3A 4BQWA 2WT2A 1H4HA 1IQAA 2PHUA 3OY8B 1Z7S1 4YG0A 1EY2A 3VDDA 3HQRA 1K42A 2PQSA 3ECQA 1DQ6A 3H1YA 5IWFA 2C26A 3VKOA 4H7MA 3G7DA 3VD3A 3DPRB 5C8WA 4WM7C 5CEHA 3A21A 3V0BB 1PMJX 3UV9A 1OMIA 4COUA 2Y6LA 2Y8KA 4PDWA 4UT5A 5APAA 4ASMB 4NIDA 5JPMB 1H8TA 2ETEA 2J1VA 4Y1VA 5B2GB 4N7IA 4YW7A 1Q8QA 3AP9A 2YMZA 4NHYA 2E32A 4LBOA 2ZX3A 5FYZA 3PUHA 3PVNA 4N9IA 3OBZA 1MZ6A 4HONA 4C90A 2QUOA 1ND3A 2GC1A 1EUUA 3WOGA 2B7YA 3ZSJA 2OZJA 4YG3A 5JSOA 2PAEA 4P14A 1O5LA 1HLCA 4CDXB 4L92A 3WP6A 1IPSA 1XSRA 3IDEA 3PVOA 5T50A 1APNA 1FV3A 1W2NA 4AAXA 2VW1A 4IETA 4N43B 1VE0A 4R8HA 4PQQA 4LIUA 4JTOA 4E2SA 1JZ3A 2ES3A 4P9LA 3J7MA 2ZKLA 4EQVA 4DY3A 2Z2SB 4BA6A 4AFDA 5J09A 5FK8A 2RM23 2D6PA 3VN4A 2CAVA 3EMRA 5DDJ3 1PGW1 4NVPA 1O3TA 4QPIA 3ZN4A 1AR83 1IKQA 2IFWA 1HRI3 2GU9A 1C5IA 1N3OA 5C33A 5JR2A 3POYA 1GP5A 1VBC2 1W9YA 3A22A 4MYEA 5A80A 1GNZA 2RM21 3WQ7A 1W8FA 4PLNA 5DDJ1 5DZEA 2Z5WA 2JG9C 3ZN6B 1AL23 5D8AA 1QNWA 2R042 1MVEA 4FPEA 2ZS6B 1RUJ3 5F8PA 1AR81 2ZACA 3OGSA 5T3NA 3Q8AA 4A6SA 3A4UA 2FCVA 1WLDA 1JYVA 2A3WA 4DPNA 2Y6HA 4DB5A 2DUPA 3B69A 1HQWA 5GZEA 4LO5B 1S0EA 3GHMA 1W2AX 4QQ2A 5FOJB 4KBZA 3TNPB 5JXJA 4Q0PA 2VBBA 4NROA 2RS32 1ZRIA 4O7XA 3MIGA 1N1VA 4P9GA 5JCTA 5FQ0B 1AL21 4L2NA 5BXXA 3FLPA 1RUJ1 4CEYC 2PHRA 2W08A 2LW8A 2XJUA 4SBVA 4YGBA 4Q4W3 2CYFA 5I8TA 1UO9A 1HV1A 2WNVA 5C71A 2WFF2 2ZGTA 4CEWB 4BQ3A 1H9PA 3HR9A 3K4DA 2YC0A 1HDKA 3GZAA 1SPPA 3IKWA 4KGGA 2JB8A 4EWAA 2D40A 3N3HA 1MS9A 1SLCA 4HN0A 4XUPA 4N7UA 4NJ4A 5DN2A 3SH5A 4Q4W1 4BHPA 1PIV3 1X7NA 4LE3A 1ULGA 1SLLA 1IS5A 1OA4A 1MACA 2D43A 4ASKA 4CDWA 1HV0A 1R091 1OI6A 1HB1A 2P34A 4CDQA 1UIKA 1VMFA 4GJZA 3WQ1A 4M3CF 4I2OA 4QX0A 2J1AA 1VB4A 1LHNA 4NPMA 3AP4A 1PIV1 1S0GA 4XZUG 3P6BA 4XAAA 4JGYA 1PZ8A 2OVUA 2XG3A 1UZ0A 3WNXA 4XFCA 2H0VA 3CZUA 5CYYA 5CG9A 1GWKA 4UWDA 4ISRA 2ORZA 3ELNA 4NE9A 2BPA2 5FYIA 1VP6A 1BK1A 1H9WA 1S0FA 3Q8FA 5L9BA 2VMDA 3NQHA 3KV9A 4OI0A 4JRLA 3I2JA 1JYXA 2CY6A 3C8XA 1UU4A 2YV8A 3ZPOA 3E6CC 1WA6X 5J36A 5FYMA 1W06A 3U11A 3MLLA 2ZJCA 1LODA 2RDRA 4KWKA 1XNBA 5CKQA 1UMHA 4IXLA 4HKWA 1LHWA 2OT7A 4UFHA 3WVJA 2WQ4A 2PLV3 2VR4A 4XQ4A 3NAPB 3VLBB 5AC92 1VBA3 4LA3A 4JX0A 1N1TA 1XXNA 3C7OA 4FP3A 3B94A 5F7UA 2V4VA 3O1RA 4EN0A 4AFBA 2RMU3 4P00B 3N9PA 1AR62 4ZHNA 2YB7A 5FZEA 1NXMA 2EIDA 4YM3A 4CXYA 2UYBA 1H1AA 4Q1RA 2Q8DA 2GSYA 4AWDA 1TVGA 3ZXFA 4A42A 1DGRA 3NL1A 4QX7A 1VBA1 4KWJA 2A71A 2RVAA 3CZJA 5LBCA 1O4ZA 4AQTA 4YVSA 4FI9A 3AK0A 4XABA 1K3IA 4ASLA 1UAIA 2GN7A 3J9SA 4QX8A 1SFPA 5JIUA 1WCSA 3RJ2X 5FDBA 4ZS2A 3SCFA 1VR3A 1H2KA 4HPKA 3PU8A 5CG8A 4BZ4A 4YSFA 3NJZA 5FZAA 5A7PA 2RR12 5JZGC 2I2SA 3POGA 1R1A3 3O0XA 1WMXA 1AYM3 3EHKA 2GN3A 2VOVA 3WW3A 1OPMA 3PJQA 2VMIA 1CN1A 1GOFA 2AH2A 5J96B 5CFCB 1OURA 2YC4A 3OEAA 5KXEA 2L9LA 1QHDA 2VVDA 3E6DA 3BTYA 1W8WA 3SMHA 1R1A1 1RUI3 4FPLA 1AYM1 4N8MA 1JOJA 4RR3A 4W50A 2Q8CA 1WW4A 1N1SA 4AEDA 5DAPA 3KCXA 2IZWA 2MNGA 4BYYA 5A70A 1WBLA 3CBNA 3J26N 3BIWE 4P5HA 3MLJA 4YW4A 1O8SA 3VZMA 1PMIA 1EV12 3SC7X 1J3PA 3FBYA 2D6KA 3K51A 4L0PA 4WZCA 3USUA 1UN1A 1REDA 4M3CA 4AI9A 1QJEA 3PLQA 5T5PA 2C24A 3NAPC 1GP6A 3QCWA 1RUI1 4AG4A 4HXCA 4XFIA 4P5YA 2P3IA 2Q1MA 4JKMA 2YHJA 2H6CA 4K7JA 4D6QA 1RUD1 2WYFA 3I2HA 2VZOA 4FFFA 2FBEA 1NQJA 3LCPA 2ATFA 4OHWA 5BNPB 5LEJA 1K5MA 1ENSA 3ZDVA 2YYOA 1G9BA 1RUH3 2ZEZA 1WLTA 2D93A 3HIFA 1GUIA 3M70A 4IEUA 3LDRA 1D2SA 3NNFA 4LO6B 4WVMA 3HBZA 1MPXA 1J59A 4HOOA 5LA2A 1ULFA 3VD9A 4GKYA 4KQ7A 1YFUA 3MHZA 1GFF2 4MGZE 1A6CA 1R082 4X6QB 4BDVB 4QMAA 5BYNA 4GULA 1UZVA 1OOPA 1RUH1 2O0OA 1US2A 2QQVA 3PVBB 3NJXA 4YW2A 3SEPA 1G7YA 1YI7A 3L2YA 5GZDA 1UKRA 1LEDA 5JR7B 1Y9MA 2K0GA 1W8OA 2WLPA 3J8F3 4Q26A 2OIIA 2RS33 2V09A 3KB5A 2P2KA 3N9QA 3AL6A 4XOGA 5LBEA 3LQCA 1O4YA 3RJRA 5C4WB 1QDCA 2GH2A 4FOVA 3VHRA 3SEEA 1MZEA 4BLIA 5CFCC 1JZ6A 3QD6A 2ZMKA 3WCRA 1NE4A 2OPKA 1YJLA 3J4UH 2NQYA 3J8F1 4AHWA 5KHKA 1GU3A 2JDMA 1UY2A 4CCMA 3O1VA 5FLIA 5ACA3 1GWMA 1CAUA 3AZYA 5ABJA 1EAH2 5C3RA 3D3AA 2FDGA 3VD5A 1BEV3 1G86A 3NV4A 2JE8A 3O1SA 2QQNA 1V9U3 2R062 4H7LA 3W58A 1PO23 4NR1A 1I9RA 5FJKA 2QQJA 3QH7A 2Y0OA 3MO4A 4FSJA 1DIWA 2WNUA 4E2GA 4Q0UA 1LKNA 2XLAA 4FO9A 1VALA 5FV3A 2G4IA 4AI3A 1UU5A 5ACA1 2VPVA 3AZVA 4JDNA 4LBQB 4LTAA 4XJWA 3MPPG 2ZOEB 4Y3OA 1BEV1 4YW3A 3AVSA 3CKHA 4CP0A 1T2XA 4XTPA 3H8OA 1Y43B 1V9U1 2XWJB 2NYYA 2YFZA 1PO21 1ZA4A 3Q8BA 1E5SA 4Q29A 3WW2A 4AHYA 3IB3A 4YZ5A 4CU8A 2Z4FA 4YM0A 3HNYM 1S2EA 4IL7A 4PDWC 3OUIA 2ARAA 4INDA 4MXWA 4V2VA 2DV9A 3J7NA 3EYPA 2ZEXA 1L3JA 1BVP1 3H1WA 3JD72 5E6HA 1SMVA 4FXGB 3E5UA 3ITQA 4A7KA 4GAZA 1TNRA 3WHUA 3WXPA 1LOEA 3JBG2 1L7RA 5FZBA 3WINE 3KS7A 4RQPC 3UNPA 1S0JA 1KGYA 1LU1A 2PFWA 4M4RA 4OUSA 2V5DA 2C0ZA 4FAGA 3TEWA 2GMEA 2OW4A 2WAAA 4JGZB 4E4HA 2ZAHA 1MEC3 3O0VA 3OCPA 4RYDA 1FPN2 4Y1YA 4I01A 4BIFA 3BTZA 1V6OA 1CQ9A 1SLTA 5C4WC 2J1TA 4TWTA 2DFBA 1ZRCA 3CDZB 3SXWA 1NCRA 1LNSA 2XVGA 1NCQB 2VULA 3ZM8A 3ZSLA 5E16A 1PGL2 3TEXA 3FMGA 5M0TA 1W0PA 3IDAA 4JKKA 4LJHA 5IUQA 1CAWB 2RDQA 4ZXEA 5C8CB 4AZZA 4OFGA 1MEC1 2WS92 1KITA 1WW7A 4YZ1A 3NMBA 2PN5A 1W39A 1W6OB 4CTEA 2RS12 1O91A 1DQ5A 3R6SA 3FJSA 1F35A 5GKAC 3T1LA 1R1ZA 4Z92B 4BMEA 2CDOA 1N3QA 3H50A 1RITA 4OUMA 4Q4V3 2VZVA 4D6SA 2QJVA 4CRQA 4DEQA 1DQ2A 2X10A 3KQRA 4BM8A 4XJ9A 4I0AA 2ZEYA 2ZCWA 4IEPA 5C5TA 3B5LB 5I91A 3AM2A 1EUTA 1UNBA 3DEMA 3LA3A 1YQ6A 2WSUA 3H8UA 4YW1A 4CUGA 3ZFGA 3T09A 5I0UA 3HVDA 3OEBA 4Q4V1 2VXRA 4IW3A 1ASJ2 2O14A 2Y6KA 3I49A 3M4FA 2XOMA 4IE5A 4XJZA 4BWOA 3JU9A 2I45A 3VBSA 3WP3A 2H6BA 3QH6A 2GP3A 5I93A 4QM8A 3RYRA 5IFTA 1BKZA 3NW4A 5LRSA 2E7TA 3ZO0B 3CIHA 1LOGA 4O9EA 4QD2A 4QXCA 1ZNPA 2YGLA 1C8M2 2R7EB 3BPSA 2B9VA 4LUMA 2WJSA 1I1EA 4GALA 3HN3A 1JZ5A 4KG8A 4J1WA 1WD3A 3OY8A 3OYWB 3ZR6A 4Q0VA 2ZGMA 4CSWA 2PHFA 4F83A 1DDLA 2NPIA 3H3LA 4CCCA 3FBMA 3WP4A 4IV3B 3KT4A 3B02A 3SKJE 5ANNA 3V0BA 4ATEA 4G3YC 1UX7A 1XYNA 4MX3A 4NMIA 4IEWA 3VBHA 1PM7A 2VTFA 1YFWA 5FIXA 1OD3A 3VBOB 4QU2A 1DP0A 2ZX4A 5EWSA 3VD7A 3LDBA 4CVUA 3LAGA 2W1WA 3RVHA 1UIJA 1IG0A 2YXSA 4I0BA 5FP7A 1OQEA 1I6XA 4BK5A 5HCBA 3VDBA 3OBRA 5E88A 4QU1A 2BNNA 4H55A 2FZ2A 2F4LA 3L2HA 5FP9A 2VUDA 2RDSA 1ENQA 4DUVA 3ZFEB 2JENA 3PUSA 5BNOB 5K0UB 4BMBA 1MQTA 1STMA 1OLQA 3RPQA 4QB2A 4MZUA 3T3YA 4B4RA 1YYNA 1ZBA2 5GLZA 4BLJA 4BQXA 1Q8SA 2A70A 3THPA 1DGWA 4I0WB 1B09A 3I2KA 4K1ZA 5FZ9A 4CE8A 4PJYA 5FP3A 5KXBA 1H2NA 2XHNA 1JW6A 2JDAA 2GMMA 5DQ0A 5IVJA 4V1PA 5FWJA 1GV9A 4GB32 1ZX5A 5EFUA 2QQWA 2JDUA 3BALA 3CJIB 4KU8A 4QGLA 2AC1A 3SCHA 2XVLA 4KMQA 4Z1VA 5K9YA 3NJYA 2TBVA 4LKSA 2W91A 2VQ0A 3UKVA 1Y4WA 5FWEA 3AC0A 5CVRA 3N9OA 4NIGA 2R49A 3BI3A 3M1HA 1COV3 4FTBA 2Y6GA 4YVSC 1YIPA 1D0HA 1W6NA 2VOWA 2XR4A 3KVBA 4R9CA 4BXSV 2GC0A 1F5FA 5A3PA 1IKPA 4DZGA 1C1FA 5A7QA 5JXIA 4BPZA 1DGLA 3WG1A 4XFAA 5FQ0A 4W6XA 2R0FA 4P02B 4BIOA 1COV1 1TZOA 4AAPA 4MO3M 2CGPA 3PNAA 1RYYA 1IPKA 5JVVA 4B1MA 2SBAA 4DINB 5ISLA 2YDEA 1JYIA 5E8AA 2B4KA 1NA1A 3ES1A 1UOBA 1MS3A 1RC6A 1XE8A 1W0NA 3LIHA 3LPFA 1ND2A 2E9QA 4MADA 2JKXA 2ZHMA 5FYUA 5FXVA 5EJ1B 4GH4A 5KC5A 4XZPA 3CO2A 1YFXA 2UY9A 2XLGA 2VZ1A 3H1MA 1VBE3 1WD4A 3JZVA 3DXTA 2H0BA 3MZHA 2D5FA 2N7GA 3ZYHA 5BNOC 5K0UC 3RMXA 5DZGA 2FZ1A 4AL9A 3JBG3 4QQLA 3USSA 2XONA 4AEDC 2CTVA 4LO4B 5L9RA 1MS4A 1UY1A 4XBNA 2J1EA 1WCKA 5C6CA 4EZHA 5FBJA 1UQXA 2EXIA 3HT1A 2HYXA 1VBE1 2RS52 5FUNA 4AVCA 4ZZ8A 2AYHA 4QXBA 3T0BA 4CCEA 3ZXAC 4V2WA 4YVWA 4E4DX 2BU9A 3K2OA 2HWE2 3NV1A 4B7EA 3HOBA 3VUOA 3CJIC 4FVVA 2E53A 3WCSA 1GOGA 1Y3TA 1PNGA 2R30A 4OMDA 4NIAA 1LHVA 3NSTA 1ODMA 3ILRA 1K5MC 3OGRA 5J37A 2WUHA 5FZOA 2BVVA 5FYTA 4E8DA 3VBUA 5JMCA 2WT0A 2HEWF 1W3VA 4JCKA 1PVC3 4C1XA 3EJKA 5C3OA 1XQNA 2P3JA 4PHZA 4D94A 2BDRA 2O1QA 4WM7B 4EJRA 4JV4A 1FMD3 4Y22A 1RL3A 2O8OA 1OOPC 2EICA 4D8MA 4C0HA 4OLLA 2G19A 1VLNA 4CP9B 5IAXA 4XACA 1PVC1 2B39A 2WZR3 3AYEA 1UOJA 5T52A 3LFIA 2HWF2 2A5ZA 4MLOA 4HG6B 1JN2P 2TEPA 2C6SA 4QPWA 4MH0E 4IQPA 2Y38A 3RZKA 1S0BA 1FMD1 2XDVA 1AJKA 3RZJA 3BYWA 2UU8A 2ZPXA 4Q4Y2 5BNNA 5A33B 2F4PA 5L7OA 4EROA 1AR72 4LIVA 3AX4A 5FRAA 5DXDA 1YCIA 2YY1A 2WZR1 1F9KA 2PELA 4O9GA 2VMGA 4Z2AA 3V0AA 3U4XA 2Y6FA 3LDKA 1CAVA 1LOBA 2V72A 1QJX3 1VBD2 2Q0AA 1W9SA 4AE2A 1O3RA 4KWUA 3S7EA 5ABJC 2PAKA 5L36A 1W04A 1VIWB 1NY72 1TEIA 5E1RA 1SQ4A 2A73B 4RHV3 4CCNA 2HWD3 1UD1A 4WM8A 4EV0A 4MOAA 1RUG3 4O61A 4IEVA 1WW5A 2QKDA 2Y33A 4MGIE 1QJU3 1W8ZA 1QJX1 2WNUC 1OSGA 3KF3A 2DFCA 1PZ7A 4EN8B 3LF7A 1PK6A 2PQQA 3T0AA 4FTSA 2Q4SA 1W6PB 3H7YA 2XUMA 3F95A 5FMBA 5I8YA 2OQ6A 1T6GC 1WZXA 4P08A 4RHV1 1EPWA 4RFRB 3KHBA 2HWD1 3PUQA 2A6ZA 2YC2A 2A6VA 1RUG1 1OC1A 1TE1B 2YROA 5J7MA 1OUSA 4RGGA 4AK3A 1QJU1 5FAXA 1W6MB 4CDUA 2WLQA 1GZWA 4LR4A 3SH4A 1LGCA 3D4KA 1DLCA 3KLSA 3H3ZA 1NX9A 3B7MA 4MSVA 3BUCA 2ILMA 4X8NA 3K46A 2E7AA 1VRH2 3AMMA 1ZRFA 2ZGQA 3ZYIB 1QQP3 3M3EA 4CEYB 1AVBA 2WN3A 3MUZ1 4JTNA 2WQZC 2VE1A 3WDYA 4DXSA 5A7OA 2QDRA 3P1IA 5HV4A 2NZ9A 1L7QA 3DYPA 5FYVA 5I0DA 1SLAA 4QGNA 5DG1A 4M4PA 2D3SA 2XVKA 1AUYA 3MIBA 3CHXA 5KWRA 3ACLA 5FOBB 1NOVA 1QQP1 1T6BX 4CCKA 1QKQA 4GB33 2QDNA 4YARA 1YJKA 5BNPA 3W5MA 3E5QA 1UKGA 5FFOC 1G9CA 1JZ8A 3C7FA 4AR2A 2R1DA 5IK5A 2VNRA 3AMNA 3POJA 1H0BA 3WF3A 1DZQA 3ILNA 3JCIA 3NKTA 3NO8A 4LOTA 3T2QA 3I2DA 1ZZ7A 2G9ZA 4RS5C 1SBDA 4N53A 3H9AA 2X05A 2VL4A 4YGEA 3HT2A 1D2QA 3JXSA 4D3WA 4QWNA 5EJ3A 5JAXA 4UAPA 2ZMLA 4ES8A 2BV4A 1Y9GA 3LA2A 1TME3 3UGHA 2IFRA 3VV1A 2WYSA 5DUUA 2VZSA 4OMCA 4MG2A 3D5OA 4FPCA 3ZFGC 4YZ2A 2LRPA 5A6ZA 2C9AA 2HH9A 3MBWA 4QX1A 3O1MA 1AR92 3KVAA 1TME1 2XBO3 1QMJA 2WT1A 5C7GA 4UW4A 4AFAA 1GICA 1XBFA 2VJXA 1HRI1 4HVOA 5GLTA 3BOPA 2CL2A 2BW8A 4XFBA 1OVSA 4YPJA 4QXHA 5FZ4A 3U07A 1X8MA 2PHTA 1BBT2 1LHOA 4GMP3 1JBCA 1C8NA 1ZM1A 2J1UA 2XBO1 3CEWA 3MFCA 4XIOA 3WLUA 5FO9B 4XF3A 5KHIA 1MZ5A 1SCSA 3K3OA 3RSJA 4QKNA 2IXIA 3TN92 5CA6A 5A6YA 2VOTA 1SBFA 1XB9A 3KT7A 2RS53 5DAQA 4GMP1 1FXZA 3SHRA 4LK6A 5FZCA 1AXKA 2JG8A 1G6NA 3H3UA 5JI9A 4XQDA 1W6QB 3W21A 1CVNA 4DQAA 1G9DA 2HWB2 4UF0B 2EF6A 1RVF3 1J3RA 2ORXA 3B3QE 2E63A 1CONA 1LJ7A 3Q9OA 4AVSA 3AFGA 3S57A 2YFUA 4RL7A 2CWSA 1SFYA 1V00A 4XFGA 1BCXA 1IZ3A 4QQPA 2CDPA 3E5XA 1JXNA 2DCKA 3ENRA 3H7JA 4EN7B 2VAUA 2QQIA 3GBWA 3NNJA 1GZ9A 3T1MA 2EVXA 5LB6A 1QXRA 1FOD2 3DYMA 5JZGB 1C57A 1RVF1 1WMFA 2NM1A 1HW5A 1NE6A 4X8PA 3GJAA 1ZBE2 4JGZA 4BQYA 2E6VA 4FFGA 5GLVA 1WCUA 5FZIA 5DUXA 4I09A 1MQTC 2DBIA 4XUOA 3ASIA 1JMUB 4TLGA 1WCDJ 5I0TA 2FMYA 3AKTA 4M01A 3U10A 5FR3A 1DQ0A 3AMQA 3MIDA 5LCWL 2GNBA 2AEYA 2HWF3 1B35B 2MEV2 2BQPA 4DXZA 2XL7A 1UXXX 1CAWA 1AJOA 3BGAA 1OBNA 4Y20A 4AVAA 4EWEA 5C8CA 4S2FA 5FXZA 2WNEA 4BQ2A 3DYOA 1U0AA 4XF9A 4A44A 1G8WA 4BISA 2P37A 1VB2A 4DRVA 4DRRA 5H9SA 1LOFA 2BTVC 1R64A 1QEXA 2HWF1 2WBKA 1JYTA 2BGCA 1REFA 1V6KA 4ORFA 2YBPA 4YFZA 2ZEWA 2ZGKA 1J58A 2X5IA 2JICA 4G4FA 1HRV2 4HANA 4XHBA 4AEMA 2ZAAA 1ZZ8A 4FPHA 4L8QA 2XJRA 1C3HA 3B93A 3O12A 4IE4A 1HN1A 2PLV1 2QQMA 5FPVA 4Q8LA 4AVTA 2ET7A 1FT9A 1U5IA 4IEQA 5C9AB 4OQ9A 1US3A 2K2SA 3V56A 3A0NA 3S7IA 3LGRA 2LALA 2JDPA 2P17A 3FUOA 3PIGA 3VZLA 4CU7A 1TQ5A 2RMU1 3HQXA 2VCCA 3IM0A 4LULA 1NT0A 3WNMA 5A32B 4WVVA 3VB9A 3UL2A 3ZFFA 1JU3A 1SHWB 4Q1PA 1JUIA 1UYZA 4IEZA 3DGTA 2NLRA 3PUAA 1VBB2 1ND2C 5CFDB 1S2BA 5LK5A 4L11A 3LIGA 5LATA 2EIGA 5F3CA 4GH4C 3IMMA 3WNOA 2JJ6A 4XDQA 1SLBA 5F6LB 3RG0A 4QX3A 3VBFA 4LKDA 5A3MA 1EYBA 5FZ8A 4TTGA 3OYWA 1V6JA 1O3SA 1W9FA 4YM2A 1W90A 2VZ3A 1MZFA 3FFQA 3ZVXA 2XGXA 3CL1A 2B42B 4LBQD 1ZRRA 4BE3A 4FOYA 4IV3A 2ZTNA 2PAMA 1WMEA 3B01A 1CZSA 1B35C 5A1AA 1JHNA 3BTXA 1RUF2 3R0RA 3K4ZA 1YNAA 3AKRA 3KD4A 4KG0A 4QPGB 4YVWC 5GZCA 4Q0SA 1YO8A 2EAKA 3W20A 1D4M2 1OLMA 4QKDA 4IV1B 2VOKA 4ZU5A 2BWCA 3WG3A 1REEA 3AXDA 4XF0A 2FCTA 4JHTA 2W39A 5A7WB 1XNCA 2NP0A 1BLZA 3POWA 4JQTA 1C1LA 1DYPA 3I2FA 5FZGA 3VDDB 3UETA 5KBFA 3KT1A 3MW2A 3V65A 1IHMA 5FP4A 1DG6A 3D0SA 3C7GA 2JIGA 3MICA 4YGCA 3OD4A 1CX4A 5F5AA 2JIJA 1AXZA 3Q8EA 2EIBA 5A3WA 5C9AC 1HXS2 4KL1A 2VUAA 1YWKA 1SDDB 2CSGA 1VBC3 2GC3A 4LHSA 4LKEA 5F5CA 2ZGUA 5FMOL 5JWPA 5FPLA 1H8TB 3WNPA 2ADEA 3EQEA 1CJPA 2VXJA 4XJ8A 3T4VA 3LSDA 4HVRA 3VZNA 3ZSEA 3ZX7A 4U2AA 5A3NA 1HB3A 5LA1A 3ZYFA 4B29A 5IK7A 1O59A 2DVBA 2R043 1IS3A 3LB9A 1ULEA 3B9CA 5HV0A 1QU0A 1A78A 3FZ3A 3NKGA 4RQPB 4C91A 5CFDC 1HB2A 1V0AA 1ND3B 3BB6A 3BN6A 1VBC1 1E5HA 1H4GA 3JB8A 3HNBM 3KM5A 3HN1A 4KI5M 4MVTA 4Y1XA 3SLIA 4QDRA 5LBFA 1Q3EA 5LY2A 4KH9A 4CCOA 3OSDA 3GGLA 2R041 1WW6A 3GF6A 3TAYA 4FQ4A 4QGMA 5ERLA 3JB4C 4TLFA 1GZCA 1TMF2 2XJSA 4NPLA 2FQPA 3UK9A 2Q5TA 3O0WA 2BBAA 5B4XA 1CJDA 3T2OA 1IS4A 3MIEA 3TN93 2WFF3 3M3QA 3ZXEA 4AF9A 1ULDA 4XTMA 2Y26A 2ZGLA 5FYBA 2ZBJA 5L19A 2VNOA 3ACGA 1Y9QA 2RS31 4GMP0 4LORA 4BJ0A 1I5PA 1OKOA 3IT8A 4QPIB 4YZ4A 4QPGC 4HK9A 3LOBA 4JVAA 3KMHA 4MGQA 2AACA 4M0HA 4UFKA 3A0KA 4XE9A 4IV1C 3WQBA 4FCAA 2HWB3 4LNVA 4M3CE 2WFF1 4W65A 4YGDA 1JZ7A 1QH7A 1FAYA 2VZUA 4GD4A 3W5NA 5CU1A 2WINB 5FZDA 4A4AA 5FJHA 4DS0A 3I3EA 3ALQA 3N7LA 4XAEA 2DVFA 3VDDC 4HKLA 5FXWA 5BPXA 4NIHA 3VBRA 3K77A 5A7NA 1ZREA 2HWC2 2JXAA 1XOYA 3WQ0A 1C5HA 1ZA7A 3AXEA 1UZWA 5DUWA 1CWPA 2UWAA 2HWB1 1PO12 5ANQA 5AVPA 2B5HA 3ZXDA 3O14A 2CGNA 5B4NA 1UYPA 2P6HA 4XJAA 4E9KA 3I4IA 4DXTA 1OQ1A 5GJ6A 5CADA 2Y64A 2RJLA 4TYSA 2A6YA 1SZBA 4ES9A 1NUKA 1KRIA 3AP5A 1H8TC 4YZ3A 3VL8A 1UW8A 2WNVB 4NAOA 2DCTA 2SLIA 2V73A 3Q8CA 2MEV3 3UKNA 1RUNA 2F6BA 3KZ4C 4UFIA 1UY3A 4Q4X2 1SPPB 3S5AA 2FDFA 2RE9A 1DCSA 1NLSA 3DKQA 4B7KA 1ND3C 2CWMA 4Z82A 3ETQA 1WWYA 2DTWA 2DYCA 3IDBB 4PI2A 3I59A 1RUE2 5IVYA 4OHZA 1C28A 2YG0A 4CDWB 2KM2A 4QM9A 5FZKA 5F9TA 4CCLA 2MEV1 4CDQB 1A34A 3O1PA 4CCDA 5AC93 2OUHA 2VQAA 1BYHA 1OVPA 2E33A 3AYAA 2YPJA 3INAA 5JUVA 1CZVA 4N53C 1UYYA 1W2OA 3AVRA 3O1OA 3O5SA 3OGGA 2DU1A 4C1WA 1JZ2A 2AZ5A 3T0DA 5FYSA 1AR63 5IVVA 1HRV3 5LK7B 4QQHA 1JZ4A 1ZZCA 4NRPA 1QXJA 4CUBA 1AYN2 2LS6A 4OZXA 2BVBA 4QPIC 2W87A 1O5UA 1VMJA 2YZ4A 3WZ1A 3VHOA 3ZKUA 2GC2A 5AC91 2RDNA 3VDAA 4PDWB 4FAHA 4NHLA 3QBQA 1H6XA 1H6YA 1JHJA 3GM8A 4AXOA 1AR61 1HRV1 3POFA 4OZOA 1IQDC 4ZU4A 3UKTA 4AQSA 4ET7A 2C1FA 5FMCA 1DYKA 1ACCA 5D8AC 1S2KA 4LA2A 3KWVA 2FD8A 1VBB3 2WL1A 2YU1A 4FPOB 4XIKA 4MUVA 3NRUA 4RN5A 5IATA 5CKNA 1BMV2 4L99A 2RR13 2BERA 2JDZA 1RMU2 3VL9A 1DHKB 1F5JA 4KBBA 4D7SA 5SV5A 5I0SA 3DV8A 3S6PA 1UMIA 2YPDA 3NJVA 2FMDA 1VBB1 3HBKA 3S5QA 2WNVC 4EN6B 4GWJA 4PIZA 4OQ8A 3HAGA 3ZXKA 4A7YA 4DFSA 2RR11 4XBLA 2IWGB 2JE7A 5KHGA 3ZYJB 4RA0A 5IVBA 2QZ2A 2BGPA 4IDZA 1BXHA 1F4AA 1HIXA 1HKDA 3PMSA 1PGSA 1XE7A 2JG9A 5C3QA 1ENRA 1U5YA 4AI0A 1F8VA 2OS2A 2QQLA 1EV13 2BNOA 3MIHA 4QHZA 1UPSA 1Q8VA 2JE9A 4RSUA 2W3JA 1GNHA 2CGOA 2EXKA 4LLFA 1DF0A 4YVSB 2B45X 1UX6A 2OXBA 3HEIA 2DCYA 1QXPA 3IAQA 4QHOA 4CDQC 4DXRA 3WT3A 3WF1A 1LULA 3AZWA 5D1IA 5LASA 3DPRA 3OG2A 3BTAA 3RZMA 5A1LA 3CU7A 1OUXA 3ZYRA 1LRHA 4HPKB 3ZXJA 3NV2A 4AQ2A 1QH6A 2OYZA 1SEFA 3WG4A 1W8HA 1GWLA 1XU1A 3GBGA 1ZRDA 1EV11 2X29A 4RD7A 5LA0A 2WAOA 1OF4A 4JGYC 3OUHA 1I5ZA 2PTMA 1RUC2 5IYYA 1K45A 4QXKA 1F4HA 3C7EA
chains in the Genus database with same CATH topology
1Z7S2 1BZWA 2DWRA 2W52A 2XJVA 4R52A 1R083 4Z2WA 4CDXA 2OZ6A 3RRDA 3V64A 1XNDA 4RR3B 4N43A 4AEDB 1FATA 2KXLA 5AFEA 4N9HA 3USUB 3ZDSA 1R081 1LOFC 2DUQA 4M3CB 3IPVB 4IESA 4MXVA 3VZJA 4E27A 3KSCA 1DU3D 1QY4A 2X5IC 4FOWA 1WLCA 1BQPA 3VKMA 1K5MB 3TNQA 2ZGNA 4D7TA 2YGMA 2UYAA 3ZN6A 1EAH3 3WG2A 4FTEA 2BFUL 4RGAA 4SLIA 5JI7A 2UY8A 3OTFA 2R063 4ATFA 5FLJA 3ROUA 5BV6A 2BYVE 1OOPB 1XYOA 4NO4A 1PGW2 2ERFA 2OUJA 3AP7A 1EAH1 2XL9A 1CGPA 1KDKA 1OHFA 2R061 3VBFC 2YUEA 4CEWA 2ZGOA 4IEYA 5DDJ2 4WV8A 3N7JA 3AMPA 1KD7A 1OA3A 3JD73 5A3LA 2DUOA 3FWEA 1V6NA 4NWWA 1A3KA 3IBMA 4RR3C 3U0ZA 4Q4X3 2AR6A 1KJLA 3CJXA 1X33A 2IXKA 5JLVA 3N4MA 1AL22 1UL9A 1CAUB 4TSVA 5ABJB 2GH8A 1RUJ2 1RUE3 1FPN3 3JD71 5FO7B 3TRSB 3ZSMA 4XYXA 4W6YA 1WGPA 1RIRA 3E97A 3JBG1 3OPZA 4LUKA 2ZGRA 5JZGA 2WNUB 4Q4X1 4ZXKA 3M3CA 2ZX2A 4NN0A 4LBNA 3B00A 1FNZA 1NXD1 2LUWA 1Q8OA 4AEJA 1LU2A 2WS93 3PVEA 4Q4W2 1FPN1 1YFYA 3AFKA 1AYN3 3TBDA 3D82A 2RS13 2UWBA 1R092 2WC2A 3B9IA 1PGL1 4MXWB 3K48A 5K7PA 1V6LA 2HYKA 2WS91 1NYWA 1PIV2 3N7KA 4P9WA 5E88A 1O4TA 3QACA 3W59A 1AYN1 2WA3A 1PHMA 2RS11 2IXLA 3BPZA 5KHHA 1QJY2 3UJQA 3NAPA 4PLMA 3WY6A 3ZXGA 1ASJ3 1NQDA 1ULCA 1VAKA 3KGZA 3RYKA 1AX1A 2D3PA 2R072 2ZA9A 3PHMA 1J1TA 4K3UA 3RQ0A 4ITCA 2VVEA 1NCRB 2Y0IA 4XEZA 3APBA 4GKXA 1ASJ1 1BMV1 4AW7A 3T2TA 1C8M3 2BWAA 1DGRN 4RS5B 3ZYPA 3KCCA 5AFBA 5A32A 1HQLA 2Z42A 3FE5A 3M8LA 2JX9A 3FC0A 3HMYA 3MGUA 4OI4A 2VNGA 1C8M1 1Q56A 3LWCA 2DU0A 3R05A 1CAXB 1QJZA 5GZFA 1RB8G 3ZFGB 1DZTA 4FPYA 2D6NA 4Y24A 4FPGA 4BH9A 4F8AA 2XJTA 1VBA2 5HCFA 2R1BA 4COZA 4L9BA 5CFCA 5JOXA 1KFXL 4HK8A 1ALYA 4QX5A 1U12A 4K9SA 4FT8A 2TUNA 4P9IA 3VBSB 4C0BA 1DLLA 4CZSA 4DOUA 5KXCA 5E89A 5EYYA 3WDVA 1H2LA 2UURA 3M2MA 3QLQA 3WDTA 2Q8OA 1LGNA 2ZGSA 1M06G 1AX0A 1A8DA 5T55A 1ZBA3 2E7QA 3MF6A 1H1MA 1WUVA 3WUDA 2BEOA 1GKBA 4B4PA 3SISA 2XJQA 4IERA 4Y26A 3ZIWA 2VECA 1NCRC 4HN1A 2C5DA 1R1A2 4LEJA 1ZBA1 1AYM2 3MI8A 3SNMA 2XKOA 4CYDA 4RFT0 2QVSB 2EALA 3LKJA 1X36A 1SLIA 3C3VA 3VBHB 1AX2A 1PVXA 1X8EA 5CAZA 1U5ZA 4KWLA 4GB31 3MLKA 4JDMA 2AUYA 2WIIB 1RUI2 1N47A 4Y5Z0 4MV2A 2W68A 4RQPA 3RZZA 3VGIA 2GZWA 4Q0QA 1RUD2 1DBNA 3MEPA 1AL0G 3WR0A 4H3WA 5BY5A 1UPIA 2Q1ZB 1MQTB 3R4DB 5C4WA 2AGSA 4ONUA 2D6MA 1A8MA 4XPVA 1X82A 2GMPA 1OKQA 1GANA 3TWIA 1NLRA 5LEKA 5IK4A 2VGDA 5J3UA 3VBSC 3DL3A 5I0RA 4LBKA 1RINA 1LTEA 1Y7BA 2AENA 1RUH2 5IK8A 1QDOA 4YM1A 3TYJA 3I8TA 3NWKA 5H9PA 4A2UA 4NHMA 4R4XA 4QPYA 1OQDA 2DCZA 4WVZA 3LSEA 4Y4YA 4FPFA 4HL0A 5JOWA 5CNAA 2R6QA 1KS5A 2JKBA 3H0OA 1Z0HA 2VG9A 1POV0 5CBLA 4E2QA 4LBQA 1W6NB 4WZFA 3M7AA 5FPZA 4LHNA 1EPZA 1G9FA 2HWE3 3G6JB 3HWJA 3DPRC 4WBBA 2CNAA 2D7FA 3J8F2 5GZGA 2WZPP 2XJPA 4DNYA 3GYDA 1MS8A 1N1YA 2HEYF 3MF9A 1ZZ9A 1ENXA 1AZDA 1CR7A 1TNFA 2RS51 1C4RA 3VBHC 3D8CA 3MW4A 4W6WA 4S2DA 1NA1B 1GQHA 3R4SA 2B8MA 2HWE1 1R093 4XQWA 3SH3A 1ND2B 3THTA 4COYA 3VKNA 4GH4B 4QQOA 3RYPA 3ATGA 1NG0A 4Q2FA 2QZ3A 2JD4A 2JEMA 4MGYE 3WDXA 1YIFA 4NOTA 5ACA2 4GWMA 4S2HA 1JH5A 2CV6A 3AKSA 1BEV2 3M3OA 4CDXC 2D6LX 4XF1A 1V9U2 4N43C 1PO22 1WLWA 2ZGPA 1N3PA 1QJY3 2QNKA 3BODA 4KGQA 4F3JA 3RS6A 1G9AA 1X50A 3URFA 1NCQA 3OBTA 4AFMA 1SFNA 2NN8A 4BCUA 3JQXA 2R073 1DQ1A 2VVFA 1S55A 4A3XA 5CIRA 4YVWB 3GNEA 2EXJA 4Q4Y3 1ZVFA 4FQZA 1W6OA 1AR73 1I3HA 2A7AA 3GZUC 1QJY1 1QGLA 1W0OA 4PIXA 2EXHA 5DUVA 4XJUA 5FMOS 4YNIA 4JC1A 3LZZA 1VBD3 2R071 3E6BA 4NPRA 5DZFA 3VBUB 4AVVA 1PZ9A 4F7ZA 4Q4Y1 5I8SA 4HSLA 3VZKA 2QCSB 1AR71 4NWVA 4XMIA 4KNCA 5GLWA 4K21A 1URXA 4AI2A 4JDOA 3BCWA 4Y22B 2VH9A 1MEC2 1LCLA 1VBD1 2CAUA 2WA4A 1XRUA 1XNKA 4HETA 4KU7A 4XBQA 3WW4A 2ZZQA 3P3NA 4P9YA 2D5HA 1RTVA 1OFNA 2R32A 1JYCA 1NY71 4AGVA 1O7FA 1MS1A 1VAVA 4DMIA 3IMNA 4JAAA 3VKLA 1NA1C 3MFAA 4Y1UA 5HXVA 2QE3A 4HVQA 4CEWC 3RMYA 4UBHA 5JPNB 1LOCA 2ARXA 5H9RA 2VOXA 4UW3A 5BNNB 2ZKNA 5FPXA 1LHUA 5L7OB 4CP1A 3ILFA 2IXJA 1V6IA 2B46X 4XMAA 1V70A 3V0AB 1VRH3 4Q4V2 1CAVB 3MPBA 1RGSA 3JQWA 1E57A 1EP0A 3OJBA 3IDCB 1KQRA 4I3GA 3HD8B 2PHWA 4OULA 3AYCA 4FXKB 3AYDA 2GDFA 2IXCA 4WM8B 3WHTA 1VRH1 2UWCA 1S1AA 3WDWA 4JRAA 4NHKA 2NMNA 4OHXA 1GSLA 3RNSA 2VU9A 4XETA 3VBOA 3ZMOA 1PK6B 5F5QA 4BQ1A 2ENRA 1WMDA 1ONAA 3VBUC 4P9XA 4Q8KA 3EXUA 3ZFEA 5BNOA 5K0UA 4B3NA 2QFEA 5FCCA 2NMOA 1GBGA 4CDUB 2ZABA 1GZWB 2K9ZA 3ZPYA 5FBZA 1RUD3 3WUCA 3ZN5A 4LO8A 5HI0A 3I7DA 3GBFA 4UBGA 5J98B 3WW1A 4D7YA 4XXAA 1QOSA 2A75A 4GA9A 1SCRA 4YYOA 1LB2A 3S30A 1OPOA 4YFWA 4R4ZA 3IPVA 1LESA 1AR93 3TOJA 3CJIA 3FLTA 4HMZA 1F2NA 2LTNA 1KS4A 1YI9A 5EV7A 3S0MA 1AHSA 3RI9A 2RHPA 3AZXA 4GWNA 5BNNC 5JMCA 4K20A 3OF1A 5DG2A 5EZWA 1UMZA 5L7OC 3WDUA 1U5XA 1KXGA 4A7ZA 2KA3A 1OFSA 2ARBA 2A6WA 3PTYA 2QQPA 4IEXA 1BBT3 4H14A 1AR91 3SITA 1CIWA 1QNYA 2GNDA 1S0IA 2ZZJA 3NVCA 1OD5A 4N53B 2X53S 1H2MA 4AI8A 4WM8C 2PYTA 1BBT1 2DCJA 4PQ9A 3KGLA 2Z69A 5JOZA 1PK6C 4JQRA 3TN91 3POSA 3GZTB 2ZHLA 3P3PA 3ZXLA 4AEKA 1IOAA 4FBFA 4K8FA 5D8AB 2G9GA 1IGOA 3RWNA 4I02A 4BOWA 2A3XA 2XB6C 5FTTC 1H30A 4CDUC 1CPNA 2BUKA 5T5OA 1KJRA 4OHYA 1FOD3 1GQGA 3RDIA 4E4ZA 3WD5A 3OD0A 4HT1T 1ZBE3 1COV2 3NV3A 1DZRA 1LOAA 4FPKA 5AVAA 3VHPA 1LGBA 5JDBA 1UU6A 2ZX0A 4GIQA 3N36A 3MDPA 1VAMA 4UXAA 3DUIA 1FOD1 4HZFA 5F1RA 1H8VA 4YG6A 1AXYA 1ZBE1 1SACA 2MHFA 5BNPC 2JG8B 4AHZA 1YXWA 2DTYA 3C2UA 3GALA 2PA7A 4R9AA 2ZX1A 5LRRA 4LT5A 3N35A 4M00A 1VBE2 1Z78A 4WM7A 4AGRA 1QOOA 4TZDA 4E4SA 1S0DA 3DN7A 4JGYB 1GYKA 5T5JA 4M0NA 2D97A 4LO7A 3LA7A 1MS0A 1QWRA 1RJ8A 1O3QA 3BU7A 1QF3A 2R0HA 3ZSKA 1SDWA 5A33A 3IIAA 1CPMA 1IS6A 4HSJA 4Y20B 1RHI2 2GNMA 2BNMA 5TSWA 2GAUA 3CF6E 4RS5A 3W9AA 3ES4A 3VKFC 1GLHA 2BFUS 2XWBB 4AYUA 1PVC2 4LLOA 2JECA 3RI8A 5HCAA 1UF2C 2ZHNA 4K40A 1J3QA 1F31A 3ZMNA 2HJIA 4LBLA 1ZZ6A 4X6RB 4Z8BA 1FMD2 1J1LA 2X5IB 4YLZA 2FHRA 2V5YA 1CAXA 2VUJA 2XHKA 1W6PA 4PBPA 5FREA 2DVDA 4COWA 3VZOA 3MIFA 2WZR2 1YLLA 1RUF3 2JG8C 1LEMA 1Q43A 2A3YA 3AKQA 5JSRA 3DKWA 3N7MA 5FLHA 2HKXA 1FYUA 1D4M3 3M3IA 4Q27A 4R9BA 1W6MA 2Q30A 3OGJA 4B4QA 1AF9A 2PHLA 3ZFFB 3KCYA 1RUF1 3ST7A 2MPFA 4OVEA 1VJ2A 4PBOA 4CEYA 1QJX2 2A6XA 1D4M1 3DF0A 3IWZA 3PJYA 2WFPA 4AFCA 4XILA 3VBFB 4LBJA 2D3RA 4JGZC 1XYPA 3WV6A 3AB0A 2E51A 4RHV2 1HXS3 2D98A 2EA7A 2HWD2 2WSVA 3D0JA 4OHVA 4QT6A 5KXDA 1RUG2 4URTA 1QJU2 3UJOA 1Q5OA 1OA2A 1KFUL 1NCQC 2GNTA 4MGKE 4OI2A 2RJKA 4YW5A 4PLOA 3PMEA 5C8CC 5J48A 4HLTA 5CB7A 1HXS1 5T54A 1FI2A 2VW2A 1RUOA 1CESA 2ZMNA 4N90A 1QOTA 4ZKTB 2WKKA 2IXHA 2XKPA 3TB0A 1W2UA 1TMF3 1LR5A 3GHNA 1WA4A 2W0XA 2ZHKA 4XFHA 1QQP2 5K8SA 3L9JT 4EWDA 3ME2A 2EAAA 4Z07A 4IEOA 1NZCA 2DVGA 1CD3G 4WVMB 1H1IA 1TMF1 2DVAA 4OI1A 4ISQA 1IPJA 2PHDA 4HKOA 3ZYGA 1GR3A 3AJYA 1V6MA 3ZFFC 4YRDA 2DURA 2OA2A 3SCGA 2P3KA 2TNFA 4XFFA 2HWC3 1ZZBA 1S0CA 5JSPA 1PO13 3IN9A 4D69A 3AZZA 1D0GA 2RM22 2O8QA 4UW5A 4G9SB 5L73A 1FX5A 1DGWX 3D6EA 1TME2 2X8KA 5JIAA 4AQ6A 5HBAA 4J6GA 1AR82 1POV3 2HWC1 1KDMA 2XLFA 1HRI2 1W6QA 3I54A 4IV3C 4I30A 3LOIA 1PO11 2AREA 2R16A 2BBVA 4AGGA 2ET1A 5KHJA 1MR5A 3JUUA 1FNYA 1HQNA 2XBO2 1XU2A 2I74A 1UCXA 1POV1 3VBOC 4FP2A 4S2GA 1SBEA 2B9UA 3AP6A 2XH6A 4PCRA 1WBFA 4COVA 3AJZA 3VBRB 3ZFEC 4FOQA 4LHLA 3X29B 1RUE1 5IT6A 2VW0A 5F6KA 1BVVA 2D6OX 4QHBA 1B35A 1MVQA 2WWSA 1YHFA 3FHIB 4FPJA 3R4UA 1D4VB 4XXPA 4HFSA 4K1YA 3ZIXA 4AVBA 5GM0A 1RVF2 4Y1ZA 1RHI3 5JOYA 3CNAA 4PIYA 3FX3A 3AMHA 3I59B 2XPJA 1DFQA 1HX6A 1RMU3 1BJQA 2HEVF 1ZYBA 4ZU7A 2VMHA 5BUVA 1RHI1 4DY5A 3QOPA 5C9AA 5EYXA 2I07B 3WX5A 2PHXA 4AHXA 1RMU1 1LENA 1Q8PA 4K6BA 5GLUA 4AI1A 3O7OA 4CP2A 1YRZA 1FV2A 4PF5A 4GQ7A 4U36A 5GALA 5T5LA 5CFDA 4META 5FO8B 4L97A 4EN9B 5H9QA 1UZZA 5BNQA 1JUHA 3EO6A 4WVWA 2DF7A 3MYXA 1M4WA 1MS5A 3FFZA 2PLV2 3VBRC 1RJ7A 3FLRA 4XF4A 4XHXA 4J1XA 2D44A 3CLPA 2VY0A 4R9DA 5EXOA 4HBNA 2RMU2 2Z79A 4I3PA 1OLRA 1RUC3 2G9FA 4UW6A 3WP5A 4XW3A 1LECA 4GXLA 1JTZX 4B8EA 4LE4A 1Z7S3 1DQ4A 4QPGA 3MW3A 3VHNA 1PNFA 5SV8A 4LBMA 4LHKA 1UZYA 4IV1A 3AKPA 3BOWA 2GALA 1RUC1 5KC6A 2IC1A 1YUDA 3EBRA 4P9JA 3FUQA 2JG9B 2LM3A 2WT2A 1H4HA 1IQAA 2PHUA 3OY8B 1Z7S1 4YG0A 1EY2A 3VDDA 3ECQA 1DQ6A 3H1YA 3VKOA 4H7MA 3G7DA 5C8WA 3DPRB 4WM7C 3V0BB 3UV9A 1OMIA 4COUA 4PDWA 4ASMB 5JPMB 1H8TA 2ETEA 4Y1VA 5B2GB 4N7IA 1Q8QA 3AP9A 2YMZA 4LBOA 2ZX3A 3PVNA 4N9IA 1MZ6A 4C90A 2QUOA 1ND3A 2GC1A 3WOGA 3ZSJA 2B7YA 5JSOA 2OZJA 4YG3A 2PAEA 4P14A 1O5LA 1HLCA 4CDXB 4L92A 3WP6A 3IDEA 3PVOA 5T50A 1APNA 1FV3A 2VW1A 4IETA 4N43B 4R8HA 4E2SA 4JTOA 2ES3A 4P9LA 2ZKLA 4DY3A 2Z2SB 4BA6A 4AFDA 5J09A 2RM23 2D6PA 3VN4A 2CAVA 5DDJ3 1PGW1 4NVPA 1O3TA 4QPIA 3ZN4A 1AR83 1IKQA 2IFWA 1HRI3 2GU9A 1C5IA 1N3OA 5C33A 3POYA 1VBC2 4MYEA 1GNZA 2RM21 3WQ7A 4PLNA 5DDJ1 5DZEA 2Z5WA 2JG9C 3ZN6B 1AL23 5D8AA 1QNWA 2R042 1MVEA 4FPEA 2ZS6B 1RUJ3 5T3NA 1AR81 2ZACA 3A4UA 1WLDA 2A3WA 4DPNA 4DB5A 2DUPA 3B69A 1HQWA 5GZEA 4LO5B 1S0EA 3GHMA 4QQ2A 5FOJB 3TNPB 4Q0PA 2RS32 3MIGA 1N1VA 4P9GA 5JCTA 5FQ0B 1AL21 4L2NA 5BXXA 3FLPA 1RUJ1 4CEYC 2PHRA 2W08A 2XJUA 4SBVA 4YGBA 5I8TA 4Q4W3 2CYFA 2WNVA 1HV1A 2WFF2 2ZGTA 4CEWB 1H9PA 3HR9A 2YC0A 1HDKA 3GZAA 3IKWA 4KGGA 4EWAA 2D40A 3N3HA 1MS9A 1SLCA 4HN0A 4N7UA 3SH5A 4Q4W1 4BHPA 1PIV3 1X7NA 4LE3A 1ULGA 1SLLA 1IS5A 1OA4A 1MACA 2D43A 4CDWA 1HV0A 1R091 1OI6A 2P34A 4CDQA 1UIKA 3WQ1A 4M3CF 1VB4A 1LHNA 3AP4A 1PIV1 1S0GA 4JGYA 1PZ8A 2OVUA 2XG3A 3WNXA 4XFCA 2H0VA 5CG9A 4ISRA 3ELNA 2BPA2 1VP6A 1BK1A 1H9WA 1S0FA 4OI0A 4JRLA 2CY6A 1UU4A 2YV8A 3E6CC 5J36A 3U11A 3MLLA 2ZJCA 1LODA 4KWKA 1XNBA 4IXLA 4HKWA 1LHWA 3WVJA 2WQ4A 2PLV3 4XQ4A 3NAPB 3VLBB 5AC92 1VBA3 4LA3A 1N1TA 1XXNA 4FP3A 3B94A 4EN0A 4AFBA 2RMU3 1AR62 1NXMA 4YM3A 2UYBA 1H1AA 4Q1RA 2GSYA 4AWDA 3ZXFA 1DGRA 3NL1A 1VBA1 4KWJA 2A71A 1O4ZA 4AQTA 4YVSA 4ASLA 3AK0A 1UAIA 2GN7A 3J9SA 5JIUA 1WCSA 3RJ2X 5FDBA 3SCFA 1VR3A 1H2KA 4HPKA 5CG8A 4BZ4A 4YSFA 3NJZA 2RR12 5JZGC 2I2SA 1R1A3 3O0XA 1AYM3 3EHKA 2GN3A 2VOVA 3WW3A 1OPMA 3PJQA 2VMIA 1CN1A 2AH2A 5J96B 5CFCB 5KXEA 1QHDA 2VVDA 3E6DA 3SMHA 1R1A1 1RUI3 4FPLA 1AYM1 4RR3A 1JOJA 1WW4A 1N1SA 4AEDA 3KCXA 2IZWA 2MNGA 4BYYA 1WBLA 3J26N 3BIWE 4P5HA 3MLJA 4YW4A 3VZMA 1PMIA 1EV12 1J3PA 3FBYA 2D6KA 3K51A 4WZCA 3USUA 1UN1A 1REDA 4M3CA 3PLQA 5T5PA 3QCWA 3NAPC 4AG4A 1RUI1 4XFIA 2P3IA 2Q1MA 2YHJA 2H6CA 4K7JA 1RUD1 2FBEA 1NQJA 3LCPA 2ATFA 4OHWA 5BNPB 5LEJA 1K5MA 1ENSA 2YYOA 1G9BA 1RUH3 1WLTA 2D93A 3HIFA 3M70A 4IEUA 1D2SA 4LO6B 4WVMA 3HBZA 1J59A 1ULFA</