2IXNA

Crystal structure of the pp2a phosphatase activator ypa2 ptpa2
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
297
structure length
292
Chain Sequence
PEKRLLTPDDMKLWEESPTRAHFTKFIIDLAESVKGHENSQYKEPISESINSMMNLLSQIKDITQKHPVIKRFGKVEFRDFYDEVSRNSRKILRSEFPSLTDEQLEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYSYGIFNLSNDSTNLVLKVFIEYLKIMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKHLKPISIHNNELVEMFAHRYLYFGCIAFINKVKSSASLRWHSPMLDDISGVKTWSKVAEGMIKMYKAEVLSKLPIMQHFYFSEFLPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN PHOSPHATASE 2A ACTIVATOR 2
publication title Crystal Structure of the Pp2A Phosphatase Activator: Implications for its Pp2A-Specific Ppiase Activity
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 97
structure length 292
sequence length 297
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03095 PTPA Phosphotyrosyl phosphate activator (PTPA) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2ixnA02
2IXNA 2IXPA 2HV7A 2IXOA 2IXMA 4NY3A 2HV6A 4LACB 2G62A
chains in the Genus database with same CATH superfamily
4U5GA 2Q4FA 1HW1A 3RQEA 4BJ6A 3AG4C 3M15A 1D0ZA 1NZEA 2R7RA 4EKWA 1GGQA 5KYWA 2PFDA 2NUTA 3G4ZA 2LK4A 2A68F 2R7VA 2HS5A 1O3UA 1DOVA 5BQIA 1ZZPA 3QTHA 1ZU4A 2OEXA 2WVOA 3GEEA 4EIYA 3SXKA 1H9GA 2R25A 1V74B 3NMKA 3US6A 1A41A 1FMVA 3QZCA 3SZRA 4BG0A 1V4AA 4BJTA 4W8PA 2Q9BA 1J8YF 2CNWD 3LS1A 3FOOA 3T6GB 4YN0B 4NTAA 3TOMA 5CI8A 3DM5A 3KMIA 2AVKA 2GWWA 2M64A 3R2PA 5EGYA 4N06A 3I4UA 2QNLA 4EBKA 3U3FA 4XPXA 4XEFA 3DD7A 3TOLA 4F4BA 3AQBA 3IQ5A 1TWHA 2R7SA 3S90A 1Y6DA 3CEXA 2AWYA 3K1IA 1RJ9A 4KBLA 1L7CA 3V5YA 2PX3A 2YL0A 2GFHA 2WZGA 4ER9A 2X0CA 3L1MA 4HE8D 4C3EA 4PFPA 1O87A 3DAGA 2OU6A 1WATA 3B71A 1NLXA 3UR3C 3FHDA 2L6FA 2NSFA 2H7VC 2JX0A 3U0CA 1ZYRF 1EQ1A 4MS2A 5JUAA 1LE2A 1E85A 2XSEA 2J8WA 1ORJA 4YL3A 4JVSA 4GYTA 4YWQA 5JLIA 1D1BA 3LEOA 3EPVA 5FCLA 1MQVA 3BEHA 2R7WA 1JR8A 3DI5A 1H9TA 1RKEB 2L6HA 2NUPB 2XLOA 3GODA 4U5HA 1OKKD 3RQFA 1AEPA 1LS4A 2DYRC 4BPMA 4E18A 4JEAA 3HNKA 1TWAA 4MVMA 2BC5A 2YZSA 4AK9A 4LDKA 3O39A 3HTKC 5D92A 4CX9A 2W4MA 4E17A 3C8GA 5FZTA 3V7OA 2EPNA 3Q6MA 3L8IA 2XL6A 3QVZA 3C7JA 4P9TA 2ZXOA 5HSWA 1LE4A 4J7YA 1WGWA 2HFIA 2YLIA 3BRJA 4PJLA 4BJ5A 2QLAA 4ULVA 3EH1A 5IY5C 1BBHA 2XXAA 1LIHA 1NU9C 2A0UA 2I8BA 1ZU5A 2M4EA 2NUTB 3AG3C 2EIKC 1BDJB 2KC3A 4N6HA 4XWJA 5AGFA 3V5XA 3W8IA 3SXYA 4A2NB 4A4AA 4ZLCA 2HJ3A 1TWCA 2MYSA 4NY3A 4Z9JA 1MMGA 3SYNA 1NSGB 2VCAA 3EHMA 4LERA 1F1MA 1V54C 2QUPA 2VASA 3EH2A 1YZCA 5T1DB 2D5RB 3ABKC 3FVYA 3HNIA 3G50A 2PF4E 2PBEA 4K7BA 2J0XA 3TJ6A 2OCCC 4JKVA 4IARA 3NRHA 1VB5A 4O7GA 4U5FE 2WZFA 2J9VA 2L9JA 2Z15A 3WAQA 1YAUO 3UGOA 2EPKX 3K1HA 1CGME 1RXQA 4PFOA 5JT4A 1LS1A 3CZ6A 2Y39A 4MVSA 4WJ0A 1GM5A 3T6BA 1VTMP 3T6JA 5L0HA 3RVYA 1SR2A 1M56C 1YYXA 5EK0A 2YRFA 2Q9CA 5L0FA 1NFNA 4CDYA 1JRAA 2UUHA 3QW1A 2XLWA 2YEVA 3AOUA 3MYFA 2G3KA 4JW1A 4XEVA 2YLGA 4CSAA 2WVNA 1MMAA 4R32A 3NDBB 4DJ9A 1FR0A 3WG7C 2YKZA 4NTFA 4XQ1A 3B29A 4JRZA 3OWTA 5E3CA 1G8XA 2J46A 1E2XA 2O9XA 3W2WA 3V5ZA 4JJGA 4MTGA 4P9FA 5L3VA 2J9UA 5KYNA 1QVXA 3S9OA 2W9YA 3N2ZB 4EWCA 2RSEB 4XPYA 4U9EA 4JCHA 3U2MA 1A0BA 3TJ5A 2EPMX 1H6GA 1D1CA 2P7VA 3S0XA 3GANA 4IGGA 3SP1A 3C8GB 1T9KA 3DAFA 4W8KA 5JRAA 1ZW2A 5JVEA 4OIOF 1ZHYA 2A69F 2NPUA 3S27A 2EPOA 2H7OA 3ZIBA 1OXKA 5KYXA 3HNJA 2XXAB 2LFFA 3LAYA 3A11A 1TFOB 1R5ID 4YL0A 4CDAA 3NMJA 4OIRF 1Z7Qc 1AVOB 3AG2C 2XLEA 5TJ5E 4U5CE 2LFDA 4K1OA 3MBGA 4QI0A 3FAPB 3IQCA 3GM1A 1QLEC 1T01A 2EINC 2IXNA 3MLGA 1KNYA 3L0IA 1VLSA 2P0NA 2VB6A 4U5BE 2CW0F 2YL7A 2LP4A 3H2VA 4BEMJ 2OQMA 3NYLA 4DVZA 1Q0DA 1FTSA 1LI7A 2CNWA 2X51A 1Q0MA 3GM2A 3JTLO 3M4BA 5B1BC 2FAPB 4FAPB 3O6XA 3ZDLA 2HUJA 2R7OA 3TK0A 2G62A 2XM4A 3TQOA 4KI2A 3JYYA 3C63A 3JSZA 3K6BA 2OKUA 3OEOA 4WGYA 4Z9IA 3TULA 2B0HA 1Z6AA 2YVKA 4MVQA 2C04A 2R7UA 2DGJA 1MNEA 3UMIA 2IYLD 3RQGA 1T6UA 1E83A 1IZMA 3IEEA 3L8JA 4PR9A 2IM8A 3RH3A 2PP4A 3EGXA 1NU7D 1VMAA 2CYDA 3DM9B 3A9CA 4DRIB 2YLDA 4M63A 1PCXA 4OIPF 3S84A 3VM6A 2XLMA 4O6NA 3FDQA 1C17M 4HFFB 4AL0A 2A1DD 1VLTA 1JAFA 3KPHA 4LLEA 3WODF 2H7BA 4JZAA 3T4RA 4CS9C 4AE4A 5F5FA 4C7OA 1FNTc 4Q5SF 4PJMA 1APCA 3FAJA 3SEOA 1U89A 2KK1A 4XEKA 3X2QC 4J30B 1LPEA 3PMRA 5B1AC 1QPUA 4C3DA 5BQHA 1KTMA 2J9WA 1T6IA 1OKKA 2V3CC 2XLVA 3I5QA 3DJNB 2LIGA 2YL1A 1HY5A 5K0IA 3DMDA 2TMVP 3L34A 3AGUA 5KYXB 5L0DA 3RYLA 3GEIA 3ZTZA 5A69A 4L6RA 3QW0A 3ZG1A 5L3QA 3DE8A 3RFYA 1CGOA 3H2UA 2ETSA 2Q3TA 1ZHZA 3RKOF 3ZWIA 4CS7A 2IXMA 4FESA 2A6HF 2VH3A 5DS6A 1BR4A 3EFOB 4MVUA 3JCUQ 4FX5A 4CIPA 1S7ZA 1VK5A 4XTKA 3ZQVA 4BJ1A 3AG1C 3B0PA 2HV6A 3IQTA 1BZ4A 4ULWA 3SNHA 3U9MA 2CGEA 4Z9HA 4E0HA 2XL4A 4MW8A 4XLNF 5JS5A 3G4XA 3F46A 2EIJC 2AWCA 2CCYA 4YT2A 5F5HA 5COFA 2MWQA 2RD9A 5HV9A 2UUIA 5EHHA 3RF3A 4MW3A 4YT5A 1TR2A 3GORA 1YA9A 1N1CA 1OR2A 2ZPAA 3QMKA 2HSBA 1Z23A 2QY9A 4D4NA 4O6MA 3EG9A 4MVZA 4OD5A 3EZIA 1K04A 4CIHA 1LVKA 4YT8A 2EILC 3AGTA 4RDAA 4IAOA 3SXZA 1H7IA 1G4WR 4MTOA 4QI2A 1XZQA 3EGXB 3LLKA 1WN0A 1LKXA 1NBBA 2XS1A 3LJBA 3O55A 4KNVA 4JTCB 1YLMA 1D0YA 1G4US 2E87A 4GQHA 1YARO 1AUEA 3GEHA 2Q7RA 3CAXA 5B3SC 5GPGB 2OJQA 4DBRA 2IOQA 4AE4B 4C7OB 3MFNA 1LM3B 3T9OA 2XLDA 4CJOA 4OD4A 3DJUB 4Q7CA 3LUTB 3B0UX 3N24A 1L3PA 1T5OA 3VRCA 1E84A 2GAQA 4WGZA 5A6BD 4BJ6C 4E7SA 2QTVA 1OR3A 1OCZC 3POVA 3E70C 3JRTA 1CPRA 2ZXPA 4JC7A 1FFTC 1YJGA 2AU5A 3ASOC 2VCCA 3LNRA 1D0XA 4NCQA 3DXJF 1SF8A 3VAYA 4PK4A 4AX2A 2JPUA 3LNMB 5DVWA 2HSQA 1ORYA 4I1OB 3EHNA 2YWAA 2R7QA 5DQZA 1O5HA 1B68A 4FWVA 1M6TA 2AP3A 2WB7A 3EQLF 5CI9A 3R7CA 2ZD9A 3M79A 1MMNA 4OIQF 2VCBA 3UNGC 3NKDA 1U6HA 1E86A 1XWJA 2QE9A 1VYKA 3S28A 3E9VA 4N6CA 1JPJA 2HMQA 4MVOA 1NFOA 3KH2A 4EBJA 5D91A 3EFOA 3S29A 5A6JA 3K1IC 3DZAA 3EG9B 4NTBA 3PHF2 4C3BA 3HKKA 3O10A 3QVYA 4ZLDA 4U9DA 5E2QA 4BEJA 1FMWA 1Q0GA 1RCPA 4PJJA 3K7DA 2I15A 1HMDA 4D4XA 5JSLA 1NG1A 1K40A 3W4YA 1QQ3A 1ST6A 2B0JA 3C62A 4YJWA 2J0WA 3GWNA 2J9BA 3KKBA 2HMZA 2YL3A 4GEHA 3WHNA 2R7XA 4OINF 3NMIA 3U5SA 2YQYA 2W4BA 1SZIA 3LS0A 4LDRA 2R05A 4ANJA 1YA7O 3ZTMA 1EA8A 4J7TA 2P6VA 1M2OA 2BE5F 1QKRA 5BQGA 3SXMA 4CS8C 5DS5A 1ORSC 1WTYA 5KYYA 3RIPA 1OXBA 1C02A 2IXOA 2W45A 3OA1A 2DI3A 3M1CB 1W2WA 4G0HA 3UMKA 4CBEA 4CDVA 1VOMA 1UG7A 4N4WA 4MTFA 2KQ9A 1DOWA 2J45A 4KNWA 4IJJA 3Q6NA 1JOGA 3B0VC 5T3TA 2J7PD 2C03A 1SYQA 1ZHTA 3NKEA 4JTDB 4BJ5C 3GWLA 5DQTA 5A6AA 3B9QA 4B6IA 1R4TA 2D4UA 1JMWA 2OEVA 4PACA 3UMHA 2EPLX 2PX0A 1HE1A 4EBBA 2KGOA 2Y3HA 4JURI 3MYIA 2BL2A 4CJGA 1TQGA 1FFHA 2XRHA 4RBNA 2LQGA 3Q7GA 5BUOA 3W2VA 4LDQA 4K0DA 4ONSA 1J8MF 1GS9A 1ZHWA 5DLJA 1ZHXA 1RKCA 3I5PA 4U5DE 3VYWA 2VC9A 4X0RA 4MQ9F 1Q0FA 1OW7A 3U8PA 4DRHB 4DRJB 1CGNA 2L7AA 1V55C 4U5EE 1M2VA 3PCVA 4XPWA 4MVRA 3ATPA 1C03A 3LEVA 2IXPA 3AQCA 3M4CA 4LACB 2KJGA 3AJMA 4Q4ZF 5KYUA 4O79A 1EKYA 5COMA 256BA 4J32B 1OCCC 3HNLA 1ZVZA 2HZ8A 1CPQA 1IW7F 3ASNC 4YT4A 4IB4A 2R9RB 3K33A 4HFKB 4WABA 2R02A 5E3AA 1HW2A 4EHPA 1YDIA 2LD6A 3DWWA 2KW3C 4CSAC 5JP7A 3KYIA 2P1AA 4CS8A 5A6KA 3U8VA 1UFBA 4IRUA 4DVYP 4JTAB 1OW8A 1S05A 2ICWG 2XL8A 4H4KC 3HLZA 5AC5A 4NC3A 4EUKB 3ECSA 2DB4A 1I4YA 1I4ZA 3PDMP 1U0BB 4DBQA 2A6EF 4G78A 1WASA 2F22A 1M57C 5KYYB 2Y3BA 4UDVA 4P6IC 3IQ6A 4NQFA 1RMVA 1MMDA 2H8AA 1PV3A 2WZLA 2Y69C 3UGPA 4YK5A 2MHRA 4I44A 2HJMA 4IWBA 1OQCA 2ASRA 2GA0A 1MNDA 1GQAA 1WWPA 3ABLC 4IAQA 3ZVRA 4CS9A 5KYWB 1QSPA 1ZW3A 3ABMC 3H65A 3U9JA 1VYIA 3EGDA 3C8GD 3ITFA 1A7DA 2KSFA 2LSEA 4JE9A 3ZQYA 1FAPB 2FGYA 1D1AA 1PD1A 3LLIA 2IBFA 5L0IA 2EIMC 3F47A 3U2LA 2ZXWC 3NYJA 5A6BA 2CDQA 1YVIA 2XM0A 1HE9A 1BR1A 3W8HA 4E0IA 2Y3DA 1Q0KA 3CSKA 2NG1A 2Y3GA 4QDLA 2XS8A 2LCHA 1LI5A 1Z63A 1KU2A 3X1OA 2L81A 4YL1A 1WOLA 3DKAA 3FOPA 3EZHA 2OG2A 1OW6A 3NYMA 4JIOA 2P61A 1YZAA 3Q7LA 3FMSA 3JRMO 3LESA 2JD3A 2Q9AA 1RJ9B 2YHSA 3JT1A 3KYJA 3IPMO 3NG1A 2A0BA 3TD7A 1M2VB 2XLHA 1SMYF 4JEBA 3GM3A 4I3MA 1XZPA 4MNDA 1G5ZA 2OOCA 1Y4CA 5F28E 3ZSUA 2OJED 1BR2A 1YYJA 1OCOC 2DYSC 2G3VA 3JZ0A 5KYUB 4E7ZA 1K05A 5DS4A 3RVZA 3K66A 1HMOA 3C18A 1PD0A 2WVQA 3J06A 1T6QA 3EJNA 4LLCA 4RD9A 2HV7A 4XLPF 3VF0A 3JSEO 4PJNA 3ZC4A 3N0TA 4AL1A 2FFHA 5COGA 1Z3IX 1EI7A 4JJFA 3IHUA 1I5NA 5E33A 2PNOA 2Q00A 2V26A 4G7ZF 2KYHA 4O6YA 4G7HF 4HEAJ 1QZXA 4JCZA 4G7OF 2NSGA 3DE9A 3RW0A 1Z5ZA 3C8ZA 2R7TA 2GDCA 3KL4A 3JYHA 2WL8A 5L0GA 2KNHA 5L0JA 1RKEA 1A7EA 4I1MA 2L6GA 2NUPA 3FXHA 4DOZA 2R03A 3EGDB 3HJCA 5CIVA 1TWGA 5B3IA 5AC4A 1OCRC 4DXWA 5L0CA 4H54A 1TKNA 4KC9A 1A7VA 2ZXRA 5T3WA 3CQZA 1JPNA 2HKVA 2J7PA 3MX3A 3U3BA 1TFKB
chains in the Genus database with same CATH topology
4U5GA 4BJ6A 3AG4C 2R7RA 1D0ZA 1NZEA 5KYWA 2PFDA 2NUTA 2A68F 1ZU4A 2WVOA 1FMVA 4BG0A 3QZCA 3SZRA 4BJTA 2Q9BA 1J8YF 2CNWD 3LS1A 4YN0B 5CI8A 3DM5A 3KMIA 5EGYA 4N06A 3I4UA 4F4BA 3DD7A 3AQBA 1TWHA 2R7SA 1RJ9A 4KBLA 2PX3A 2GFHA 2WZGA 4HE8D 4C3EA 4PFPA 1O87A 3DAGA 3UR3C 3FHDA 2H7VC 1ZYRF 2XSEA 4JVSA 4GYTA 4YWQA 1D1BA 3EPVA 5FCLA 2R7WA 2NUPB 3GODA 4U5HA 1OKKD 2DYRC 1TWAA 2YZSA 4AK9A 3O39A 3HTKC 5D92A 2W4MA 3V7OA 3Q6MA 5HSWA 2ZXOA 4PJLA 1WGWA 5IY5C 4BJ5A 3EH1A 2XXAA 1NU9C 2I8BA 2M4EA 2NUTB 1ZU5A 3AG3C 4G7OF 4XWJA 2EIKC 3W8IA 4ZLCA 1TWCA 2MYSA 4NY3A 1MMGA 3SYNA 3EHMA 4LERA 1V54C 2VASA 3EH2A 5T1DB 2D5RB 3ABKC 3FVYA 2PF4E 4K7BA 2J0XA 2OCCC 3NRHA 4O7GA 4U5FE 2WZFA 2J9VA 2L9JA 2Z15A 3UGOA 3K1HA 4PFOA 1LS1A 3CZ6A 2Y39A 4WJ0A 3T6BA 3T6JA 1M56C 2Q9CA 2YEVA 4JW1A 2G3KA 4CSAA 2WVNA 1MMAA 3NDBB 3WG7C 3OWTA 5E3CA 1G8XA 2J46A 2O9XA 3W2WA 4JJGA 5L3VA 2J9UA 5KYNA 2W9YA 3N2ZB 4EWCA 4JCHA 1D1CA 2P7VA 3S0XA 3GANA 3SP1A 3DAFA 4W8KA 4OIOF 1ZHYA 2A69F 3S27A 2H7OA 3ZIBA 5KYXA 2XXAB 3LAYA 4OIRF 3AG2C 4U5CE 4QI0A 4DBRA 1QLEC 3MLGA 2EINC 2IXNA 3L0IA 2VB6A 4U5BE 2CW0F 3NYLA 4DVZA 2CNWA 1FTSA 5B1BC 2X51A 3O6XA 2R7OA 2G62A 4KI2A 3JSZA 3K6BA 3OEOA 1Z6AA 2C04A 2R7UA 2DGJA 1MNEA 3UMIA 2IYLD 1IZMA 3IEEA 3RH3A 2PP4A 3EGXA 1NU7D 1VMAA 3DM9B 4M63A 1PCXA 4OIPF 4O6NA 3FDQA 4HFFB 2A1DD 4LLEA 3WODF 2H7BA 4JZAA 3T4RA 4CS9C 4AE4A 5F5FA 4C7OA 4Q5SF 4PJMA 3FAJA 3SEOA 3X2QC 4J30B 3PMRA 5B1AC 4C3DA 2J9WA 1OKKA 2V3CC 3I5QA 3DJNB 3DMDA 3L34A 5KYXB 3RYLA 5L3QA 3ZG1A 3RFYA 2Q3TA 1ZHZA 3RKOF 4CS7A 2IXMA 4FESA 2A6HF 2VH3A 5DS6A 1BR4A 3EFOB 3JCUQ 4FX5A 1S7ZA 1VK5A 4XTKA 4BJ1A 3AG1C 3B0PA 2HV6A 4ULWA 3SNHA 2CGEA 2XL4A 4XLNF 4YT2A 3F46A 2EIJC 5F5HA 2MWQA 5EHHA 4YT5A 1TR2A 1N1CA 2ZPAA 3QMKA 2QY9A 1Z23A 4O6MA 3EG9A 4OD5A 3EZIA 4CIHA 1LVKA 4YT8A 2EILC 4RDAA 4IAOA 4QI2A 3EGXB 3LLKA 3LJBA 1LKXA 4KNVA 1D0YA 2E87A 5B3SC 2IOQA 4AE4B 4C7OB 4OD4A 3DJUB 4Q7CA 3B0UX 3N24A 4BJ6C 4E7SA 2QTVA 1OCZC 3POVA 3E70C 3JRTA 2ZXPA 1FFTC 3ASOC 3LNRA 1D0XA 3DXJF 1SF8A 3VAYA 4PK4A 4AX2A 5DVWA 4I1OB 3EHNA 2R7QA 5DQZA 1O5HA 4FWVA 2WB7A 3EQLF 5CI9A 4OIQF 1MMNA 3UNGC 3NKDA 1VYKA 3S28A 3E9VA 1JPJA 3KH2A 5D91A 3EFOA 3S29A 3K1IC 3DZAA 3EG9B 3PHF2 4C3BA 4ZLDA 5E2QA 4BEJA 1FMWA 4PJJA 3K7DA 1NG1A 1ST6A 2B0JA 4YJWA 2J0WA 2R7XA 3KKBA 4GEHA 4OINF 2W4BA 1SZIA 3LS0A 4ANJA 2R7VA 2P6VA 1M2OA 2BE5F 5DS5A 4CS8C 5KYYA 3RIPA 2IXOA 2W45A 3OA1A 3UMKA 3M1CB 1W2WA 4G0HA 4CBEA 1VOMA 2KQ9A 2J45A 4KNWA 4IJJA 3Q6NA 3B0VC 5T3TA 2J7PD 2C03A 3NKEA 1ZHTA 4BJ5C 5DQTA 3B9QA 4B6IA 3UMHA 2PX0A 4EBBA 2KGOA 2Y3HA 4JURI 1FFHA 2XRHA 4RBNA 3Q7GA 5BUOA 3W2VA 4K0DA 1J8MF 5DLJA 1ZHWA 1ZHXA 4U5DE 3I5PA 3VYWA 4X0RA 4MQ9F 1V55C 4U5EE 1M2VA 3LEVA 4LACB 2IXPA 3AQCA 2KJGA 4Q4ZF 5KYUA 4O79A 4J32B 1OCCC 1IW7F 3ASNC 4YT4A 3K33A 4HFKB 5E3AA 2KW3C 4CSAC 4CS8A 4DVYP 4IRUA 4H4KC 3HLZA 3ECSA 4DBQA 2A6EF 5KYYB 1M57C 2Y3BA 4P6IC 1MMDA 2Y69C 2WZLA 3UGPA 4I44A 4IWBA 1MNDA 3ABLC 3ZVRA 5KYWB 4CS9A 3ABMC 3H65A 1VYIA 3EGDA 3ITFA 2LSEA 2FGYA 1D1AA 1PD1A 3LLIA 2EIMC 3F47A 2ZXWC 3NYJA 2CDQA 1BR1A 3W8HA 2Y3DA 3CSKA 2NG1A 2Y3GA 4QDLA 1Z63A 1KU2A 3X1OA 2L81A 3EZHA 2OG2A 3NYMA 3Q7LA 3LESA 2JD3A 2Q9AA 1RJ9B 2YHSA 3JT1A 3NG1A 3TD7A 1M2VB 1SMYF 4A2NB 4I3MA 4MNDA 3ZSUA 1BR2A 2DYSC 1OCOC 2G3VA 5KYUB 4E7ZA 5DS4A 3K66A 1PD0A 2WVQA 3EJNA 4LLCA 4RD9A 2HV7A 4XLPF 4PJNA 3ZC4A 3N0TA 2FFHA 1Z3IX 4JJFA 5E33A 2V26A 4G7ZF 4O6YA 4G7HF 4HEAJ 1QZXA 1Z5ZA 2R7TA 3KL4A 3JYHA 2WL8A 2KNHA 4I1MA 2NUPA 4DOZA 3HJCA 3EGDB 1TWGA 1OCRC 1TKNA 4KC9A 2ZXRA 5T3WA 3CQZA 1JPNA 2J7PA 3MX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IXN A;  2IXP A;  2HV7 A;  2IXO A;  2IXM A;  4NY3 A;  2HV6 A;  4LAC B;  2G62 A; 
#chains in the Genus database with same CATH topology
 4U5G A;  2Q4F A;  1HW1 A;  3RQE A;  4BJ6 A;  3AG4 C;  3M15 A;  1D0Z A;  1NZE A;  2R7R A;  4EKW A;  1GGQ A;  5KYW A;  2PFD A;  2NUT A;  3G4Z A;  2LK4 A;  2A68 F;  2R7V A;  2HS5 A;  1O3U A;  1DOV A;  5BQI A;  1ZZP A;  3QTH A;  1ZU4 A;  2OEX A;  2WVO A;  3GEE A;  4EIY A;  3SXK A;  1H9G A;  2R25 A;  1V74 B;  3NMK A;  3US6 A;  1A41 A;  1FMV A;  3QZC A;  3SZR A;  4BG0 A;  1V4A A;  4BJT A;  4W8P A;  2Q9B A;  1J8Y F;  2CNW D;  3LS1 A;  3FOO A;  3T6G B;  4YN0 B;  4NTA A;  3TOM A;  5CI8 A;  3DM5 A;  3KMI A;  2AVK A;  2GWW A;  2M64 A;  3R2P A;  5EGY A;  4N06 A;  3I4U A;  2QNL A;  4EBK A;  3U3F A;  4XPX A;  4XEF A;  3DD7 A;  3TOL A;  4F4B A;  3AQB A;  3IQ5 A;  1TWH A;  2R7S A;  3S90 A;  1Y6D A;  3CEX A;  2AWY A;  3K1I A;  1RJ9 A;  4KBL A;  1L7C A;  3V5Y A;  2PX3 A;  2YL0 A;  2GFH A;  2WZG A;  4ER9 A;  2X0C A;  3L1M A;  4HE8 D;  4C3E A;  4PFP A;  1O87 A;  3DAG A;  2OU6 A;  1WAT A;  3B71 A;  1NLX A;  3UR3 C;  3FHD A;  2L6F A;  2NSF A;  2H7V C;  2JX0 A;  3U0C A;  1ZYR F;  1EQ1 A;  4MS2 A;  5JUA A;  1LE2 A;  1E85 A;  2XSE A;  2J8W A;  1ORJ A;  4YL3 A;  4JVS A;  4GYT A;  4YWQ A;  5JLI A;  1D1B A;  3LEO A;  3EPV A;  5FCL A;  1MQV A;  3BEH A;  2R7W A;  1JR8 A;  3DI5 A;  1H9T A;  1RKE B;  2L6H A;  2NUP B;  2XLO A;  3GOD A;  4U5H A;  1OKK D;  3RQF A;  1AEP A;  1LS4 A;  2DYR C;  4BPM A;  4E18 A;  4JEA A;  3HNK A;  1TWA A;  4MVM A;  2BC5 A;  2YZS A;  4AK9 A;  4LDK A;  3O39 A;  3HTK C;  5D92 A;  4CX9 A;  2W4M A;  4E17 A;  3C8G A;  5FZT A;  3V7O A;  2EPN A;  3Q6M A;  3L8I A;  2XL6 A;  3QVZ A;  3C7J A;  4P9T A;  2ZXO A;  5HSW A;  1LE4 A;  4J7Y A;  1WGW A;  2HFI A;  2YLI A;  3BRJ A;  4PJL A;  4BJ5 A;  2QLA A;  4ULV A;  3EH1 A;  5IY5 C;  1BBH A;  2XXA A;  1LIH A;  1NU9 C;  2A0U A;  2I8B A;  1ZU5 A;  2M4E A;  2NUT B;  3AG3 C;  2EIK C;  1BDJ B;  2KC3 A;  4N6H A;  4XWJ A;  5AGF A;  3V5X A;  3W8I A;  3SXY A;  4A2N B;  4A4A A;  4ZLC A;  2HJ3 A;  1TWC A;  2MYS A;  4NY3 A;  4Z9J A;  1MMG A;  3SYN A;  1NSG B;  2VCA A;  3EHM A;  4LER A;  1F1M A;  1V54 C;  2QUP A;  2VAS A;  3EH2 A;  1YZC A;  5T1D B;  2D5R B;  3ABK C;  3FVY A;  3HNI A;  3G50 A;  2PF4 E;  2PBE A;  4K7B A;  2J0X A;  3TJ6 A;  2OCC C;  4JKV A;  4IAR A;  3NRH A;  1VB5 A;  4O7G A;  4U5F E;  2WZF A;  2J9V A;  2L9J A;  2Z15 A;  3WAQ A;  1YAU O;  3UGO A;  2EPK X;  3K1H A;  1CGM E;  1RXQ A;  4PFO A;  5JT4 A;  1LS1 A;  3CZ6 A;  2Y39 A;  4MVS A;  4WJ0 A;  1GM5 A;  3T6B A;  1VTM P;  3T6J A;  5L0H A;  3RVY A;  1SR2 A;  1M56 C;  1YYX A;  5EK0 A;  2YRF A;  2Q9C A;  5L0F A;  1NFN A;  4CDY A;  1JRA A;  2UUH A;  3QW1 A;  2XLW A;  2YEV A;  3AOU A;  3MYF A;  2G3K A;  4JW1 A;  4XEV A;  2YLG A;  4CSA A;  2WVN A;  1MMA A;  4R32 A;  3NDB B;  4DJ9 A;  1FR0 A;  3WG7 C;  2YKZ A;  4NTF A;  4XQ1 A;  3B29 A;  4JRZ A;  3OWT A;  5E3C A;  1G8X A;  2J46 A;  1E2X A;  2O9X A;  3W2W A;  3V5Z A;  4JJG A;  4MTG A;  4P9F A;  5L3V A;  2J9U A;  5KYN A;  1QVX A;  3S9O A;  2W9Y A;  3N2Z B;  4EWC A;  2RSE B;  4XPY A;  4U9E A;  4JCH A;  3U2M A;  1A0B A;  3TJ5 A;  2EPM X;  1H6G A;  1D1C A;  2P7V A;  3S0X A;  3GAN A;  4IGG A;  3SP1 A;  3C8G B;  1T9K A;  3DAF A;  4W8K A;  5JRA A;  1ZW2 A;  5JVE A;  4OIO F;  1ZHY A;  2A69 F;  2NPU A;  3S27 A;  2EPO A;  2H7O A;  3ZIB A;  1OXK A;  5KYX A;  3HNJ A;  2XXA B;  2LFF A;  3LAY A;  3A11 A;  1TFO B;  1R5I D;  4YL0 A;  4CDA A;  3NMJ A;  4OIR F;  1Z7Q c;  1AVO B;  3AG2 C;  2XLE A;  5TJ5 E;  4U5C E;  2LFD A;  4K1O A;  3MBG A;  4QI0 A;  3FAP B;  3IQC A;  3GM1 A;  1QLE C;  1T01 A;  2EIN C;  2IXN A;  3MLG A;  1KNY A;  3L0I A;  1VLS A;  2P0N A;  2VB6 A;  4U5B E;  2CW0 F;  2YL7 A;  2LP4 A;  3H2V A;  4BEM J;  2OQM A;  3NYL A;  4DVZ A;  1Q0D A;  1FTS A;  1LI7 A;  2CNW A;  2X51 A;  1Q0M A;  3GM2 A;  3JTL O;  3M4B A;  5B1B C;  2FAP B;  4FAP B;  3O6X A;  3ZDL A;  2HUJ A;  2R7O A;  3TK0 A;  2G62 A;  2XM4 A;  3TQO A;  4KI2 A;  3JYY A;  3C63 A;  3JSZ A;  3K6B A;  2OKU A;  3OEO A;  4WGY A;  4Z9I A;  3TUL A;  2B0H A;  1Z6A A;  2YVK A;  4MVQ A;  2C04 A;  2R7U A;  2DGJ A;  1MNE A;  3UMI A;  2IYL D;  3RQG A;  1T6U A;  1E83 A;  1IZM A;  3IEE A;  3L8J A;  4PR9 A;  2IM8 A;  3RH3 A;  2PP4 A;  3EGX A;  1NU7 D;  1VMA A;  2CYD A;  3DM9 B;  3A9C A;  4DRI B;  2YLD A;  4M63 A;  1PCX A;  4OIP F;  3S84 A;  3VM6 A;  2XLM A;  4O6N A;  3FDQ A;  1C17 M;  4HFF B;  4AL0 A;  2A1D D;  1VLT A;  1JAF A;  3KPH A;  4LLE A;  3WOD F;  2H7B A;  4JZA A;  3T4R A;  4CS9 C;  4AE4 A;  5F5F A;  4C7O A;  1FNT c;  4Q5S F;  4PJM A;  1APC A;  3FAJ A;  3SEO A;  1U89 A;  2KK1 A;  4XEK A;  3X2Q C;  4J30 B;  1LPE A;  3PMR A;  5B1A C;  1QPU A;  4C3D A;  5BQH A;  1KTM A;  2J9W A;  1T6I A;  1OKK A;  2V3C C;  2XLV A;  3I5Q A;  3DJN B;  2LIG A;  2YL1 A;  1HY5 A;  5K0I A;  3DMD A;  2TMV P;  3L34 A;  3AGU A;  5KYX B;  5L0D A;  3RYL A;  3GEI A;  3ZTZ A;  5A69 A;  4L6R A;  3QW0 A;  3ZG1 A;  5L3Q A;  3DE8 A;  3RFY A;  1CGO A;  3H2U A;  2ETS A;  2Q3T A;  1ZHZ A;  3RKO F;  3ZWI A;  4CS7 A;  2IXM A;  4FES A;  2A6H F;  2VH3 A;  5DS6 A;  1BR4 A;  3EFO B;  4MVU A;  3JCU Q;  4FX5 A;  4CIP A;  1S7Z A;  1VK5 A;  4XTK A;  3ZQV A;  4BJ1 A;  3AG1 C;  3B0P A;  2HV6 A;  3IQT A;  1BZ4 A;  4ULW A;  3SNH A;  3U9M A;  2CGE A;  4Z9H A;  4E0H A;  2XL4 A;  4MW8 A;  4XLN F;  5JS5 A;  3G4X A;  3F46 A;  2EIJ C;  2AWC A;  2CCY A;  4YT2 A;  5F5H A;  5COF A;  2MWQ A;  2RD9 A;  5HV9 A;  2UUI A;  5EHH A;  3RF3 A;  4MW3 A;  4YT5 A;  1TR2 A;  3GOR A;  1YA9 A;  1N1C A;  1OR2 A;  2ZPA A;  3QMK A;  2HSB A;  1Z23 A;  2QY9 A;  4D4N A;  4O6M A;  3EG9 A;  4MVZ A;  4OD5 A;  3EZI A;  1K04 A;  4CIH A;  1LVK A;  4YT8 A;  2EIL C;  3AGT A;  4RDA A;  4IAO A;  3SXZ A;  1H7I A;  1G4W R;  4MTO A;  4QI2 A;  1XZQ A;  3EGX B;  3LLK A;  1WN0 A;  1LKX A;  1NBB A;  2XS1 A;  3LJB A;  3O55 A;  4KNV A;  4JTC B;  1YLM A;  1D0Y A;  1G4U S;  2E87 A;  4GQH A;  1YAR O;  1AUE A;  3GEH A;  2Q7R A;  3CAX A;  5B3S C;  5GPG B;  2OJQ A;  4DBR A;  2IOQ A;  4AE4 B;  4C7O B;  3MFN A;  1LM3 B;  3T9O A;  2XLD A;  4CJO A;  4OD4 A;  3DJU B;  4Q7C A;  3LUT B;  3B0U X;  3N24 A;  1L3P A;  1T5O A;  3VRC A;  1E84 A;  2GAQ A;  4WGZ A;  5A6B D;  4BJ6 C;  4E7S A;  2QTV A;  1OR3 A;  1OCZ C;  3POV A;  3E70 C;  3JRT A;  1CPR A;  2ZXP A;  4JC7 A;  1FFT C;  1YJG A;  2AU5 A;  3ASO C;  2VCC A;  3LNR A;  1D0X A;  4NCQ A;  3DXJ F;  1SF8 A;  3VAY A;  4PK4 A;  4AX2 A;  2JPU A;  3LNM B;  5DVW A;  2HSQ A;  1ORY A;  4I1O B;  3EHN A;  2YWA A;  2R7Q A;  5DQZ A;  1O5H A;  1B68 A;  4FWV A;  1M6T A;  2AP3 A;  2WB7 A;  3EQL F;  5CI9 A;  3R7C A;  2ZD9 A;  3M79 A;  1MMN A;  4OIQ F;  2VCB A;  3UNG C;  3NKD A;  1U6H A;  1E86 A;  1XWJ A;  2QE9 A;  1VYK A;  3S28 A;  3E9V A;  4N6C A;  1JPJ A;  2HMQ A;  4MVO A;  1NFO A;  3KH2 A;  4EBJ A;  5D91 A;  3EFO A;  3S29 A;  5A6J A;  3K1I C;  3DZA A;  3EG9 B;  4NTB A;  3PHF 2;  4C3B A;  3HKK A;  3O10 A;  3QVY A;  4ZLD A;  4U9D A;  5E2Q A;  4BEJ A;  1FMW A;  1Q0G A;  1RCP A;  4PJJ A;  3K7D A;  2I15 A;  1HMD A;  4D4X A;  5JSL A;  1NG1 A;  1K40 A;  3W4Y A;  1QQ3 A;  1ST6 A;  2B0J A;  3C62 A;  4YJW A;  2J0W A;  3GWN A;  2J9B A;  3KKB A;  2HMZ A;  2YL3 A;  4GEH A;  3WHN A;  2R7X A;  4OIN F;  3NMI A;  3U5S A;  2YQY A;  2W4B A;  1SZI A;  3LS0 A;  4LDR A;  2R05 A;  4ANJ A;  1YA7 O;  3ZTM A;  1EA8 A;  4J7T A;  2P6V A;  1M2O A;  2BE5 F;  1QKR A;  5BQG A;  3SXM A;  4CS8 C;  5DS5 A;  1ORS C;  1WTY A;  5KYY A;  3RIP A;  1OXB A;  1C02 A;  2IXO A;  2W45 A;  3OA1 A;  2DI3 A;  3M1C B;  1W2W A;  4G0H A;  3UMK A;  4CBE A;  4CDV A;  1VOM A;  1UG7 A;  4N4W A;  4MTF A;  2KQ9 A;  1DOW A;  2J45 A;  4KNW A;  4IJJ A;  3Q6N A;  1JOG A;  3B0V C;  5T3T A;  2J7P D;  2C03 A;  1SYQ A;  1ZHT A;  3NKE A;  4JTD B;  4BJ5 C;  3GWL A;  5DQT A;  5A6A A;  3B9Q A;  4B6I A;  1R4T A;  2D4U A;  1JMW A;  2OEV A;  4PAC A;  3UMH A;  2EPL X;  2PX0 A;  1HE1 A;  4EBB A;  2KGO A;  2Y3H A;  4JUR I;  3MYI A;  2BL2 A;  4CJG A;  1TQG A;  1FFH A;  2XRH A;  4RBN A;  2LQG A;  3Q7G A;  5BUO A;  3W2V A;  4LDQ A;  4K0D A;  4ONS A;  1J8M F;  1GS9 A;  1ZHW A;  5DLJ A;  1ZHX A;  1RKC A;  3I5P A;  4U5D E;  3VYW A;  2VC9 A;  4X0R A;  4MQ9 F;  1Q0F A;  1OW7 A;  3U8P A;  4DRH B;  4DRJ B;  1CGN A;  2L7A A;  1V55 C;  4U5E E;  1M2V A;  3PCV A;  4XPW A;  4MVR A;  3ATP A;  1C03 A;  3LEV A;  2IXP A;  3AQC A;  3M4C A;  4LAC B;  2KJG A;  3AJM A;  4Q4Z F;  5KYU A;  4O79 A;  1EKY A;  5COM A;  256B A;  4J32 B;  1OCC C;  3HNL A;  1ZVZ A;  2HZ8 A;  1CPQ A;  1IW7 F;  3ASN C;  4YT4 A;  4IB4 A;  2R9R B;  3K33 A;  4HFK B;  4WAB A;  2R02 A;  5E3A A;  1HW2 A;  4EHP A;  1YDI A;  2LD6 A;  3DWW A;  2KW3 C;  4CSA C;  5JP7 A;  3KYI A;  2P1A A;  4CS8 A;  5A6K A;  3U8V A;  1UFB A;  4IRU A;  4DVY P;  4JTA B;  1OW8 A;  1S05 A;  2ICW G;  2XL8 A;  4H4K C;  3HLZ A;  5AC5 A;  4NC3 A;  4EUK B;  3ECS A;  2DB4 A;  1I4Y A;  1I4Z A;  3PDM P;  1U0B B;  4DBQ A;  2A6E F;  4G78 A;  1WAS A;  2F22 A;  1M57 C;  5KYY B;  2Y3B A;  4UDV A;  4P6I C;  3IQ6 A;  4NQF A;  1RMV A;  1MMD A;  2H8A A;  1PV3 A;  2WZL A;  2Y69 C;  3UGP A;  4YK5 A;  2MHR A;  4I44 A;  2HJM A;  4IWB A;  1OQC A;  2ASR A;  2GA0 A;  1MND A;  1GQA A;  1WWP A;  3ABL C;  4IAQ A;  3ZVR A;  4CS9 A;  5KYW B;  1QSP A;  1ZW3 A;  3ABM C;  3H65 A;  3U9J A;  1VYI A;  3EGD A;  3C8G D;  3ITF A;  1A7D A;  2KSF A;  2LSE A;  4JE9 A;  3ZQY A;  1FAP B;  2FGY A;  1D1A A;  1PD1 A;  3LLI A;  2IBF A;  5L0I A;  2EIM C;  3F47 A;  3U2L A;  2ZXW C;  3NYJ A;  5A6B A;  2CDQ A;  1YVI A;  2XM0 A;  1HE9 A;  1BR1 A;  3W8H A;  4E0I A;  2Y3D A;  1Q0K A;  3CSK A;  2NG1 A;  2Y3G A;  4QDL A;  2XS8 A;  2LCH A;  1LI5 A;  1Z63 A;  1KU2 A;  3X1O A;  2L81 A;  4YL1 A;  1WOL A;  3DKA A;  3FOP A;  3EZH A;  2OG2 A;  1OW6 A;  3NYM A;  4JIO A;  2P61 A;  1YZA A;  3Q7L A;  3FMS A;  3JRM O;  3LES A;  2JD3 A;  2Q9A A;  1RJ9 B;  2YHS A;  3JT1 A;  3KYJ A;  3IPM O;  3NG1 A;  2A0B A;  3TD7 A;  1M2V B;  2XLH A;  1SMY F;  4JEB A;  3GM3 A;  4I3M A;  1XZP A;  4MND A;  1G5Z A;  2OOC A;  1Y4C A;  5F28 E;  3ZSU A;  2OJE D;  1BR2 A;  1YYJ A;  1OCO C;  2DYS C;  2G3V A;  3JZ0 A;  5KYU B;  4E7Z A;  1K05 A;  5DS4 A;  3RVZ A;  3K66 A;  1HMO A;  3C18 A;  1PD0 A;  2WVQ A;  3J06 A;  1T6Q A;  3EJN A;  4LLC A;  4RD9 A;  2HV7 A;  4XLP F;  3VF0 A;  3JSE O;  4PJN A;  3ZC4 A;  3N0T A;  4AL1 A;  2FFH A;  5COG A;  1Z3I X;  1EI7 A;  4JJF A;  3IHU A;  1I5N A;  5E33 A;  2PNO A;  2Q00 A;  2V26 A;  4G7Z F;  2KYH A;  4O6Y A;  4G7H F;  4HEA J;  1QZX A;  4JCZ A;  4G7O F;  2NSG A;  3DE9 A;  3RW0 A;  1Z5Z A;  3C8Z A;  2R7T A;  2GDC A;  3KL4 A;  3JYH A;  2WL8 A;  5L0G A;  2KNH A;  5L0J A;  1RKE A;  1A7E A;  4I1M A;  2L6G A;  2NUP A;  3FXH A;  4DOZ A;  2R03 A;  3EGD B;  3HJC A;  5CIV A;  1TWG A;  5B3I A;  5AC4 A;  1OCR C;  4DXW A;  5L0C A;  4H54 A;  1TKN A;  4KC9 A;  1A7V A;  2ZXR A;  5T3W A;  3CQZ A;  1JPN A;  2HKV A;  2J7P A;  3MX3 A;  3U3B A;  1TFK B; 
#chains in the Genus database with same CATH homology
 4U5G A;  4BJ6 A;  3AG4 C;  2R7R A;  1D0Z A;  1NZE A;  5KYW A;  2PFD A;  2NUT A;  2A68 F;  1ZU4 A;  2WVO A;  1FMV A;  4BG0 A;  3QZC A;  3SZR A;  4BJT A;  2Q9B A;  1J8Y F;  2CNW D;  3LS1 A;  4YN0 B;  5CI8 A;  3DM5 A;  3KMI A;  5EGY A;  4N06 A;  3I4U A;  4F4B A;  3DD7 A;  3AQB A;  1TWH A;  2R7S A;  1RJ9 A;  4KBL A;  2PX3 A;  2GFH A;  2WZG A;  4HE8 D;  4C3E A;  4PFP A;  1O87 A;  3DAG A;  3UR3 C;  3FHD A;  2H7V C;  1ZYR F;  2XSE A;  4JVS A;  4GYT A;  4YWQ A;  1D1B A;  3EPV A;  5FCL A;  2R7W A;  2NUP B;  3GOD A;  4U5H A;  1OKK D;  2DYR C;  1TWA A;  2YZS A;  4AK9 A;  3O39 A;  3HTK C;  5D92 A;  2W4M A;  3V7O A;  3Q6M A;  5HSW A;  2ZXO A;  4PJL A;  1WGW A;  5IY5 C;  4BJ5 A;  3EH1 A;  2XXA A;  1NU9 C;  2I8B A;  2M4E A;  2NUT B;  1ZU5 A;  3AG3 C;  4G7O F;  4XWJ A;  2EIK C;  3W8I A;  4ZLC A;  1TWC A;  2MYS A;  4NY3 A;  1MMG A;  3SYN A;  3EHM A;  4LER A;  1V54 C;  2VAS A;  3EH2 A;  5T1D B;  2D5R B;  3ABK C;  3FVY A;  2PF4 E;  4K7B A;  2J0X A;  2OCC C;  3NRH A;  4O7G A;  4U5F E;  2WZF A;  2J9V A;  2L9J A;  2Z15 A;  3UGO A;  3K1H A;  4PFO A;  1LS1 A;  3CZ6 A;  2Y39 A;  4WJ0 A;  3T6B A;  3T6J A;  1M56 C;  2Q9C A;  2YEV A;  4JW1 A;  2G3K A;  4CSA A;  2WVN A;  1MMA A;  3NDB B;  3WG7 C;  3OWT A;  5E3C A;  1G8X A;  2J46 A;  2O9X A;  3W2W A;  4JJG A;  5L3V A;  2J9U A;  5KYN A;  2W9Y A;  3N2Z B;  4EWC A;  4JCH A;  1D1C A;  2P7V A;  3S0X A;  3GAN A;  3SP1 A;  3DAF A;  4W8K A;  4OIO F;  1ZHY A;  2A69 F;  3S27 A;  2H7O A;  3ZIB A;  5KYX A;  2XXA B;  3LAY A;  4OIR F;  3AG2 C;  4U5C E;  4QI0 A;  4DBR A;  1QLE C;  3MLG A;  2EIN C;  2IXN A;  3L0I A;  2VB6 A;  4U5B E;  2CW0 F;  3NYL A;  4DVZ A;  2CNW A;  1FTS A;  5B1B C;  2X51 A;  3O6X A;  2R7O A;  2G62 A;  4KI2 A;  3JSZ A;  3K6B A;  3OEO A;  1Z6A A;  2C04 A;  2R7U A;  2DGJ A;  1MNE A;  3UMI A;  2IYL D;  1IZM A;  3IEE A;  3RH3 A;  2PP4 A;  3EGX A;  1NU7 D;  1VMA A;  3DM9 B;  4M63 A;  1PCX A;  4OIP F;  4O6N A;  3FDQ A;  4HFF B;  2A1D D;  4LLE A;  3WOD F;  2H7B A;  4JZA A;  3T4R A;  4CS9 C;  4AE4 A;  5F5F A;  4C7O A;  4Q5S F;  4PJM A;  3FAJ A;  3SEO A;  3X2Q C;  4J30 B;  3PMR A;  5B1A C;  4C3D A;  2J9W A;  1OKK A;  2V3C C;  3I5Q A;  3DJN B;  3DMD A;  3L34 A;  5KYX B;  3RYL A;  5L3Q A;  3ZG1 A;  3RFY A;  2Q3T A;  1ZHZ A;  3RKO F;  4CS7 A;  2IXM A;  4FES A;  2A6H F;  2VH3 A;  5DS6 A;  1BR4 A;  3EFO B;  3JCU Q;  4FX5 A;  1S7Z A;  1VK5 A;  4XTK A;  4BJ1 A;  3AG1 C;  3B0P A;  2HV6 A;  4ULW A;  3SNH A;  2CGE A;  2XL4 A;  4XLN F;  4YT2 A;  3F46 A;  2EIJ C;  5F5H A;  2MWQ A;  5EHH A;  4YT5 A;  1TR2 A;  1N1C A;  2ZPA A;  3QMK A;  2QY9 A;  1Z23 A;  4O6M A;  3EG9 A;  4OD5 A;  3EZI A;  4CIH A;  1LVK A;  4YT8 A;  2EIL C;  4RDA A;  4IAO A;  4QI2 A;  3EGX B;  3LLK A;  3LJB A;  1LKX A;  4KNV A;  1D0Y A;  2E87 A;  5B3S C;  2IOQ A;  4AE4 B;  4C7O B;  4OD4 A;  3DJU B;  4Q7C A;  3B0U X;  3N24 A;  4BJ6 C;  4E7S A;  2QTV A;  1OCZ C;  3POV A;  3E70 C;  3JRT A;  2ZXP A;  1FFT C;  3ASO C;  3LNR A;  1D0X A;  3DXJ F;  1SF8 A;  3VAY A;  4PK4 A;  4AX2 A;  5DVW A;  4I1O B;  3EHN A;  2R7Q A;  5DQZ A;  1O5H A;  4FWV A;  2WB7 A;  3EQL F;  5CI9 A;  4OIQ F;  1MMN A;  3UNG C;  3NKD A;  1VYK A;  3S28 A;  3E9V A;  1JPJ A;  3KH2 A;  5D91 A;  3EFO A;  3S29 A;  3K1I C;  3DZA A;  3EG9 B;  3PHF 2;  4C3B A;  4ZLD A;  5E2Q A;  4BEJ A;  1FMW A;  4PJJ A;  3K7D A;  1NG1 A;  1ST6 A;  2B0J A;  4YJW A;  2J0W A;  2R7X A;  3KKB A;  4GEH A;  4OIN F;  2W4B A;  1SZI A;  3LS0 A;  4ANJ A;  2R7V A;  2P6V A;  1M2O A;  2BE5 F;  5DS5 A;  4CS8 C;  5KYY A;  3RIP A;  2IXO A;  2W45 A;  3OA1 A;  3UMK A;  3M1C B;  1W2W A;  4G0H A;  4CBE A;  1VOM A;  2KQ9 A;  2J45 A;  4KNW A;  4IJJ A;  3Q6N A;  3B0V C;  5T3T A;  2J7P D;  2C03 A;  3NKE A;  1ZHT A;  4BJ5 C;  5DQT A;  3B9Q A;  4B6I A;  3UMH A;  2PX0 A;  4EBB A;  2KGO A;  2Y3H A;  4JUR I;  1FFH A;  2XRH A;  4RBN A;  3Q7G A;  5BUO A;  3W2V A;  4K0D A;  1J8M F;  5DLJ A;  1ZHW A;  1ZHX A;  4U5D E;  3I5P A;  3VYW A;  4X0R A;  4MQ9 F;  1V55 C;  4U5E E;  1M2V A;  3LEV A;  4LAC B;  2IXP A;  3AQC A;  2KJG A;  4Q4Z F;  5KYU A;  4O79 A;  4J32 B;  1OCC C;  1IW7 F;  3ASN C;  4YT4 A;  3K33 A;  4HFK B;  5E3A A;  2KW3 C;  4CSA C;  4CS8 A;  4DVY P;  4IRU A;  4H4K C;  3HLZ A;  3ECS A;  4DBQ A;  2A6E F;  5KYY B;  1M57 C;  2Y3B A;  4P6I C;  1MMD A;  2Y69 C;  2WZL A;  3UGP A;  4I44 A;  4IWB A;  1MND A;  3ABL C;  3ZVR A;  5KYW B;  4CS9 A;  3ABM C;  3H65 A;  1VYI A;  3EGD A;  3ITF A;  2LSE A;  2FGY A;  1D1A A;  1PD1 A;  3LLI A;  2EIM C;  3F47 A;  2ZXW C;  3NYJ A;  2CDQ A;  1BR1 A;  3W8H A;  2Y3D A;  3CSK A;  2NG1 A;  2Y3G A;  4QDL A;  1Z63 A;  1KU2 A;  3X1O A;  2L81 A;  3EZH A;  2OG2 A;  3NYM A;  3Q7L A;  3LES A;  2JD3 A;  2Q9A A;  1RJ9 B;  2YHS A;  3JT1 A;  3NG1 A;  3TD7 A;  1M2V B;  1SMY F;  4A2N B;  4I3M A;  4MND A;  3ZSU A;  1BR2 A;  2DYS C;  1OCO C;  2G3V A;  5KYU B;  4E7Z A;  5DS4 A;  3K66 A;  1PD0 A;  2WVQ A;  3EJN A;  4LLC A;  4RD9 A;  2HV7 A;  4XLP F;  4PJN A;  3ZC4 A;  3N0T A;  2FFH A;  1Z3I X;  4JJF A;  5E33 A;  2V26 A;  4G7Z F;  4O6Y A;  4G7H F;  4HEA J;  1QZX A;  1Z5Z A;  2R7T A;  3KL4 A;  3JYH A;  2WL8 A;  2KNH A;  4I1M A;  2NUP A;  4DOZ A;  3HJC A;  3EGD B;  1TWG A;  1OCR C;  1TKN A;  4KC9 A;  2ZXR A;  5T3W A;  3CQZ A;  1JPN A;  2J7P A;  3MX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...