2IXNA

Crystal structure of the pp2a phosphatase activator ypa2 ptpa2
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
297
structure length
292
Chain Sequence
b'PEKRLLTPDDMKLWEESPTRAHFTKFIIDLAESVKGHENSQYKEPISESINSMMNLLSQIKDITQKHPVIKRFGKVEFRDFYDEVSRNSRKILRSEFPSLTDEQLEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYSYGIFNLSNDSTNLVLKVFIEYLKIMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKHLKPISIHNNELVEMFAHRYLYFGCIAFINKVKSSASLRWHSPMLDDISGVKTWSKVAEGMIKMYKAEVLSKLPIMQHFYFSEFLPC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN PHOSPHATASE 2A ACTIVATOR 2
publication title Crystal Structure of the Pp2A Phosphatase Activator: Implications for its Pp2A-Specific Ppiase Activity
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 97
structure length 292
sequence length 297
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03095 PTPA Phosphotyrosyl phosphate activator (PTPA) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2ixnA02
2HV6A 2IXOA 2IXNA 2G62A 2HV7A 4NY3A 2IXPA 4LACB 2IXMA
chains in the Genus database with same CATH superfamily
2H7VC 3JT1A 1L3PA 3IQ5A 2Q4FA 3WAQA 1H6GA 4XEVA 4AL1A 3QW0A 2J9UA 4CS8C 4PJLA 4OIOF 4ONSA 2YQYA 2XSEA 4F4BA 1Z3IX 1IZMA 3PCVA 4FX5A 4JC7A 1ZU5A 1AUEA 3T6GB 4JZAA 3U0CA 1GS9A 3ZVRA 1QSPA 3I5QA 1A7VA 4BJTA 1U0BB 5E3AA 1LE4A 3I5PA 3UGOA 3KKBA 5CIVA 1T01A 3ZTMA 4MW8A 3EG9A 3G4ZA 5COFA 1OXKA 1PV3A 5BQHA 5A6AA 2R7XA 4WGYA 4JW1A 2MWQA 3CZ6A 2IM8A 1KTMA 5DS5A 4XPYA 2OG2A 1APCA 1LVKA 2XS8A 3PMRA 1WTYA 4K7BA 2H7OA 5EHHA 4YL0A 2QTVA 1Z7Qc 3X2QC 4IJJA 3C8GB 1FAPB 1LE2A 3H2VA 3K6BA 5KYNA 2YLGA 2ZXRA 4DVZA 2I8BA 3NYLA 2EPOA 3HLZA 5COGA 2Q3TA 3TOMA 1ZU4A 4BPMA 2Q00A 4C3EA 3AG2C 4P9FA 3QTHA 3KPHA 3O55A 1D1BA 2YHSA 2HKVA 3ZIBA 1YARO 5IY5C 1VTMP 2WZLA 1R4TA 4J7YA 4ULVA 1UFBA 4IAOA 4N6HA 1Q0DA 3SNHA 3MLGA 3U2MA 1TKNA 4MVRA 3JRTA 1E2XA 5D91A 5KYWB 2IBFA 1K40A 5T3WA 3W2WA 2J7PA 1YZCA 3PDMP 4MTOA 1V74B 3FHDA 4AX2A 4CIPA 5KYUB 4GEHA 4Q7CA 4BJ6A 3ZDLA 4MS2A 3OA1A 4HEAJ 1ST6A 3U8VA 3WG7C 1OCOC 2AWCA 4DXWA 2ZPAA 1T6IA 2J46A 2OJQA 3NG1A 2YRFA 3H2UA 2R7SA 2HV7A 2W4MA 1BZ4A 1CGOA 1HW2A 4P6IC 1YVIA 5JS5A 2A69F 4XLNF 2J0WA 5L0JA 1NG1A 3EHNA 2PFDA 4PK4A 1MQVA 2AVKA 2XM0A 4JCHA 2ZD9A 4PJMA 5JSLA 4N6CA 4PJNA 3MBGA 3AQBA 1T9KA 2PBEA 4JCZA 5KYWA 3R2PA 2EIMC 2L9JA 2BL2A 3MYFA 1I5NA 2EIJC 3HNJA 1QQ3A 4YT2A 2XLWA 2C03A 5KYUA 1WOLA 3B0UX 4EBJA 1C03A 1MMAA 2MHRA 2G3VA 2P61A 1L7CA 4J32B 3WODF 4BJ6C 3NDBB 3IQCA 1E86A 1OW6A 1NU9C 3TJ6A 2XS1A 4L6RA 3UMKA 3VM6A 3W4YA 3ZSUA 5DS6A 1BDJB 5A6BA 4H4KC 4DRHB 3W8HA 3OEOA 1XZPA 3WHNA 1K05A 2L6FA 4AE4B 4YL1A 2Q9BA 4JTCB 4CS9A 5BQIA 4OIPF 1SMYF 3MX3A 1RKEB 4U5FE 3UMHA 1ZYRF 3AGUA 3JCUQ 2MYSA 3GEEA 1MMDA 3S0XA 1BR4A 4E17A 3UMIA 5F5FA 4MVZA 1D0YA 1WASA 2DGJA 2GAQA 2CDQA 3LEVA 3RYLA 4EKWA 2KQ9A 3EHMA 4W8PA 5JP7A 3VYWA 5A6KA 5F28E 1TFOB 4QI0A 1RKCA 4UDVA 2R7VA 2J8WA 4BG0A 1H7IA 1V54C 2WB7A 3ABLC 3IEEA 2WVNA 2J9WA 3B71A 2FAPB 3IQTA 1OCZC 3N2ZB 3L34A 3GODA 5L0FA 1ORSC 1U89A 2XL6A 2YL0A 3NMKA 3S28A 4CJOA 4FESA 3SEOA 4AK9A 1K04A 2OJED 5E33A 1M2VB 4E0HA 1YZAA 2TMVP 4RD9A 5K0IA 2J7PD 1XWJA 2YZSA 5A6JA 4CS9C 4OIRF 3U3FA 1RKEA 3PHF2 1A7DA 2J45A 1LI7A 5TJ5E 1LM3B 3NRHA 4NC3A 3LNRA 5T3TA 2CW0F 3V5YA 3GORA 3Q7LA 1RJ9B 2PP4A 2J0XA 3DD7A 5JRAA 3FXHA 3O6XA 1HY5A 3KMIA 4U5EE 5B1AC 1RCPA 4ULWA 4DJ9A 1LI5A 2XRHA 2C04A 4YN0B 4OINF 3DE8A 3U8PA 4HFFB 4P9TA 1MNEA 3EPVA 4BJ5A 1G8XA 4KNWA 4EBBA 2CGEA 2YLIA 5JT4A 1NFOA 3AGTA 1T6QA 2LQGA 3Q7GA 1UG7A 1ZW3A 2M64A 3L0IA 3NYJA 1HMDA 2XM4A 3BRJA 4O79A 3L8IA 4CX9A 1M2VA 2LFDA 2IXPA 3FMSA 1HE9A 5COMA 2YKZA 1AEPA 3L8JA 5DQTA 3SXMA 2EPNA 1NU7D 2NUTB 2OU6A 2WZFA 4XPWA 2P7VA 3HNIA 2OKUA 2A1DD 2HMQA 3NKDA 2EPKX 2LD6A 2X0CA 4C3DA 3UGPA 2JPUA 3V5XA 3FOOA 3M4BA 4CDAA 1RJ9A 3F47A 1Q0GA 1WGWA 5A6BD 2IYLD 2LIGA 4PFPA 1C17M 4EWCA 1WN0A 4EIYA 3EGXB 1DOWA 2L81A 2WZGA 3EGDB 3DZAA 3T9OA 2R7TA 3RH3A 1OR3A 2HJ3A 3EQLF 4O6YA 4XWJA 3AQCA 3ZQYA 4BJ5C 4G0HA 3K7DA 2XLOA 2OCCC 3LJBA 1RMVA 2GDCA 2X51A 1E85A 1ORYA 2KSFA 2XLMA 2DB4A 1ZHTA 1TR2A 5JLIA 3POVA 5L3QA 3KYJA 3RVYA 4BJ1A 1HW1A 5L0CA 1QZXA 4GQHA 2BC5A 1FTSA 1OR2A 3TULA 2AP3A 2NUTA 3X1OA 4CS7A 1Q0MA 2QY9A 2OEVA 3KL4A 2UUHA 2R7WA 5CI9A 2YWAA 1OXBA 4RBNA 1JPNA 2PX3A 2HS5A 2JD3A 2VB6A 4N06A 1Z5ZA 4XEKA 5B3IA 2B0JA 3Q6MA 1A41A 2R03A 4JTDB 5FZTA 2IXOA 1BBHA 3C8GA 3N0TA 3US6A 4XLPF 1MNDA 3EGDA 2P0NA 1Z63A 4JTAB 5KYXB 4A2NB 1GM5A 1Z6AA 1QPUA 1H9TA 2G3KA 1QLEC 2LP4A 5EGYA 2QUPA 2R05A 2A6EF 2L7AA 2ETSA 1FNTc 1D0ZA 5L3VA 1V55C 1VYIA 1ZHXA 1KNYA 3DM5A 2CNWA 4XPXA 2A0UA 2O9XA 4JEAA 3ZG1A 5AC5A 3A9CA 2XLDA 4NQFA 3VRCA 1D1CA 3CSKA 2WVOA 2IXNA 1F1MA 2NG1A 1VMAA 1YYJA 5BUOA 2W9YA 4QDLA 4XQ1A 2KJGA 3GEIA 5DQZA 3K1IA 2ZXPA 3C62A 3DM9B 2KYHA 3F46A 4KNVA 4Z9JA 3I4UA 3SXZA 4ZLDA 1WWPA 2YEVA 4O6NA 2E87A 2H7BA 2KGOA 4MNDA 2FGYA 2XL4A 2R7UA 1W2WA 4JKVA 3K33A 4XTKA 4Z9HA 4OD4A 5DVWA 5FCLA 4J7TA 2W4BA 3E70C 4WGZA 1Q0KA 4JEBA 1KU2A 4IB4A 4YJWA 4MW3A 1G4US 2CCYA 2XL8A 4PR9A 3FAPB 4JVSA 1R5ID 4MQ9F 3LESA 1J8MF 1SZIA 2NSFA 2VCAA 2XLEA 3S9OA 4D4XA 4YT4A 2OOCA 2P1AA 1OCRC 4JRZA 3RQGA 2Y3BA 2BE5F 1A0BA 2ICWG 3LAYA 4R32A 3MYIA 1T5OA 4E7SA 3ATPA 3DJUB 3O10A 3AOUA 2J9BA 1NFNA 5DLJA 4Q4ZF 1ZW2A 3C7JA 3K1IC 4LDQA 3T4RA 3CQZA 1LIHA 1VK5A 3DI5A 1FFTC 3QVZA 5F5HA 3RQFA 3HJCA 1VYKA 2HSQA 3ASOC 3GWNA 3JTLO 4YK5A 2QNLA 2FFHA 3VF0A 3U3BA 3LLKA 1A7EA 4LERA 1QVXA 1YDIA 2A68F 4YWQA 4MVMA 2M4EA 1YYXA 4PACA 3VAYA 4AE4A 2YL7A 1SYQA 1E83A 2WL8A 2HZ8A 4XEFA 4IWBA 3HNKA 3C8ZA 2YVKA 3TJ5A 4BEMJ 1PD1A 3SXYA 2VASA 2D5RB 4QI2A 3C8GD 4O6MA 3GEHA 4CJGA 3EZIA 1YA7O 4E0IA 2R7RA 1JMWA 3KH2A 4DOZA 4WJ0A 5AC4A 3B0VC 3S84A 1TWAA 2L6GA 2NUPB 2QLAA 3L1MA 3S27A 4MVSA 5L0HA 3M79A 3RIPA 1S7ZA 4OIQF 4OD5A 2L6HA 1D1AA 2EIKC 2CNWD 2GFHA 2HUJA 5JUAA 3JRMO 2KK1A 4EHPA 1G4WR 2LCHA 2Z15A 2ZXWC 3EFOB 3H65A 3IHUA 3IPMO 4NCQA 1LS4A 1Y4CA 3RF3A 1M56C 2Q7RA 3QMKA 5HSWA 1NSGB 5DS4A 2PNOA 2PF4E 3R7CA 3JZ0A 4YL3A 2AU5A 2OEXA 3AJMA 3CAXA 3JYYA 4MTFA 4ANJA 3QVYA 1E84A 4NTAA 4LLEA 2RD9A 4CDYA 3RW0A 3HTKC 4MTGA 4BEJA 2XXAB 4E7ZA 3DAFA 1HMOA 1ORJA 3RKOF 4D4NA 1O3UA 1O5HA 3OWTA 2V26A 1OKKA 4NTFA 4C3BA 4JE9A 5JVEA 4NTBA 2Y39A 3SP1A 2Y3HA 1EI7A 2A0BA 2OQMA 2NUPA 4N4WA 2NPUA 2DYRC 3DXJF 4KBLA 5L0GA 1NLXA 1N1CA 1I4YA 3HKKA 1M57C 4JURI 1NZEA 3ABMC 3EFOA 4K0DA 5T1DB 3M4CA 4HFKB 2V3CC 1QKRA 2P6VA 3V7OA 3JSEO 2WVQA 5E3CA 4LDKA 1GQAA 4U5DE 4U5CE 3HNLA 3T6JA 1U6HA 1C02A 4U5GA 2HFIA 1FMVA 5CI8A 3A11A 4JJGA 3KYIA 4Q5SF 1XZQA 4HE8D 1SF8A 1JPJA 3NYMA 3K1HA 4G78A 4Z9IA 5BQGA 2XXAA 1YA9A 4GYTA 3LEOA 1Y6DA 1YJGA 4G7HF 4FAPB 3LUTB 1GGQA 4B6IA 4CBEA 1JOGA 1I4ZA 5AGFA 4C7OB 1MMGA 256BA 3UR3C 3EGXA 1T6UA 4WABA 5L0DA 2R25A 2B0HA 1J8YF 1YLMA 3DMDA 3SXKA 4K1OA 2DYSC 2VC9A 1AVOB 1TWHA 3IQ6A 4MVUA 4MVOA 1ZHYA 2H8AA 1BR1A 3FOPA 4W8KA 3ZC4A 4A4AA 4YT8A 3EH1A 4EBKA 3ASNC 1EQ1A 1PCXA 3JYHA 3ZWIA 4PFOA 4LDRA 3TQOA 3LNMB 3GWLA 4I44A 1JR8A 5KYYB 3T6BA 3S29A 2EINC 1Z23A 1CPRA 3EJNA 2YL3A 4I1OB 1BR2A 3K66A 3LS0A 3TOLA 2YL1A 1RXQA 5B3SC 3ZQVA 3QZCA 1VB5A 2PX0A 1IW7F 2I15A 4IAQA 1NBBA 4KI2A 3UNGC 1TFKB 2XLVA 5D92A 4G7ZF 2EPMX 2DI3A 4ER9A 4C7OA 1VLSA 4NY3A 2D4UA 1TWGA 4M63A 4LACB 3ECSA 4DBRA 5KYXA 5E2QA 3ZTZA 4IRUA 3B0PA 3BEHA 2G62A 3C63A 3G4XA 2J9VA 1JRAA 1TQGA 4U9DA 1CGME 4AL0A 1FR0A 1ZZPA 3FAJA 1FFHA 4H54A 1OW7A 5EK0A 2RSEB 4E18A 2ASRA 2CYDA 3N24A 2HSBA 2IOQA 3MFNA 3W8IA 1SR2A 1OKKD 2Y3DA 5KYYA 3DAGA 1H9GA 3ABKC 2HMZA 3DJNB 3GM3A 3GM2A 3S90A 2F22A 1M2OA 3AG1C 1G5ZA 1VLTA 2LK4A 3SYNA 3RVZA 3U9MA 3G50A 4FWVA 3U9JA 3GM1A 4G7OF 1O87A 1WATA 2JX0A 2W45A 2HJMA 3DE9A 4CSAA 1FMWA 4DVYP 4DBQA 1OQCA 4DRIB 2GA0A 3C18A 4DRJB 2R02A 1M6TA 5GPGB 3TD7A 3EH2A 2VCBA 1OW8A 2A6HF 3NKEA 4EUKB 1CPQA 1MMNA 2QE9A 1LS1A 4RDAA 3RFYA 3TK0A 3E9VA 4YT5A 3U2LA 4CDVA 1Q0FA 1DOVA 4O7GA 4KC9A 1ZHWA 4LLCA 4I1MA 4JIOA 4IGGA 1D0XA 4JJFA 3B9QA 2LSEA 1ZHZA 4CS8A 1EA8A 1CGNA 2EILC 3O39A 2KC3A 3J06A 2UUIA 2YLDA 3AG4C 1VOMA 3SZRA 2R7OA 4J30B 4IARA 2LFFA 3Q6NA 2Y3GA 3CEXA 2KW3C 2VH3A 1ZVZA 2VCCA 1YAUO 3DKAA 1HE1A 5HV9A 3JSZA 1S05A 3QW1A 4ZLCA 5B1BC 3NMIA 5L0IA 1TWCA 2IXMA 1OCCC 1LKXA 2Q9AA 2Y69C 2KNHA 4U5BE 3FDQA 3LLIA 4CSAC 4U5HA 3EG9B 3M1CB 1V4AA 3U5SA 3V5ZA 1PD0A 2XLHA 1LPEA 3LS1A 3FVYA 2R7QA 2Q9CA 4PJJA 4U9EA 4CIHA 2NSGA 2AWYA 2HV6A 1B68A 1JAFA 2ZXOA 3ITFA 4I3MA 2EPLX 3DWWA 5A69A 3AG3C 3GANA 3M15A 3NMJA 3RQEA 3EZHA 1EKYA 4MVQA 2GWWA 3B29A 2R9RB 4X0RA 3W2VA
chains in the Genus database with same CATH topology
2H7VC 3JT1A 2J9UA 4CS8C 4PJLA 4OIOF 2XSEA 4F4BA 1Z3IX 1IZMA 4FX5A 1ZU5A 4JZAA 3ZVRA 3I5QA 4BJTA 5E3AA 3I5PA 3UGOA 3KKBA 3EG9A 2R7XA 4JW1A 2MWQA 3CZ6A 5DS5A 2OG2A 1LVKA 3PMRA 4K7BA 2H7OA 5EHHA 2QTVA 3X2QC 4IJJA 3K6BA 5KYNA 2ZXRA 4DVZA 2I8BA 3NYLA 3HLZA 2Q3TA 1ZU4A 4C3EA 3AG2C 1D1BA 2YHSA 3ZIBA 5IY5C 2WZLA 3SNHA 4IAOA 3MLGA 5KYWB 1TKNA 3JRTA 5D91A 5T3WA 3W2WA 2J7PA 3FHDA 4AX2A 5KYUB 4GEHA 4Q7CA 4BJ6A 3OA1A 4HEAJ 1ST6A 3WG7C 1OCOC 2ZPAA 2J46A 3NG1A 2R7SA 2HV7A 2W4MA 4P6IC 2A69F 4XLNF 2J0WA 1NG1A 3EHNA 2PFDA 4PK4A 4JCHA 4PJMA 4PJNA 3AQBA 5KYWA 2EIMC 2L9JA 2EIJC 4YT2A 2C03A 5KYUA 3B0UX 4J32B 1MMAA 3WODF 2G3VA 4BJ6C 3NDBB 1NU9C 3UMKA 3ZSUA 5DS6A 4H4KC 3W8HA 3OEOA 4AE4B 2Q9BA 4CS9A 4OIPF 3MX3A 1SMYF 4U5FE 3UMHA 1ZYRF 3JCUQ 2MYSA 3S0XA 1MMDA 1BR4A 3UMIA 5F5FA 1D0YA 2DGJA 3LEVA 2CDQA 3RYLA 2KQ9A 3EHMA 3VYWA 4QI0A 2R7VA 4BG0A 1V54C 2WB7A 3ABLC 3IEEA 2WVNA 2J9WA 3N2ZB 1OCZC 3L34A 3GODA 3S28A 4FESA 3SEOA 4AK9A 5E33A 1M2VB 4RD9A 2J7PD 2YZSA 4CS9C 4OIRF 3PHF2 2J45A 3NRHA 3LNRA 5T3TA 2CW0F 3Q7LA 1RJ9B 2PP4A 2J0XA 3DD7A 3O6XA 5B1AC 3KMIA 4U5EE 4ULWA 2XRHA 2C04A 4YN0B 4OINF 4HFFB 1MNEA 3EPVA 4BJ5A 1G8XA 4KNWA 4EBBA 2CGEA 3Q7GA 3L0IA 3NYJA 4O79A 1M2VA 2IXPA 5DQTA 1NU7D 2NUTB 2WZFA 5FCLA 2P7VA 2A1DD 3NKDA 4C3DA 3UGPA 1RJ9A 3F47A 1WGWA 2IYLD 4PFPA 4EWCA 3EGXB 2L81A 2WZGA 3EGDB 3DZAA 2R7TA 3RH3A 3EQLF 4XWJA 4O6YA 4BJ5C 3AQCA 4G0HA 3K7DA 2OCCC 3LJBA 2X51A 1ZHTA 1TR2A 3POVA 5L3QA 4BJ1A 1QZXA 1FTSA 3X1OA 2NUTA 4CS7A 2QY9A 3KL4A 2R7WA 5CI9A 4RBNA 1JPNA 2PX3A 2JD3A 2VB6A 4N06A 1Z5ZA 2B0JA 3Q6MA 2IXOA 3N0TA 4XLPF 1MNDA 3EGDA 1Z63A 5KYXB 4A2NB 1Z6AA 2G3KA 1QLEC 5EGYA 2A6EF 1D0ZA 5L3VA 1V55C 1VYIA 1ZHXA 3DM5A 2CNWA 3ZG1A 2O9XA 1D1CA 3CSKA 2WVOA 2IXNA 2NG1A 1VMAA 5BUOA 2W9YA 4QDLA 2KJGA 5DQZA 2ZXPA 3DM9B 3F46A 4KNVA 3I4UA 4ZLDA 2YEVA 4O6NA 2E87A 2H7BA 2KGOA 4MNDA 2FGYA 2XL4A 2R7UA 1W2WA 3K33A 4XTKA 4OD4A 5DVWA 2W4BA 3E70C 1KU2A 4YJWA 4JVSA 4MQ9F 3LESA 1J8MF 1SZIA 4YT4A 1OCRC 2Y3BA 2BE5F 3LAYA 4E7SA 3DJUB 5DLJA 4Q4ZF 3K1IC 3T4RA 3CQZA 1VK5A 5F5HA 1FFTC 3HJCA 1VYKA 3ASOC 2FFHA 3LLKA 4LERA 2A68F 4YWQA 2M4EA 4AE4A 3VAYA 2WL8A 4IWBA 1PD1A 2VASA 2D5RB 4QI2A 4O6MA 3EZIA 2R7RA 4DOZA 3KH2A 4WJ0A 3B0VC 1TWAA 2NUPB 3S27A 3RIPA 1S7ZA 4OIQF 4OD5A 1D1AA 2EIKC 2CNWD 2GFHA 2Z15A 2ZXWC 3EFOB 3H65A 1M56C 3QMKA 5HSWA 5DS4A 2PF4E 4ANJA 4LLEA 4BEJA 3HTKC 2XXAB 4E7ZA 3DAFA 3RKOF 1O5HA 3OWTA 2V26A 1OKKA 4C3BA 2Y39A 3SP1A 2Y3HA 2NUPA 2DYRC 3DXJF 4KBLA 1N1CA 1M57C 4JURI 1NZEA 3EFOA 3ABMC 4K0DA 5T1DB 4HFKB 2V3CC 2P6VA 3V7OA 2WVQA 5E3CA 4U5DE 4U5CE 3T6JA 4U5GA 1FMVA 5CI8A 4JJGA 4Q5SF 4HE8D 1SF8A 1JPJA 3NYMA 3K1HA 2XXAA 4GYTA 4G7HF 4B6IA 4CBEA 4C7OB 1MMGA 3UR3C 3EGXA 1J8YF 3DMDA 2DYSC 1TWHA 4W8KA 1ZHYA 1BR1A 3ZC4A 4YT8A 3EH1A 3ASNC 1PCXA 3JYHA 4PFOA 4I44A 5KYYB 3T6BA 3S29A 2EINC 1Z23A 3EJNA 4I1OB 1BR2A 3K66A 3LS0A 5B3SC 3QZCA 2PX0A 1IW7F 4KI2A 3UNGC 4G7ZF 5D92A 4C7OA 4NY3A 1TWGA 4M63A 4LACB 3ECSA 4DBRA 5KYXA 5E2QA 4IRUA 3B0PA 2G62A 2J9VA 3FAJA 1FFHA 3N24A 2IOQA 3W8IA 1OKKD 2Y3DA 5KYYA 3DAGA 3ABKC 3DJNB 1M2OA 3SYNA 4FWVA 4G7OF 1O87A 2W45A 4CSAA 1FMWA 4DVYP 4DBQA 3TD7A 3EH2A 2A6HF 3NKEA 1MMNA 4RDAA 1LS1A 3RFYA 3E9VA 4YT5A 4O7GA 4KC9A 1ZHWA 4LLCA 4I1MA 1D0XA 4JJFA 3B9QA 2LSEA 1ZHZA 4CS8A 2EILC 3O39A 3AG4C 1VOMA 3SZRA 2R7OA 4J30B 3Q6NA 2Y3GA 2KW3C 2VH3A 3JSZA 4ZLCA 5B1BC 1TWCA 2IXMA 1OCCC 1LKXA 2Q9AA 2Y69C 2KNHA 4U5BE 3FDQA 3LLIA 4CSAC 4U5HA 3EG9B 3M1CB 1PD0A 3LS1A 3FVYA 2R7QA 2Q9CA 4PJJA 4CIHA 2HV6A 3ITFA 2ZXOA 4I3MA 3AG3C 3GANA 3EZHA 3AG1C 4X0RA 3W2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HV6 A;  2IXO A;  2IXN A;  2G62 A;  2HV7 A;  4NY3 A;  2IXP A;  4LAC B;  2IXM A; 
#chains in the Genus database with same CATH topology
 2H7V C;  3JT1 A;  1L3P A;  3IQ5 A;  2Q4F A;  3WAQ A;  1H6G A;  4XEV A;  4AL1 A;  3QW0 A;  2J9U A;  4CS8 C;  4PJL A;  4OIO F;  4ONS A;  2YQY A;  2XSE A;  4F4B A;  1Z3I X;  1IZM A;  3PCV A;  4FX5 A;  4JC7 A;  1ZU5 A;  1AUE A;  3T6G B;  4JZA A;  3U0C A;  1GS9 A;  3ZVR A;  1QSP A;  3I5Q A;  1A7V A;  4BJT A;  1U0B B;  5E3A A;  1LE4 A;  3I5P A;  3UGO A;  3KKB A;  5CIV A;  1T01 A;  3ZTM A;  4MW8 A;  3EG9 A;  3G4Z A;  5COF A;  1OXK A;  1PV3 A;  5BQH A;  5A6A A;  2R7X A;  4WGY A;  4JW1 A;  2MWQ A;  3CZ6 A;  2IM8 A;  1KTM A;  5DS5 A;  4XPY A;  2OG2 A;  1APC A;  1LVK A;  2XS8 A;  3PMR A;  1WTY A;  4K7B A;  2H7O A;  5EHH A;  4YL0 A;  2QTV A;  1Z7Q c;  3X2Q C;  4IJJ A;  3C8G B;  1FAP B;  1LE2 A;  3H2V A;  3K6B A;  5KYN A;  2YLG A;  2ZXR A;  4DVZ A;  2I8B A;  3NYL A;  2EPO A;  3HLZ A;  5COG A;  2Q3T A;  3TOM A;  1ZU4 A;  4BPM A;  2Q00 A;  4C3E A;  3AG2 C;  4P9F A;  3QTH A;  3KPH A;  3O55 A;  1D1B A;  2YHS A;  2HKV A;  3ZIB A;  1YAR O;  5IY5 C;  1VTM P;  2WZL A;  1R4T A;  4J7Y A;  4ULV A;  1UFB A;  4IAO A;  4N6H A;  1Q0D A;  3SNH A;  3MLG A;  3U2M A;  1TKN A;  4MVR A;  3JRT A;  1E2X A;  5D91 A;  5KYW B;  2IBF A;  1K40 A;  5T3W A;  3W2W A;  2J7P A;  1YZC A;  3PDM P;  4MTO A;  1V74 B;  3FHD A;  4AX2 A;  4CIP A;  5KYU B;  4GEH A;  4Q7C A;  4BJ6 A;  3ZDL A;  4MS2 A;  3OA1 A;  4HEA J;  1ST6 A;  3U8V A;  3WG7 C;  1OCO C;  2AWC A;  4DXW A;  2ZPA A;  1T6I A;  2J46 A;  2OJQ A;  3NG1 A;  2YRF A;  3H2U A;  2R7S A;  2HV7 A;  2W4M A;  1BZ4 A;  1CGO A;  1HW2 A;  4P6I C;  1YVI A;  5JS5 A;  2A69 F;  4XLN F;  2J0W A;  5L0J A;  1NG1 A;  3EHN A;  2PFD A;  4PK4 A;  1MQV A;  2AVK A;  2XM0 A;  4JCH A;  2ZD9 A;  4PJM A;  5JSL A;  4N6C A;  4PJN A;  3MBG A;  3AQB A;  1T9K A;  2PBE A;  4JCZ A;  5KYW A;  3R2P A;  2EIM C;  2L9J A;  2BL2 A;  3MYF A;  1I5N A;  2EIJ C;  3HNJ A;  1QQ3 A;  4YT2 A;  2XLW A;  2C03 A;  5KYU A;  1WOL A;  3B0U X;  4EBJ A;  1C03 A;  1MMA A;  2MHR A;  2G3V A;  2P61 A;  1L7C A;  4J32 B;  3WOD F;  4BJ6 C;  3NDB B;  3IQC A;  1E86 A;  1OW6 A;  1NU9 C;  3TJ6 A;  2XS1 A;  4L6R A;  3UMK A;  3VM6 A;  3W4Y A;  3ZSU A;  5DS6 A;  1BDJ B;  5A6B A;  4H4K C;  4DRH B;  3W8H A;  3OEO A;  1XZP A;  3WHN A;  1K05 A;  2L6F A;  4AE4 B;  4YL1 A;  2Q9B A;  4JTC B;  4CS9 A;  5BQI A;  4OIP F;  1SMY F;  3MX3 A;  1RKE B;  4U5F E;  3UMH A;  1ZYR F;  3AGU A;  3JCU Q;  2MYS A;  3GEE A;  1MMD A;  3S0X A;  1BR4 A;  4E17 A;  3UMI A;  5F5F A;  4MVZ A;  1D0Y A;  1WAS A;  2DGJ A;  2GAQ A;  2CDQ A;  3LEV A;  3RYL A;  4EKW A;  2KQ9 A;  3EHM A;  4W8P A;  5JP7 A;  3VYW A;  5A6K A;  5F28 E;  1TFO B;  4QI0 A;  1RKC A;  4UDV A;  2R7V A;  2J8W A;  4BG0 A;  1H7I A;  1V54 C;  2WB7 A;  3ABL C;  3IEE A;  2WVN A;  2J9W A;  3B71 A;  2FAP B;  3IQT A;  1OCZ C;  3N2Z B;  3L34 A;  3GOD A;  5L0F A;  1ORS C;  1U89 A;  2XL6 A;  2YL0 A;  3NMK A;  3S28 A;  4CJO A;  4FES A;  3SEO A;  4AK9 A;  1K04 A;  2OJE D;  5E33 A;  1M2V B;  4E0H A;  1YZA A;  2TMV P;  4RD9 A;  5K0I A;  2J7P D;  1XWJ A;  2YZS A;  5A6J A;  4CS9 C;  4OIR F;  3U3F A;  1RKE A;  3PHF 2;  1A7D A;  2J45 A;  1LI7 A;  5TJ5 E;  1LM3 B;  3NRH A;  4NC3 A;  3LNR A;  5T3T A;  2CW0 F;  3V5Y A;  3GOR A;  3Q7L A;  1RJ9 B;  2PP4 A;  2J0X A;  3DD7 A;  5JRA A;  3FXH A;  3O6X A;  1HY5 A;  3KMI A;  4U5E E;  5B1A C;  1RCP A;  4ULW A;  4DJ9 A;  1LI5 A;  2XRH A;  2C04 A;  4YN0 B;  4OIN F;  3DE8 A;  3U8P A;  4HFF B;  4P9T A;  1MNE A;  3EPV A;  4BJ5 A;  1G8X A;  4KNW A;  4EBB A;  2CGE A;  2YLI A;  5JT4 A;  1NFO A;  3AGT A;  1T6Q A;  2LQG A;  3Q7G A;  1UG7 A;  1ZW3 A;  2M64 A;  3L0I A;  3NYJ A;  1HMD A;  2XM4 A;  3BRJ A;  4O79 A;  3L8I A;  4CX9 A;  1M2V A;  2LFD A;  2IXP A;  3FMS A;  1HE9 A;  5COM A;  2YKZ A;  1AEP A;  3L8J A;  5DQT A;  3SXM A;  2EPN A;  1NU7 D;  2NUT B;  2OU6 A;  2WZF A;  4XPW A;  2P7V A;  3HNI A;  2OKU A;  2A1D D;  2HMQ A;  3NKD A;  2EPK X;  2LD6 A;  2X0C A;  4C3D A;  3UGP A;  2JPU A;  3V5X A;  3FOO A;  3M4B A;  4CDA A;  1RJ9 A;  3F47 A;  1Q0G A;  1WGW A;  5A6B D;  2IYL D;  2LIG A;  4PFP A;  1C17 M;  4EWC A;  1WN0 A;  4EIY A;  3EGX B;  1DOW A;  2L81 A;  2WZG A;  3EGD B;  3DZA A;  3T9O A;  2R7T A;  3RH3 A;  1OR3 A;  2HJ3 A;  3EQL F;  4O6Y A;  4XWJ A;  3AQC A;  3ZQY A;  4BJ5 C;  4G0H A;  3K7D A;  2XLO A;  2OCC C;  3LJB A;  1RMV A;  2GDC A;  2X51 A;  1E85 A;  1ORY A;  2KSF A;  2XLM A;  2DB4 A;  1ZHT A;  1TR2 A;  5JLI A;  3POV A;  5L3Q A;  3KYJ A;  3RVY A;  4BJ1 A;  1HW1 A;  5L0C A;  1QZX A;  4GQH A;  2BC5 A;  1FTS A;  1OR2 A;  3TUL A;  2AP3 A;  2NUT A;  3X1O A;  4CS7 A;  1Q0M A;  2QY9 A;  2OEV A;  3KL4 A;  2UUH A;  2R7W A;  5CI9 A;  2YWA A;  1OXB A;  4RBN A;  1JPN A;  2PX3 A;  2HS5 A;  2JD3 A;  2VB6 A;  4N06 A;  1Z5Z A;  4XEK A;  5B3I A;  2B0J A;  3Q6M A;  1A41 A;  2R03 A;  4JTD B;  5FZT A;  2IXO A;  1BBH A;  3C8G A;  3N0T A;  3US6 A;  4XLP F;  1MND A;  3EGD A;  2P0N A;  1Z63 A;  4JTA B;  5KYX B;  4A2N B;  1GM5 A;  1Z6A A;  1QPU A;  1H9T A;  2G3K A;  1QLE C;  2LP4 A;  5EGY A;  2QUP A;  2R05 A;  2A6E F;  2L7A A;  2ETS A;  1FNT c;  1D0Z A;  5L3V A;  1V55 C;  1VYI A;  1ZHX A;  1KNY A;  3DM5 A;  2CNW A;  4XPX A;  2A0U A;  2O9X A;  4JEA A;  3ZG1 A;  5AC5 A;  3A9C A;  2XLD A;  4NQF A;  3VRC A;  1D1C A;  3CSK A;  2WVO A;  2IXN A;  1F1M A;  2NG1 A;  1VMA A;  1YYJ A;  5BUO A;  2W9Y A;  4QDL A;  4XQ1 A;  2KJG A;  3GEI A;  5DQZ A;  3K1I A;  2ZXP A;  3C62 A;  3DM9 B;  2KYH A;  3F46 A;  4KNV A;  4Z9J A;  3I4U A;  3SXZ A;  4ZLD A;  1WWP A;  2YEV A;  4O6N A;  2E87 A;  2H7B A;  2KGO A;  4MND A;  2FGY A;  2XL4 A;  2R7U A;  1W2W A;  4JKV A;  3K33 A;  4XTK A;  4Z9H A;  4OD4 A;  5DVW A;  5FCL A;  4J7T A;  2W4B A;  3E70 C;  4WGZ A;  1Q0K A;  4JEB A;  1KU2 A;  4IB4 A;  4YJW A;  4MW3 A;  1G4U S;  2CCY A;  2XL8 A;  4PR9 A;  3FAP B;  4JVS A;  1R5I D;  4MQ9 F;  3LES A;  1J8M F;  1SZI A;  2NSF A;  2VCA A;  2XLE A;  3S9O A;  4D4X A;  4YT4 A;  2OOC A;  2P1A A;  1OCR C;  4JRZ A;  3RQG A;  2Y3B A;  2BE5 F;  1A0B A;  2ICW G;  3LAY A;  4R32 A;  3MYI A;  1T5O A;  4E7S A;  3ATP A;  3DJU B;  3O10 A;  3AOU A;  2J9B A;  1NFN A;  5DLJ A;  4Q4Z F;  1ZW2 A;  3C7J A;  3K1I C;  4LDQ A;  3T4R A;  3CQZ A;  1LIH A;  1VK5 A;  3DI5 A;  1FFT C;  3QVZ A;  5F5H A;  3RQF A;  3HJC A;  1VYK A;  2HSQ A;  3ASO C;  3GWN A;  3JTL O;  4YK5 A;  2QNL A;  2FFH A;  3VF0 A;  3U3B A;  3LLK A;  1A7E A;  4LER A;  1QVX A;  1YDI A;  2A68 F;  4YWQ A;  4MVM A;  2M4E A;  1YYX A;  4PAC A;  3VAY A;  4AE4 A;  2YL7 A;  1SYQ A;  1E83 A;  2WL8 A;  2HZ8 A;  4XEF A;  4IWB A;  3HNK A;  3C8Z A;  2YVK A;  3TJ5 A;  4BEM J;  1PD1 A;  3SXY A;  2VAS A;  2D5R B;  4QI2 A;  3C8G D;  4O6M A;  3GEH A;  4CJG A;  3EZI A;  1YA7 O;  4E0I A;  2R7R A;  1JMW A;  3KH2 A;  4DOZ A;  4WJ0 A;  5AC4 A;  3B0V C;  3S84 A;  1TWA A;  2L6G A;  2NUP B;  2QLA A;  3L1M A;  3S27 A;  4MVS A;  5L0H A;  3M79 A;  3RIP A;  1S7Z A;  4OIQ F;  4OD5 A;  2L6H A;  1D1A A;  2EIK C;  2CNW D;  2GFH A;  2HUJ A;  5JUA A;  3JRM O;  2KK1 A;  4EHP A;  1G4W R;  2LCH A;  2Z15 A;  2ZXW C;  3EFO B;  3H65 A;  3IHU A;  3IPM O;  4NCQ A;  1LS4 A;  1Y4C A;  3RF3 A;  1M56 C;  2Q7R A;  3QMK A;  5HSW A;  1NSG B;  5DS4 A;  2PNO A;  2PF4 E;  3R7C A;  3JZ0 A;  4YL3 A;  2AU5 A;  2OEX A;  3AJM A;  3CAX A;  3JYY A;  4MTF A;  4ANJ A;  3QVY A;  1E84 A;  4NTA A;  4LLE A;  2RD9 A;  4CDY A;  3RW0 A;  3HTK C;  4MTG A;  4BEJ A;  2XXA B;  4E7Z A;  3DAF A;  1HMO A;  1ORJ A;  3RKO F;  4D4N A;  1O3U A;  1O5H A;  3OWT A;  2V26 A;  1OKK A;  4NTF A;  4C3B A;  4JE9 A;  5JVE A;  4NTB A;  2Y39 A;  3SP1 A;  2Y3H A;  1EI7 A;  2A0B A;  2OQM A;  2NUP A;  4N4W A;  2NPU A;  2DYR C;  3DXJ F;  4KBL A;  5L0G A;  1NLX A;  1N1C A;  1I4Y A;  3HKK A;  1M57 C;  4JUR I;  1NZE A;  3ABM C;  3EFO A;  4K0D A;  5T1D B;  3M4C A;  4HFK B;  2V3C C;  1QKR A;  2P6V A;  3V7O A;  3JSE O;  2WVQ A;  5E3C A;  4LDK A;  1GQA A;  4U5D E;  4U5C E;  3HNL A;  3T6J A;  1U6H A;  1C02 A;  4U5G A;  2HFI A;  1FMV A;  5CI8 A;  3A11 A;  4JJG A;  3KYI A;  4Q5S F;  1XZQ A;  4HE8 D;  1SF8 A;  1JPJ A;  3NYM A;  3K1H A;  4G78 A;  4Z9I A;  5BQG A;  2XXA A;  1YA9 A;  4GYT A;  3LEO A;  1Y6D A;  1YJG A;  4G7H F;  4FAP B;  3LUT B;  1GGQ A;  4B6I A;  4CBE A;  1JOG A;  1I4Z A;  5AGF A;  4C7O B;  1MMG A;  256B A;  3UR3 C;  3EGX A;  1T6U A;  4WAB A;  5L0D A;  2R25 A;  2B0H A;  1J8Y F;  1YLM A;  3DMD A;  3SXK A;  4K1O A;  2DYS C;  2VC9 A;  1AVO B;  1TWH A;  3IQ6 A;  4MVU A;  4MVO A;  1ZHY A;  2H8A A;  1BR1 A;  3FOP A;  4W8K A;  3ZC4 A;  4A4A A;  4YT8 A;  3EH1 A;  4EBK A;  3ASN C;  1EQ1 A;  1PCX A;  3JYH A;  3ZWI A;  4PFO A;  4LDR A;  3TQO A;  3LNM B;  3GWL A;  4I44 A;  1JR8 A;  5KYY B;  3T6B A;  3S29 A;  2EIN C;  1Z23 A;  1CPR A;  3EJN A;  2YL3 A;  4I1O B;  1BR2 A;  3K66 A;  3LS0 A;  3TOL A;  2YL1 A;  1RXQ A;  5B3S C;  3ZQV A;  3QZC A;  1VB5 A;  2PX0 A;  1IW7 F;  2I15 A;  4IAQ A;  1NBB A;  4KI2 A;  3UNG C;  1TFK B;  2XLV A;  5D92 A;  4G7Z F;  2EPM X;  2DI3 A;  4ER9 A;  4C7O A;  1VLS A;  4NY3 A;  2D4U A;  1TWG A;  4M63 A;  4LAC B;  3ECS A;  4DBR A;  5KYX A;  5E2Q A;  3ZTZ A;  4IRU A;  3B0P A;  3BEH A;  2G62 A;  3C63 A;  3G4X A;  2J9V A;  1JRA A;  1TQG A;  4U9D A;  1CGM E;  4AL0 A;  1FR0 A;  1ZZP A;  3FAJ A;  1FFH A;  4H54 A;  1OW7 A;  5EK0 A;  2RSE B;  4E18 A;  2ASR A;  2CYD A;  3N24 A;  2HSB A;  2IOQ A;  3MFN A;  3W8I A;  1SR2 A;  1OKK D;  2Y3D A;  5KYY A;  3DAG A;  1H9G A;  3ABK C;  2HMZ A;  3DJN B;  3GM3 A;  3GM2 A;  3S90 A;  2F22 A;  1M2O A;  3AG1 C;  1G5Z A;  1VLT A;  2LK4 A;  3SYN A;  3RVZ A;  3U9M A;  3G50 A;  4FWV A;  3U9J A;  3GM1 A;  4G7O F;  1O87 A;  1WAT A;  2JX0 A;  2W45 A;  2HJM A;  3DE9 A;  4CSA A;  1FMW A;  4DVY P;  4DBQ A;  1OQC A;  4DRI B;  2GA0 A;  3C18 A;  4DRJ B;  2R02 A;  1M6T A;  5GPG B;  3TD7 A;  3EH2 A;  2VCB A;  1OW8 A;  2A6H F;  3NKE A;  4EUK B;  1CPQ A;  1MMN A;  2QE9 A;  1LS1 A;  4RDA A;  3RFY A;  3TK0 A;  3E9V A;  4YT5 A;  3U2L A;  4CDV A;  1Q0F A;  1DOV A;  4O7G A;  4KC9 A;  1ZHW A;  4LLC A;  4I1M A;  4JIO A;  4IGG A;  1D0X A;  4JJF A;  3B9Q A;  2LSE A;  1ZHZ A;  4CS8 A;  1EA8 A;  1CGN A;  2EIL C;  3O39 A;  2KC3 A;  3J06 A;  2UUI A;  2YLD A;  3AG4 C;  1VOM A;  3SZR A;  2R7O A;  4J30 B;  4IAR A;  2LFF A;  3Q6N A;  2Y3G A;  3CEX A;  2KW3 C;  2VH3 A;  1ZVZ A;  2VCC A;  1YAU O;  3DKA A;  1HE1 A;  5HV9 A;  3JSZ A;  1S05 A;  3QW1 A;  4ZLC A;  5B1B C;  3NMI A;  5L0I A;  1TWC A;  2IXM A;  1OCC C;  1LKX A;  2Q9A A;  2Y69 C;  2KNH A;  4U5B E;  3FDQ A;  3LLI A;  4CSA C;  4U5H A;  3EG9 B;  3M1C B;  1V4A A;  3U5S A;  3V5Z A;  1PD0 A;  2XLH A;  1LPE A;  3LS1 A;  3FVY A;  2R7Q A;  2Q9C A;  4PJJ A;  4U9E A;  4CIH A;  2NSG A;  2AWY A;  2HV6 A;  1B68 A;  1JAF A;  2ZXO A;  3ITF A;  4I3M A;  2EPL X;  3DWW A;  5A69 A;  3AG3 C;  3GAN A;  3M15 A;  3NMJ A;  3RQE A;  3EZH A;  1EKY A;  4MVQ A;  2GWW A;  3B29 A;  2R9R B;  4X0R A;  3W2V A; 
#chains in the Genus database with same CATH homology
 2H7V C;  3JT1 A;  2J9U A;  4CS8 C;  4PJL A;  4OIO F;  2XSE A;  4F4B A;  1Z3I X;  1IZM A;  4FX5 A;  1ZU5 A;  4JZA A;  3ZVR A;  3I5Q A;  4BJT A;  5E3A A;  3I5P A;  3UGO A;  3KKB A;  3EG9 A;  2R7X A;  4JW1 A;  2MWQ A;  3CZ6 A;  5DS5 A;  2OG2 A;  1LVK A;  3PMR A;  4K7B A;  2H7O A;  5EHH A;  2QTV A;  3X2Q C;  4IJJ A;  3K6B A;  5KYN A;  2ZXR A;  4DVZ A;  2I8B A;  3NYL A;  3HLZ A;  2Q3T A;  1ZU4 A;  4C3E A;  3AG2 C;  1D1B A;  2YHS A;  3ZIB A;  5IY5 C;  2WZL A;  3SNH A;  4IAO A;  3MLG A;  5KYW B;  1TKN A;  3JRT A;  5D91 A;  5T3W A;  3W2W A;  2J7P A;  3FHD A;  4AX2 A;  5KYU B;  4GEH A;  4Q7C A;  4BJ6 A;  3OA1 A;  4HEA J;  1ST6 A;  3WG7 C;  1OCO C;  2ZPA A;  2J46 A;  3NG1 A;  2R7S A;  2HV7 A;  2W4M A;  4P6I C;  2A69 F;  4XLN F;  2J0W A;  1NG1 A;  3EHN A;  2PFD A;  4PK4 A;  4JCH A;  4PJM A;  4PJN A;  3AQB A;  5KYW A;  2EIM C;  2L9J A;  2EIJ C;  4YT2 A;  2C03 A;  5KYU A;  3B0U X;  4J32 B;  1MMA A;  3WOD F;  2G3V A;  4BJ6 C;  3NDB B;  1NU9 C;  3UMK A;  3ZSU A;  5DS6 A;  4H4K C;  3W8H A;  3OEO A;  4AE4 B;  2Q9B A;  4CS9 A;  4OIP F;  3MX3 A;  1SMY F;  4U5F E;  3UMH A;  1ZYR F;  3JCU Q;  2MYS A;  3S0X A;  1MMD A;  1BR4 A;  3UMI A;  5F5F A;  1D0Y A;  2DGJ A;  3LEV A;  2CDQ A;  3RYL A;  2KQ9 A;  3EHM A;  3VYW A;  4QI0 A;  2R7V A;  4BG0 A;  1V54 C;  2WB7 A;  3ABL C;  3IEE A;  2WVN A;  2J9W A;  3N2Z B;  1OCZ C;  3L34 A;  3GOD A;  3S28 A;  4FES A;  3SEO A;  4AK9 A;  5E33 A;  1M2V B;  4RD9 A;  2J7P D;  2YZS A;  4CS9 C;  4OIR F;  3PHF 2;  2J45 A;  3NRH A;  3LNR A;  5T3T A;  2CW0 F;  3Q7L A;  1RJ9 B;  2PP4 A;  2J0X A;  3DD7 A;  3O6X A;  5B1A C;  3KMI A;  4U5E E;  4ULW A;  2XRH A;  2C04 A;  4YN0 B;  4OIN F;  4HFF B;  1MNE A;  3EPV A;  4BJ5 A;  1G8X A;  4KNW A;  4EBB A;  2CGE A;  3Q7G A;  3L0I A;  3NYJ A;  4O79 A;  1M2V A;  2IXP A;  5DQT A;  1NU7 D;  2NUT B;  2WZF A;  5FCL A;  2P7V A;  2A1D D;  3NKD A;  4C3D A;  3UGP A;  1RJ9 A;  3F47 A;  1WGW A;  2IYL D;  4PFP A;  4EWC A;  3EGX B;  2L81 A;  2WZG A;  3EGD B;  3DZA A;  2R7T A;  3RH3 A;  3EQL F;  4XWJ A;  4O6Y A;  4BJ5 C;  3AQC A;  4G0H A;  3K7D A;  2OCC C;  3LJB A;  2X51 A;  1ZHT A;  1TR2 A;  3POV A;  5L3Q A;  4BJ1 A;  1QZX A;  1FTS A;  3X1O A;  2NUT A;  4CS7 A;  2QY9 A;  3KL4 A;  2R7W A;  5CI9 A;  4RBN A;  1JPN A;  2PX3 A;  2JD3 A;  2VB6 A;  4N06 A;  1Z5Z A;  2B0J A;  3Q6M A;  2IXO A;  3N0T A;  4XLP F;  1MND A;  3EGD A;  1Z63 A;  5KYX B;  4A2N B;  1Z6A A;  2G3K A;  1QLE C;  5EGY A;  2A6E F;  1D0Z A;  5L3V A;  1V55 C;  1VYI A;  1ZHX A;  3DM5 A;  2CNW A;  3ZG1 A;  2O9X A;  1D1C A;  3CSK A;  2WVO A;  2IXN A;  2NG1 A;  1VMA A;  5BUO A;  2W9Y A;  4QDL A;  2KJG A;  5DQZ A;  2ZXP A;  3DM9 B;  3F46 A;  4KNV A;  3I4U A;  4ZLD A;  2YEV A;  4O6N A;  2E87 A;  2H7B A;  2KGO A;  4MND A;  2FGY A;  2XL4 A;  2R7U A;  1W2W A;  3K33 A;  4XTK A;  4OD4 A;  5DVW A;  2W4B A;  3E70 C;  1KU2 A;  4YJW A;  4JVS A;  4MQ9 F;  3LES A;  1J8M F;  1SZI A;  4YT4 A;  1OCR C;  2Y3B A;  2BE5 F;  3LAY A;  4E7S A;  3DJU B;  5DLJ A;  4Q4Z F;  3K1I C;  3T4R A;  3CQZ A;  1VK5 A;  5F5H A;  1FFT C;  3HJC A;  1VYK A;  3ASO C;  2FFH A;  3LLK A;  4LER A;  2A68 F;  4YWQ A;  2M4E A;  4AE4 A;  3VAY A;  2WL8 A;  4IWB A;  1PD1 A;  2VAS A;  2D5R B;  4QI2 A;  4O6M A;  3EZI A;  2R7R A;  4DOZ A;  3KH2 A;  4WJ0 A;  3B0V C;  1TWA A;  2NUP B;  3S27 A;  3RIP A;  1S7Z A;  4OIQ F;  4OD5 A;  1D1A A;  2EIK C;  2CNW D;  2GFH A;  2Z15 A;  2ZXW C;  3EFO B;  3H65 A;  1M56 C;  3QMK A;  5HSW A;  5DS4 A;  2PF4 E;  4ANJ A;  4LLE A;  4BEJ A;  3HTK C;  2XXA B;  4E7Z A;  3DAF A;  3RKO F;  1O5H A;  3OWT A;  2V26 A;  1OKK A;  4C3B A;  2Y39 A;  3SP1 A;  2Y3H A;  2NUP A;  2DYR C;  3DXJ F;  4KBL A;  1N1C A;  1M57 C;  4JUR I;  1NZE A;  3EFO A;  3ABM C;  4K0D A;  5T1D B;  4HFK B;  2V3C C;  2P6V A;  3V7O A;  2WVQ A;  5E3C A;  4U5D E;  4U5C E;  3T6J A;  4U5G A;  1FMV A;  5CI8 A;  4JJG A;  4Q5S F;  4HE8 D;  1SF8 A;  1JPJ A;  3NYM A;  3K1H A;  2XXA A;  4GYT A;  4G7H F;  4B6I A;  4CBE A;  4C7O B;  1MMG A;  3UR3 C;  3EGX A;  1J8Y F;  3DMD A;  2DYS C;  1TWH A;  4W8K A;  1ZHY A;  1BR1 A;  3ZC4 A;  4YT8 A;  3EH1 A;  3ASN C;  1PCX A;  3JYH A;  4PFO A;  4I44 A;  5KYY B;  3T6B A;  3S29 A;  2EIN C;  1Z23 A;  3EJN A;  4I1O B;  1BR2 A;  3K66 A;  3LS0 A;  5B3S C;  3QZC A;  2PX0 A;  1IW7 F;  4KI2 A;  3UNG C;  4G7Z F;  5D92 A;  4C7O A;  4NY3 A;  1TWG A;  4M63 A;  4LAC B;  3ECS A;  4DBR A;  5KYX A;  5E2Q A;  4IRU A;  3B0P A;  2G62 A;  2J9V A;  3FAJ A;  1FFH A;  3N24 A;  2IOQ A;  3W8I A;  1OKK D;  2Y3D A;  5KYY A;  3DAG A;  3ABK C;  3DJN B;  1M2O A;  3SYN A;  4FWV A;  4G7O F;  1O87 A;  2W45 A;  4CSA A;  1FMW A;  4DVY P;  4DBQ A;  3TD7 A;  3EH2 A;  2A6H F;  3NKE A;  1MMN A;  4RDA A;  1LS1 A;  3RFY A;  3E9V A;  4YT5 A;  4O7G A;  4KC9 A;  1ZHW A;  4LLC A;  4I1M A;  1D0X A;  4JJF A;  3B9Q A;  2LSE A;  1ZHZ A;  4CS8 A;  2EIL C;  3O39 A;  3AG4 C;  1VOM A;  3SZR A;  2R7O A;  4J30 B;  3Q6N A;  2Y3G A;  2KW3 C;  2VH3 A;  3JSZ A;  4ZLC A;  5B1B C;  1TWC A;  2IXM A;  1OCC C;  1LKX A;  2Q9A A;  2Y69 C;  2KNH A;  4U5B E;  3FDQ A;  3LLI A;  4CSA C;  4U5H A;  3EG9 B;  3M1C B;  1PD0 A;  3LS1 A;  3FVY A;  2R7Q A;  2Q9C A;  4PJJ A;  4CIH A;  2HV6 A;  3ITF A;  2ZXO A;  4I3M A;  3AG3 C;  3GAN A;  3EZH A;  3AG1 C;  4X0R A;  3W2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...