2IXNA

Crystal structure of the pp2a phosphatase activator ypa2 ptpa2
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
297
structure length
292
Chain Sequence
PEKRLLTPDDMKLWEESPTRAHFTKFIIDLAESVKGHENSQYKEPISESINSMMNLLSQIKDITQKHPVIKRFGKVEFRDFYDEVSRNSRKILRSEFPSLTDEQLEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYSYGIFNLSNDSTNLVLKVFIEYLKIMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKHLKPISIHNNELVEMFAHRYLYFGCIAFINKVKSSASLRWHSPMLDDISGVKTWSKVAEGMIKMYKAEVLSKLPIMQHFYFSEFLPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Pp2A Phosphatase Activator: Implications for its Pp2A-Specific Ppiase Activity
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
molecule keywords SERINE/THREONINE-PROTEIN PHOSPHATASE 2A ACTIVATOR 2
total genus 97
structure length 292
sequence length 297
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03095 PTPA Phosphotyrosyl phosphate activator (PTPA) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2ixnA02
2G62A 2HV7A 2IXOA 2IXNA 2HV6A 2IXPA 2IXMA 4LACB 4NY3A
chains in the Genus database with same CATH superfamily
1SF8A 2HJMA 3VYWA 1VK5A 5BQIA 4U5GA 2M4EA 4IJJA 2ICWG 4JCHA 5JS5A 4JTCB 1FFTC 4W8KA 3T6JA 2OEXA 2R7SA 1A7EA 1Y6DA 3O55A 1U6HA 1L7CA 2QUPA 4JE9A 2BC5A 3NRHA 4BJ6C 2VCAA 3C8GB 1WWPA 3E70C 4PFOA 1MMAA 5GPGB 2MYSA 5DQTA 3EGDB 1FR0A 2UUHA 2R7OA 1MQVA 2ZXOA 2ZD9A 3U8PA 4MS2A 3UR3C 2V26A 1QLEC 2NUPB 3UMIA 4D4XA 2WZLA 2D5RB 4N4WA 4XEVA 2NSFA 2PFDA 3GANA 4FX5A 5JP7A 3X1OA 1HMDA 1JAFA 2A6HF 2I8BA 2LP4A 5KYUA 5KYUB 3S0XA 4C7OA 4JTDB 5DS4A 2V3CC 3L8IA 5AC5A 3HKKA 5CI9A 1C17M 3ZSUA 2Y69C 5L0IA 3U9MA 3FXHA 5L0JA 1ZHZA 2QE9A 2HUJA 2HMZA 4JTAB 4DBQA 2ZXWC 1TKNA 3EH1A 3ITFA 3C8ZA 4OIRF 1T01A 2IXOA 1U0BB 1WASA 3K1HA 3K66A 3UMHA 3BEHA 4KBLA 2CNWD 3RYLA 1OKKA 1OCCC 1OXBA 1YARO 5BQGA 3IQ6A 3HNKA 5E33A 3RQFA 3TULA 2E87A 2WVNA 5F28E 1OCOC 1GS9A 1NG1A 4PJJA 2YZSA 5KYXA 3EGXB 4KNVA 1M2VA 2XLOA 3T6GB 2YL1A 4XLNF 3I5PA 4JCZA 3Q7GA 3SXYA 3W4YA 2XXAB 3DE9A 1OXKA 2J9WA 4NCQA 2GDCA 4G78A 3T9OA 2XLVA 2B0HA 4DJ9A 2LK4A 3AJMA 1OQCA 3SXMA 4PFPA 1RMVA 2R7XA 1OR2A 1ORSC 2FGYA 2G3KA 2RSEB 2WVOA 1K05A 4LDQA 3ZIBA 2YWAA 3N24A 1D1CA 3JZ0A 1FTSA 4OINF 5A6BD 3TQOA 3NDBB 4HFFB 5JRAA 5T1DB 4EHPA 1G8XA 2R05A 4MVUA 3LNRA 3J06A 5KYYA 2XRHA 2GWWA 1LS1A 5F5HA 3F47A 1O3UA 5T3TA 4CS8C 5HSWA 1FNTc 2EPMX 1HE9A 1NLXA 2J9UA 2CNWA 3GEEA 3U8VA 1CPQA 4ULVA 4AL1A 4BJTA 3U0CA 2JX0A 1RCPA 3RQGA 2QLAA 2OCCC 4U9DA 2DYRC 2YLDA 4KNWA 1RJ9A 3GORA 4OD4A 4N06A 3GM1A 2O9XA 2KGOA 2P61A 3I4UA 2NUPA 3B29A 3EHMA 3DD7A 2KW3C 3SNHA 1H9TA 2LCHA 2YL0A 1IW7F 1UFBA 2MWQA 3M79A 1FMWA 2CCYA 4CSAA 3GODA 3HTKC 3O6XA 4C3DA 2A69F 2J9VA 3H65A 5COFA 4ZLDA 4E17A 3U2MA 4AK9A 3KL4A 5F5FA 2KK1A 3RF3A 4XEKA 2YRFA 1OW6A 1VB5A 3UGOA 3FAJA 1WN0A 3NMIA 3U9JA 4CS9C 2HV6A 1ZYRF 3WAQA 2QTVA 4OIPF 1TWGA 1NU9C 4LDRA 4EUKB 5E2QA 4O6MA 5A6BA 3EFOA 1OKKD 4O7GA 1C03A 1D0YA 4X0RA 1O5HA 4J32B 2EIJC 3RVZA 4U5EE 3S90A 1ZW2A 1LVKA 3SP1A 1QKRA 4MNDA 4ULWA 4EBKA 3A11A 1BR2A 4IARA 4O6YA 3CAXA 2CGEA 1FFHA 3JRTA 4XQ1A 5AGFA 3LNMB 4NC3A 5E3CA 2CYDA 2EIMC 2C03A 2R25A 2OEVA 2XLWA 2R9RB 4MVOA 4CDYA 5K0IA 3OWTA 5CI8A 4P9TA 3RIPA 2R7RA 2LSEA 3DZAA 3SEOA 2VASA 1E2XA 2L9JA 3K1IA 2BL2A 4MTOA 1J8YF 1D1AA 4XPYA 2A0UA 2NSGA 3LEVA 1HY5A 1SYQA 3K6BA 4J7TA 4P9FA 5COGA 1JRAA 1T5OA 1ZZPA 256BA 1DOWA 1GGQA 3N2ZB 3KMIA 5TJ5E 1CPRA 1VLSA 1U89A 4H4KC 2J9BA 3M4BA 3O39A 3RKOF 4CBEA 2R7VA 4WGYA 2Y3HA 1NSGB 4LACB 3E9VA 3BRJA 1NZEA 4MVZA 3IQTA 4IAOA 4N6HA 4PK4A 3ABLC 2KC3A 2AP3A 3M15A 4XTKA 3C63A 2J8WA 2Q9CA 2Y3GA 1LM3B 1R5ID 3VAYA 2I15A 1C02A 4CDAA 4YWQA 5A6KA 1A7DA 2W4BA 4PR9A 4CJGA 3GWLA 3HNIA 2LIGA 3DJUB 3U2LA 2KYHA 2DGJA 4OIQF 1BBHA 1T6UA 1D1BA 1O87A 2C04A 2OKUA 3KH2A 1EA8A 1XZPA 1JR8A 3B0VC 2DYSC 2F22A 2QY9A 1Q0GA 1HW1A 3OA1A 5D91A 2NPUA 2J7PD 2UUIA 2HZ8A 3EZHA 3L1MA 4JZAA 1TFKB 2PF4E 3ZTMA 4JC7A 1L3PA 3T4RA 3S9OA 3CQZA 1LE2A 4Q5SF 1ZHXA 1LI5A 2J7PA 2XM0A 1JMWA 3DM9B 3VRCA 4EKWA 3QW0A 3U3BA 2H8AA 4A2NB 4E7ZA 2Q9BA 2YL7A 4CDVA 4C7OB 3RQEA 3EFOB 5HV9A 3DE8A 3QZCA 4Z9IA 4MTGA 2AU5A 1JPJA 4BG0A 1VYIA 3TOLA 2ZXPA 3WG7C 3W2WA 1KTMA 3PMRA 2AWYA 4JEAA 2KQ9A 2LQGA 2IXPA 1D0ZA 1QPUA 4N6CA 1TFOB 2JD3A 1HMOA 3EG9B 1ORJA 1Q0DA 4O79A 4UDVA 1WOLA 4D4NA 2YVKA 3R7CA 5IY5C 4GEHA 3NMKA 4Q7CA 1EI7A 3U3FA 5KYWB 1YZCA 4WGZA 4C3BA 4DXWA 2ASRA 1RXQA 4IGGA 4O6NA 3TJ5A 4EWCA 1NBBA 1YJGA 2HFIA 4CSAC 3ZWIA 3FVYA 3SXZA 1BDJB 3EJNA 4M63A 3ABMC 4PJNA 1MMNA 5L0GA 4E0IA 5DS6A 3O10A 2D4UA 1V4AA 1V74B 4U5BE 2IXMA 4QI0A 4G7HF 1PD1A 3EQLF 1OW7A 1I5NA 3C8GD 4JURI 2XL4A 3M1CB 3KYIA 2HJ3A 4JW1A 4R32A 5AC4A 2H7BA 2IOQA 2X0CA 4BEMJ 1W2WA 2QNLA 1Z7Qc 2PX3A 3KYJA 1I4ZA 2XL8A 1OCRC 1XZQA 3C18A 2FAPB 3GM3A 5FZTA 1LS4A 2EPKX 5A69A 3S27A 2GA0A 3IEEA 2KNHA 1K40A 4XPWA 3TJ6A 1G4US 4JVSA 4MVQA 1ZU4A 2HV7A 4E18A 5B3SC 4OD5A 3DWWA 2J46A 3ABKC 4BJ5C 4LLCA 2VCBA 1Y4CA 1J8MF 1ZW3A 2WL8A 3IQ5A 3NKDA 3AGUA 3SXKA 3LLIA 5BUOA 1K04A 1V54C 4AX2A 4DRIB 1A41A 2W9YA 3CZ6A 3C8GA 3GM2A 1NFNA 3ZVRA 1ZVZA 4BPMA 4J7YA 5DQZA 2L7AA 3FAPB 4JRZA 1M6TA 1YAUO 2H7VC 2PP4A 4W8PA 2Q4FA 3C7JA 1ZHYA 1Q0KA 5DS5A 4EBJA 3NG1A 4IWBA 3RW0A 5L0DA 1YVIA 2ZPAA 5B1BC 2Q7RA 1R4TA 4WJ0A 5BQHA 4PJLA 3UNGC 3EHNA 2A68F 3ECSA 2AVKA 1JPNA 1JOGA 4NY3A 5EK0A 5L0HA 1Q0MA 4HE8D 3JSEO 3X2QC 3UGPA 3TK0A 3ZQYA 5L0CA 3B0UX 2VH3A 3JTLO 1YDIA 4WABA 4C3EA 1LIHA 2WZGA 1KNYA 4FWVA 3NMJA 1B68A 1I4YA 3DJNB 1NFOA 1PCXA 2OU6A 2YL3A 4ER9A 3DI5A 2XSEA 3S28A 1Z6AA 3LJBA 3US6A 5JVEA 2P0NA 2AWCA 4JIOA 5B1AC 3M4CA 3CSKA 3QMKA 4FAPB 3W2VA 2HMQA 3ZC4A 4I44A 4IB4A 4YK5A 1Z63A 2LFDA 2OJQA 4QDLA 1PV3A 3B71A 4MVMA 4DOZA 1CGME 4CIPA 3RVYA 1H9GA 3CEXA 3HNJA 3L0IA 4A4AA 2XS8A 2YLGA 5DVWA 4G7OF 2DB4A 2YLIA 2OOCA 5KYNA 3NYMA 4I3MA 3Q6MA 2IYLD 2J0WA 2WB7A 2YKZA 3JT1A 4NTFA 3NKEA 4Z9HA 1WTYA 4IAQA 2NUTB 1ORYA 3I5QA 2YHSA 3QTHA 3HNLA 1H6GA 1AUEA 4CS8A 1EQ1A 5JT4A 2OG2A 1TWHA 4MVRA 3LUTB 1YLMA 3NYJA 1S05A 3LS1A 3FDQA 5EGYA 2GFHA 3PCVA 2XLEA 3ZG1A 4NTBA 4BJ1A 4J30B 3MYIA 2DI3A 2KJGA 3QVYA 2XXAA 3HLZA 4YT4A 3DAGA 1S7ZA 1Z5ZA 1YZAA 1CGOA 3HJCA 3IQCA 1QQ3A 3EGDA 4JJGA 1LI7A 1YYXA 3DM5A 4G0HA 4K0DA 4BJ6A 4I1MA 4XEFA 2PBEA 4E7SA 3IHUA 4JJFA 3V5YA 2L6GA 2NG1A 3DMDA 2W4MA 4YL0A 2OJED 3L34A 2LFFA 3JRMO 4CS9A 1A7VA 3LESA 1QSPA 4CX9A 3AG1C 1T6QA 4E0HA 1Z23A 4ANJA 3AQBA 2M64A 3AOUA 4I1OB 1RKEA 3EPVA 1MNDA 2EPOA 2A1DD 3KPHA 2Q3TA 2YEVA 3LEOA 1LE4A 2J45A 3GWNA 4FESA 4XPXA 4YN0B 2Y39A 3GEIA 3LLKA 2RD9A 1YYJA 3FMSA 3AG4C 4U5DE 4RBNA 1T6IA 3FOPA 1UG7A 1M56C 2A0BA 2XM4A 3AQCA 1G4WR 1AVOB 1NU7D 3PHF2 4XLPF 3VM6A 1KU2A 1SZIA 3Q6NA 3FOOA 1ZU5A 2MHRA 3SYNA 1TR2A 2HKVA 1Z3IX 1SR2A 3EGXA 2W45A 4OIOF 1YA9A 5T3WA 2P1AA 2OQMA 2BE5F 5E3AA 3G4XA 2PX0A 1IZMA 2Q00A 1SMYF 2XLDA 1MMGA 3SZRA 3U5SA 5FCLA 4G7ZF 1VMAA 1E83A 1VTMP 1FAPB 4MW3A 4MTFA 4YL3A 4EBBA 3KKBA 4U5CE 1GM5A 1E86A 1T9KA 3B0PA 3L8JA 2GAQA 3K1IC 3T6BA 2HSQA 1HE1A 2LD6A 3LAYA 1E84A 1XWJA 2IXNA 2PNOA 4DVZA 1PD0A 3H2UA 4CS7A 4YT2A 2XLHA 3FHDA 3NYLA 2P7VA 1LPEA 4B6IA 1RKCA 3GEHA 3V7OA 3MBGA 3R2PA 4RDAA 2Y3DA 4AE4B 1M2VB 3W8HA 4H54A 5JSLA 4DBRA 4IRUA 2R7WA 4U9EA 2L81A 5JUAA 3V5XA 3K33A 4F4BA 2R7TA 3WODF 4BEJA 2X51A 1CGNA 2XL6A 1QVXA 1TQGA 4EIYA 5B3IA 4PJMA 1BR4A 3EG9A 4QI2A 3Q7LA 3ASOC 4MW8A 4HFKB 3IPMO 4LERA 4LDKA 1E85A 3QW1A 1WATA 3A9CA 3ZTZA 5L3QA 1FMVA 3MYFA 4NQFA 1BZ4A 1QZXA 3JCUQ 2G62A 2WZFA 1OCZC 2R02A 4DRHB 2YQYA 4YT5A 5EHHA 2L6HA 4YL1A 4ONSA 4U5HA 3RH3A 3ZQVA 1M2OA 4YT8A 4U5FE 2R7UA 5L0FA 4GQHA 1ST6A 2CW0F 4MQ9F 4KC9A 1M57C 1VOMA 1F1MA 2R7QA 2ZXRA 3EZIA 4HEAJ 1VLTA 3TOMA 5DLJA 1Q0FA 2JPUA 2IBFA 2KSFA 3DKAA 3MFNA 1G5ZA 4K1OA 3AG3C 4NTAA 4KI2A 3JYHA 3WHNA 2R03A 2EINC 2ETSA 3RFYA 2G3VA 3DXJF 3N0TA 1V55C 3UMKA 1ZHWA 2A6EF 1RKEB 4ZLCA 4P6IC 1D0XA 2XLMA 2H7OA 1EKYA 3QVZA 1AEPA 3C62A 3POVA 3MX3A 1ZHTA 2P6VA 2EIKC 4RD9A 1H7IA 2Y3BA 1VYKA 4AE4A 2VB6A 3ATPA 2VCCA 5D92A 4LLEA 4Z9JA 3W8IA 2B0JA 2IM8A 1RJ9B 3S29A 3K7DA 4DRJB 4CIHA 3H2VA 3JSZA 3AG2C 1APCA 1GQAA 1MMDA 5KYWA 4Q4ZF 3B9QA 4GYTA 1OR3A 1TWAA 4L6RA 4AL0A 4YJWA 5JLIA 3F46A 3G4ZA 1N1CA 4BJ5A 2WVQA 4DVYP 1HW2A 1WGWA 1TWCA 2EPNA 2Z15A 3MLGA 3V5ZA 3ZDLA 1MNEA 4CJOA 2L6FA 3AGTA 2CDQA 5L3VA 4XWJA 4PACA 3ASNC 3VF0A 5A6AA 3EH2A 5KYXB 4K7BA 1BR1A 2VC9A 3PDMP 3G50A 2NUTA 3JYYA 2EILC 1OW8A 2J0XA 2EPLX 4JKVA 4MVSA 1A0BA 5A6JA 3DAFA 1DOVA 3LS0A 2TMVP 3OEOA 2FFHA 1LKXA 5CIVA 1YA7O 2XS1A 5KYYB 2HSBA 4JEBA 3S84A 2HS5A 5COMA 3TD7A 2Q9AA
chains in the Genus database with same CATH topology
1SF8A 3VYWA 1VK5A 4U5GA 2M4EA 4IJJA 4JCHA 1FFTC 4W8KA 3T6JA 2R7SA 3NRHA 4BJ6C 3E70C 4PFOA 1MMAA 2MYSA 5DQTA 3EGDB 2R7OA 2ZXOA 3UR3C 2V26A 1QLEC 2NUPB 3UMIA 2WZLA 2D5RB 3X1OA 3GANA 2PFDA 4FX5A 3S0XA 2A6HF 2I8BA 5KYUA 4C7OA 5KYUB 2V3CC 5DS4A 5CI9A 3ZSUA 2Y69C 1ZHZA 4DBQA 2ZXWC 1TKNA 3EH1A 3ITFA 4OIRF 2IXOA 3K1HA 3UMHA 3K66A 4KBLA 2CNWD 3RYLA 1OKKA 1OCCC 5E33A 2E87A 2WVNA 1OCOC 1NG1A 4PJJA 2YZSA 5KYXA 3EGXB 4KNVA 1M2VA 4XLNF 3I5PA 3Q7GA 2XXAB 2J9WA 2R7XA 4PFPA 2FGYA 2G3KA 3ZIBA 2WVOA 3N24A 1D1CA 1FTSA 4OINF 3NDBB 4HFFB 5T1DB 1G8XA 3LNRA 5KYYA 2XRHA 5F5HA 1LS1A 3F47A 5T3TA 4CS8C 5HSWA 2CNWA 2J9UA 4BJTA 2OCCC 2DYRC 4KNWA 1RJ9A 4OD4A 4N06A 2O9XA 2KGOA 3I4UA 2NUPA 3EHMA 3DD7A 2KW3C 3SNHA 1IW7F 2MWQA 4CSAA 1FMWA 3GODA 3HTKC 3O6XA 4C3DA 2A69F 2J9VA 3H65A 4ZLDA 5F5FA 4AK9A 3KL4A 3UGOA 3FAJA 4CS9C 2HV6A 1ZYRF 2QTVA 4OIPF 1TWGA 1NU9C 5E2QA 4O6MA 3EFOA 1OKKD 4O7GA 4X0RA 1D0YA 1O5HA 4J32B 2EIJC 4U5EE 1LVKA 3SP1A 4MNDA 4ULWA 1BR2A 4O6YA 2CGEA 1FFHA 3JRTA 5E3CA 2EIMC 2C03A 2R7RA 3OWTA 5CI8A 3RIPA 2LSEA 3DZAA 3SEOA 2VASA 2L9JA 1J8YF 1D1AA 3LEVA 3K6BA 3N2ZB 3KMIA 4H4KC 3O39A 3RKOF 4CBEA 2R7VA 2Y3HA 4LACB 3E9VA 1NZEA 4PK4A 4IAOA 3ABLC 4XTKA 4C3EA 4YWQA 2Q9CA 2Y3GA 3VAYA 2W4BA 3DJUB 2DGJA 4OIQF 2C04A 1D1BA 1O87A 3KH2A 3B0VC 2DYSC 2QY9A 3OA1A 5D91A 2J7PD 3EZHA 4JZAA 2PF4E 3T4RA 3CQZA 4Q5SF 1ZHXA 2J7PA 3DM9B 4A2NB 4E7ZA 2Q9BA 4C7OB 3EFOB 3QZCA 1JPJA 4BG0A 1VYIA 2ZXPA 3WG7C 3W2WA 3PMRA 2KQ9A 2IXPA 1D0ZA 2JD3A 3EG9B 4O79A 5IY5C 4GEHA 4Q7CA 5KYWB 4C3BA 4O6NA 4CSAC 3FVYA 4PJNA 3EJNA 4M63A 3ABMC 1MMNA 5DS6A 4U5BE 2IXMA 4QI0A 4G7HF 1PD1A 3EQLF 4JURI 2XL4A 3M1CB 4JW1A 2H7BA 2IOQA 1W2WA 2PX3A 1OCRC 3S27A 3IEEA 2KNHA 4JVSA 1ZU4A 2HV7A 5B3SC 4OD5A 2J46A 3ABKC 4BJ5C 4LLCA 3NKDA 1J8MF 2WL8A 5BUOA 4Q4ZF 3LLIA 1V54C 4AX2A 3CZ6A 2W9YA 3ZVRA 5DQZA 2H7VC 2PP4A 1ZHYA 5DS5A 3NG1A 4IWBA 2ZPAA 5B1BC 4WJ0A 4PJLA 3UNGC 3EHNA 2A68F 3ECSA 1JPNA 4NY3A 4HE8D 3X2QC 3UGPA 3B0UX 2VH3A 4FWVA 2WZGA 3DJNB 1PCXA 2XSEA 3S28A 1Z6AA 3LJBA 5B1AC 3QMKA 3CSKA 3W2VA 3ZC4A 4I44A 1Z63A 4QDLA 4DOZA 3L0IA 5DVWA 4G7OF 5KYNA 3NYMA 4I3MA 3Q6MA 2IYLD 2J0WA 2WB7A 3JT1A 3NKEA 2NUTB 3I5QA 2YHSA 4CS8A 2OG2A 1TWHA 3NYJA 3LS1A 3FDQA 5EGYA 2GFHA 3ZG1A 4BJ1A 4J30B 2KJGA 2XXAA 3HLZA 4YT4A 3DAGA 1S7ZA 1Z5ZA 3HJCA 3EGDA 4JJGA 4K0DA 3DM5A 4G0HA 4BJ6A 4I1MA 4E7SA 4JJFA 2NG1A 3DMDA 2W4MA 3L34A 4CS9A 3LESA 3AG1C 1Z23A 4ANJA 3AQBA 4I1OB 3EPVA 1MNDA 2A1DD 2Q3TA 2YEVA 4FESA 2J45A 4YN0B 2Y39A 3LLKA 3AG4C 4U5DE 4RBNA 1M56C 3AQCA 1NU7D 3PHF2 4XLPF 1KU2A 1SZIA 3Q6NA 1ZU5A 3SYNA 1TR2A 1Z3IX 3EGXA 2W45A 4OIOF 5T3WA 2BE5F 5E3AA 2PX0A 1IZMA 1SMYF 3SZRA 1MMGA 5FCLA 4G7ZF 1VMAA 4EBBA 3KKBA 4U5CE 3B0PA 3K1IC 3T6BA 3LAYA 2IXNA 4DVZA 1PD0A 4CS7A 4YT2A 3FHDA 3NYLA 2P7VA 4B6IA 3V7OA 4RDAA 2Y3DA 4AE4B 1M2VB 3W8HA 2R7WA 4DBRA 4IRUA 2L81A 3K33A 4F4BA 2R7TA 3WODF 4BEJA 2X51A 4PJMA 1BR4A 3EG9A 4QI2A 3Q7LA 3ASOC 4HFKB 4LERA 5L3QA 1FMVA 1QZXA 3JCUQ 2G62A 2WZFA 1OCZC 4YT5A 5EHHA 3RH3A 4U5HA 1M2OA 4YT8A 4U5FE 2R7UA 1ST6A 2CW0F 4MQ9F 4KC9A 1M57C 1VOMA 2R7QA 3EZIA 2ZXRA 4HEAJ 5DLJA 3AG3C 4KI2A 3JYHA 2EINC 3RFYA 2G3VA 3DXJF 3N0TA 1V55C 3UMKA 1ZHWA 2A6EF 4ZLCA 4P6IC 1D0XA 2H7OA 3POVA 3MX3A 1ZHTA 2P6VA 2EIKC 4RD9A 2Y3BA 1VYKA 4AE4A 2VB6A 5D92A 4LLEA 3W8IA 2B0JA 1RJ9B 3S29A 3K7DA 4CIHA 3JSZA 3AG2C 1MMDA 5KYWA 3B9QA 4GYTA 1TWAA 4YJWA 3F46A 1N1CA 4BJ5A 2WVQA 4DVYP 1WGWA 1TWCA 3MLGA 2Z15A 1MNEA 2CDQA 5L3VA 4XWJA 3ASNC 3EH2A 5KYXB 4K7BA 1BR1A 2NUTA 2EILC 2J0XA 3DAFA 3LS0A 3OEOA 2FFHA 1LKXA 5KYYB 4EWCA 3TD7A 2Q9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G62 A;  2HV7 A;  2IXO A;  2IXN A;  2HV6 A;  2IXP A;  2IXM A;  4LAC B;  4NY3 A; 
#chains in the Genus database with same CATH topology
 1SF8 A;  2HJM A;  3VYW A;  1VK5 A;  5BQI A;  4U5G A;  2M4E A;  4IJJ A;  2ICW G;  4JCH A;  5JS5 A;  4JTC B;  1FFT C;  4W8K A;  3T6J A;  2OEX A;  2R7S A;  1A7E A;  1Y6D A;  3O55 A;  1U6H A;  1L7C A;  2QUP A;  4JE9 A;  2BC5 A;  3NRH A;  4BJ6 C;  2VCA A;  3C8G B;  1WWP A;  3E70 C;  4PFO A;  1MMA A;  5GPG B;  2MYS A;  5DQT A;  3EGD B;  1FR0 A;  2UUH A;  2R7O A;  1MQV A;  2ZXO A;  2ZD9 A;  3U8P A;  4MS2 A;  3UR3 C;  2V26 A;  1QLE C;  2NUP B;  3UMI A;  4D4X A;  2WZL A;  2D5R B;  4N4W A;  4XEV A;  2NSF A;  2PFD A;  3GAN A;  4FX5 A;  5JP7 A;  3X1O A;  1HMD A;  1JAF A;  2A6H F;  2I8B A;  2LP4 A;  5KYU A;  5KYU B;  3S0X A;  4C7O A;  4JTD B;  5DS4 A;  2V3C C;  3L8I A;  5AC5 A;  3HKK A;  5CI9 A;  1C17 M;  3ZSU A;  2Y69 C;  5L0I A;  3U9M A;  3FXH A;  5L0J A;  1ZHZ A;  2QE9 A;  2HUJ A;  2HMZ A;  4JTA B;  4DBQ A;  2ZXW C;  1TKN A;  3EH1 A;  3ITF A;  3C8Z A;  4OIR F;  1T01 A;  2IXO A;  1U0B B;  1WAS A;  3K1H A;  3K66 A;  3UMH A;  3BEH A;  4KBL A;  2CNW D;  3RYL A;  1OKK A;  1OCC C;  1OXB A;  1YAR O;  5BQG A;  3IQ6 A;  3HNK A;  5E33 A;  3RQF A;  3TUL A;  2E87 A;  2WVN A;  5F28 E;  1OCO C;  1GS9 A;  1NG1 A;  4PJJ A;  2YZS A;  5KYX A;  3EGX B;  4KNV A;  1M2V A;  2XLO A;  3T6G B;  2YL1 A;  4XLN F;  3I5P A;  4JCZ A;  3Q7G A;  3SXY A;  3W4Y A;  2XXA B;  3DE9 A;  1OXK A;  2J9W A;  4NCQ A;  2GDC A;  4G78 A;  3T9O A;  2XLV A;  2B0H A;  4DJ9 A;  2LK4 A;  3AJM A;  1OQC A;  3SXM A;  4PFP A;  1RMV A;  2R7X A;  1OR2 A;  1ORS C;  2FGY A;  2G3K A;  2RSE B;  2WVO A;  1K05 A;  4LDQ A;  3ZIB A;  2YWA A;  3N24 A;  1D1C A;  3JZ0 A;  1FTS A;  4OIN F;  5A6B D;  3TQO A;  3NDB B;  4HFF B;  5JRA A;  5T1D B;  4EHP A;  1G8X A;  2R05 A;  4MVU A;  3LNR A;  3J06 A;  5KYY A;  2XRH A;  2GWW A;  1LS1 A;  5F5H A;  3F47 A;  1O3U A;  5T3T A;  4CS8 C;  5HSW A;  1FNT c;  2EPM X;  1HE9 A;  1NLX A;  2J9U A;  2CNW A;  3GEE A;  3U8V A;  1CPQ A;  4ULV A;  4AL1 A;  4BJT A;  3U0C A;  2JX0 A;  1RCP A;  3RQG A;  2QLA A;  2OCC C;  4U9D A;  2DYR C;  2YLD A;  4KNW A;  1RJ9 A;  3GOR A;  4OD4 A;  4N06 A;  3GM1 A;  2O9X A;  2KGO A;  2P61 A;  3I4U A;  2NUP A;  3B29 A;  3EHM A;  3DD7 A;  2KW3 C;  3SNH A;  1H9T A;  2LCH A;  2YL0 A;  1IW7 F;  1UFB A;  2MWQ A;  3M79 A;  1FMW A;  2CCY A;  4CSA A;  3GOD A;  3HTK C;  3O6X A;  4C3D A;  2A69 F;  2J9V A;  3H65 A;  5COF A;  4ZLD A;  4E17 A;  3U2M A;  4AK9 A;  3KL4 A;  5F5F A;  2KK1 A;  3RF3 A;  4XEK A;  2YRF A;  1OW6 A;  1VB5 A;  3UGO A;  3FAJ A;  1WN0 A;  3NMI A;  3U9J A;  4CS9 C;  2HV6 A;  1ZYR F;  3WAQ A;  2QTV A;  4OIP F;  1TWG A;  1NU9 C;  4LDR A;  4EUK B;  5E2Q A;  4O6M A;  5A6B A;  3EFO A;  1OKK D;  4O7G A;  1C03 A;  1D0Y A;  4X0R A;  1O5H A;  4J32 B;  2EIJ C;  3RVZ A;  4U5E E;  3S90 A;  1ZW2 A;  1LVK A;  3SP1 A;  1QKR A;  4MND A;  4ULW A;  4EBK A;  3A11 A;  1BR2 A;  4IAR A;  4O6Y A;  3CAX A;  2CGE A;  1FFH A;  3JRT A;  4XQ1 A;  5AGF A;  3LNM B;  4NC3 A;  5E3C A;  2CYD A;  2EIM C;  2C03 A;  2R25 A;  2OEV A;  2XLW A;  2R9R B;  4MVO A;  4CDY A;  5K0I A;  3OWT A;  5CI8 A;  4P9T A;  3RIP A;  2R7R A;  2LSE A;  3DZA A;  3SEO A;  2VAS A;  1E2X A;  2L9J A;  3K1I A;  2BL2 A;  4MTO A;  1J8Y F;  1D1A A;  4XPY A;  2A0U A;  2NSG A;  3LEV A;  1HY5 A;  1SYQ A;  3K6B A;  4J7T A;  4P9F A;  5COG A;  1JRA A;  1T5O A;  1ZZP A;  256B A;  1DOW A;  1GGQ A;  3N2Z B;  3KMI A;  5TJ5 E;  1CPR A;  1VLS A;  1U89 A;  4H4K C;  2J9B A;  3M4B A;  3O39 A;  3RKO F;  4CBE A;  2R7V A;  4WGY A;  2Y3H A;  1NSG B;  4LAC B;  3E9V A;  3BRJ A;  1NZE A;  4MVZ A;  3IQT A;  4IAO A;  4N6H A;  4PK4 A;  3ABL C;  2KC3 A;  2AP3 A;  3M15 A;  4XTK A;  3C63 A;  2J8W A;  2Q9C A;  2Y3G A;  1LM3 B;  1R5I D;  3VAY A;  2I15 A;  1C02 A;  4CDA A;  4YWQ A;  5A6K A;  1A7D A;  2W4B A;  4PR9 A;  4CJG A;  3GWL A;  3HNI A;  2LIG A;  3DJU B;  3U2L A;  2KYH A;  2DGJ A;  4OIQ F;  1BBH A;  1T6U A;  1D1B A;  1O87 A;  2C04 A;  2OKU A;  3KH2 A;  1EA8 A;  1XZP A;  1JR8 A;  3B0V C;  2DYS C;  2F22 A;  2QY9 A;  1Q0G A;  1HW1 A;  3OA1 A;  5D91 A;  2NPU A;  2J7P D;  2UUI A;  2HZ8 A;  3EZH A;  3L1M A;  4JZA A;  1TFK B;  2PF4 E;  3ZTM A;  4JC7 A;  1L3P A;  3T4R A;  3S9O A;  3CQZ A;  1LE2 A;  4Q5S F;  1ZHX A;  1LI5 A;  2J7P A;  2XM0 A;  1JMW A;  3DM9 B;  3VRC A;  4EKW A;  3QW0 A;  3U3B A;  2H8A A;  4A2N B;  4E7Z A;  2Q9B A;  2YL7 A;  4CDV A;  4C7O B;  3RQE A;  3EFO B;  5HV9 A;  3DE8 A;  3QZC A;  4Z9I A;  4MTG A;  2AU5 A;  1JPJ A;  4BG0 A;  1VYI A;  3TOL A;  2ZXP A;  3WG7 C;  3W2W A;  1KTM A;  3PMR A;  2AWY A;  4JEA A;  2KQ9 A;  2LQG A;  2IXP A;  1D0Z A;  1QPU A;  4N6C A;  1TFO B;  2JD3 A;  1HMO A;  3EG9 B;  1ORJ A;  1Q0D A;  4O79 A;  4UDV A;  1WOL A;  4D4N A;  2YVK A;  3R7C A;  5IY5 C;  4GEH A;  3NMK A;  4Q7C A;  1EI7 A;  3U3F A;  5KYW B;  1YZC A;  4WGZ A;  4C3B A;  4DXW A;  2ASR A;  1RXQ A;  4IGG A;  4O6N A;  3TJ5 A;  4EWC A;  1NBB A;  1YJG A;  2HFI A;  4CSA C;  3ZWI A;  3FVY A;  3SXZ A;  1BDJ B;  3EJN A;  4M63 A;  3ABM C;  4PJN A;  1MMN A;  5L0G A;  4E0I A;  5DS6 A;  3O10 A;  2D4U A;  1V4A A;  1V74 B;  4U5B E;  2IXM A;  4QI0 A;  4G7H F;  1PD1 A;  3EQL F;  1OW7 A;  1I5N A;  3C8G D;  4JUR I;  2XL4 A;  3M1C B;  3KYI A;  2HJ3 A;  4JW1 A;  4R32 A;  5AC4 A;  2H7B A;  2IOQ A;  2X0C A;  4BEM J;  1W2W A;  2QNL A;  1Z7Q c;  2PX3 A;  3KYJ A;  1I4Z A;  2XL8 A;  1OCR C;  1XZQ A;  3C18 A;  2FAP B;  3GM3 A;  5FZT A;  1LS4 A;  2EPK X;  5A69 A;  3S27 A;  2GA0 A;  3IEE A;  2KNH A;  1K40 A;  4XPW A;  3TJ6 A;  1G4U S;  4JVS A;  4MVQ A;  1ZU4 A;  2HV7 A;  4E18 A;  5B3S C;  4OD5 A;  3DWW A;  2J46 A;  3ABK C;  4BJ5 C;  4LLC A;  2VCB A;  1Y4C A;  1J8M F;  1ZW3 A;  2WL8 A;  3IQ5 A;  3NKD A;  3AGU A;  3SXK A;  3LLI A;  5BUO A;  1K04 A;  1V54 C;  4AX2 A;  4DRI B;  1A41 A;  2W9Y A;  3CZ6 A;  3C8G A;  3GM2 A;  1NFN A;  3ZVR A;  1ZVZ A;  4BPM A;  4J7Y A;  5DQZ A;  2L7A A;  3FAP B;  4JRZ A;  1M6T A;  1YAU O;  2H7V C;  2PP4 A;  4W8P A;  2Q4F A;  3C7J A;  1ZHY A;  1Q0K A;  5DS5 A;  4EBJ A;  3NG1 A;  4IWB A;  3RW0 A;  5L0D A;  1YVI A;  2ZPA A;  5B1B C;  2Q7R A;  1R4T A;  4WJ0 A;  5BQH A;  4PJL A;  3UNG C;  3EHN A;  2A68 F;  3ECS A;  2AVK A;  1JPN A;  1JOG A;  4NY3 A;  5EK0 A;  5L0H A;  1Q0M A;  4HE8 D;  3JSE O;  3X2Q C;  3UGP A;  3TK0 A;  3ZQY A;  5L0C A;  3B0U X;  2VH3 A;  3JTL O;  1YDI A;  4WAB A;  4C3E A;  1LIH A;  2WZG A;  1KNY A;  4FWV A;  3NMJ A;  1B68 A;  1I4Y A;  3DJN B;  1NFO A;  1PCX A;  2OU6 A;  2YL3 A;  4ER9 A;  3DI5 A;  2XSE A;  3S28 A;  1Z6A A;  3LJB A;  3US6 A;  5JVE A;  2P0N A;  2AWC A;  4JIO A;  5B1A C;  3M4C A;  3CSK A;  3QMK A;  4FAP B;  3W2V A;  2HMQ A;  3ZC4 A;  4I44 A;  4IB4 A;  4YK5 A;  1Z63 A;  2LFD A;  2OJQ A;  4QDL A;  1PV3 A;  3B71 A;  4MVM A;  4DOZ A;  1CGM E;  4CIP A;  3RVY A;  1H9G A;  3CEX A;  3HNJ A;  3L0I A;  4A4A A;  2XS8 A;  2YLG A;  5DVW A;  4G7O F;  2DB4 A;  2YLI A;  2OOC A;  5KYN A;  3NYM A;  4I3M A;  3Q6M A;  2IYL D;  2J0W A;  2WB7 A;  2YKZ A;  3JT1 A;  4NTF A;  3NKE A;  4Z9H A;  1WTY A;  4IAQ A;  2NUT B;  1ORY A;  3I5Q A;  2YHS A;  3QTH A;  3HNL A;  1H6G A;  1AUE A;  4CS8 A;  1EQ1 A;  5JT4 A;  2OG2 A;  1TWH A;  4MVR A;  3LUT B;  1YLM A;  3NYJ A;  1S05 A;  3LS1 A;  3FDQ A;  5EGY A;  2GFH A;  3PCV A;  2XLE A;  3ZG1 A;  4NTB A;  4BJ1 A;  4J30 B;  3MYI A;  2DI3 A;  2KJG A;  3QVY A;  2XXA A;  3HLZ A;  4YT4 A;  3DAG A;  1S7Z A;  1Z5Z A;  1YZA A;  1CGO A;  3HJC A;  3IQC A;  1QQ3 A;  3EGD A;  4JJG A;  1LI7 A;  1YYX A;  3DM5 A;  4G0H A;  4K0D A;  4BJ6 A;  4I1M A;  4XEF A;  2PBE A;  4E7S A;  3IHU A;  4JJF A;  3V5Y A;  2L6G A;  2NG1 A;  3DMD A;  2W4M A;  4YL0 A;  2OJE D;  3L34 A;  2LFF A;  3JRM O;  4CS9 A;  1A7V A;  3LES A;  1QSP A;  4CX9 A;  3AG1 C;  1T6Q A;  4E0H A;  1Z23 A;  4ANJ A;  3AQB A;  2M64 A;  3AOU A;  4I1O B;  1RKE A;  3EPV A;  1MND A;  2EPO A;  2A1D D;  3KPH A;  2Q3T A;  2YEV A;  3LEO A;  1LE4 A;  2J45 A;  3GWN A;  4FES A;  4XPX A;  4YN0 B;  2Y39 A;  3GEI A;  3LLK A;  2RD9 A;  1YYJ A;  3FMS A;  3AG4 C;  4U5D E;  4RBN A;  1T6I A;  3FOP A;  1UG7 A;  1M56 C;  2A0B A;  2XM4 A;  3AQC A;  1G4W R;  1AVO B;  1NU7 D;  3PHF 2;  4XLP F;  3VM6 A;  1KU2 A;  1SZI A;  3Q6N A;  3FOO A;  1ZU5 A;  2MHR A;  3SYN A;  1TR2 A;  2HKV A;  1Z3I X;  1SR2 A;  3EGX A;  2W45 A;  4OIO F;  1YA9 A;  5T3W A;  2P1A A;  2OQM A;  2BE5 F;  5E3A A;  3G4X A;  2PX0 A;  1IZM A;  2Q00 A;  1SMY F;  2XLD A;  1MMG A;  3SZR A;  3U5S A;  5FCL A;  4G7Z F;  1VMA A;  1E83 A;  1VTM P;  1FAP B;  4MW3 A;  4MTF A;  4YL3 A;  4EBB A;  3KKB A;  4U5C E;  1GM5 A;  1E86 A;  1T9K A;  3B0P A;  3L8J A;  2GAQ A;  3K1I C;  3T6B A;  2HSQ A;  1HE1 A;  2LD6 A;  3LAY A;  1E84 A;  1XWJ A;  2IXN A;  2PNO A;  4DVZ A;  1PD0 A;  3H2U A;  4CS7 A;  4YT2 A;  2XLH A;  3FHD A;  3NYL A;  2P7V A;  1LPE A;  4B6I A;  1RKC A;  3GEH A;  3V7O A;  3MBG A;  3R2P A;  4RDA A;  2Y3D A;  4AE4 B;  1M2V B;  3W8H A;  4H54 A;  5JSL A;  4DBR A;  4IRU A;  2R7W A;  4U9E A;  2L81 A;  5JUA A;  3V5X A;  3K33 A;  4F4B A;  2R7T A;  3WOD F;  4BEJ A;  2X51 A;  1CGN A;  2XL6 A;  1QVX A;  1TQG A;  4EIY A;  5B3I A;  4PJM A;  1BR4 A;  3EG9 A;  4QI2 A;  3Q7L A;  3ASO C;  4MW8 A;  4HFK B;  3IPM O;  4LER A;  4LDK A;  1E85 A;  3QW1 A;  1WAT A;  3A9C A;  3ZTZ A;  5L3Q A;  1FMV A;  3MYF A;  4NQF A;  1BZ4 A;  1QZX A;  3JCU Q;  2G62 A;  2WZF A;  1OCZ C;  2R02 A;  4DRH B;  2YQY A;  4YT5 A;  5EHH A;  2L6H A;  4YL1 A;  4ONS A;  4U5H A;  3RH3 A;  3ZQV A;  1M2O A;  4YT8 A;  4U5F E;  2R7U A;  5L0F A;  4GQH A;  1ST6 A;  2CW0 F;  4MQ9 F;  4KC9 A;  1M57 C;  1VOM A;  1F1M A;  2R7Q A;  2ZXR A;  3EZI A;  4HEA J;  1VLT A;  3TOM A;  5DLJ A;  1Q0F A;  2JPU A;  2IBF A;  2KSF A;  3DKA A;  3MFN A;  1G5Z A;  4K1O A;  3AG3 C;  4NTA A;  4KI2 A;  3JYH A;  3WHN A;  2R03 A;  2EIN C;  2ETS A;  3RFY A;  2G3V A;  3DXJ F;  3N0T A;  1V55 C;  3UMK A;  1ZHW A;  2A6E F;  1RKE B;  4ZLC A;  4P6I C;  1D0X A;  2XLM A;  2H7O A;  1EKY A;  3QVZ A;  1AEP A;  3C62 A;  3POV A;  3MX3 A;  1ZHT A;  2P6V A;  2EIK C;  4RD9 A;  1H7I A;  2Y3B A;  1VYK A;  4AE4 A;  2VB6 A;  3ATP A;  2VCC A;  5D92 A;  4LLE A;  4Z9J A;  3W8I A;  2B0J A;  2IM8 A;  1RJ9 B;  3S29 A;  3K7D A;  4DRJ B;  4CIH A;  3H2V A;  3JSZ A;  3AG2 C;  1APC A;  1GQA A;  1MMD A;  5KYW A;  4Q4Z F;  3B9Q A;  4GYT A;  1OR3 A;  1TWA A;  4L6R A;  4AL0 A;  4YJW A;  5JLI A;  3F46 A;  3G4Z A;  1N1C A;  4BJ5 A;  2WVQ A;  4DVY P;  1HW2 A;  1WGW A;  1TWC A;  2EPN A;  2Z15 A;  3MLG A;  3V5Z A;  3ZDL A;  1MNE A;  4CJO A;  2L6F A;  3AGT A;  2CDQ A;  5L3V A;  4XWJ A;  4PAC A;  3ASN C;  3VF0 A;  5A6A A;  3EH2 A;  5KYX B;  4K7B A;  1BR1 A;  2VC9 A;  3PDM P;  3G50 A;  2NUT A;  3JYY A;  2EIL C;  1OW8 A;  2J0X A;  2EPL X;  4JKV A;  4MVS A;  1A0B A;  5A6J A;  3DAF A;  1DOV A;  3LS0 A;  2TMV P;  3OEO A;  2FFH A;  1LKX A;  5CIV A;  1YA7 O;  2XS1 A;  5KYY B;  2HSB A;  4JEB A;  3S84 A;  2HS5 A;  5COM A;  3TD7 A;  2Q9A A; 
#chains in the Genus database with same CATH homology
 1SF8 A;  3VYW A;  1VK5 A;  4U5G A;  2M4E A;  4IJJ A;  4JCH A;  1FFT C;  4W8K A;  3T6J A;  2R7S A;  3NRH A;  4BJ6 C;  3E70 C;  4PFO A;  1MMA A;  2MYS A;  5DQT A;  3EGD B;  2R7O A;  2ZXO A;  3UR3 C;  2V26 A;  1QLE C;  2NUP B;  3UMI A;  2WZL A;  2D5R B;  3X1O A;  3GAN A;  2PFD A;  4FX5 A;  3S0X A;  2A6H F;  2I8B A;  5KYU A;  4C7O A;  5KYU B;  2V3C C;  5DS4 A;  5CI9 A;  3ZSU A;  2Y69 C;  1ZHZ A;  4DBQ A;  2ZXW C;  1TKN A;  3EH1 A;  3ITF A;  4OIR F;  2IXO A;  3K1H A;  3UMH A;  3K66 A;  4KBL A;  2CNW D;  3RYL A;  1OKK A;  1OCC C;  5E33 A;  2E87 A;  2WVN A;  1OCO C;  1NG1 A;  4PJJ A;  2YZS A;  5KYX A;  3EGX B;  4KNV A;  1M2V A;  4XLN F;  3I5P A;  3Q7G A;  2XXA B;  2J9W A;  2R7X A;  4PFP A;  2FGY A;  2G3K A;  3ZIB A;  2WVO A;  3N24 A;  1D1C A;  1FTS A;  4OIN F;  3NDB B;  4HFF B;  5T1D B;  1G8X A;  3LNR A;  5KYY A;  2XRH A;  5F5H A;  1LS1 A;  3F47 A;  5T3T A;  4CS8 C;  5HSW A;  2CNW A;  2J9U A;  4BJT A;  2OCC C;  2DYR C;  4KNW A;  1RJ9 A;  4OD4 A;  4N06 A;  2O9X A;  2KGO A;  3I4U A;  2NUP A;  3EHM A;  3DD7 A;  2KW3 C;  3SNH A;  1IW7 F;  2MWQ A;  4CSA A;  1FMW A;  3GOD A;  3HTK C;  3O6X A;  4C3D A;  2A69 F;  2J9V A;  3H65 A;  4ZLD A;  5F5F A;  4AK9 A;  3KL4 A;  3UGO A;  3FAJ A;  4CS9 C;  2HV6 A;  1ZYR F;  2QTV A;  4OIP F;  1TWG A;  1NU9 C;  5E2Q A;  4O6M A;  3EFO A;  1OKK D;  4O7G A;  4X0R A;  1D0Y A;  1O5H A;  4J32 B;  2EIJ C;  4U5E E;  1LVK A;  3SP1 A;  4MND A;  4ULW A;  1BR2 A;  4O6Y A;  2CGE A;  1FFH A;  3JRT A;  5E3C A;  2EIM C;  2C03 A;  2R7R A;  3OWT A;  5CI8 A;  3RIP A;  2LSE A;  3DZA A;  3SEO A;  2VAS A;  2L9J A;  1J8Y F;  1D1A A;  3LEV A;  3K6B A;  3N2Z B;  3KMI A;  4H4K C;  3O39 A;  3RKO F;  4CBE A;  2R7V A;  2Y3H A;  4LAC B;  3E9V A;  1NZE A;  4PK4 A;  4IAO A;  3ABL C;  4XTK A;  4C3E A;  4YWQ A;  2Q9C A;  2Y3G A;  3VAY A;  2W4B A;  3DJU B;  2DGJ A;  4OIQ F;  2C04 A;  1D1B A;  1O87 A;  3KH2 A;  3B0V C;  2DYS C;  2QY9 A;  3OA1 A;  5D91 A;  2J7P D;  3EZH A;  4JZA A;  2PF4 E;  3T4R A;  3CQZ A;  4Q5S F;  1ZHX A;  2J7P A;  3DM9 B;  4A2N B;  4E7Z A;  2Q9B A;  4C7O B;  3EFO B;  3QZC A;  1JPJ A;  4BG0 A;  1VYI A;  2ZXP A;  3WG7 C;  3W2W A;  3PMR A;  2KQ9 A;  2IXP A;  1D0Z A;  2JD3 A;  3EG9 B;  4O79 A;  5IY5 C;  4GEH A;  4Q7C A;  5KYW B;  4C3B A;  4O6N A;  4CSA C;  3FVY A;  4PJN A;  3EJN A;  4M63 A;  3ABM C;  1MMN A;  5DS6 A;  4U5B E;  2IXM A;  4QI0 A;  4G7H F;  1PD1 A;  3EQL F;  4JUR I;  2XL4 A;  3M1C B;  4JW1 A;  2H7B A;  2IOQ A;  1W2W A;  2PX3 A;  1OCR C;  3S27 A;  3IEE A;  2KNH A;  4JVS A;  1ZU4 A;  2HV7 A;  5B3S C;  4OD5 A;  2J46 A;  3ABK C;  4BJ5 C;  4LLC A;  3NKD A;  1J8M F;  2WL8 A;  5BUO A;  4Q4Z F;  3LLI A;  1V54 C;  4AX2 A;  3CZ6 A;  2W9Y A;  3ZVR A;  5DQZ A;  2H7V C;  2PP4 A;  1ZHY A;  5DS5 A;  3NG1 A;  4IWB A;  2ZPA A;  5B1B C;  4WJ0 A;  4PJL A;  3UNG C;  3EHN A;  2A68 F;  3ECS A;  1JPN A;  4NY3 A;  4HE8 D;  3X2Q C;  3UGP A;  3B0U X;  2VH3 A;  4FWV A;  2WZG A;  3DJN B;  1PCX A;  2XSE A;  3S28 A;  1Z6A A;  3LJB A;  5B1A C;  3QMK A;  3CSK A;  3W2V A;  3ZC4 A;  4I44 A;  1Z63 A;  4QDL A;  4DOZ A;  3L0I A;  5DVW A;  4G7O F;  5KYN A;  3NYM A;  4I3M A;  3Q6M A;  2IYL D;  2J0W A;  2WB7 A;  3JT1 A;  3NKE A;  2NUT B;  3I5Q A;  2YHS A;  4CS8 A;  2OG2 A;  1TWH A;  3NYJ A;  3LS1 A;  3FDQ A;  5EGY A;  2GFH A;  3ZG1 A;  4BJ1 A;  4J30 B;  2KJG A;  2XXA A;  3HLZ A;  4YT4 A;  3DAG A;  1S7Z A;  1Z5Z A;  3HJC A;  3EGD A;  4JJG A;  4K0D A;  3DM5 A;  4G0H A;  4BJ6 A;  4I1M A;  4E7S A;  4JJF A;  2NG1 A;  3DMD A;  2W4M A;  3L34 A;  4CS9 A;  3LES A;  3AG1 C;  1Z23 A;  4ANJ A;  3AQB A;  4I1O B;  3EPV A;  1MND A;  2A1D D;  2Q3T A;  2YEV A;  4FES A;  2J45 A;  4YN0 B;  2Y39 A;  3LLK A;  3AG4 C;  4U5D E;  4RBN A;  1M56 C;  3AQC A;  1NU7 D;  3PHF 2;  4XLP F;  1KU2 A;  1SZI A;  3Q6N A;  1ZU5 A;  3SYN A;  1TR2 A;  1Z3I X;  3EGX A;  2W45 A;  4OIO F;  5T3W A;  2BE5 F;  5E3A A;  2PX0 A;  1IZM A;  1SMY F;  3SZR A;  1MMG A;  5FCL A;  4G7Z F;  1VMA A;  4EBB A;  3KKB A;  4U5C E;  3B0P A;  3K1I C;  3T6B A;  3LAY A;  2IXN A;  4DVZ A;  1PD0 A;  4CS7 A;  4YT2 A;  3FHD A;  3NYL A;  2P7V A;  4B6I A;  3V7O A;  4RDA A;  2Y3D A;  4AE4 B;  1M2V B;  3W8H A;  2R7W A;  4DBR A;  4IRU A;  2L81 A;  3K33 A;  4F4B A;  2R7T A;  3WOD F;  4BEJ A;  2X51 A;  4PJM A;  1BR4 A;  3EG9 A;  4QI2 A;  3Q7L A;  3ASO C;  4HFK B;  4LER A;  5L3Q A;  1FMV A;  1QZX A;  3JCU Q;  2G62 A;  2WZF A;  1OCZ C;  4YT5 A;  5EHH A;  3RH3 A;  4U5H A;  1M2O A;  4YT8 A;  4U5F E;  2R7U A;  1ST6 A;  2CW0 F;  4MQ9 F;  4KC9 A;  1M57 C;  1VOM A;  2R7Q A;  3EZI A;  2ZXR A;  4HEA J;  5DLJ A;  3AG3 C;  4KI2 A;  3JYH A;  2EIN C;  3RFY A;  2G3V A;  3DXJ F;  3N0T A;  1V55 C;  3UMK A;  1ZHW A;  2A6E F;  4ZLC A;  4P6I C;  1D0X A;  2H7O A;  3POV A;  3MX3 A;  1ZHT A;  2P6V A;  2EIK C;  4RD9 A;  2Y3B A;  1VYK A;  4AE4 A;  2VB6 A;  5D92 A;  4LLE A;  3W8I A;  2B0J A;  1RJ9 B;  3S29 A;  3K7D A;  4CIH A;  3JSZ A;  3AG2 C;  1MMD A;  5KYW A;  3B9Q A;  4GYT A;  1TWA A;  4YJW A;  3F46 A;  1N1C A;  4BJ5 A;  2WVQ A;  4DVY P;  1WGW A;  1TWC A;  3MLG A;  2Z15 A;  1MNE A;  2CDQ A;  5L3V A;  4XWJ A;  3ASN C;  3EH2 A;  5KYX B;  4K7B A;  1BR1 A;  2NUT A;  2EIL C;  2J0X A;  3DAF A;  3LS0 A;  3OEO A;  2FFH A;  1LKX A;  5KYY B;  4EWC A;  3TD7 A;  2Q9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...