2IXNA

Crystal structure of the pp2a phosphatase activator ypa2 ptpa2
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
297
structure length
292
Chain Sequence
b'PEKRLLTPDDMKLWEESPTRAHFTKFIIDLAESVKGHENSQYKEPISESINSMMNLLSQIKDITQKHPVIKRFGKVEFRDFYDEVSRNSRKILRSEFPSLTDEQLEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYSYGIFNLSNDSTNLVLKVFIEYLKIMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKHLKPISIHNNELVEMFAHRYLYFGCIAFINKVKSSASLRWHSPMLDDISGVKTWSKVAEGMIKMYKAEVLSKLPIMQHFYFSEFLPC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN PHOSPHATASE 2A ACTIVATOR 2
publication title Crystal Structure of the Pp2A Phosphatase Activator: Implications for its Pp2A-Specific Ppiase Activity
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 97
structure length 292
sequence length 297
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03095 PTPA Phosphotyrosyl phosphate activator (PTPA) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2ixnA02
2IXNA 2HV7A 2IXMA 4LACB 2G62A 2IXPA 2HV6A 2IXOA 4NY3A
chains in the Genus database with same CATH superfamily
3AG1C 5T1DB 2OKUA 2EIJC 3Q6NA 4DRHB 5IY5C 3FDQA 3E70C 3SP1A 1C17M 1IW7F 1IZMA 3FXHA 1Y6DA 3TK0A 4I1OB 3GWLA 5L0GA 5KYYA 2H7OA 5HV9A 3JT1A 4JKVA 1T9KA 1FFTC 4JW1A 3DXJF 4WGZA 5JSLA 3U9JA 3WAQA 4AE4A 4CS9C 2XL6A 4JEBA 5A69A 5A6JA 3JSEO 3GM1A 3UMIA 3U8VA 3O55A 4PJMA 3RQGA 2P6VA 3LLIA 4DBRA 4LDQA 3K7DA 5DS5A 1H9TA 1BR1A 2OEXA 3F46A 1OXKA 1YA7O 3LLKA 5D91A 4U5BE 3EFOA 2NUPB 3AG4C 2A1DD 4XLPF 2EINC 1S7ZA 2WVQA 4BJ5C 3SZRA 2R7RA 3JCUQ 1M57C 3QMKA 4OINF 2YZSA 5K0IA 2W9YA 3RW0A 3O6XA 4E0IA 3HLZA 4G7OF 4Z9HA 2JX0A 3J06A 3DD7A 3AG2C 3MX3A 3W8IA 1OXBA 2EPMX 2G3VA 4OIQF 3CAXA 4FWVA 1ZW2A 3KPHA 2YL7A 3WHNA 5JT4A 4N6CA 2A6EF 4XEVA 1LI5A 1K04A 1HW2A 2OEVA 1M6TA 2WZLA 1BBHA 2CNWD 4PFOA 5JUAA 2TMVP 2L9JA 4O79A 3ABLC 3NKEA 1AVOB 1ZU4A 4XEFA 1EI7A 1NG1A 4XPWA 4CBEA 4JIOA 4Q4ZF 4ULVA 5BQIA 2R7SA 2XS8A 1EQ1A 5JVEA 4DXWA 2KK1A 3OA1A 2P0NA 3L8JA 3L8IA 2LFFA 2XS1A 4FESA 1HE1A 4WJ0A 4YN0B 5AC5A 1VYKA 3VF0A 2V3CC 1LKXA 4JJGA 5E33A 1M2OA 4O6MA 4MVRA 3UNGC 4CJOA 4YL0A 4G7ZF 2A0BA 2R7OA 3EPVA 2OQMA 3G4ZA 4MVSA 1J8YF 3SXKA 1BR4A 1M2VB 2JPUA 3GEEA 4FAPB 3U2LA 1D0XA 2YLDA 2AWCA 2Q9CA 4O6YA 1MMAA 1NBBA 2XLMA 3U3FA 5CI9A 1FNTc 1YZAA 4X0RA 1AEPA 1Y4CA 3WODF 2R7XA 3ZTMA 3EG9B 2HMZA 2Q00A 3A11A 3ZWIA 3F47A 2PFDA 3HNIA 1TWCA 1YYJA 4BJ6A 5EGYA 2YEVA 2KGOA 2DI3A 2XLVA 4JRZA 4MTGA 5L0DA 2XL4A 2XLOA 2YKZA 3BRJA 4J7YA 1SR2A 2DB4A 2R03A 1VLSA 3R7CA 3VYWA 4AK9A 3WG7C 1LI7A 2V26A 1V74B 3K1IA 1T01A 4NY3A 4EUKB 1YDIA 3LNMB 4EBJA 3C8GB 2NUTB 3EGDA 5A6BA 1VK5A 2LD6A 2HSBA 1YYXA 2Q3TA 2PP4A 3ASNC 1RMVA 3GEIA 4MVQA 1GM5A 1EA8A 2H7BA 1OKKA 4WGYA 3RQEA 4KBLA 1BR2A 2P7VA 4CS8A 1A0BA 1RKEA 1YLMA 2MHRA 5JP7A 2OJED 3JTLO 2XXAB 4W8PA 3EJNA 3T6BA 4C7OA 2H7VC 1JAFA 1V4AA 4G78A 3ZQVA 2VCAA 2IBFA 4NTAA 1MMGA 1OW6A 4J32B 1ZU5A 3SNHA 4IB4A 3ZVRA 3S28A 3Q7GA 5DLJA 4MVZA 2UUIA 2J9VA 4QI0A 4EKWA 4YT4A 3HNJA 3TQOA 2ICWG 4JZAA 1OR3A 2KQ9A 4LLCA 5F5HA 1Q0FA 2DYSC 2J7PA 2Y3BA 3VM6A 2H8AA 3TULA 3CEXA 5BQHA 5AGFA 3S29A 1LVKA 2Z15A 2BC5A 3QVZA 5DQZA 4NTFA 4XLNF 256BA 2WB7A 2WVNA 1OCZC 4JURI 4ULWA 3O39A 1T6IA 3HNKA 5CI8A 2XL8A 3DAFA 2W4BA 2A68F 2X51A 2CYDA 2J0XA 2LP4A 2EILC 2ZXPA 2J9WA 2J9UA 2G3KA 2OU6A 1JOGA 3DKAA 3KYJA 1Z23A 3EH2A 2IOQA 3POVA 3LNRA 3S9OA 4E0HA 3NG1A 4CSAC 5A6BD 2R9RB 3PHF2 4U5CE 5B3SC 2MWQA 2IXOA 1L3PA 4PJNA 3RVYA 1OKKD 3AG3C 2RD9A 3C63A 5L0HA 3RQFA 4LACB 2LK4A 2AWYA 2YLGA 4PJLA 4U5EE 1FR0A 1C03A 3RIPA 2J45A 2HS5A 3NMJA 3UMHA 4CJGA 5EK0A 5T3WA 3B0PA 2UUHA 3G4XA 3IEEA 3JRMO 5F28E 1Q0GA 1LPEA 5KYXA 1T6UA 4MQ9F 2NUPA 3ZC4A 3X1OA 3K1HA 1ORYA 2WZFA 1TWGA 4L6RA 4PJJA 4LDRA 3LAYA 4CX9A 3U0CA 2HFIA 3O10A 2Y3DA 3FHDA 1BZ4A 1ZYRF 1MNEA 4K7BA 1K40A 4CDVA 3M79A 2L6HA 1GGQA 2VC9A 2HSQA 3MFNA 5CIVA 1YAUO 2J7PD 1KTMA 2MYSA 3VAYA 2ZXOA 5L0IA 3KL4A 4HFKB 1ORSC 3PDMP 4IGGA 4GYTA 4OD5A 2PBEA 1APCA 3H65A 2Y3HA 1Q0MA 2A69F 2JD3A 3TJ6A 3LS0A 2HUJA 1NZEA 1YVIA 3H2UA 4NQFA 4CS9A 5JS5A 5L0CA 1HMOA 1TQGA 1LM3B 1QVXA 1I4ZA 4Z9JA 2Q7RA 4BG0A 1WATA 1O3UA 4N4WA 3RVZA 1HW1A 2YWAA 2Y69C 1G4US 4KNVA 2OOCA 1FAPB 1QZXA 1LS1A 1OCRC 4IJJA 2F22A 1HE9A 2C03A 1K05A 4U9DA 2EIKC 2YQYA 3FMSA 5FZTA 1Z7Qc 1D0YA 3NYLA 3DM5A 4YT2A 5KYNA 3DE8A 3MYFA 2WVOA 2WL8A 4YT8A 3N24A 4U9EA 3ABKC 2KSFA 2L6FA 1QQ3A 3CZ6A 4RD9A 2LFDA 5DQTA 1H7IA 3GM2A 4GQHA 1U89A 4IARA 3CSKA 4AL1A 1ZHWA 3C18A 4GEHA 4CS7A 3H2VA 5KYYB 1O87A 4JJFA 1VTMP 4JVSA 3QVYA 4D4NA 1Z5ZA 2XM4A 4ONSA 4CDYA 2O9XA 1YZCA 2YHSA 3UMKA 3V5ZA 5EHHA 3U8PA 1HMDA 1N1CA 4C3BA 4JE9A 4I44A 4OIOF 4PACA 4N6HA 2DGJA 1YARO 1KU2A 3AJMA 2E87A 3C62A 3MBGA 1SMYF 1DOVA 2Q9AA 4K0DA 2NUTA 4YL1A 4DBQA 2YVKA 3SEOA 4O7GA 4XWJA 4PFPA 3DMDA 2QE9A 5B3IA 1EKYA 1WOLA 3DWWA 3GWNA 2XLEA 1E2XA 4HFFB 2XXAA 2KYHA 1B68A 1D1CA 2W4MA 3HNLA 3MYIA 5D92A 5GPGB 4YWQA 1DOWA 3BEHA 1E86A 3IQCA 1PV3A 1ZHTA 1AUEA 2YL0A 3M4CA 1NFNA 1UG7A 3L34A 4BJ6C 3HJCA 4E7ZA 1WTYA 3ZTZA 2R7TA 2VCCA 4B6IA 3LEOA 3I4UA 1D0ZA 1ST6A 2R7WA 1Z3IX 5AC4A 1VYIA 2QLAA 2VB6A 3U5SA 4NCQA 5B1BC 3M15A 2HZ8A 3K1IC 2NPUA 2YRFA 3N2ZB 3NYJA 2GWWA 4P9FA 1PD0A 2KJGA 2YL1A 3AGUA 2FAPB 3LUTB 3RYLA 5DS4A 5HSWA 3V7OA 4JTAB 3AOUA 4EBBA 1JPNA 3GORA 2D4UA 2M4EA 4E7SA 2J9BA 4XEKA 4BEJA 4CS8C 2A0UA 2EIMC 3NMIA 3DI5A 5DS6A 1CPRA 5TJ5E 4MVUA 4IRUA 4MNDA 3ZG1A 2AU5A 4EIYA 4J7TA 5L0JA 3ZDLA 1A7DA 1NU9C 3FAJA 4JCZA 2J0WA 4JEAA 3U9MA 1OQCA 2ZXRA 4R32A 2CGEA 4ER9A 4DVZA 1A41A 2HJ3A 5KYUB 4DJ9A 2AVKA 3S90A 1MMNA 1A7EA 4F4BA 2XM0A 3JYHA 3RFYA 3X2QC 4G0HA 2IM8A 2IXMA 5DVWA 3W2WA 1Z63A 2LSEA 4LLEA 2KNHA 3EGDB 5KYWB 3EH1A 5COMA 4ZLCA 1WN0A 4PK4A 3QTHA 1YA9A 4DOZA 3OEOA 3IPMO 4CDAA 3DJUB 1RJ9B 3QZCA 2I15A 3FOPA 3G50A 1UFBA 4N06A 5COGA 1RKEB 3HKKA 2OG2A 3JZ0A 4IAQA 4JTCB 2ZD9A 1NLXA 1PCXA 3CQZA 5BUOA 4MVMA 3OWTA 3JRTA 3HTKC 1T5OA 2KW3C 4Q5SF 2C04A 2FFHA 3DE9A 2CW0F 1NSGB 4E17A 4OD4A 1CGME 1U0BB 2Y3GA 2QY9A 1I4YA 3KYIA 4A2NB 4MS2A 3NDBB 2CNWA 1TFOB 1Q0DA 1V54C 2HJMA 2Q9BA 4LDKA 2LIGA 3IHUA 4W8KA 4XPXA 3KKBA 2HMQA 1JR8A 1TKNA 2IXNA 2YLIA 3LEVA 5A6AA 1C02A 3T6GB 1D1BA 4MTFA 4KC9A 4HEAJ 3DZAA 3ZIBA 1SYQA 4PR9A 4EHPA 2CDQA 1FTSA 3ZQYA 3EHNA 2L6GA 2P1AA 4C3EA 3EGXB 3NYMA 1TR2A 2VCBA 1VMAA 1WGWA 3IQTA 2QTVA 3UGPA 2LCHA 4P6IC 4C3DA 1F1MA 1H6GA 3N0TA 1QPUA 3ITFA 1OR2A 3B0VC 2IXPA 2J46A 4I1MA 2XLDA 4RBNA 3LJBA 5JRAA 1VLTA 3I5QA 2P61A 2BE5F 3ASOC 1ZHZA 3JSZA 3K66A 3ECSA 3IQ6A 3K33A 4BJ5A 4H54A 3W4YA 4DRJB 1OW8A 2EPKX 1NFOA 2XLHA 1M2VA 5E3CA 1KNYA 3VRCA 4EBKA 3RKOF 3A9CA 1FMVA 1L7CA 3FOOA 1D1AA 4Z9IA 3SYNA 3T6JA 5KYXB 4OIPF 2I8BA 2L7AA 1JPJA 3I5PA 2R7UA 1MMDA 2EPNA 3DM9B 3EG9A 1WWPA 3NKDA 3AQCA 4AE4B 2NSFA 5A6KA 3TD7A 1XZQA 3GEHA 3AGTA 1CPQA 2ZXWC 1G4WR 3C8ZA 4JCHA 1Z6AA 1RKCA 2EPOA 2R05A 3LESA 3K6BA 5E3AA 4DRIB 4DVYP 1LE4A 1V55C 2HV7A 2PF4E 3QW0A 4NTBA 4BEMJ 1JRAA 3EFOB 4QDLA 3R2PA 1MQVA 4AL0A 3Q6MA 1LE2A 2J8WA 1E84A 3C8GA 3RF3A 1RXQA 2B0JA 1TWAA 2GFHA 2X0CA 4BJ1A 4YL3A 4KI2A 3Q7LA 1QLEC 1R4TA 1SZIA 3NRHA 3EQLF 2AP3A 3B9QA 3W8HA 3B0UX 5B1AC 3LS1A 4CIPA 1FMWA 3FVYA 4A4AA 4K1OA 3L0IA 1CGOA 3PCVA 4JTDB 5COFA 4QI2A 1MNDA 3TOLA 3KMIA 2IYLD 3GODA 2XSEA 4O6NA 4I3MA 3UR3C 1HY5A 3RH3A 1SF8A 2QNLA 2OCCC 2ZPAA 3SXYA 2L81A 3EZHA 2LQGA 1XWJA 2PNOA 4LERA 4D4XA 4CIHA 4XTKA 2B0HA 3B71A 4P9TA 4H4KC 4BPMA 4UDVA 1CGNA 2PX3A 3KH2A 2VH3A 2BL2A 1GQAA 3ATPA 2NSGA 4ZLDA 1H9GA 5KYUA 4E18A 1ZHXA 4MVOA 2ETSA 2HKVA 3DJNB 4IWBA 3AQBA 2D5RB 3GANA 1FFHA 3T4RA 2XRHA 2GDCA 3E9VA 3T9OA 1GS9A 1QSPA 3C8GD 4EWCA 4M63A 5BQGA 1I5NA 5KYWA 5L0FA 2ASRA 3FAPB 3QW1A 5T3TA 4OIRF 1LIHA 1RJ9A 4XQ1A 2OJQA 1W2WA 4U5DE 3GM3A 1LS4A 1ZVZA 2VASA 1VB5A 5L3VA 3L1MA 1M56C 1O5HA 2G62A 2R7QA 4KNWA 4NC3A 4FX5A 2Y39A 4YK5A 4G7HF 4U5FE 1TFKB 3EZIA 1QKRA 4IAOA 3DAGA 4U5GA 5E2QA 3US6A 2YL3A 1XZPA 4ANJA 3S84A 2A6HF 1Q0KA 2FGYA 3M1CB 1J8MF 1ZW3A 2RSEB 3B29A 3IQ5A 1ZZPA 4YJWA 4HE8D 3U3BA 1E85A 2PX0A 1TWHA 3U2MA 1OW7A 2R02A 4JC7A 1ORJA 1JMWA 4XPYA 1R5ID 1WASA 5FCLA 4C7OB 5F5FA 3C7JA 1OCOC 1RCPA 1S05A 4CSAA 5JLIA 4YT5A 3PMRA 2EPLX 2WZGA 3JYYA 2XLWA 3EGXA 3SXMA 3S0XA 4RDAA 4Q7CA 4BJTA 1A7VA 3ZSUA 4AX2A 2NG1A 2QUPA 3SXZA 2DYRC 1VOMA 2R25A 3M4BA 1E83A 1U6HA 2GA0A 2M64A 4MTOA 4MW8A 2Q4FA 3TOMA 3V5YA 4WABA 5L3QA 3EHMA 2R7VA 1YJGA 1G5ZA 1G8XA 2GAQA 2W45A 4J30B 3S27A 3TJ5A 3W2VA 3NMKA 1BDJB 1NU7D 3MLGA 1ZHYA 4MW3A 1OCCC 3V5XA 1T6QA 2KC3A 3ABMC 2HV6A 3UGOA 2CCYA 4U5HA 1PD1A
chains in the Genus database with same CATH topology
3AG1C 5T1DB 2EIJC 3Q6NA 5IY5C 3FDQA 3E70C 3SP1A 1IW7F 1IZMA 5KYYA 4I1OB 2H7OA 3JT1A 1FFTC 4JW1A 3DXJF 4AE4A 4CS9C 3UMIA 4PJMA 2P6VA 3LLIA 4DBRA 5DS5A 3K7DA 1BR1A 3F46A 3LLKA 5D91A 4U5BE 3EFOA 2NUPB 3AG4C 2A1DD 4XLPF 2EINC 1S7ZA 2WVQA 4BJ5C 3SZRA 2R7RA 3JCUQ 1M57C 3QMKA 4OINF 2YZSA 4G7OF 2W9YA 3O6XA 3HLZA 3DD7A 3AG2C 3MX3A 3W8IA 2G3VA 4OIQF 4FWVA 2A6EF 2WZLA 2CNWD 4PFOA 2L9JA 4O79A 3ABLC 3NKEA 1ZU4A 4CBEA 1NG1A 4Q4ZF 2R7SA 3OA1A 4YN0B 4FESA 4WJ0A 2V3CC 1VYKA 1LKXA 4JJGA 5E33A 1M2OA 4O6MA 3UNGC 3B0VC 4G7ZF 2R7OA 3EPVA 1J8YF 1BR4A 1M2VB 1D0XA 2Q9CA 4O6YA 1MMAA 5CI9A 4X0RA 3WODF 2R7XA 3EG9B 3F47A 2PFDA 1TWCA 4BJ6A 5EGYA 2YEVA 2KGOA 2XL4A 3VYWA 4AK9A 3WG7C 2V26A 4NY3A 2NUTB 3EGDA 1VK5A 2Q3TA 2PP4A 3ASNC 2H7BA 1OKKA 4KBLA 1BR2A 2P7VA 4CS8A 2XXAB 3EJNA 3T6BA 4C7OA 2H7VC 1MMGA 4J32B 1ZU5A 3SNHA 3ZVRA 3S28A 3Q7GA 5DLJA 2J9VA 4QI0A 4YT4A 4JZAA 4LLCA 2KQ9A 5F5HA 2DYSC 2Y3BA 2J7PA 3S29A 1LVKA 2Z15A 5DQZA 4XLNF 4OIPF 2WB7A 2WVNA 1OCZC 4JURI 4ULWA 3O39A 5CI8A 3DAFA 2W4BA 2A68F 2X51A 2J0XA 2ZXPA 2EILC 2J9WA 2J9UA 2G3KA 1Z23A 3EH2A 2IOQA 3POVA 3LNRA 3NG1A 4CSAC 3PHF2 4U5CE 5B3SC 2MWQA 2IXOA 4PJNA 1OKKD 3AG3C 4LACB 4U5EE 4PJLA 3RIPA 2J45A 3UMHA 5T3WA 3B0PA 3IEEA 5KYXA 4MQ9F 2NUPA 3X1OA 3K1HA 2WZFA 1TWGA 4PJJA 3LAYA 2Y3DA 3FHDA 1ZYRF 4K7BA 2J7PD 2MYSA 3VAYA 2ZXOA 3KL4A 4HFKB 4GYTA 4OD5A 3H65A 2Y3HA 2A69F 2JD3A 3LS0A 1NZEA 4CS9A 4BG0A 2Y69C 4KNVA 1QZXA 1LS1A 1OCRC 4IJJA 2C03A 5FCLA 2EIKC 4YT2A 5KYNA 1D0YA 3NYLA 3DM5A 2WVOA 2WL8A 4YT8A 3N24A 3ABKC 3CZ6A 4RD9A 5DQTA 3CSKA 1ZHWA 4GEHA 4CS7A 5KYYB 1O87A 4JJFA 4JVSA 1Z5ZA 2O9XA 2YHSA 3UMKA 5EHHA 1N1CA 4C3BA 4I44A 4OIOF 2DGJA 1KU2A 2E87A 1SMYF 2Q9AA 4K0DA 2NUTA 3SEOA 4O7GA 4XWJA 4PFPA 3DMDA 4HFFB 2XXAA 1D1CA 2W4MA 4YWQA 5D92A 1ZHTA 3L34A 4BJ6C 3HJCA 4E7ZA 2R7TA 4B6IA 3I4UA 1D0ZA 1ST6A 2R7WA 1Z3IX 1VYIA 2VB6A 5B1BC 3K1IC 3N2ZB 1PD1A 3NYJA 1PD0A 2KJGA 3RYLA 5DS4A 5HSWA 3V7OA 4EBBA 1JPNA 2M4EA 4E7SA 4BEJA 4CS8C 2EIMC 5DS6A 4IRUA 4MNDA 3ZG1A 1NU9C 3FAJA 2J0WA 2ZXRA 2CGEA 4DVZA 5KYUB 1MMNA 4F4BA 3JYHA 3RFYA 3X2QC 4G0HA 2IXMA 5DVWA 1Z63A 3W2WA 2LSEA 4LLEA 2KNHA 3EGDB 5KYWB 3EH1A 4ZLCA 4PK4A 4DOZA 3OEOA 3DJUB 1RJ9B 3QZCA 4N06A 2OG2A 1PCXA 3CQZA 5BUOA 3OWTA 3JRTA 3HTKC 2KW3C 4Q5SF 2C04A 2FFHA 2CW0F 4OD4A 2Y3GA 2QY9A 4A2NB 3NDBB 2CNWA 1V54C 2Q9BA 4W8KA 3KKBA 2IXNA 1TKNA 3LEVA 1D1BA 4KC9A 4HEAJ 3DZAA 3ZIBA 2CDQA 1FTSA 3EHNA 4C3EA 3EGXB 3NYMA 1TR2A 1VMAA 1WGWA 2QTVA 3UGPA 4P6IC 4C3DA 3N0TA 3ITFA 2IXPA 2J46A 4I1MA 4RBNA 3LJBA 3I5QA 2BE5F 3ASOC 1ZHZA 3JSZA 3K66A 3ECSA 3K33A 4BJ5A 1M2VA 5E3CA 3RKOF 1FMVA 5KYXB 1D1AA 3T6JA 3SYNA 2I8BA 1JPJA 3I5PA 2R7UA 1MMDA 3DM9B 3EG9A 3NKDA 3AQCA 4AE4B 3TD7A 2ZXWC 4JCHA 1Z6AA 3LESA 3K6BA 5E3AA 4DVYP 1V55C 2HV7A 2PF4E 3EFOB 4QDLA 3Q6MA 2B0JA 1TWAA 2GFHA 4BJ1A 4KI2A 3Q7LA 1QLEC 1SZIA 3NRHA 3EQLF 3W8HA 3B9QA 3B0UX 5B1AC 3LS1A 1FMWA 3FVYA 3L0IA 4QI2A 1MNDA 3KMIA 2IYLD 3GODA 2XSEA 4O6NA 4I3MA 3UR3C 3RH3A 1SF8A 2OCCC 2ZPAA 2L81A 3EZHA 4LERA 4CIHA 4XTKA 4H4KC 2PX3A 3KH2A 2VH3A 4ZLDA 5KYUA 1ZHXA 4IWBA 3DJNB 3AQBA 2D5RB 3GANA 1FFHA 3T4RA 2XRHA 3E9VA 5KYWA 4EWCA 4M63A 5T3TA 4OIRF 1RJ9A 1W2WA 4U5DE 2VASA 5L3VA 1M56C 1O5HA 2G62A 2R7QA 4KNWA 4FX5A 2Y39A 4G7HF 4U5FE 3EZIA 4IAOA 3DAGA 4U5GA 5E2QA 4ANJA 2A6HF 2FGYA 3M1CB 1J8MF 4YJWA 4HE8D 2PX0A 1TWHA 5F5FA 4C7OB 1OCOC 4CSAA 4YT5A 3PMRA 2WZGA 3S0XA 3EGXA 4RDAA 4Q7CA 4BJTA 3ZSUA 4AX2A 2NG1A 2DYRC 1VOMA 5L3QA 3EHMA 2R7VA 2W45A 1G8XA 4J30B 4DBQA 3S27A 3W2VA 3ZC4A 1NU7D 3MLGA 1ZHYA 1OCCC 3ABMC 2HV6A 3UGOA 4U5HA 1MNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IXN A;  2HV7 A;  2IXM A;  4LAC B;  2G62 A;  2IXP A;  2HV6 A;  2IXO A;  4NY3 A; 
#chains in the Genus database with same CATH topology
 3AG1 C;  5T1D B;  2OKU A;  2EIJ C;  3Q6N A;  4DRH B;  5IY5 C;  3FDQ A;  3E70 C;  3SP1 A;  1C17 M;  1IW7 F;  1IZM A;  3FXH A;  1Y6D A;  3TK0 A;  4I1O B;  3GWL A;  5L0G A;  5KYY A;  2H7O A;  5HV9 A;  3JT1 A;  4JKV A;  1T9K A;  1FFT C;  4JW1 A;  3DXJ F;  4WGZ A;  5JSL A;  3U9J A;  3WAQ A;  4AE4 A;  4CS9 C;  2XL6 A;  4JEB A;  5A69 A;  5A6J A;  3JSE O;  3GM1 A;  3UMI A;  3U8V A;  3O55 A;  4PJM A;  3RQG A;  2P6V A;  3LLI A;  4DBR A;  4LDQ A;  3K7D A;  5DS5 A;  1H9T A;  1BR1 A;  2OEX A;  3F46 A;  1OXK A;  1YA7 O;  3LLK A;  5D91 A;  4U5B E;  3EFO A;  2NUP B;  3AG4 C;  2A1D D;  4XLP F;  2EIN C;  1S7Z A;  2WVQ A;  4BJ5 C;  3SZR A;  2R7R A;  3JCU Q;  1M57 C;  3QMK A;  4OIN F;  2YZS A;  5K0I A;  2W9Y A;  3RW0 A;  3O6X A;  4E0I A;  3HLZ A;  4G7O F;  4Z9H A;  2JX0 A;  3J06 A;  3DD7 A;  3AG2 C;  3MX3 A;  3W8I A;  1OXB A;  2EPM X;  2G3V A;  4OIQ F;  3CAX A;  4FWV A;  1ZW2 A;  3KPH A;  2YL7 A;  3WHN A;  5JT4 A;  4N6C A;  2A6E F;  4XEV A;  1LI5 A;  1K04 A;  1HW2 A;  2OEV A;  1M6T A;  2WZL A;  1BBH A;  2CNW D;  4PFO A;  5JUA A;  2TMV P;  2L9J A;  4O79 A;  3ABL C;  3NKE A;  1AVO B;  1ZU4 A;  4XEF A;  1EI7 A;  1NG1 A;  4XPW A;  4CBE A;  4JIO A;  4Q4Z F;  4ULV A;  5BQI A;  2R7S A;  2XS8 A;  1EQ1 A;  5JVE A;  4DXW A;  2KK1 A;  3OA1 A;  2P0N A;  3L8J A;  3L8I A;  2LFF A;  2XS1 A;  4FES A;  1HE1 A;  4WJ0 A;  4YN0 B;  5AC5 A;  1VYK A;  3VF0 A;  2V3C C;  1LKX A;  4JJG A;  5E33 A;  1M2O A;  4O6M A;  4MVR A;  3UNG C;  4CJO A;  4YL0 A;  4G7Z F;  2A0B A;  2R7O A;  3EPV A;  2OQM A;  3G4Z A;  4MVS A;  1J8Y F;  3SXK A;  1BR4 A;  1M2V B;  2JPU A;  3GEE A;  4FAP B;  3U2L A;  1D0X A;  2YLD A;  2AWC A;  2Q9C A;  4O6Y A;  1MMA A;  1NBB A;  2XLM A;  3U3F A;  5CI9 A;  1FNT c;  1YZA A;  4X0R A;  1AEP A;  1Y4C A;  3WOD F;  2R7X A;  3ZTM A;  3EG9 B;  2HMZ A;  2Q00 A;  3A11 A;  3ZWI A;  3F47 A;  2PFD A;  3HNI A;  1TWC A;  1YYJ A;  4BJ6 A;  5EGY A;  2YEV A;  2KGO A;  2DI3 A;  2XLV A;  4JRZ A;  4MTG A;  5L0D A;  2XL4 A;  2XLO A;  2YKZ A;  3BRJ A;  4J7Y A;  1SR2 A;  2DB4 A;  2R03 A;  1VLS A;  3R7C A;  3VYW A;  4AK9 A;  3WG7 C;  1LI7 A;  2V26 A;  1V74 B;  3K1I A;  1T01 A;  4NY3 A;  4EUK B;  1YDI A;  3LNM B;  4EBJ A;  3C8G B;  2NUT B;  3EGD A;  5A6B A;  1VK5 A;  2LD6 A;  2HSB A;  1YYX A;  2Q3T A;  2PP4 A;  3ASN C;  1RMV A;  3GEI A;  4MVQ A;  1GM5 A;  1EA8 A;  2H7B A;  1OKK A;  4WGY A;  3RQE A;  4KBL A;  1BR2 A;  2P7V A;  4CS8 A;  1A0B A;  1RKE A;  1YLM A;  2MHR A;  5JP7 A;  2OJE D;  3JTL O;  2XXA B;  4W8P A;  3EJN A;  3T6B A;  4C7O A;  2H7V C;  1JAF A;  1V4A A;  4G78 A;  3ZQV A;  2VCA A;  2IBF A;  4NTA A;  1MMG A;  1OW6 A;  4J32 B;  1ZU5 A;  3SNH A;  4IB4 A;  3ZVR A;  3S28 A;  3Q7G A;  5DLJ A;  4MVZ A;  2UUI A;  2J9V A;  4QI0 A;  4EKW A;  4YT4 A;  3HNJ A;  3TQO A;  2ICW G;  4JZA A;  1OR3 A;  2KQ9 A;  4LLC A;  5F5H A;  1Q0F A;  2DYS C;  2J7P A;  2Y3B A;  3VM6 A;  2H8A A;  3TUL A;  3CEX A;  5BQH A;  5AGF A;  3S29 A;  1LVK A;  2Z15 A;  2BC5 A;  3QVZ A;  5DQZ A;  4NTF A;  4XLN F;  256B A;  2WB7 A;  2WVN A;  1OCZ C;  4JUR I;  4ULW A;  3O39 A;  1T6I A;  3HNK A;  5CI8 A;  2XL8 A;  3DAF A;  2W4B A;  2A68 F;  2X51 A;  2CYD A;  2J0X A;  2LP4 A;  2EIL C;  2ZXP A;  2J9W A;  2J9U A;  2G3K A;  2OU6 A;  1JOG A;  3DKA A;  3KYJ A;  1Z23 A;  3EH2 A;  2IOQ A;  3POV A;  3LNR A;  3S9O A;  4E0H A;  3NG1 A;  4CSA C;  5A6B D;  2R9R B;  3PHF 2;  4U5C E;  5B3S C;  2MWQ A;  2IXO A;  1L3P A;  4PJN A;  3RVY A;  1OKK D;  3AG3 C;  2RD9 A;  3C63 A;  5L0H A;  3RQF A;  4LAC B;  2LK4 A;  2AWY A;  2YLG A;  4PJL A;  4U5E E;  1FR0 A;  1C03 A;  3RIP A;  2J45 A;  2HS5 A;  3NMJ A;  3UMH A;  4CJG A;  5EK0 A;  5T3W A;  3B0P A;  2UUH A;  3G4X A;  3IEE A;  3JRM O;  5F28 E;  1Q0G A;  1LPE A;  5KYX A;  1T6U A;  4MQ9 F;  2NUP A;  3ZC4 A;  3X1O A;  3K1H A;  1ORY A;  2WZF A;  1TWG A;  4L6R A;  4PJJ A;  4LDR A;  3LAY A;  4CX9 A;  3U0C A;  2HFI A;  3O10 A;  2Y3D A;  3FHD A;  1BZ4 A;  1ZYR F;  1MNE A;  4K7B A;  1K40 A;  4CDV A;  3M79 A;  2L6H A;  1GGQ A;  2VC9 A;  2HSQ A;  3MFN A;  5CIV A;  1YAU O;  2J7P D;  1KTM A;  2MYS A;  3VAY A;  2ZXO A;  5L0I A;  3KL4 A;  4HFK B;  1ORS C;  3PDM P;  4IGG A;  4GYT A;  4OD5 A;  2PBE A;  1APC A;  3H65 A;  2Y3H A;  1Q0M A;  2A69 F;  2JD3 A;  3TJ6 A;  3LS0 A;  2HUJ A;  1NZE A;  1YVI A;  3H2U A;  4NQF A;  4CS9 A;  5JS5 A;  5L0C A;  1HMO A;  1TQG A;  1LM3 B;  1QVX A;  1I4Z A;  4Z9J A;  2Q7R A;  4BG0 A;  1WAT A;  1O3U A;  4N4W A;  3RVZ A;  1HW1 A;  2YWA A;  2Y69 C;  1G4U S;  4KNV A;  2OOC A;  1FAP B;  1QZX A;  1LS1 A;  1OCR C;  4IJJ A;  2F22 A;  1HE9 A;  2C03 A;  1K05 A;  4U9D A;  2EIK C;  2YQY A;  3FMS A;  5FZT A;  1Z7Q c;  1D0Y A;  3NYL A;  3DM5 A;  4YT2 A;  5KYN A;  3DE8 A;  3MYF A;  2WVO A;  2WL8 A;  4YT8 A;  3N24 A;  4U9E A;  3ABK C;  2KSF A;  2L6F A;  1QQ3 A;  3CZ6 A;  4RD9 A;  2LFD A;  5DQT A;  1H7I A;  3GM2 A;  4GQH A;  1U89 A;  4IAR A;  3CSK A;  4AL1 A;  1ZHW A;  3C18 A;  4GEH A;  4CS7 A;  3H2V A;  5KYY B;  1O87 A;  4JJF A;  1VTM P;  4JVS A;  3QVY A;  4D4N A;  1Z5Z A;  2XM4 A;  4ONS A;  4CDY A;  2O9X A;  1YZC A;  2YHS A;  3UMK A;  3V5Z A;  5EHH A;  3U8P A;  1HMD A;  1N1C A;  4C3B A;  4JE9 A;  4I44 A;  4OIO F;  4PAC A;  4N6H A;  2DGJ A;  1YAR O;  1KU2 A;  3AJM A;  2E87 A;  3C62 A;  3MBG A;  1SMY F;  1DOV A;  2Q9A A;  4K0D A;  2NUT A;  4YL1 A;  4DBQ A;  2YVK A;  3SEO A;  4O7G A;  4XWJ A;  4PFP A;  3DMD A;  2QE9 A;  5B3I A;  1EKY A;  1WOL A;  3DWW A;  3GWN A;  2XLE A;  1E2X A;  4HFF B;  2XXA A;  2KYH A;  1B68 A;  1D1C A;  2W4M A;  3HNL A;  3MYI A;  5D92 A;  5GPG B;  4YWQ A;  1DOW A;  3BEH A;  1E86 A;  3IQC A;  1PV3 A;  1ZHT A;  1AUE A;  2YL0 A;  3M4C A;  1NFN A;  1UG7 A;  3L34 A;  4BJ6 C;  3HJC A;  4E7Z A;  1WTY A;  3ZTZ A;  2R7T A;  2VCC A;  4B6I A;  3LEO A;  3I4U A;  1D0Z A;  1ST6 A;  2R7W A;  1Z3I X;  5AC4 A;  1VYI A;  2QLA A;  2VB6 A;  3U5S A;  4NCQ A;  5B1B C;  3M15 A;  2HZ8 A;  3K1I C;  2NPU A;  2YRF A;  3N2Z B;  3NYJ A;  2GWW A;  4P9F A;  1PD0 A;  2KJG A;  2YL1 A;  3AGU A;  2FAP B;  3LUT B;  3RYL A;  5DS4 A;  5HSW A;  3V7O A;  4JTA B;  3AOU A;  4EBB A;  1JPN A;  3GOR A;  2D4U A;  2M4E A;  4E7S A;  2J9B A;  4XEK A;  4BEJ A;  4CS8 C;  2A0U A;  2EIM C;  3NMI A;  3DI5 A;  5DS6 A;  1CPR A;  5TJ5 E;  4MVU A;  4IRU A;  4MND A;  3ZG1 A;  2AU5 A;  4EIY A;  4J7T A;  5L0J A;  3ZDL A;  1A7D A;  1NU9 C;  3FAJ A;  4JCZ A;  2J0W A;  4JEA A;  3U9M A;  1OQC A;  2ZXR A;  4R32 A;  2CGE A;  4ER9 A;  4DVZ A;  1A41 A;  2HJ3 A;  5KYU B;  4DJ9 A;  2AVK A;  3S90 A;  1MMN A;  1A7E A;  4F4B A;  2XM0 A;  3JYH A;  3RFY A;  3X2Q C;  4G0H A;  2IM8 A;  2IXM A;  5DVW A;  3W2W A;  1Z63 A;  2LSE A;  4LLE A;  2KNH A;  3EGD B;  5KYW B;  3EH1 A;  5COM A;  4ZLC A;  1WN0 A;  4PK4 A;  3QTH A;  1YA9 A;  4DOZ A;  3OEO A;  3IPM O;  4CDA A;  3DJU B;  1RJ9 B;  3QZC A;  2I15 A;  3FOP A;  3G50 A;  1UFB A;  4N06 A;  5COG A;  1RKE B;  3HKK A;  2OG2 A;  3JZ0 A;  4IAQ A;  4JTC B;  2ZD9 A;  1NLX A;  1PCX A;  3CQZ A;  5BUO A;  4MVM A;  3OWT A;  3JRT A;  3HTK C;  1T5O A;  2KW3 C;  4Q5S F;  2C04 A;  2FFH A;  3DE9 A;  2CW0 F;  1NSG B;  4E17 A;  4OD4 A;  1CGM E;  1U0B B;  2Y3G A;  2QY9 A;  1I4Y A;  3KYI A;  4A2N B;  4MS2 A;  3NDB B;  2CNW A;  1TFO B;  1Q0D A;  1V54 C;  2HJM A;  2Q9B A;  4LDK A;  2LIG A;  3IHU A;  4W8K A;  4XPX A;  3KKB A;  2HMQ A;  1JR8 A;  1TKN A;  2IXN A;  2YLI A;  3LEV A;  5A6A A;  1C02 A;  3T6G B;  1D1B A;  4MTF A;  4KC9 A;  4HEA J;  3DZA A;  3ZIB A;  1SYQ A;  4PR9 A;  4EHP A;  2CDQ A;  1FTS A;  3ZQY A;  3EHN A;  2L6G A;  2P1A A;  4C3E A;  3EGX B;  3NYM A;  1TR2 A;  2VCB A;  1VMA A;  1WGW A;  3IQT A;  2QTV A;  3UGP A;  2LCH A;  4P6I C;  4C3D A;  1F1M A;  1H6G A;  3N0T A;  1QPU A;  3ITF A;  1OR2 A;  3B0V C;  2IXP A;  2J46 A;  4I1M A;  2XLD A;  4RBN A;  3LJB A;  5JRA A;  1VLT A;  3I5Q A;  2P61 A;  2BE5 F;  3ASO C;  1ZHZ A;  3JSZ A;  3K66 A;  3ECS A;  3IQ6 A;  3K33 A;  4BJ5 A;  4H54 A;  3W4Y A;  4DRJ B;  1OW8 A;  2EPK X;  1NFO A;  2XLH A;  1M2V A;  5E3C A;  1KNY A;  3VRC A;  4EBK A;  3RKO F;  3A9C A;  1FMV A;  1L7C A;  3FOO A;  1D1A A;  4Z9I A;  3SYN A;  3T6J A;  5KYX B;  4OIP F;  2I8B A;  2L7A A;  1JPJ A;  3I5P A;  2R7U A;  1MMD A;  2EPN A;  3DM9 B;  3EG9 A;  1WWP A;  3NKD A;  3AQC A;  4AE4 B;  2NSF A;  5A6K A;  3TD7 A;  1XZQ A;  3GEH A;  3AGT A;  1CPQ A;  2ZXW C;  1G4W R;  3C8Z A;  4JCH A;  1Z6A A;  1RKC A;  2EPO A;  2R05 A;  3LES A;  3K6B A;  5E3A A;  4DRI B;  4DVY P;  1LE4 A;  1V55 C;  2HV7 A;  2PF4 E;  3QW0 A;  4NTB A;  4BEM J;  1JRA A;  3EFO B;  4QDL A;  3R2P A;  1MQV A;  4AL0 A;  3Q6M A;  1LE2 A;  2J8W A;  1E84 A;  3C8G A;  3RF3 A;  1RXQ A;  2B0J A;  1TWA A;  2GFH A;  2X0C A;  4BJ1 A;  4YL3 A;  4KI2 A;  3Q7L A;  1QLE C;  1R4T A;  1SZI A;  3NRH A;  3EQL F;  2AP3 A;  3B9Q A;  3W8H A;  3B0U X;  5B1A C;  3LS1 A;  4CIP A;  1FMW A;  3FVY A;  4A4A A;  4K1O A;  3L0I A;  1CGO A;  3PCV A;  4JTD B;  5COF A;  4QI2 A;  1MND A;  3TOL A;  3KMI A;  2IYL D;  3GOD A;  2XSE A;  4O6N A;  4I3M A;  3UR3 C;  1HY5 A;  3RH3 A;  1SF8 A;  2QNL A;  2OCC C;  2ZPA A;  3SXY A;  2L81 A;  3EZH A;  2LQG A;  1XWJ A;  2PNO A;  4LER A;  4D4X A;  4CIH A;  4XTK A;  2B0H A;  3B71 A;  4P9T A;  4H4K C;  4BPM A;  4UDV A;  1CGN A;  2PX3 A;  3KH2 A;  2VH3 A;  2BL2 A;  1GQA A;  3ATP A;  2NSG A;  4ZLD A;  1H9G A;  5KYU A;  4E18 A;  1ZHX A;  4MVO A;  2ETS A;  2HKV A;  3DJN B;  4IWB A;  3AQB A;  2D5R B;  3GAN A;  1FFH A;  3T4R A;  2XRH A;  2GDC A;  3E9V A;  3T9O A;  1GS9 A;  1QSP A;  3C8G D;  4EWC A;  4M63 A;  5BQG A;  1I5N A;  5KYW A;  5L0F A;  2ASR A;  3FAP B;  3QW1 A;  5T3T A;  4OIR F;  1LIH A;  1RJ9 A;  4XQ1 A;  2OJQ A;  1W2W A;  4U5D E;  3GM3 A;  1LS4 A;  1ZVZ A;  2VAS A;  1VB5 A;  5L3V A;  3L1M A;  1M56 C;  1O5H A;  2G62 A;  2R7Q A;  4KNW A;  4NC3 A;  4FX5 A;  2Y39 A;  4YK5 A;  4G7H F;  4U5F E;  1TFK B;  3EZI A;  1QKR A;  4IAO A;  3DAG A;  4U5G A;  5E2Q A;  3US6 A;  2YL3 A;  1XZP A;  4ANJ A;  3S84 A;  2A6H F;  1Q0K A;  2FGY A;  3M1C B;  1J8M F;  1ZW3 A;  2RSE B;  3B29 A;  3IQ5 A;  1ZZP A;  4YJW A;  4HE8 D;  3U3B A;  1E85 A;  2PX0 A;  1TWH A;  3U2M A;  1OW7 A;  2R02 A;  4JC7 A;  1ORJ A;  1JMW A;  4XPY A;  1R5I D;  1WAS A;  5FCL A;  4C7O B;  5F5F A;  3C7J A;  1OCO C;  1RCP A;  1S05 A;  4CSA A;  5JLI A;  4YT5 A;  3PMR A;  2EPL X;  2WZG A;  3JYY A;  2XLW A;  3EGX A;  3SXM A;  3S0X A;  4RDA A;  4Q7C A;  4BJT A;  1A7V A;  3ZSU A;  4AX2 A;  2NG1 A;  2QUP A;  3SXZ A;  2DYR C;  1VOM A;  2R25 A;  3M4B A;  1E83 A;  1U6H A;  2GA0 A;  2M64 A;  4MTO A;  4MW8 A;  2Q4F A;  3TOM A;  3V5Y A;  4WAB A;  5L3Q A;  3EHM A;  2R7V A;  1YJG A;  1G5Z A;  1G8X A;  2GAQ A;  2W45 A;  4J30 B;  3S27 A;  3TJ5 A;  3W2V A;  3NMK A;  1BDJ B;  1NU7 D;  3MLG A;  1ZHY A;  4MW3 A;  1OCC C;  3V5X A;  1T6Q A;  2KC3 A;  3ABM C;  2HV6 A;  3UGO A;  2CCY A;  4U5H A;  1PD1 A; 
#chains in the Genus database with same CATH homology
 3AG1 C;  5T1D B;  2EIJ C;  3Q6N A;  5IY5 C;  3FDQ A;  3E70 C;  3SP1 A;  1IW7 F;  1IZM A;  5KYY A;  4I1O B;  2H7O A;  3JT1 A;  1FFT C;  4JW1 A;  3DXJ F;  4AE4 A;  4CS9 C;  3UMI A;  4PJM A;  2P6V A;  3LLI A;  4DBR A;  5DS5 A;  3K7D A;  1BR1 A;  3F46 A;  3LLK A;  5D91 A;  4U5B E;  3EFO A;  2NUP B;  3AG4 C;  2A1D D;  4XLP F;  2EIN C;  1S7Z A;  2WVQ A;  4BJ5 C;  3SZR A;  2R7R A;  3JCU Q;  1M57 C;  3QMK A;  4OIN F;  2YZS A;  4G7O F;  2W9Y A;  3O6X A;  3HLZ A;  3DD7 A;  3AG2 C;  3MX3 A;  3W8I A;  2G3V A;  4OIQ F;  4FWV A;  2A6E F;  2WZL A;  2CNW D;  4PFO A;  2L9J A;  4O79 A;  3ABL C;  3NKE A;  1ZU4 A;  4CBE A;  1NG1 A;  4Q4Z F;  2R7S A;  3OA1 A;  4YN0 B;  4FES A;  4WJ0 A;  2V3C C;  1VYK A;  1LKX A;  4JJG A;  5E33 A;  1M2O A;  4O6M A;  3UNG C;  3B0V C;  4G7Z F;  2R7O A;  3EPV A;  1J8Y F;  1BR4 A;  1M2V B;  1D0X A;  2Q9C A;  4O6Y A;  1MMA A;  5CI9 A;  4X0R A;  3WOD F;  2R7X A;  3EG9 B;  3F47 A;  2PFD A;  1TWC A;  4BJ6 A;  5EGY A;  2YEV A;  2KGO A;  2XL4 A;  3VYW A;  4AK9 A;  3WG7 C;  2V26 A;  4NY3 A;  2NUT B;  3EGD A;  1VK5 A;  2Q3T A;  2PP4 A;  3ASN C;  2H7B A;  1OKK A;  4KBL A;  1BR2 A;  2P7V A;  4CS8 A;  2XXA B;  3EJN A;  3T6B A;  4C7O A;  2H7V C;  1MMG A;  4J32 B;  1ZU5 A;  3SNH A;  3ZVR A;  3S28 A;  3Q7G A;  5DLJ A;  2J9V A;  4QI0 A;  4YT4 A;  4JZA A;  4LLC A;  2KQ9 A;  5F5H A;  2DYS C;  2Y3B A;  2J7P A;  3S29 A;  1LVK A;  2Z15 A;  5DQZ A;  4XLN F;  4OIP F;  2WB7 A;  2WVN A;  1OCZ C;  4JUR I;  4ULW A;  3O39 A;  5CI8 A;  3DAF A;  2W4B A;  2A68 F;  2X51 A;  2J0X A;  2ZXP A;  2EIL C;  2J9W A;  2J9U A;  2G3K A;  1Z23 A;  3EH2 A;  2IOQ A;  3POV A;  3LNR A;  3NG1 A;  4CSA C;  3PHF 2;  4U5C E;  5B3S C;  2MWQ A;  2IXO A;  4PJN A;  1OKK D;  3AG3 C;  4LAC B;  4U5E E;  4PJL A;  3RIP A;  2J45 A;  3UMH A;  5T3W A;  3B0P A;  3IEE A;  5KYX A;  4MQ9 F;  2NUP A;  3X1O A;  3K1H A;  2WZF A;  1TWG A;  4PJJ A;  3LAY A;  2Y3D A;  3FHD A;  1ZYR F;  4K7B A;  2J7P D;  2MYS A;  3VAY A;  2ZXO A;  3KL4 A;  4HFK B;  4GYT A;  4OD5 A;  3H65 A;  2Y3H A;  2A69 F;  2JD3 A;  3LS0 A;  1NZE A;  4CS9 A;  4BG0 A;  2Y69 C;  4KNV A;  1QZX A;  1LS1 A;  1OCR C;  4IJJ A;  2C03 A;  5FCL A;  2EIK C;  4YT2 A;  5KYN A;  1D0Y A;  3NYL A;  3DM5 A;  2WVO A;  2WL8 A;  4YT8 A;  3N24 A;  3ABK C;  3CZ6 A;  4RD9 A;  5DQT A;  3CSK A;  1ZHW A;  4GEH A;  4CS7 A;  5KYY B;  1O87 A;  4JJF A;  4JVS A;  1Z5Z A;  2O9X A;  2YHS A;  3UMK A;  5EHH A;  1N1C A;  4C3B A;  4I44 A;  4OIO F;  2DGJ A;  1KU2 A;  2E87 A;  1SMY F;  2Q9A A;  4K0D A;  2NUT A;  3SEO A;  4O7G A;  4XWJ A;  4PFP A;  3DMD A;  4HFF B;  2XXA A;  1D1C A;  2W4M A;  4YWQ A;  5D92 A;  1ZHT A;  3L34 A;  4BJ6 C;  3HJC A;  4E7Z A;  2R7T A;  4B6I A;  3I4U A;  1D0Z A;  1ST6 A;  2R7W A;  1Z3I X;  1VYI A;  2VB6 A;  5B1B C;  3K1I C;  3N2Z B;  1PD1 A;  3NYJ A;  1PD0 A;  2KJG A;  3RYL A;  5DS4 A;  5HSW A;  3V7O A;  4EBB A;  1JPN A;  2M4E A;  4E7S A;  4BEJ A;  4CS8 C;  2EIM C;  5DS6 A;  4IRU A;  4MND A;  3ZG1 A;  1NU9 C;  3FAJ A;  2J0W A;  2ZXR A;  2CGE A;  4DVZ A;  5KYU B;  1MMN A;  4F4B A;  3JYH A;  3RFY A;  3X2Q C;  4G0H A;  2IXM A;  5DVW A;  1Z63 A;  3W2W A;  2LSE A;  4LLE A;  2KNH A;  3EGD B;  5KYW B;  3EH1 A;  4ZLC A;  4PK4 A;  4DOZ A;  3OEO A;  3DJU B;  1RJ9 B;  3QZC A;  4N06 A;  2OG2 A;  1PCX A;  3CQZ A;  5BUO A;  3OWT A;  3JRT A;  3HTK C;  2KW3 C;  4Q5S F;  2C04 A;  2FFH A;  2CW0 F;  4OD4 A;  2Y3G A;  2QY9 A;  4A2N B;  3NDB B;  2CNW A;  1V54 C;  2Q9B A;  4W8K A;  3KKB A;  2IXN A;  1TKN A;  3LEV A;  1D1B A;  4KC9 A;  4HEA J;  3DZA A;  3ZIB A;  2CDQ A;  1FTS A;  3EHN A;  4C3E A;  3EGX B;  3NYM A;  1TR2 A;  1VMA A;  1WGW A;  2QTV A;  3UGP A;  4P6I C;  4C3D A;  3N0T A;  3ITF A;  2IXP A;  2J46 A;  4I1M A;  4RBN A;  3LJB A;  3I5Q A;  2BE5 F;  3ASO C;  1ZHZ A;  3JSZ A;  3K66 A;  3ECS A;  3K33 A;  4BJ5 A;  1M2V A;  5E3C A;  3RKO F;  1FMV A;  5KYX B;  1D1A A;  3T6J A;  3SYN A;  2I8B A;  1JPJ A;  3I5P A;  2R7U A;  1MMD A;  3DM9 B;  3EG9 A;  3NKD A;  3AQC A;  4AE4 B;  3TD7 A;  2ZXW C;  4JCH A;  1Z6A A;  3LES A;  3K6B A;  5E3A A;  4DVY P;  1V55 C;  2HV7 A;  2PF4 E;  3EFO B;  4QDL A;  3Q6M A;  2B0J A;  1TWA A;  2GFH A;  4BJ1 A;  4KI2 A;  3Q7L A;  1QLE C;  1SZI A;  3NRH A;  3EQL F;  3W8H A;  3B9Q A;  3B0U X;  5B1A C;  3LS1 A;  1FMW A;  3FVY A;  3L0I A;  4QI2 A;  1MND A;  3KMI A;  2IYL D;  3GOD A;  2XSE A;  4O6N A;  4I3M A;  3UR3 C;  3RH3 A;  1SF8 A;  2OCC C;  2ZPA A;  2L81 A;  3EZH A;  4LER A;  4CIH A;  4XTK A;  4H4K C;  2PX3 A;  3KH2 A;  2VH3 A;  4ZLD A;  5KYU A;  1ZHX A;  4IWB A;  3DJN B;  3AQB A;  2D5R B;  3GAN A;  1FFH A;  3T4R A;  2XRH A;  3E9V A;  5KYW A;  4EWC A;  4M63 A;  5T3T A;  4OIR F;  1RJ9 A;  1W2W A;  4U5D E;  2VAS A;  5L3V A;  1M56 C;  1O5H A;  2G62 A;  2R7Q A;  4KNW A;  4FX5 A;  2Y39 A;  4G7H F;  4U5F E;  3EZI A;  4IAO A;  3DAG A;  4U5G A;  5E2Q A;  4ANJ A;  2A6H F;  2FGY A;  3M1C B;  1J8M F;  4YJW A;  4HE8 D;  2PX0 A;  1TWH A;  5F5F A;  4C7O B;  1OCO C;  4CSA A;  4YT5 A;  3PMR A;  2WZG A;  3S0X A;  3EGX A;  4RDA A;  4Q7C A;  4BJT A;  3ZSU A;  4AX2 A;  2NG1 A;  2DYR C;  1VOM A;  5L3Q A;  3EHM A;  2R7V A;  2W45 A;  1G8X A;  4J30 B;  4DBQ A;  3S27 A;  3W2V A;  3ZC4 A;  1NU7 D;  3MLG A;  1ZHY A;  1OCC C;  3ABM C;  2HV6 A;  3UGO A;  4U5H A;  1MNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...