2IY2A

Crystal structure of the n-terminal dimer domain of e.coli dsbg
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
69
structure length
69
Chain Sequence
b'LPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOL DISULFIDE INTERCHANGE PROTEIN DSBG
publication title Structures of the Dimerization Domains of the Escherichia Coli Disulfide-Bond Isomerase Enzymes Dsbc and Dsbg
pubmed doi rcsb
molecule tags Chaperone
total genus 13
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 2iy2A00
2H0HA 2H0IA 1EEJA 1T3BA 2H0GA 2IY2A 1JZOA 5G1LA 2IYJA 1JZDA 4ILFA 1TJDA 5G1KA 1G0TA 4NPBA 4I5QA 1V58A 1V57A
chains in the Genus database with same CATH superfamily
2Y73A 4WWUC 1YGEA 3DY5A 4O02B 1QJGA 1BNIA 1LQMB 2CWVA 1NO3A 2BO9B 2CX1A 3RGRA 4MMZB 4HBRA 2CG1A 5IG4A 2CFGA 4R80A 1W6YA 1QAFA 3T0UA 1IVWA 1I3FA 2ZHXB 1O7GB 4BTWA 5JPUA 1LQGC 4H3UA 7RNTA 2QA43 3CCR3 1BRSA 4RZMA 1WQLB 1CH0A 1Q9EA 1MWRA 1ULIB 2W56B 1RGLA 3HIGA 5CK6A 5G1KA 3JUOA 3KCHA 1C7HA 2INXA 1DETA 2WOFA 2M7OA 4EV5A 2CW9A 1N8R4 1QMAA 3LTAA 2KF3A 1B2ZA 4HM8B 4G1MB 3F14A 1MWSA 2P05A 2LQVA 2V1LA 3H51A 3GZRA 1ZS7A 5IF6A 1R4YA 1PFPA 3EN1B 2AADA 1VQN3 1BNEA 3WOFB 3GRDA 4HAAA 4FCJA 4L8OA 1BRNL 1YI23 5IEOA 1RJOA 1N8QA 2BIRA 2HMJB 1LOYA 4IPBA 5LC7A 3DMCA 4HYZA 2E2UA 2P0MA 4AEQA 1G96A 1VQ83 2BMQB 1MNLA 1AR0A 3NBRA 4NREA 2XSHB 4Q53A 1K41A 2BMOB 1ZGXA 2C11A 3A5EA 3AGOA 1RGCA 2XR8B 3HIIA 3MG3A 3CCS3 4WP5A 3D5GA 1IQ8A 3F7SA 1BANA 1GY6A 3NQZA 1DVDA 2ZL8A 5EEOA 5EVHA 3NUVA 3OXAA 3AHSA 1VQ63 1UGHI 1VQK3 4HM2B 8RNTA 5HGRA 3WDGB 3BNBA 2YFIB 1T2HA 3LT9A 2CKFB 2CFDA 3KFQC 1R4CA 3VSYA 2STDA 3EBYA 2IUKA 3S67A 2K0MA 1YVSA 3KKGA 1A67A 3F8HA 1HYFA 2UX0A 3MSOA 1A2PA 3FH1A 4X2OA 3B4OA 1VQ73 2IY2A 1IQXA 4HZBB 1BVIA 3MKIA 3OWYA 4OVMA 2F56A 1I3IA 2KCDA 4AKYA 4LMIA 3URPA 2I9WA 5LC6A 3G0KA 4HKVB 1RHLA 3SVAA 1UUWB 3FLJA 3SX1A 4KVHA 5AIIA 4TX4A 3D4AA 5STDA 3K9MC 1B27A 3DM8A 1W6CA 1QAKA 3V99A 2OQEC 3X42A 3NX0A 3A76A 4HM1B 1DYUA 4XDVA 3HI7A 3IPTA 2QIYA 3L0RA 1JN5A 1GSPA 1WNHA 3N54B 4FMDA 4J9AA 3V92A 4EYCA 1BSDA 1I0XA 1AVKA 1JKGB 1O7NB 1JJ22 1OHOA 2ZDJA 2FGTA 1RCKA 1V58A 3AMOB 3KE7A 3DH2A 1EEJA 1B3SA 3CCJ3 4I4KA 3ZG0A 4BTXA 1BUJA 1OF5A 1BNRA 4J8TA 1L5GB 1Q864 4BL3A 1TP6A 1NB5I 4FR9A 2R4IA 1WTHA 4KT3B 5G1LA 2GXFA 5BXQA 1K734 1RGGA 3PXMA 3JVCA 1I0VA 1ROVA 2YX9A 5AIFA 1EQKA 4MEIA 5JPPA 1US1A 1DMNA 1VQP3 3BNEA 1SPUA 2OCTA 2XFSA 1SARA 1B2UA 4EW5A 1HZ1A 3UL5A 2KF6A 3LOYA 3LT8A 3FZWA 1X1XA 3QK9A 1RCLA 4FCZA 3S28A 3LTBA 3EE1A 1WMPA 3WA3A 1OUNA 1ZO2A 4WYKA 1CYVA 1BRIA 3AHWA 3NHXA 2GU1A 3LTDA 2AAEA 4N6OB 4HM7B 2YFJB 1Q824 3QRDA 1NDOB 4BU4A 1BNFA 2O9UX 1DMQA 1LXEA 2C10A 1RGFA 3NV0A 5AIGA 2WOHA 3WMDA 4KFEA 1KSIA 4OK0A 1UDII 4IIAA 1NNVA 4GHOA 3TDGA 5AEWB 4J5KA 4KZ1A 1RKYA 1NWWA 6RNTA 1SIIA 3CNXA 4LSOA 3X3XA 1NB3I 2XFTA 4XBYA 3DGOA 4H61A 1PU4A 1W7CA 1E3VA 3RDEA 1X1UA 3PZWA 5BVBA 1GD4A 2W04A 3J7Yd 3NXJA 4HM6B 3CC73 1KQS2 1W2B2 1D6UA 2GSPA 1UGIA 3NBJA 5CXOA 5IERA 2HOHA 3MWZA 3KZTA 5AI1A 5M18A 3CCE3 1LNHA 1RN1A 4J5GA 1LOWA 1UW1A 2D1WA 1V74A 1FGOA 1GY7A 3ECFA 3PCSA 3PS8A 4GL6A 5GSPA 1QALA 4N3VA 1O7HB 1MWUA 1VQ53 1RGEA 2K54A 3S27A 1FZUA 2XEPA 3LXUX 1SQWA 2WGQA 3ZG5A 1MWTA 2MC8A 3OV4A 4JRFA 4NPBA 1A2VA 2XGNA 1IVVA 2GU3A 2Z77A 1YIT3 1DE3A 1LRAA 2CHCA 1MGRA 8CHOA 2F99A 4FCMA 1UUVB 2W9QA 4JF8A 1A2KA 1YGWA 3B8LA 4I5QA 1UI8A 2CFLA 3SOYA 3GZBA 4K1UA 1Y4KA 3FCSB 1B2SA 4LYLB 1M1XB 4GB5A 3LMLA 4HM5B 1YHQ3 3FSDA 2OOVA 2LYXA 1ZX2A 4EBGA 3FKAA 3VF1A 2J8XB 1X1YA 2D42A 1KC84 3WODG 3BLZA 7STDA 3D5IA 3MG1A 1D6YA 1OH0A 2HMOB 3N9HA 1JV2B 3OX9A 2MF7A 1B21A 2UGIA 5DRVA 1B2XA 4N6UA 1BRHA 3OW22 5FGOA 3IMAB 1EA2A 1W6GA 2KF5A 2IYJA 3DGYA 4WFOA 3EJVA 4AKZA 1Q40B 2CWUA 3WHOA 1Q814 1N9EA 3O8YA 1UCKA 1M9GA 3HK4A 5A0OB 2ZA4A 3EB8A 1F8NA 3LH4A 1V57A 3DGLA 2H0IA 4CDLA 1EKMA 2YFLB 5M1AA 1VQ43 2OTL3 1BGSA 2Z76A 1GYBA 1TTOA 5KP3A 3ALAA 3IJEB 1GOYA 1N9JA 1LVNA 5RNTA 3M8CA 5HOHA 2CH9A 5CF2A 1G0TA 1TRQA 2KF4A 4U13A 1OHPA 2IMJA 3WOEB 1RGKA 3HOHA 3OWUA 1ISKA 4CCVA 3U1WA 3SOAA 3T8NA 3UL6A 2F5WA 1LNIA 2W56A 2XF3A 4HJLB 1BU4A 1JBRA 3D79A 2KXGA 4ILFA 2W0QA 3FGYA 3DGNA 1W00A 3X41A 1BSAA 3DXOA 1Q7HA 1ULJB 3G4S3 4R9KA 5ELUA 3NM2A 1FYSA 1TUHA 2KRTA 1K9M4 5KP4A 2GBXB 3V98A 2XGLA 4N6V0 1CEWI 2IUJA 3X3YA 1T2IA 3D9RA 1RN4A 1ASKA 1UCJA 2JDIH 2F98A 3KIIA 5D82A 3VGNA 4EXRA 3FG4A 3CPOA 1T5YA 3G8ZA 1BSBA 1BRGA 4RNYA 1M904 2ML5A 3HZPA 2CC3A 3KN4A 2F5MA 4FMAA 1E3RA 3CU3A 1C54A 2BU4A 3SLUA 3CC23 5D83A 1K28A 3LZAA 2GBWB 2XSOB 3UJMA 1I70A 5BIRA 4L7KA 1BRKA 1OACA 1S723 1IDPA 1VQM3 1MOLA 1UCIA 1ROAA 4MMYB 3SXXA 1Q42A 1VQ93 1Q7Y4 1JZOA 3WR2A 4IT7A 3JUMA 1JB2A 1I8VA 1TJDA 2OOVC 5KP1A 1KD14 4K1VA 2CFKA 1RRLA 1RN7A 4N6MA 1CYUA 4L8PA 1GMQA 1VZZA 3Q2PA 1QVF2 1GOVA 3BNCA 1YNVX 2P0XA 1YVBI 4O3VA 1BIRA 3G6E3 4LGQA 3CPW2 4DKIA 3CXC2 4STDA 1DMMA 1BOXA 1UCLA 3FG1A 1RMSA 5G2GA 5BU4A 1FA3A 1MGWA 1JB5A 3B4PA 4HZ9B 3CD63 1TIJA 1U8CB 1KWIA 3DZLA 3JUQA 5CF1A 1IV9A 2CFWA 2KAAA 1JKGA 3F7XA 3NM7A 2SARA 3PCRA 2H0HA 3UNLA 1HKXA 4HM0B 2B1XB 3AMOA 1BAOA 1GOUA 2F4YA 1IVUA 3I563 1O7PB 2WGOA 2C4BA 1EUIC 3I0YA 4GSPA 4OUQA 1TU5A 4R1KA 2IA7A 3G713 2Q07A 1VQL3 4N6LA 1VQQA 1CQSA 4ZM8A 5IEPA 3B7CA 2CWTA 1BRJA 1OGXA 2GEXA 2O3OA 2F86B 1EG9B 4O2HA 5IG0A 5I97A 3CCQ3 1BUQA 4N6TA 2CX0A 4HM4B 1K8A4 1W2ZA 3EF8A 1DVCA 2P09A 2XRXB 1Z1SA 1YJN3 1GY5A 1YJW3 1JN5B 3BB9A 1FGTA 1JRQA 3I553 1FUWA 1I2FA 3ROBA 1RNBA 3U97A 1BNGA 2RFRA 2RSXA 3EN8A 2CK3H 3NQYA 4K90B 2HMLB 3GSPA 3MHEA 1S5AA 4O8SA 2CIUA 1VQO3 1PY3A 1OF5B 1AV4A 1JZDA 5DREA 2E2VA 4N6NB 1UUGB 2RBIA 4BIRA 3X40A 3F9SA 4HVNA 1SIHA 1UI7A 2BHMA 2L4VA 3Q90A 4MJDA 2BNGA 2B24B 1B20A 1TFOA 3NBBA 2A15A 4PEJA 2BMRB 1OCVA 1OGZA 2E2TA 1BSEA 1BSCA 3Q3FA 1AY7A 1OPYA 5AIHA 3H3HA 3RNTA 1TRPA 3KSPA 3MYTA 1N5PA 9RNTA 2OWPA 2FNQA 3CC43 1STDA 1FGRA 3D3LA 4WYKB 1IT7A 1BNJA 1IVXA 1A90A 5AYSC 1LOXA 1W4NA 2W03A 2HMKB 1RDSA 3G16A 2Z7AA 3GAXA 3S5CA 4XB5A 1W01A 3NV0B 3OWSA 2P38A 3GZYB 2PZVA 1IU7A 4R9LA 3ER7A 2ML6A 3Q1CA 4EV2A 3S29A 3CCM3 4RNTA 1OHSA 1AQZA 6GSPA 4ORLA 2XH9A 2BT3A 3MPHA 5IW9A 2CG0A 2QGUA 1T3BA 3N8BA 1FUSA 7GSPA 1IQYA 2K3DA 2L1SA 3PGBA 5AYRB 3EHCA 1YJ93 1STFI 3KSED 3DUKA 2RCDA 1O7MB 2WO0A 3BU4A 2QEX3 1WMOA 3FG3A 2SBLA 1JBSA 3CME3 1I2EA 5IG3A 3JUPA 3T8UA 2Z6BA 1FGQA 1QVG2 4LZIA 3LTCA 4LEHA 1M1K4 1RTUA 1PYLA 3MG2A 4KFDA 1W5ZA 3GZXB 4EC6A 1GS3A 1RRHA 2FXTA 3PYJA 4RNZA 5IENA 1GD3A 1FUTA 1G02A 1JBTA 3LYGA 4KFFA 1TFKA 2W9PA 2HMMB 3EQQB 1FGMA 3K0ZA 1I2GA 3K5TA 3BIRA 4X2HA 4BTYA 1JNQA 1HU9A 4XBTA 3X3ZA 1U5OA 2GEYA 1JB4A 3F8XA 1FW7A 6STDA 1GMRA 1RGAA 3EX9A 4K61A 1Q40A 3SYUA 1W02A 3K63A 3K7CA 1RLSA 4NHFA 4RBNA 3SEDA 1RNTA 3STDA 4MMXB 3CCL3 1YIJ3 1B2MA 2UUGC 3E99A 4HOHA 3UB1A 1WMNA 3FF0A 3GWRA 4QWTA 4R4KA 1BNSA 1RGHA 3JUNA 4XDWA 3RGAA 5JBSA 3CMA3 1J2BA 1IT8A 1NJI4 2OTJ3 3AGNA 3DGMA 1GMPA 3BNDA 3EBTA 1IV7A 4BL2A 2W2CA 5IG5A 1IYYA 2RGQA 4XBXA 1NU3A 5EQLA 1AVLA 2W6JH 5AEUB 4HM3B 1N5HA 2HMNB 2PNCA 1LOVA 3ZFZA 1X1WA 2H0GA 2JQ5A 5FW5A 5M19A 1E97A 5CLKA 5D81A 3EC9A 3HX8A 2OQEA 4XM4A 4CPKA 1IK3A 1O7WB 2Y74A 3FF2A 1D6ZA 4FMCA 1RSNA 2RNTA 1SJWA 3CNMA 2R41A 4CJNA 5ELJA 3WA2X 4FMBA 3F40A 5TGNA 3CCU3 3CCV3 4WHAA
chains in the Genus database with same CATH topology
2H0HA 2H0IA 1EEJA 1T3BA 2H0GA 2IY2A 1JZOA 5G1LA 2IYJA 1JZDA 4ILFA 1TJDA 5G1KA 1G0TA 4NPBA 4I5QA 1V58A 1V57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H0H A;  2H0I A;  1EEJ A;  1T3B A;  2H0G A;  2IY2 A;  1JZO A;  5G1L A;  2IYJ A;  1JZD A;  4ILF A;  1TJD A;  5G1K A;  1G0T A;  4NPB A;  4I5Q A;  1V58 A;  1V57 A; 
#chains in the Genus database with same CATH topology
 2Y73 A;  4WWU C;  1YGE A;  3DY5 A;  4O02 B;  1QJG A;  1BNI A;  1LQM B;  2CWV A;  1NO3 A;  2BO9 B;  2CX1 A;  3RGR A;  4MMZ B;  4HBR A;  2CG1 A;  5IG4 A;  2CFG A;  4R80 A;  1W6Y A;  1QAF A;  3T0U A;  1IVW A;  1I3F A;  2ZHX B;  1O7G B;  4BTW A;  5JPU A;  1LQG C;  4H3U A;  7RNT A;  2QA4 3;  3CCR 3;  1BRS A;  4RZM A;  1WQL B;  1CH0 A;  1Q9E A;  1MWR A;  1ULI B;  2W56 B;  1RGL A;  3HIG A;  5CK6 A;  5G1K A;  3JUO A;  3KCH A;  1C7H A;  2INX A;  1DET A;  2WOF A;  2M7O A;  4EV5 A;  2CW9 A;  1N8R 4;  1QMA A;  3LTA A;  2KF3 A;  1B2Z A;  4HM8 B;  4G1M B;  3F14 A;  1MWS A;  2P05 A;  2LQV A;  2V1L A;  3H51 A;  3GZR A;  1ZS7 A;  5IF6 A;  1R4Y A;  1PFP A;  3EN1 B;  2AAD A;  1VQN 3;  1BNE A;  3WOF B;  3GRD A;  4HAA A;  4FCJ A;  4L8O A;  1BRN L;  1YI2 3;  5IEO A;  1RJO A;  1N8Q A;  2BIR A;  2HMJ B;  1LOY A;  4IPB A;  5LC7 A;  3DMC A;  4HYZ A;  2E2U A;  2P0M A;  4AEQ A;  1G96 A;  1VQ8 3;  2BMQ B;  1MNL A;  1AR0 A;  3NBR A;  4NRE A;  2XSH B;  4Q53 A;  1K41 A;  2BMO B;  1ZGX A;  2C11 A;  3A5E A;  3AGO A;  1RGC A;  2XR8 B;  3HII A;  3MG3 A;  3CCS 3;  4WP5 A;  3D5G A;  1IQ8 A;  3F7S A;  1BAN A;  1GY6 A;  3NQZ A;  1DVD A;  2ZL8 A;  5EEO A;  5EVH A;  3NUV A;  3OXA A;  3AHS A;  1VQ6 3;  1UGH I;  1VQK 3;  4HM2 B;  8RNT A;  5HGR A;  3WDG B;  3BNB A;  2YFI B;  1T2H A;  3LT9 A;  2CKF B;  2CFD A;  3KFQ C;  1R4C A;  3VSY A;  2STD A;  3EBY A;  2IUK A;  3S67 A;  2K0M A;  1YVS A;  3KKG A;  1A67 A;  3F8H A;  1HYF A;  2UX0 A;  3MSO A;  1A2P A;  3FH1 A;  4X2O A;  3B4O A;  1VQ7 3;  2IY2 A;  1IQX A;  4HZB B;  1BVI A;  3MKI A;  3OWY A;  4OVM A;  2F56 A;  1I3I A;  2KCD A;  4AKY A;  4LMI A;  3URP A;  2I9W A;  5LC6 A;  3G0K A;  4HKV B;  1RHL A;  3SVA A;  1UUW B;  3FLJ A;  3SX1 A;  4KVH A;  5AII A;  4TX4 A;  3D4A A;  5STD A;  3K9M C;  1B27 A;  3DM8 A;  1W6C A;  1QAK A;  3V99 A;  2OQE C;  3X42 A;  3NX0 A;  3A76 A;  4HM1 B;  1DYU A;  4XDV A;  3HI7 A;  3IPT A;  2QIY A;  3L0R A;  1JN5 A;  1GSP A;  1WNH A;  3N54 B;  4FMD A;  4J9A A;  3V92 A;  4EYC A;  1BSD A;  1I0X A;  1AVK A;  1JKG B;  1O7N B;  1JJ2 2;  1OHO A;  2ZDJ A;  2FGT A;  1RCK A;  1V58 A;  3AMO B;  3KE7 A;  3DH2 A;  1EEJ A;  1B3S A;  3CCJ 3;  4I4K A;  3ZG0 A;  4BTX A;  1BUJ A;  1OF5 A;  1BNR A;  4J8T A;  1L5G B;  1Q86 4;  4BL3 A;  1TP6 A;  1NB5 I;  4FR9 A;  2R4I A;  1WTH A;  4KT3 B;  5G1L A;  2GXF A;  5BXQ A;  1K73 4;  1RGG A;  3PXM A;  3JVC A;  1I0V A;  1ROV A;  2YX9 A;  5AIF A;  1EQK A;  4MEI A;  5JPP A;  1US1 A;  1DMN A;  1VQP 3;  3BNE A;  1SPU A;  2OCT A;  2XFS A;  1SAR A;  1B2U A;  4EW5 A;  1HZ1 A;  3UL5 A;  2KF6 A;  3LOY A;  3LT8 A;  3FZW A;  1X1X A;  3QK9 A;  1RCL A;  4FCZ A;  3S28 A;  3LTB A;  3EE1 A;  1WMP A;  3WA3 A;  1OUN A;  1ZO2 A;  4WYK A;  1CYV A;  1BRI A;  3AHW A;  3NHX A;  2GU1 A;  3LTD A;  2AAE A;  4N6O B;  4HM7 B;  2YFJ B;  1Q82 4;  3QRD A;  1NDO B;  4BU4 A;  1BNF A;  2O9U X;  1DMQ A;  1LXE A;  2C10 A;  1RGF A;  3NV0 A;  5AIG A;  2WOH A;  3WMD A;  4KFE A;  1KSI A;  4OK0 A;  1UDI I;  4IIA A;  1NNV A;  4GHO A;  3TDG A;  5AEW B;  4J5K A;  4KZ1 A;  1RKY A;  1NWW A;  6RNT A;  1SII A;  3CNX A;  4LSO A;  3X3X A;  1NB3 I;  2XFT A;  4XBY A;  3DGO A;  4H61 A;  1PU4 A;  1W7C A;  1E3V A;  3RDE A;  1X1U A;  3PZW A;  5BVB A;  1GD4 A;  2W04 A;  3J7Y d;  3NXJ A;  4HM6 B;  3CC7 3;  1KQS 2;  1W2B 2;  1D6U A;  2GSP A;  1UGI A;  3NBJ A;  5CXO A;  5IER A;  2HOH A;  3MWZ A;  3KZT A;  5AI1 A;  5M18 A;  3CCE 3;  1LNH A;  1RN1 A;  4J5G A;  1LOW A;  1UW1 A;  2D1W A;  1V74 A;  1FGO A;  1GY7 A;  3ECF A;  3PCS A;  3PS8 A;  4GL6 A;  5GSP A;  1QAL A;  4N3V A;  1O7H B;  1MWU A;  1VQ5 3;  1RGE A;  2K54 A;  3S27 A;  1FZU A;  2XEP A;  3LXU X;  1SQW A;  2WGQ A;  3ZG5 A;  1MWT A;  2MC8 A;  3OV4 A;  4JRF A;  4NPB A;  1A2V A;  2XGN A;  1IVV A;  2GU3 A;  2Z77 A;  1YIT 3;  1DE3 A;  1LRA A;  2CHC A;  1MGR A;  8CHO A;  2F99 A;  4FCM A;  1UUV B;  2W9Q A;  4JF8 A;  1A2K A;  1YGW A;  3B8L A;  4I5Q A;  1UI8 A;  2CFL A;  3SOY A;  3GZB A;  4K1U A;  1Y4K A;  3FCS B;  1B2S A;  4LYL B;  1M1X B;  4GB5 A;  3LML A;  4HM5 B;  1YHQ 3;  3FSD A;  2OOV A;  2LYX A;  1ZX2 A;  4EBG A;  3FKA A;  3VF1 A;  2J8X B;  1X1Y A;  2D42 A;  1KC8 4;  3WOD G;  3BLZ A;  7STD A;  3D5I A;  3MG1 A;  1D6Y A;  1OH0 A;  2HMO B;  3N9H A;  1JV2 B;  3OX9 A;  2MF7 A;  1B21 A;  2UGI A;  5DRV A;  1B2X A;  4N6U A;  1BRH A;  3OW2 2;  5FGO A;  3IMA B;  1EA2 A;  1W6G A;  2KF5 A;  2IYJ A;  3DGY A;  4WFO A;  3EJV A;  4AKZ A;  1Q40 B;  2CWU A;  3WHO A;  1Q81 4;  1N9E A;  3O8Y A;  1UCK A;  1M9G A;  3HK4 A;  5A0O B;  2ZA4 A;  3EB8 A;  1F8N A;  3LH4 A;  1V57 A;  3DGL A;  2H0I A;  4CDL A;  1EKM A;  2YFL B;  5M1A A;  1VQ4 3;  2OTL 3;  1BGS A;  2Z76 A;  1GYB A;  1TTO A;  5KP3 A;  3ALA A;  3IJE B;  1GOY A;  1N9J A;  1LVN A;  5RNT A;  3M8C A;  5HOH A;  2CH9 A;  5CF2 A;  1G0T A;  1TRQ A;  2KF4 A;  4U13 A;  1OHP A;  2IMJ A;  3WOE B;  1RGK A;  3HOH A;  3OWU A;  1ISK A;  4CCV A;  3U1W A;  3SOA A;  3T8N A;  3UL6 A;  2F5W A;  1LNI A;  2W56 A;  2XF3 A;  4HJL B;  1BU4 A;  1JBR A;  3D79 A;  2KXG A;  4ILF A;  2W0Q A;  3FGY A;  3DGN A;  1W00 A;  3X41 A;  1BSA A;  3DXO A;  1Q7H A;  1ULJ B;  3G4S 3;  4R9K A;  5ELU A;  3NM2 A;  1FYS A;  1TUH A;  2KRT A;  1K9M 4;  5KP4 A;  2GBX B;  3V98 A;  2XGL A;  4N6V 0;  1CEW I;  2IUJ A;  3X3Y A;  1T2I A;  3D9R A;  1RN4 A;  1ASK A;  1UCJ A;  2JDI H;  2F98 A;  3KII A;  5D82 A;  3VGN A;  4EXR A;  3FG4 A;  3CPO A;  1T5Y A;  3G8Z A;  1BSB A;  1BRG A;  4RNY A;  1M90 4;  2ML5 A;  3HZP A;  2CC3 A;  3KN4 A;  2F5M A;  4FMA A;  1E3R A;  3CU3 A;  1C54 A;  2BU4 A;  3SLU A;  3CC2 3;  5D83 A;  1K28 A;  3LZA A;  2GBW B;  2XSO B;  3UJM A;  1I70 A;  5BIR A;  4L7K A;  1BRK A;  1OAC A;  1S72 3;  1IDP A;  1VQM 3;  1MOL A;  1UCI A;  1ROA A;  4MMY B;  3SXX A;  1Q42 A;  1VQ9 3;  1Q7Y 4;  1JZO A;  3WR2 A;  4IT7 A;  3JUM A;  1JB2 A;  1I8V A;  1TJD A;  2OOV C;  5KP1 A;  1KD1 4;  4K1V A;  2CFK A;  1RRL A;  1RN7 A;  4N6M A;  1CYU A;  4L8P A;  1GMQ A;  1VZZ A;  3Q2P A;  1QVF 2;  1GOV A;  3BNC A;  1YNV X;  2P0X A;  1YVB I;  4O3V A;  1BIR A;  3G6E 3;  4LGQ A;  3CPW 2;  4DKI A;  3CXC 2;  4STD A;  1DMM A;  1BOX A;  1UCL A;  3FG1 A;  1RMS A;  5G2G A;  5BU4 A;  1FA3 A;  1MGW A;  1JB5 A;  3B4P A;  4HZ9 B;  3CD6 3;  1TIJ A;  1U8C B;  1KWI A;  3DZL A;  3JUQ A;  5CF1 A;  1IV9 A;  2CFW A;  2KAA A;  1JKG A;  3F7X A;  3NM7 A;  2SAR A;  3PCR A;  2H0H A;  3UNL A;  1HKX A;  4HM0 B;  2B1X B;  3AMO A;  1BAO A;  1GOU A;  2F4Y A;  1IVU A;  3I56 3;  1O7P B;  2WGO A;  2C4B A;  1EUI C;  3I0Y A;  4GSP A;  4OUQ A;  1TU5 A;  4R1K A;  2IA7 A;  3G71 3;  2Q07 A;  1VQL 3;  4N6L A;  1VQQ A;  1CQS A;  4ZM8 A;  5IEP A;  3B7C A;  2CWT A;  1BRJ A;  1OGX A;  2GEX A;  2O3O A;  2F86 B;  1EG9 B;  4O2H A;  5IG0 A;  5I97 A;  3CCQ 3;  1BUQ A;  4N6T A;  2CX0 A;  4HM4 B;  1K8A 4;  1W2Z A;  3EF8 A;  1DVC A;  2P09 A;  2XRX B;  1Z1S A;  1YJN 3;  1GY5 A;  1YJW 3;  1JN5 B;  3BB9 A;  1FGT A;  1JRQ A;  3I55 3;  1FUW A;  1I2F A;  3ROB A;  1RNB A;  3U97 A;  1BNG A;  2RFR A;  2RSX A;  3EN8 A;  2CK3 H;  3NQY A;  4K90 B;  2HML B;  3GSP A;  3MHE A;  1S5A A;  4O8S A;  2CIU A;  1VQO 3;  1PY3 A;  1OF5 B;  1AV4 A;  1JZD A;  5DRE A;  2E2V A;  4N6N B;  1UUG B;  2RBI A;  4BIR A;  3X40 A;  3F9S A;  4HVN A;  1SIH A;  1UI7 A;  2BHM A;  2L4V A;  3Q90 A;  4MJD A;  2BNG A;  2B24 B;  1B20 A;  1TFO A;  3NBB A;  2A15 A;  4PEJ A;  2BMR B;  1OCV A;  1OGZ A;  2E2T A;  1BSE A;  1BSC A;  3Q3F A;  1AY7 A;  1OPY A;  5AIH A;  3H3H A;  3RNT A;  1TRP A;  3KSP A;  3MYT A;  1N5P A;  9RNT A;  2OWP A;  2FNQ A;  3CC4 3;  1STD A;  1FGR A;  3D3L A;  4WYK B;  1IT7 A;  1BNJ A;  1IVX A;  1A90 A;  5AYS C;  1LOX A;  1W4N A;  2W03 A;  2HMK B;  1RDS A;  3G16 A;  2Z7A A;  3GAX A;  3S5C A;  4XB5 A;  1W01 A;  3NV0 B;  3OWS A;  2P38 A;  3GZY B;  2PZV A;  1IU7 A;  4R9L A;  3ER7 A;  2ML6 A;  3Q1C A;  4EV2 A;  3S29 A;  3CCM 3;  4RNT A;  1OHS A;  1AQZ A;  6GSP A;  4ORL A;  2XH9 A;  2BT3 A;  3MPH A;  5IW9 A;  2CG0 A;  2QGU A;  1T3B A;  3N8B A;  1FUS A;  7GSP A;  1IQY A;  2K3D A;  2L1S A;  3PGB A;  5AYR B;  3EHC A;  1YJ9 3;  1STF I;  3KSE D;  3DUK A;  2RCD A;  1O7M B;  2WO0 A;  3BU4 A;  2QEX 3;  1WMO A;  3FG3 A;  2SBL A;  1JBS A;  3CME 3;  1I2E A;  5IG3 A;  3JUP A;  3T8U A;  2Z6B A;  1FGQ A;  1QVG 2;  4LZI A;  3LTC A;  4LEH A;  1M1K 4;  1RTU A;  1PYL A;  3MG2 A;  4KFD A;  1W5Z A;  3GZX B;  4EC6 A;  1GS3 A;  1RRH A;  2FXT A;  3PYJ A;  4RNZ A;  5IEN A;  1GD3 A;  1FUT A;  1G02 A;  1JBT A;  3LYG A;  4KFF A;  1TFK A;  2W9P A;  2HMM B;  3EQQ B;  1FGM A;  3K0Z A;  1I2G A;  3K5T A;  3BIR A;  4X2H A;  4BTY A;  1JNQ A;  1HU9 A;  4XBT A;  3X3Z A;  1U5O A;  2GEY A;  1JB4 A;  3F8X A;  1FW7 A;  6STD A;  1GMR A;  1RGA A;  3EX9 A;  4K61 A;  1Q40 A;  3SYU A;  1W02 A;  3K63 A;  3K7C A;  1RLS A;  4NHF A;  4RBN A;  3SED A;  1RNT A;  3STD A;  4MMX B;  3CCL 3;  1YIJ 3;  1B2M A;  2UUG C;  3E99 A;  4HOH A;  3UB1 A;  1WMN A;  3FF0 A;  3GWR A;  4QWT A;  4R4K A;  1BNS A;  1RGH A;  3JUN A;  4XDW A;  3RGA A;  5JBS A;  3CMA 3;  1J2B A;  1IT8 A;  1NJI 4;  2OTJ 3;  3AGN A;  3DGM A;  1GMP A;  3BND A;  3EBT A;  1IV7 A;  4BL2 A;  2W2C A;  5IG5 A;  1IYY A;  2RGQ A;  4XBX A;  1NU3 A;  5EQL A;  1AVL A;  2W6J H;  5AEU B;  4HM3 B;  1N5H A;  2HMN B;  2PNC A;  1LOV A;  3ZFZ A;  1X1W A;  2H0G A;  2JQ5 A;  5FW5 A;  5M19 A;  1E97 A;  5CLK A;  5D81 A;  3EC9 A;  3HX8 A;  2OQE A;  4XM4 A;  4CPK A;  1IK3 A;  1O7W B;  2Y74 A;  3FF2 A;  1D6Z A;  4FMC A;  1RSN A;  2RNT A;  1SJW A;  3CNM A;  2R41 A;  4CJN A;  5ELJ A;  3WA2 X;  4FMB A;  3F40 A;  5TGN A;  3CCU 3;  3CCV 3;  4WHA A; 
#chains in the Genus database with same CATH homology
 2H0H A;  2H0I A;  1EEJ A;  1T3B A;  2H0G A;  2IY2 A;  1JZO A;  5G1L A;  2IYJ A;  1JZD A;  4ILF A;  1TJD A;  5G1K A;  1G0T A;  4NPB A;  4I5Q A;  1V58 A;  1V57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...