2IY2A

Crystal structure of the n-terminal dimer domain of e.coli dsbg
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
69
structure length
69
Chain Sequence
LPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOL DISULFIDE INTERCHANGE PROTEIN DSBG
publication title Structures of the Dimerization Domains of the Escherichia Coli Disulfide-Bond Isomerase Enzymes Dsbc and Dsbg
pubmed doi rcsb
molecule tags Chaperone
total genus 13
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 2iy2A00
2H0GA 4I5QA 1JZDA 1V58A 1V57A 5G1KA 1T3BA 1JZOA 2IY2A 4ILFA 2H0IA 4NPBA 1G0TA 1TJDA 1EEJA 5G1LA 2IYJA 2H0HA
chains in the Genus database with same CATH superfamily
1IT8A 4EYCA 1VQ53 1YVSA 4JF8A 1TTOA 1B27A 3GAXA 1BANA 1DMNA 4QWTA 3VF1A 1IU7A 1NNVA 3Q1CA 1GY5A 5STDA 3K0ZA 3NQZA 3NV0B 4RNZA 1UDII 7STDA 3CD63 5EEOA 2V1LA 1DE3A 5I97A 2W0QA 4HOHA 4O02B 2CFLA 4RNYA 4XB5A 1JN5B 1M9GA 2Q07A 5AEUB 2C10A 2XSOB 3FF0A 1IV9A 2L1SA 1JBSA 1RCKA 2F99A 5AYRB 3SOAA 1N9JA 3CPOA 1UCLA 2A15A 2H0GA 1GYBA 3GZBA 1DMQA 1BRJA 4CJNA 3BNDA 2E2UA 3DH2A 4RNTA 1JBRA 4FMCA 3EX9A 4FMBA 1W4NA 3L0RA 2XH9A 5IEPA 3VSYA 2CFGA 1W2B2 3FZWA 5M19A 2Y74A 2WOFA 2BMQB 3KN4A 3BNBA 4HAAA 2IUJA 3ROBA 1BRHA 4XDVA 2F86B 1AVKA 3X3XA 3CCU3 3G8ZA 1N8QA 5LC7A 1I3FA 1VQL3 2I9WA 1C54A 4HM6B 1GD3A 4N6OB 1ROAA 2OQEA 1LOWA 1TRPA 3MG1A 4G1MB 4IT7A 2FGTA 4R4KA 1KC84 3EF8A 2CFDA 1OCVA 2ZHXB 1WMOA 2J8XB 3IJEB 1VQQA 4WWUC 1GS3A 2P09A 2Z77A 3X3YA 3MG3A 3NX0A 4WP5A 1YIJ3 1Q824 1OF5B 1A2VA 1W6YA 2CIUA 4HM7B 3GRDA 2P0MA 1SIHA 5EQLA 5IW9A 5AEWB 3GZYB 4BIRA 1G0TA 1AVLA 1OGXA 3E99A 2KF6A 4BU4A 2E2TA 3H51A 5EVHA 5DREA 3BNEA 3N8BA 5AIIA 1LXEA 5AYSC 2Z76A 1V58A 2XR8B 2CH9A 1NWWA 2O3OA 3K9MC 3MSOA 4HJLB 4HZBB 4XBXA 4PEJA 4XBTA 3VGNA 1BNGA 4J5KA 4NPBA 1OHSA 3BU4A 3LTCA 1VQ73 1W02A 6RNTA 1JN5A 1RLSA 3D5GA 3SX1A 2KAAA 1O7PB 1MGRA 1GMQA 1RN1A 1N5HA 1RN4A 3NBJA 2F98A 1UUGB 3HX8A 3BNCA 1S5AA 3G6E3 1MGWA 1ULIB 3KCHA 1BSBA 5CLKA 2XEPA 1I8VA 2OTJ3 1LNIA 4GHOA 3UJMA 4ZM8A 1GY6A 1HYFA 3HOHA 1BSEA 1O7NB 1FYSA 3PGBA 4X2HA 1TUHA 3UL5A 1FW7A 2UX0A 3EBTA 2W56B 3HI7A 3SEDA 1GD4A 3BLZA 3Q90A 2B24B 3M8CA 1K734 2GU1A 3MKIA 3WA2X 1T5YA 1T2HA 1A2PA 1R4YA 2XGNA 4EV2A 1OGZA 4N6NB 4BL2A 3CCR3 4JRFA 4OK0A 3D79A 1I70A 1FZUA 3MHEA 3S27A 2W9QA 1I2EA 2OCTA 1LNHA 2OOVA 3SYUA 3EN1B 3WHOA 1AR0A 5KP4A 3ZFZA 2IY2A 4MMYB 1OHPA 1OF5A 3DMCA 1R4CA 4N3VA 1MNLA 1FGQA 4N6UA 3EBYA 3A5EA 1IQ8A 4GSPA 4L7KA 3WA3A 3X42A 3T8NA 1Q40B 1LOVA 4OUQA 3I0YA 3TDGA 2WGQA 1UW1A 3CCM3 1IV7A 2ZL8A 1X1UA 3EE1A 1BNFA 1PY3A 3DGLA 1I0VA 5JPPA 4CPKA 4MJDA 3HIGA 1T2IA 1IT7A 3F9SA 5BIRA 2R4IA 2BU4A 2CFWA 3K5TA 4ILFA 4KVHA 3CNMA 1QVF2 3CCE3 5D82A 1ULJB 3T0UA 4XM4A 2D42A 3DY5A 1IQXA 4R9KA 1L5GB 5RNTA 1K8A4 1MOLA 3KE7A 1FUWA 2O9UX 1N9EA 2HMLB 3FKAA 3HIIA 1JBTA 2XFSA 1UI8A 4K1UA 3MG2A 1Q42A 2W56A 3LXUX 3OWYA 4LEHA 4AEQA 1Q814 3D9RA 4HYZA 3JVCA 1OH0A 1UGHI 5IENA 3UB1A 1JJ22 5IERA 1NB5I 4HM3B 1AQZA 1RGFA 3OX9A 1QMAA 1PYLA 1O7GB 1YJ93 2FNQA 3SXXA 3KZTA 7GSPA 1TFOA 1F8NA 5A0OB 1PFPA 1GOVA 1SQWA 1RNTA 1VZZA 1B3SA 2XGLA 4XBYA 1BNIA 1RRLA 2PZVA 4H61A 3CCV3 1ISKA 4K61A 2D1WA 1YIT3 6GSPA 1VQK3 1JB5A 1EKMA 1RMSA 5IG5A 3LTBA 1ZS7A 3CMA3 1A67A 4FCJA 4HM4B 2IUKA 2XF3A 1ZX2A 3UL6A 3V92A 1BRNL 3RGRA 1Q40A 2CG0A 5TGNA 4R1KA 2C11A 2INXA 2UGIA 3S5CA 2W6JH 3B4OA 3S67A 3MYTA 2CWTA 3FF2A 3RDEA 9RNTA 2QGUA 1C7HA 4LMIA 4EV5A 1IQYA 5HOHA 2HMNB 5AIGA 1M1K4 2CK3H 1TP6A 3AGOA 1CYUA 1GOUA 1WMPA 3G4S3 1N5PA 1Q9EA 2W04A 1X1XA 1BSAA 1I2GA 1O7WB 1D6YA 3EQQB 4K90B 1DMMA 1RN7A 3LTAA 3NXJA 1PU4A 3EN8A 1AV4A 1QJGA 3NM2A 1Q7Y4 1Z1SA 2SBLA 4MMZB 3V99A 1KD14 1VQ93 1IVWA 3J7Yd 1DVDA 4HM1B 5DRVA 3S29A 2M7OA 1FGMA 1MWRA 2RCDA 4HM2B 3CCQ3 3ECFA 1QAKA 4HM0B 1W6GA 5G1KA 1B2UA 2KRTA 3WR2A 1OPYA 1UCKA 1RGKA 2OQEC 2L4VA 3QRDA 1MWUA 3FSDA 1JNQA 2UUGC 3KIIA 1Q864 2OWPA 3RNTA 4FR9A 4LZIA 1FA3A 5IG0A 6STDA 3UNLA 1UCJA 2XSHB 1A2KA 1W01A 3ZG5A 1LOXA 1GOYA 4FMDA 1YVBI 3AHSA 3U1WA 1RTUA 1V74A 4N6TA 3OXAA 5JPUA 3DUKA 3B7CA 3U97A 1STDA 2P0XA 4X2OA 1RGAA 2LQVA 2W9PA 1BVIA 1B2SA 1DYUA 3KSED 5AI1A 2C4BA 3NBBA 1IK3A 4OVMA 1RJOA 2HMKB 2ML6A 1RNBA 2B1XB 1EUIC 3PS8A 3DGOA 3IPTA 4STDA 1RSNA 1DVCA 1K28A 4WFOA 1YNVX 4R9LA 3AGNA 1I3IA 1I2FA 1QAFA 2QIYA 5ELUA 4AKYA 1CH0A 3F8HA 4MEIA 3OWSA 2BMOB 3N54B 1W5ZA 1D6UA 1UGIA 2IA7A 2XFTA 3DXOA 2GEXA 1W6CA 2BIRA 4AKZA 5IG4A 1NJI4 2RFRA 1WTHA 2BMRB 2HMJB 3LOYA 2ZA4A 2P05A 2YFLB 3GWRA 4WHAA 1BRSA 3LMLA 1NO3A 1GMRA 1LVNA 4CDLA 1RDSA 1E3RA 1RGLA 2IYJA 5AIHA 1UUWB 4HM8B 1JB4A 1JZDA 4KZ1A 1YGWA 3KFQC 3NQYA 3LH4A 4BTXA 1VQ83 3ALAA 1JB2A 4L8PA 4N6V0 5FGOA 1W2ZA 4KT3B 1LRAA 1FGOA 1QVG2 1VQP3 3JUPA 7RNTA 2CX0A 2CWVA 5CXOA 2W03A 1HZ1A 1YJW3 4IIAA 1ZO2A 1G02A 3G713 4KFFA 3CCL3 3MWZA 4LYLB 3Q2PA 1CQSA 1EQKA 5IF6A 3WOEB 1KSIA 2F56A 3I563 4H3UA 2F4YA 2STDA 1UCIA 1E97A 2CFKA 4R80A 1RGGA 4EBGA 2CG1A 3DM8A 5IG3A 3FGYA 1IVXA 3CNXA 2OOVC 2LYXA 3D3LA 3G0KA 4NREA 3K63A 4WYKA 1BRGA 1M1XB 2JQ5A 5KP3A 1US1A 4HZ9B 3CC43 3CME3 1Y4KA 3PYJA 1TFKA 3FG4A 3HK4A 3LT9A 2Z6BA 4MMXB 3EHCA 2WGOA 1YHQ3 1NB3I 4BTYA 1BNRA 3F40A 3KKGA 2RNTA 5D83A 3RGAA 8CHOA 1O7HB 5M18A 1X1YA 5GSPA 4Q53A 4N6MA 2KF3A 2HMMB 1JRQA 1SARA 1B20A 1NU3A 3X40A 4HBRA 2K0MA 5HGRA 1BRIA 1WQLB 4RBNA 4ORLA 3LZAA 1VQO3 5G1LA 3K7CA 4GB5A 1BOXA 2ML5A 3PZWA 4O3VA 2CHCA 2JDIH 2KF4A 5IEOA 2IMJA 1EA2A 4LGQA 1SPUA 3ZG0A 5CF2A 1BAOA 3F7SA 5BVBA 5JBSA 3FH1A 3OV4A 2CKFB 3DGNA 4HVNA 4L8OA 1BIRA 3EB8A 1B21A 2WO0A 2Y73A 4FMAA 1LQMB 1LOYA 1I0XA 5BXQA 2RBIA 1SIIA 1JKGB 1K41A 3HZPA 1E3VA 3FG3A 3CC23 1RGHA 3JUOA 2H0HA 1BU4A 3GSPA 4LSOA 3GZRA 4EXRA 2KCDA 4BTWA 3DGYA 2ZDJA 4TX4A 3BIRA 3JUMA 3NHXA 3CU3A 3N9HA 2CWUA 1V57A 3LYGA 4J5GA 1BRKA 1HKXA 1JZOA 1JV2B 1RHLA 2P38A 1GSPA 1RGEA 1X1WA 1G96A 1D6ZA 2KXGA 1BSCA 1BSDA 4XDWA 4BL3A 1N8R4 3D5IA 3SOYA 3F14A 1GY7A 1NDOB 2AADA 1OHOA 1AY7A 1QALA 1W7CA 3IMAB 4CCVA 4EW5A 3EJVA 3QK9A 3I553 4GL6A 5D81A 3S28A 1OUNA 1Q7HA 3CCS3 3FCSB 3AHWA 3JUQA 3F7XA 5ELJA 1MWSA 2GXFA 2GSPA 3OWUA 4N6LA 3X3ZA 3AMOB 3G16A 2Z7AA 3O8YA 1VQ43 3CPW2 2BO9B 1FUTA 2RGQA 2CC3A 2MC8A 1B2MA 1T3BA 1IVVA 3KSPA 3NBRA 3NV0A 4J9AA 4WYKB 1U5OA 1IDPA 5AIFA 1STFI 2XRXB 1K9M4 3FLJA 4KFDA 1BUQA 3WMDA 3CC73 2GEYA 3A76A 1CEWI 3EC9A 4DKIA 4EC6A 2W2CA 3SVAA 1BNEA 2CX1A 1FUSA 4I4KA 1WNHA 1TU5A 4IPBA 1RRHA 1GMPA 3FG1A 3B4PA 1TJDA 3F8XA 2BT3A 1BNJA 1A90A 1MWTA 1YJN3 1ZGXA 1FGTA 2K54A 1WMNA 1YGEA 2GBXB 3PCSA 2PNCA 3WDGB 1JKGA 1BGSA 3NM7A 2OTL3 5LC6A 4O2HA 3DZLA 3WOFB 3JUNA 2HMOB 4HKVB 3SLUA 2BHMA 4FCMA 1YI23 3GZXB 1B2ZA 4FCZA 1BUJA 3OW22 4K1VA 5CK6A 1B2XA 2AAEA 3NUVA 3STDA 1J2BA 1S723 1W00A 1VQ63 4HM5B 4KFEA 1EG9B 2F5WA 1O7MB 1SJWA 2GBWB 4NHFA 5KP1A 1CYVA 1FGRA 1VQM3 4J8TA 3CCJ3 1IVUA 4U13A 5CF1A 3D4AA 1LQGC 1KWIA 5BU4A 1TIJA 3Q3FA 1UI7A 3H3HA 5G2GA 2YX9A 1M904 2BNGA 1RGCA 3B8LA 2MF7A 1UUVB 2E2VA 3PCRA 3LTDA 1ASKA 3T8UA 3AMOA 2R41A 3WODG 2K3DA 1DETA 3DGMA 1VQN3 1EEJA 3MPHA 4RZMA 3X41A 2KF5A 3PXMA 1RKYA 2QEX3 3URPA 2GU3A 2WOHA 3BB9A 1KQS2 1ROVA 2CW9A 2H0IA 2YFIB 1U8CB 1HU9A 3ER7A 1RCLA 2SARA 3LT8A 4I5QA 4O8SA 2QA43 5FW5A 1IYYA 2YFJB 2RSXA 2HOHA 5M1AA 3V98A 2F5MA 1TRQA 3CXC2 1OACA 2FXTA 8RNTA 1BNSA
chains in the Genus database with same CATH topology
2H0GA 4I5QA 1JZDA 1V58A 1V57A 5G1KA 1T3BA 1JZOA 2IY2A 4ILFA 2H0IA 4NPBA 1G0TA 1TJDA 1EEJA 5G1LA 2IYJA 2H0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H0G A;  4I5Q A;  1JZD A;  1V58 A;  1V57 A;  5G1K A;  1T3B A;  1JZO A;  2IY2 A;  4ILF A;  2H0I A;  4NPB A;  1G0T A;  1TJD A;  1EEJ A;  5G1L A;  2IYJ A;  2H0H A; 
#chains in the Genus database with same CATH topology
 1IT8 A;  4EYC A;  1VQ5 3;  1YVS A;  4JF8 A;  1TTO A;  1B27 A;  3GAX A;  1BAN A;  1DMN A;  4QWT A;  3VF1 A;  1IU7 A;  1NNV A;  3Q1C A;  1GY5 A;  5STD A;  3K0Z A;  3NQZ A;  3NV0 B;  4RNZ A;  1UDI I;  7STD A;  3CD6 3;  5EEO A;  2V1L A;  1DE3 A;  5I97 A;  2W0Q A;  4HOH A;  4O02 B;  2CFL A;  4RNY A;  4XB5 A;  1JN5 B;  1M9G A;  2Q07 A;  5AEU B;  2C10 A;  2XSO B;  3FF0 A;  1IV9 A;  2L1S A;  1JBS A;  1RCK A;  2F99 A;  5AYR B;  3SOA A;  1N9J A;  3CPO A;  1UCL A;  2A15 A;  2H0G A;  1GYB A;  3GZB A;  1DMQ A;  1BRJ A;  4CJN A;  3BND A;  2E2U A;  3DH2 A;  4RNT A;  1JBR A;  4FMC A;  3EX9 A;  4FMB A;  1W4N A;  3L0R A;  2XH9 A;  5IEP A;  3VSY A;  2CFG A;  1W2B 2;  3FZW A;  5M19 A;  2Y74 A;  2WOF A;  2BMQ B;  3KN4 A;  3BNB A;  4HAA A;  2IUJ A;  3ROB A;  1BRH A;  4XDV A;  2F86 B;  1AVK A;  3X3X A;  3CCU 3;  3G8Z A;  1N8Q A;  5LC7 A;  1I3F A;  1VQL 3;  2I9W A;  1C54 A;  4HM6 B;  1GD3 A;  4N6O B;  1ROA A;  2OQE A;  1LOW A;  1TRP A;  3MG1 A;  4G1M B;  4IT7 A;  2FGT A;  4R4K A;  1KC8 4;  3EF8 A;  2CFD A;  1OCV A;  2ZHX B;  1WMO A;  2J8X B;  3IJE B;  1VQQ A;  4WWU C;  1GS3 A;  2P09 A;  2Z77 A;  3X3Y A;  3MG3 A;  3NX0 A;  4WP5 A;  1YIJ 3;  1Q82 4;  1OF5 B;  1A2V A;  1W6Y A;  2CIU A;  4HM7 B;  3GRD A;  2P0M A;  1SIH A;  5EQL A;  5IW9 A;  5AEW B;  3GZY B;  4BIR A;  1G0T A;  1AVL A;  1OGX A;  3E99 A;  2KF6 A;  4BU4 A;  2E2T A;  3H51 A;  5EVH A;  5DRE A;  3BNE A;  3N8B A;  5AII A;  1LXE A;  5AYS C;  2Z76 A;  1V58 A;  2XR8 B;  2CH9 A;  1NWW A;  2O3O A;  3K9M C;  3MSO A;  4HJL B;  4HZB B;  4XBX A;  4PEJ A;  4XBT A;  3VGN A;  1BNG A;  4J5K A;  4NPB A;  1OHS A;  3BU4 A;  3LTC A;  1VQ7 3;  1W02 A;  6RNT A;  1JN5 A;  1RLS A;  3D5G A;  3SX1 A;  2KAA A;  1O7P B;  1MGR A;  1GMQ A;  1RN1 A;  1N5H A;  1RN4 A;  3NBJ A;  2F98 A;  1UUG B;  3HX8 A;  3BNC A;  1S5A A;  3G6E 3;  1MGW A;  1ULI B;  3KCH A;  1BSB A;  5CLK A;  2XEP A;  1I8V A;  2OTJ 3;  1LNI A;  4GHO A;  3UJM A;  4ZM8 A;  1GY6 A;  1HYF A;  3HOH A;  1BSE A;  1O7N B;  1FYS A;  3PGB A;  4X2H A;  1TUH A;  3UL5 A;  1FW7 A;  2UX0 A;  3EBT A;  2W56 B;  3HI7 A;  3SED A;  1GD4 A;  3BLZ A;  3Q90 A;  2B24 B;  3M8C A;  1K73 4;  2GU1 A;  3MKI A;  3WA2 X;  1T5Y A;  1T2H A;  1A2P A;  1R4Y A;  2XGN A;  4EV2 A;  1OGZ A;  4N6N B;  4BL2 A;  3CCR 3;  4JRF A;  4OK0 A;  3D79 A;  1I70 A;  1FZU A;  3MHE A;  3S27 A;  2W9Q A;  1I2E A;  2OCT A;  1LNH A;  2OOV A;  3SYU A;  3EN1 B;  3WHO A;  1AR0 A;  5KP4 A;  3ZFZ A;  2IY2 A;  4MMY B;  1OHP A;  1OF5 A;  3DMC A;  1R4C A;  4N3V A;  1MNL A;  1FGQ A;  4N6U A;  3EBY A;  3A5E A;  1IQ8 A;  4GSP A;  4L7K A;  3WA3 A;  3X42 A;  3T8N A;  1Q40 B;  1LOV A;  4OUQ A;  3I0Y A;  3TDG A;  2WGQ A;  1UW1 A;  3CCM 3;  1IV7 A;  2ZL8 A;  1X1U A;  3EE1 A;  1BNF A;  1PY3 A;  3DGL A;  1I0V A;  5JPP A;  4CPK A;  4MJD A;  3HIG A;  1T2I A;  1IT7 A;  3F9S A;  5BIR A;  2R4I A;  2BU4 A;  2CFW A;  3K5T A;  4ILF A;  4KVH A;  3CNM A;  1QVF 2;  3CCE 3;  5D82 A;  1ULJ B;  3T0U A;  4XM4 A;  2D42 A;  3DY5 A;  1IQX A;  4R9K A;  1L5G B;  5RNT A;  1K8A 4;  1MOL A;  3KE7 A;  1FUW A;  2O9U X;  1N9E A;  2HML B;  3FKA A;  3HII A;  1JBT A;  2XFS A;  1UI8 A;  4K1U A;  3MG2 A;  1Q42 A;  2W56 A;  3LXU X;  3OWY A;  4LEH A;  4AEQ A;  1Q81 4;  3D9R A;  4HYZ A;  3JVC A;  1OH0 A;  1UGH I;  5IEN A;  3UB1 A;  1JJ2 2;  5IER A;  1NB5 I;  4HM3 B;  1AQZ A;  1RGF A;  3OX9 A;  1QMA A;  1PYL A;  1O7G B;  1YJ9 3;  2FNQ A;  3SXX A;  3KZT A;  7GSP A;  1TFO A;  1F8N A;  5A0O B;  1PFP A;  1GOV A;  1SQW A;  1RNT A;  1VZZ A;  1B3S A;  2XGL A;  4XBY A;  1BNI A;  1RRL A;  2PZV A;  4H61 A;  3CCV 3;  1ISK A;  4K61 A;  2D1W A;  1YIT 3;  6GSP A;  1VQK 3;  1JB5 A;  1EKM A;  1RMS A;  5IG5 A;  3LTB A;  1ZS7 A;  3CMA 3;  1A67 A;  4FCJ A;  4HM4 B;  2IUK A;  2XF3 A;  1ZX2 A;  3UL6 A;  3V92 A;  1BRN L;  3RGR A;  1Q40 A;  2CG0 A;  5TGN A;  4R1K A;  2C11 A;  2INX A;  2UGI A;  3S5C A;  2W6J H;  3B4O A;  3S67 A;  3MYT A;  2CWT A;  3FF2 A;  3RDE A;  9RNT A;  2QGU A;  1C7H A;  4LMI A;  4EV5 A;  1IQY A;  5HOH A;  2HMN B;  5AIG A;  1M1K 4;  2CK3 H;  1TP6 A;  3AGO A;  1CYU A;  1GOU A;  1WMP A;  3G4S 3;  1N5P A;  1Q9E A;  2W04 A;  1X1X A;  1BSA A;  1I2G A;  1O7W B;  1D6Y A;  3EQQ B;  4K90 B;  1DMM A;  1RN7 A;  3LTA A;  3NXJ A;  1PU4 A;  3EN8 A;  1AV4 A;  1QJG A;  3NM2 A;  1Q7Y 4;  1Z1S A;  2SBL A;  4MMZ B;  3V99 A;  1KD1 4;  1VQ9 3;  1IVW A;  3J7Y d;  1DVD A;  4HM1 B;  5DRV A;  3S29 A;  2M7O A;  1FGM A;  1MWR A;  2RCD A;  4HM2 B;  3CCQ 3;  3ECF A;  1QAK A;  4HM0 B;  1W6G A;  5G1K A;  1B2U A;  2KRT A;  3WR2 A;  1OPY A;  1UCK A;  1RGK A;  2OQE C;  2L4V A;  3QRD A;  1MWU A;  3FSD A;  1JNQ A;  2UUG C;  3KII A;  1Q86 4;  2OWP A;  3RNT A;  4FR9 A;  4LZI A;  1FA3 A;  5IG0 A;  6STD A;  3UNL A;  1UCJ A;  2XSH B;  1A2K A;  1W01 A;  3ZG5 A;  1LOX A;  1GOY A;  4FMD A;  1YVB I;  3AHS A;  3U1W A;  1RTU A;  1V74 A;  4N6T A;  3OXA A;  5JPU A;  3DUK A;  3B7C A;  3U97 A;  1STD A;  2P0X A;  4X2O A;  1RGA A;  2LQV A;  2W9P A;  1BVI A;  1B2S A;  1DYU A;  3KSE D;  5AI1 A;  2C4B A;  3NBB A;  1IK3 A;  4OVM A;  1RJO A;  2HMK B;  2ML6 A;  1RNB A;  2B1X B;  1EUI C;  3PS8 A;  3DGO A;  3IPT A;  4STD A;  1RSN A;  1DVC A;  1K28 A;  4WFO A;  1YNV X;  4R9L A;  3AGN A;  1I3I A;  1I2F A;  1QAF A;  2QIY A;  5ELU A;  4AKY A;  1CH0 A;  3F8H A;  4MEI A;  3OWS A;  2BMO B;  3N54 B;  1W5Z A;  1D6U A;  1UGI A;  2IA7 A;  2XFT A;  3DXO A;  2GEX A;  1W6C A;  2BIR A;  4AKZ A;  5IG4 A;  1NJI 4;  2RFR A;  1WTH A;  2BMR B;  2HMJ B;  3LOY A;  2ZA4 A;  2P05 A;  2YFL B;  3GWR A;  4WHA A;  1BRS A;  3LML A;  1NO3 A;  1GMR A;  1LVN A;  4CDL A;  1RDS A;  1E3R A;  1RGL A;  2IYJ A;  5AIH A;  1UUW B;  4HM8 B;  1JB4 A;  1JZD A;  4KZ1 A;  1YGW A;  3KFQ C;  3NQY A;  3LH4 A;  4BTX A;  1VQ8 3;  3ALA A;  1JB2 A;  4L8P A;  4N6V 0;  5FGO A;  1W2Z A;  4KT3 B;  1LRA A;  1FGO A;  1QVG 2;  1VQP 3;  3JUP A;  7RNT A;  2CX0 A;  2CWV A;  5CXO A;  2W03 A;  1HZ1 A;  1YJW 3;  4IIA A;  1ZO2 A;  1G02 A;  3G71 3;  4KFF A;  3CCL 3;  3MWZ A;  4LYL B;  3Q2P A;  1CQS A;  1EQK A;  5IF6 A;  3WOE B;  1KSI A;  2F56 A;  3I56 3;  4H3U A;  2F4Y A;  2STD A;  1UCI A;  1E97 A;  2CFK A;  4R80 A;  1RGG A;  4EBG A;  2CG1 A;  3DM8 A;  5IG3 A;  3FGY A;  1IVX A;  3CNX A;  2OOV C;  2LYX A;  3D3L A;  3G0K A;  4NRE A;  3K63 A;  4WYK A;  1BRG A;  1M1X B;  2JQ5 A;  5KP3 A;  1US1 A;  4HZ9 B;  3CC4 3;  3CME 3;  1Y4K A;  3PYJ A;  1TFK A;  3FG4 A;  3HK4 A;  3LT9 A;  2Z6B A;  4MMX B;  3EHC A;  2WGO A;  1YHQ 3;  1NB3 I;  4BTY A;  1BNR A;  3F40 A;  3KKG A;  2RNT A;  5D83 A;  3RGA A;  8CHO A;  1O7H B;  5M18 A;  1X1Y A;  5GSP A;  4Q53 A;  4N6M A;  2KF3 A;  2HMM B;  1JRQ A;  1SAR A;  1B20 A;  1NU3 A;  3X40 A;  4HBR A;  2K0M A;  5HGR A;  1BRI A;  1WQL B;  4RBN A;  4ORL A;  3LZA A;  1VQO 3;  5G1L A;  3K7C A;  4GB5 A;  1BOX A;  2ML5 A;  3PZW A;  4O3V A;  2CHC A;  2JDI H;  2KF4 A;  5IEO A;  2IMJ A;  1EA2 A;  4LGQ A;  1SPU A;  3ZG0 A;  5CF2 A;  1BAO A;  3F7S A;  5BVB A;  5JBS A;  3FH1 A;  3OV4 A;  2CKF B;  3DGN A;  4HVN A;  4L8O A;  1BIR A;  3EB8 A;  1B21 A;  2WO0 A;  2Y73 A;  4FMA A;  1LQM B;  1LOY A;  1I0X A;  5BXQ A;  2RBI A;  1SII A;  1JKG B;  1K41 A;  3HZP A;  1E3V A;  3FG3 A;  3CC2 3;  1RGH A;  3JUO A;  2H0H A;  1BU4 A;  3GSP A;  4LSO A;  3GZR A;  4EXR A;  2KCD A;  4BTW A;  3DGY A;  2ZDJ A;  4TX4 A;  3BIR A;  3JUM A;  3NHX A;  3CU3 A;  3N9H A;  2CWU A;  1V57 A;  3LYG A;  4J5G A;  1BRK A;  1HKX A;  1JZO A;  1JV2 B;  1RHL A;  2P38 A;  1GSP A;  1RGE A;  1X1W A;  1G96 A;  1D6Z A;  2KXG A;  1BSC A;  1BSD A;  4XDW A;  4BL3 A;  1N8R 4;  3D5I A;  3SOY A;  3F14 A;  1GY7 A;  1NDO B;  2AAD A;  1OHO A;  1AY7 A;  1QAL A;  1W7C A;  3IMA B;  4CCV A;  4EW5 A;  3EJV A;  3QK9 A;  3I55 3;  4GL6 A;  5D81 A;  3S28 A;  1OUN A;  1Q7H A;  3CCS 3;  3FCS B;  3AHW A;  3JUQ A;  3F7X A;  5ELJ A;  1MWS A;  2GXF A;  2GSP A;  3OWU A;  4N6L A;  3X3Z A;  3AMO B;  3G16 A;  2Z7A A;  3O8Y A;  1VQ4 3;  3CPW 2;  2BO9 B;  1FUT A;  2RGQ A;  2CC3 A;  2MC8 A;  1B2M A;  1T3B A;  1IVV A;  3KSP A;  3NBR A;  3NV0 A;  4J9A A;  4WYK B;  1U5O A;  1IDP A;  5AIF A;  1STF I;  2XRX B;  1K9M 4;  3FLJ A;  4KFD A;  1BUQ A;  3WMD A;  3CC7 3;  2GEY A;  3A76 A;  1CEW I;  3EC9 A;  4DKI A;  4EC6 A;  2W2C A;  3SVA A;  1BNE A;  2CX1 A;  1FUS A;  4I4K A;  1WNH A;  1TU5 A;  4IPB A;  1RRH A;  1GMP A;  3FG1 A;  3B4P A;  1TJD A;  3F8X A;  2BT3 A;  1BNJ A;  1A90 A;  1MWT A;  1YJN 3;  1ZGX A;  1FGT A;  2K54 A;  1WMN A;  1YGE A;  2GBX B;  3PCS A;  2PNC A;  3WDG B;  1JKG A;  1BGS A;  3NM7 A;  2OTL 3;  5LC6 A;  4O2H A;  3DZL A;  3WOF B;  3JUN A;  2HMO B;  4HKV B;  3SLU A;  2BHM A;  4FCM A;  1YI2 3;  3GZX B;  1B2Z A;  4FCZ A;  1BUJ A;  3OW2 2;  4K1V A;  5CK6 A;  1B2X A;  2AAE A;  3NUV A;  3STD A;  1J2B A;  1S72 3;  1W00 A;  1VQ6 3;  4HM5 B;  4KFE A;  1EG9 B;  2F5W A;  1O7M B;  1SJW A;  2GBW B;  4NHF A;  5KP1 A;  1CYV A;  1FGR A;  1VQM 3;  4J8T A;  3CCJ 3;  1IVU A;  4U13 A;  5CF1 A;  3D4A A;  1LQG C;  1KWI A;  5BU4 A;  1TIJ A;  3Q3F A;  1UI7 A;  3H3H A;  5G2G A;  2YX9 A;  1M90 4;  2BNG A;  1RGC A;  3B8L A;  2MF7 A;  1UUV B;  2E2V A;  3PCR A;  3LTD A;  1ASK A;  3T8U A;  3AMO A;  2R41 A;  3WOD G;  2K3D A;  1DET A;  3DGM A;  1VQN 3;  1EEJ A;  3MPH A;  4RZM A;  3X41 A;  2KF5 A;  3PXM A;  1RKY A;  2QEX 3;  3URP A;  2GU3 A;  2WOH A;  3BB9 A;  1KQS 2;  1ROV A;  2CW9 A;  2H0I A;  2YFI B;  1U8C B;  1HU9 A;  3ER7 A;  1RCL A;  2SAR A;  3LT8 A;  4I5Q A;  4O8S A;  2QA4 3;  5FW5 A;  1IYY A;  2YFJ B;  2RSX A;  2HOH A;  5M1A A;  3V98 A;  2F5M A;  1TRQ A;  3CXC 2;  1OAC A;  2FXT A;  8RNT A;  1BNS A; 
#chains in the Genus database with same CATH homology
 2H0G A;  4I5Q A;  1JZD A;  1V58 A;  1V57 A;  5G1K A;  1T3B A;  1JZO A;  2IY2 A;  4ILF A;  2H0I A;  4NPB A;  1G0T A;  1TJD A;  1EEJ A;  5G1L A;  2IYJ A;  2H0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...