2IY2A

Crystal structure of the n-terminal dimer domain of e.coli dsbg
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
69
structure length
69
Chain Sequence
LPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Dimerization Domains of the Escherichia Coli Disulfide-Bond Isomerase Enzymes Dsbc and Dsbg
pubmed doi rcsb
molecule tags Chaperone
molecule keywords THIOL DISULFIDE INTERCHANGE PROTEIN DSBG
total genus 13
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 2iy2A00
1G0TA 4ILFA 2IYJA 1T3BA 1TJDA 2H0HA 2H0IA 4I5QA 1V58A 2H0GA 5G1KA 4NPBA 5G1LA 2IY2A 1V57A 1JZDA 1JZOA 1EEJA
chains in the Genus database with same CATH superfamily
2WGQA 1T2IA 1T2HA 1W7CA 4STDA 2P0XA 4R9LA 2OQEC 1BSEA 4N6V0 1RTUA 1OHOA 3N8BA 2W0QA 3EE1A 1BU4A 1IVUA 2W9PA 3CMA3 1B2XA 1BRJA 1YJW3 3ECFA 1GOVA 3LMLA 3GZRA 2BO9B 1YGWA 4RNTA 1FUTA 1TUHA 4H3UA 3RGAA 7RNTA 1WMNA 4XB5A 1QJGA 3DGMA 1RGEA 1UUVB 2B24B 2P05A 1UUWB 3X3ZA 1HZ1A 3F14A 3KFQC 4BTWA 1VQK3 5EVHA 3LH4A 4EYCA 2Y74A 5BU4A 1GMRA 3RNTA 3D5GA 2BMOB 2OWPA 4J5KA 3T8UA 2UGIA 2H0HA 3FG3A 4QWTA 2RGQA 2XGLA 2ZHXB 5AYSC 3AHWA 3WOFB 3D9RA 3IJEB 2FXTA 1Q40A 1ROVA 2IUKA 1CEWI 4NREA 5HOHA 4R9KA 1EKMA 3X3YA 1K28A 1SIHA 1W5ZA 4HYZA 3S67A 1X1UA 2ZDJA 2WOHA 1JN5B 1AVLA 3JUPA 1LOVA 4CCVA 1IVXA 1O7HB 3D79A 3Q2PA 1WMPA 1YVSA 2BNGA 3G713 1VQ73 4EC6A 2JQ5A 5CF2A 5ELJA 1GMQA 4FCZA 2F86B 3K7CA 1JBSA 5CK6A 5AEWB 2XEPA 3AMOA 2GU3A 1N9EA 4FCMA 4KZ1A 3LTAA 4RNZA 4EBGA 1K8A4 2E2TA 5IG0A 3I553 5M19A 1YNVX 1JRQA 3V92A 3FF2A 1ULJB 2QA43 1K9M4 4MMYB 1LNHA 1YIT3 1PFPA 3CNMA 4L8OA 3WDGB 3WHOA 1VQO3 3FG1A 3BNBA 2CHCA 2CX1A 4XBXA 2CH9A 2M7OA 3K5TA 1BRNL 1EA2A 3DH2A 2CC3A 1ZO2A 1OACA 3SXXA 2F4YA 3NHXA 1RSNA 4BL3A 4K61A 1HU9A 3FCSB 2E2UA 1UCJA 3CNXA 2IY2A 2KF3A 2GU1A 1NU3A 3PZWA 4LZIA 3FSDA 4KFFA 3MG3A 3ALAA 1YIJ3 2D1WA 2BU4A 3L0RA 2YFJB 1RLSA 1BNRA 1UGIA 5STDA 6RNTA 1IQXA 2XFSA 3Q90A 3V98A 1CYVA 1LOWA 2WO0A 3D5IA 5JPUA 1RCKA 2STDA 1U5OA 5RNTA 3HI7A 3I563 1D6UA 1ISKA 5JBSA 1Q7Y4 1W02A 4X2OA 1BUQA 5LC7A 3EF8A 3S27A 1W6CA 5IEPA 2W56A 3EN8A 3CCR3 4R1KA 1N5PA 5AIFA 2XRXB 1W4NA 3G8ZA 2IUJA 3S5CA 1IT8A 3PXMA 3GZBA 1RMSA 5CLKA 3OW22 1UW1A 4LEHA 3TDGA 3LOYA 2HMJB 3LZAA 4HKVB 1O7MB 4FR9A 3X41A 3EBTA 3DGYA 3KIIA 4NHFA 1BNIA 4NPBA 2QIYA 1FGQA 4J8TA 1EEJA 1FGOA 2GEYA 2GBWB 1M1K4 1TRQA 1KD14 4LGQA 3CCQ3 1RKYA 3GAXA 5LC6A 3MSOA 4BIRA 1I8VA 4EXRA 1I0VA 3KSED 3VGNA 1RN4A 1W2B2 5FW5A 4HJLB 2P0MA 5D81A 5IW9A 1U8CB 1W6GA 2XFTA 4K90B 2V1LA 2W04A 2ZA4A 1RGAA 3GZXB 3LTCA 3B4OA 1GY7A 3LT8A 3EN1B 3FF0A 3FLJA 1GOUA 4HVNA 3CME3 1AQZA 3CU3A 3MHEA 1X1WA 1A2PA 3ZG0A 1M1XB 4XDVA 2MF7A 1IU7A 3DUKA 1KC84 4N6UA 1N9JA 4N3VA 2Z7AA 1RGHA 3QK9A 1GD4A 3X3XA 1NB3I 3IMAB 4WP5A 1QALA 3DGNA 4X2HA 4MEIA 3KKGA 4XM4A 2OQEA 1PY3A 2YFLB 5BVBA 1FUWA 1VQL3 4N6LA 2CW9A 4HM8B 1DMNA 3F40A 5KP3A 1NWWA 5AIGA 1I2FA 1HYFA 2BIRA 1V74A 2HMOB 4U13A 1TU5A 1BRIA 1I0XA 2CKFB 4PEJA 1YI23 1YVBI 1B3SA 1GOYA 8RNTA 5I97A 4MJDA 1L5GB 3MPHA 1RNBA 4HOHA 1C7HA 3K63A 3DZLA 1DVDA 4BTYA 1T5YA 5G1LA 2C11A 4HM1B 1I2EA 2R4IA 1W00A 1M904 3KZTA 5D82A 3X40A 1E3RA 1Q7HA 4O8SA 1BNSA 1S723 1FW7A 3SVAA 2QGUA 1Q814 1Q42A 3NM7A 2CFGA 4AEQA 1RDSA 3FGYA 3JUQA 3WODG 2FNQA 2XGNA 4EW5A 2HMNB 1OUNA 5IG5A 1A2KA 3SEDA 1BRGA 3VF1A 1A2VA 2A15A 3KCHA 3WA2X 1BVIA 1VQM3 1O7GB 1WQLB 3OWSA 3UL6A 1DMMA 2K3DA 3SLUA 4HAAA 1O7WB 2PZVA 1JKGA 1EQKA 1JB5A 3SX1A 1KQS2 1EG9B 1M9GA 1YHQ3 1QVF2 4GSPA 4N6NB 1AR0A 1LRAA 5IG3A 2W03A 3RDEA 2K0MA 3H51A 2UUGC 3CC43 2R41A 2GEXA 2HMMB 2XSHB 3MG2A 5IERA 1WTHA 2ZL8A 3AGNA 1JZOA 5G2GA 2SARA 2FGTA 4FMCA 1UGHI 3RGRA 2Y73A 2K54A 3NV0A 3EBYA 2RBIA 5TGNA 2W9QA 2C4BA 2W6JH 2Q07A 4HM7B 1RNTA 1MWTA 6STDA 4TX4A 1LQGC 3IPTA 1QAKA 2KAAA 4L8PA 4XDWA 2KF6A 2OTL3 3MG1A 3NQZA 2MC8A 1B27A 1RGFA 1B2SA 2KF4A 4HBRA 2UX0A 1VQ63 1OHSA 3B8LA 3N9HA 3E99A 1I2GA 3HZPA 3LYGA 5AIHA 5EQLA 1MWRA 4KFEA 3DGLA 3BLZA 4HM2B 4ORLA 2E2VA 3CC23 1GS3A 3WA3A 1BNGA 7GSPA 3WOEB 2GBXB 1UI7A 1SQWA 3OXAA 1BNEA 3DMCA 1KSIA 1IV7A 2XH9A 2Z76A 3BNEA 3HOHA 1GMPA 2YX9A 1X1YA 1NJI4 1G0TA 2CWVA 1F8NA 3G0KA 4EV2A 1MOLA 4OK0A 2RSXA 5JPPA 1VQ53 4N6MA 4HM3B 5A0OB 1D6ZA 2KF5A 3STDA 2F5WA 4ILFA 2O9UX 1B21A 3NV0B 2I9WA 3WR2A 4AKYA 1KWIA 4LSOA 2WOFA 2L1SA 4L7KA 4I4KA 2O3OA 1FGRA 2IYJA 1BSCA 3FKAA 1EUIC 4N6TA 1CYUA 3OWYA 2F98A 3GZYB 1TP6A 5D83A 4KT3B 1BRSA 5KP4A 3T8NA 2CK3H 1IYYA 2XF3A 3DM8A 3CXC2 4IPBA 3G6E3 1OGZA 1QAFA 1OHPA 1QMAA 3SOYA 1OH0A 1LQMB 3DXOA 3EJVA 3A5EA 1E97A 1RGCA 3FZWA 1W6YA 2BT3A 4CDLA 4IT7A 2AADA 1JB4A 2CFWA 3MKIA 1TIJA 3CPOA 3D4AA 1R4YA 1JKGB 4ZM8A 5BIRA 1K734 4FMAA 1VQP3 2BMRB 4HM4B 3CPW2 1OF5B 1PYLA 4G1MB 1STFI 3ZG5A 1C54A 1DMQA 1NNVA 3EHCA 1BIRA 1JB2A 3GRDA 4KFDA 4O3VA 2LYXA 1US1A 1RRLA 4GHOA 9RNTA 3UB1A 1FZUA 1WMOA 1LNIA 3BB9A 1N8R4 4XBTA 2F5MA 1Y4KA 2H0IA 2CG0A 4I5QA 1LOYA 1V58A 2GSPA 2BHMA 2GXFA 2P09A 4BL2A 5CF1A 3T0UA 4Q53A 1BAOA 1IT7A 1N8QA 1BANA 3FG4A 1IVVA 5DREA 1UCIA 3S29A 2RNTA 5M18A 1BNJA 1RGLA 2IA7A 2B1XB 5IEOA 3LXUX 4EV5A 2CX0A 3ER7A 2C10A 1N5HA 2AAEA 3PYJA 3BNDA 1VQ43 1NO3A 3U1WA 2HMKB 1SIIA 1BSBA 3G4S3 4DKIA 3B4PA 3NBRA 1LXEA 3BIRA 8CHOA 1JV2B 3SOAA 1E3VA 1VQ93 1A90A 2HOHA 2OOVC 1Q864 1BUJA 1UUGB 4BU4A 1MWSA 3ZFZA 2JDIH 3CD63 2QEX3 1OF5A 4JRFA 1W01A 4FCJA 3EC9A 3GSPA 1AY7A 3BNCA 1IQYA 2XSOB 3I0YA 2L4VA 3JVCA 3OV4A 3J7Yd 5HGRA 5AEUB 1I70A 1V57A 1WNHA 1JN5A 1B2ZA 3URPA 2WGOA 3NUVA 1ULIB 4WYKA 3GWRA 3G16A 1B2UA 2RFRA 1Z1SA 2Z77A 3A76A 1W2ZA 3KSPA 2W2CA 3NX0A 1Q40B 3AGOA 5IF6A 1RJOA 1ASKA 2CFKA 4IIAA 5AYRB 1BRHA 2XR8B 4FMDA 4JF8A 2F56A 1D6YA 1IQ8A 1IVWA 4KVHA 5IENA 2PNCA 1DETA 2LQVA 3VSYA 4RBNA 4WWUC 3F8XA 3KE7A 1FYSA 4HZ9B 1IV9A 4LYLB 1MGRA 3NM2A 2ML6A 2KCDA 4O2HA 1IK3A 1SPUA 3Q1CA 1RCLA 3F7SA 2OOVA 1X1XA 3NXJA 3S28A 3KN4A 1MNLA 1S5AA 1NB5I 2IMJA 1SARA 1HKXA 3Q3FA 1YJN3 1G02A 2KXGA 4HM0B 4R4KA 1O7PB 1RGKA 4HZBB 1K41A 1ZX2A 1A67A 1GD3A 1QVG2 4BTXA 1TJDA 1UI8A 4RNYA 1JNQA 1GSPA 3BU4A 5FGOA 1OGXA 1JJ22 1RGGA 6GSPA 4GB5A 5ELUA 5M1AA 3PGBA 7STDA 3UL5A 5KP1A 5AI1A 3CC73 2CIUA 4WYKB 3CCV3 3N54B 3CCM3 1JZDA 3F8HA 3F9SA 1DVCA 5GSPA 2CWTA 3M8CA 3CCJ3 1TFKA 3OX9A 3LTDA 3F7XA 1I3IA 1ZS7A 4MMZB 4MMXB 1DYUA 1GYBA 1T3BA 3CCE3 1RRHA 3OWUA 1FA3A 2KRTA 3K0ZA 2INXA 5IG4A 2F99A 5AIIA 1B2MA 1TFOA 3UJMA 2J8XB 1OCVA 1BNFA 1MGWA 1MWUA 4GL6A 1Q9EA 2H0GA 3HX8A 4O02B 3AMOB 1JBRA 2YFIB 2Z6BA 3H3HA 4K1VA 1UDII 3MWZA 1RN7A 5G1KA 2CG1A 3CCS3 4HM6B 1DE3A 3WMDA 3D3LA 5BXQA 1VQ83 1B20A 3K9MC 4HM5B 1Q824 1LOXA 1UCKA 2ML5A 1BGSA 1TRPA 3DY5A 2CFDA 1LVNA 2D42A 1UCLA 4WFOA 4N6OB 5EEOA 1FUSA 1YJ93 1CH0A 4CPKA 2SBLA 3X42A 1RN1A 3EX9A 4H61A 3AHSA 5CXOA 1IDPA 2HMLB 1OPYA 1AVKA 3MYTA 4CJNA 2OTJ3 1ZGXA 4AKZA 3NBJA 1BOXA 1CQSA 1VQQA 1SJWA 4FMBA 1STDA 1RHLA 1J2BA 3JUNA 3O8YA 1BSDA 2CWUA 3SYUA 4J9AA 1ROAA 3EB8A 1GY5A 3JUMA 3JUOA 1BRKA 1VQN3 3PCSA 1JBTA 1FGMA 2W56B 2BMQB 3HIGA 4WHAA 4RZMA 3HIIA 4XBYA 3PS8A 3CCL3 3EQQB 4LMIA 1GY6A 3U97A 1AV4A 3QRDA 3FH1A 1TTOA 3LTBA 3UNLA 3CCU3 3ROBA 1R4CA 2P38A 1NDOB 3V99A 4K1UA 4J5GA 4OVMA 1O7NB 3PCRA 2RCDA 1PU4A 3B7CA 1I3FA 3LT9A 5DRVA 3NQYA 4OUQA 1VZZA 3HK4A 1BSAA 2CFLA 1FGTA 1YGEA 3NBBA 4R80A 2OCTA 3DGOA 1G96A
chains in the Genus database with same CATH topology
1G0TA 4ILFA 2IYJA 1T3BA 1TJDA 2H0HA 2H0IA 4I5QA 1V58A 2H0GA 5G1KA 4NPBA 5G1LA 2IY2A 1V57A 1JZDA 1JZOA 1EEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G0T A;  4ILF A;  2IYJ A;  1T3B A;  1TJD A;  2H0H A;  2H0I A;  4I5Q A;  1V58 A;  2H0G A;  5G1K A;  4NPB A;  5G1L A;  2IY2 A;  1V57 A;  1JZD A;  1JZO A;  1EEJ A; 
#chains in the Genus database with same CATH topology
 2WGQ A;  1T2I A;  1T2H A;  1W7C A;  4STD A;  2P0X A;  4R9L A;  2OQE C;  1BSE A;  4N6V 0;  1RTU A;  1OHO A;  3N8B A;  2W0Q A;  3EE1 A;  1BU4 A;  1IVU A;  2W9P A;  3CMA 3;  1B2X A;  1BRJ A;  1YJW 3;  3ECF A;  1GOV A;  3LML A;  3GZR A;  2BO9 B;  1YGW A;  4RNT A;  1FUT A;  1TUH A;  4H3U A;  3RGA A;  7RNT A;  1WMN A;  4XB5 A;  1QJG A;  3DGM A;  1RGE A;  1UUV B;  2B24 B;  2P05 A;  1UUW B;  3X3Z A;  1HZ1 A;  3F14 A;  3KFQ C;  4BTW A;  1VQK 3;  5EVH A;  3LH4 A;  4EYC A;  2Y74 A;  5BU4 A;  1GMR A;  3RNT A;  3D5G A;  2BMO B;  2OWP A;  4J5K A;  3T8U A;  2UGI A;  2H0H A;  3FG3 A;  4QWT A;  2RGQ A;  2XGL A;  2ZHX B;  5AYS C;  3AHW A;  3WOF B;  3D9R A;  3IJE B;  2FXT A;  1Q40 A;  1ROV A;  2IUK A;  1CEW I;  4NRE A;  5HOH A;  4R9K A;  1EKM A;  3X3Y A;  1K28 A;  1SIH A;  1W5Z A;  4HYZ A;  3S67 A;  1X1U A;  2ZDJ A;  2WOH A;  1JN5 B;  1AVL A;  3JUP A;  1LOV A;  4CCV A;  1IVX A;  1O7H B;  3D79 A;  3Q2P A;  1WMP A;  1YVS A;  2BNG A;  3G71 3;  1VQ7 3;  4EC6 A;  2JQ5 A;  5CF2 A;  5ELJ A;  1GMQ A;  4FCZ A;  2F86 B;  3K7C A;  1JBS A;  5CK6 A;  5AEW B;  2XEP A;  3AMO A;  2GU3 A;  1N9E A;  4FCM A;  4KZ1 A;  3LTA A;  4RNZ A;  4EBG A;  1K8A 4;  2E2T A;  5IG0 A;  3I55 3;  5M19 A;  1YNV X;  1JRQ A;  3V92 A;  3FF2 A;  1ULJ B;  2QA4 3;  1K9M 4;  4MMY B;  1LNH A;  1YIT 3;  1PFP A;  3CNM A;  4L8O A;  3WDG B;  3WHO A;  1VQO 3;  3FG1 A;  3BNB A;  2CHC A;  2CX1 A;  4XBX A;  2CH9 A;  2M7O A;  3K5T A;  1BRN L;  1EA2 A;  3DH2 A;  2CC3 A;  1ZO2 A;  1OAC A;  3SXX A;  2F4Y A;  3NHX A;  1RSN A;  4BL3 A;  4K61 A;  1HU9 A;  3FCS B;  2E2U A;  1UCJ A;  3CNX A;  2IY2 A;  2KF3 A;  2GU1 A;  1NU3 A;  3PZW A;  4LZI A;  3FSD A;  4KFF A;  3MG3 A;  3ALA A;  1YIJ 3;  2D1W A;  2BU4 A;  3L0R A;  2YFJ B;  1RLS A;  1BNR A;  1UGI A;  5STD A;  6RNT A;  1IQX A;  2XFS A;  3Q90 A;  3V98 A;  1CYV A;  1LOW A;  2WO0 A;  3D5I A;  5JPU A;  1RCK A;  2STD A;  1U5O A;  5RNT A;  3HI7 A;  3I56 3;  1D6U A;  1ISK A;  5JBS A;  1Q7Y 4;  1W02 A;  4X2O A;  1BUQ A;  5LC7 A;  3EF8 A;  3S27 A;  1W6C A;  5IEP A;  2W56 A;  3EN8 A;  3CCR 3;  4R1K A;  1N5P A;  5AIF A;  2XRX B;  1W4N A;  3G8Z A;  2IUJ A;  3S5C A;  1IT8 A;  3PXM A;  3GZB A;  1RMS A;  5CLK A;  3OW2 2;  1UW1 A;  4LEH A;  3TDG A;  3LOY A;  2HMJ B;  3LZA A;  4HKV B;  1O7M B;  4FR9 A;  3X41 A;  3EBT A;  3DGY A;  3KII A;  4NHF A;  1BNI A;  4NPB A;  2QIY A;  1FGQ A;  4J8T A;  1EEJ A;  1FGO A;  2GEY A;  2GBW B;  1M1K 4;  1TRQ A;  1KD1 4;  4LGQ A;  3CCQ 3;  1RKY A;  3GAX A;  5LC6 A;  3MSO A;  4BIR A;  1I8V A;  4EXR A;  1I0V A;  3KSE D;  3VGN A;  1RN4 A;  1W2B 2;  5FW5 A;  4HJL B;  2P0M A;  5D81 A;  5IW9 A;  1U8C B;  1W6G A;  2XFT A;  4K90 B;  2V1L A;  2W04 A;  2ZA4 A;  1RGA A;  3GZX B;  3LTC A;  3B4O A;  1GY7 A;  3LT8 A;  3EN1 B;  3FF0 A;  3FLJ A;  1GOU A;  4HVN A;  3CME 3;  1AQZ A;  3CU3 A;  3MHE A;  1X1W A;  1A2P A;  3ZG0 A;  1M1X B;  4XDV A;  2MF7 A;  1IU7 A;  3DUK A;  1KC8 4;  4N6U A;  1N9J A;  4N3V A;  2Z7A A;  1RGH A;  3QK9 A;  1GD4 A;  3X3X A;  1NB3 I;  3IMA B;  4WP5 A;  1QAL A;  3DGN A;  4X2H A;  4MEI A;  3KKG A;  4XM4 A;  2OQE A;  1PY3 A;  2YFL B;  5BVB A;  1FUW A;  1VQL 3;  4N6L A;  2CW9 A;  4HM8 B;  1DMN A;  3F40 A;  5KP3 A;  1NWW A;  5AIG A;  1I2F A;  1HYF A;  2BIR A;  1V74 A;  2HMO B;  4U13 A;  1TU5 A;  1BRI A;  1I0X A;  2CKF B;  4PEJ A;  1YI2 3;  1YVB I;  1B3S A;  1GOY A;  8RNT A;  5I97 A;  4MJD A;  1L5G B;  3MPH A;  1RNB A;  4HOH A;  1C7H A;  3K63 A;  3DZL A;  1DVD A;  4BTY A;  1T5Y A;  5G1L A;  2C11 A;  4HM1 B;  1I2E A;  2R4I A;  1W00 A;  1M90 4;  3KZT A;  5D82 A;  3X40 A;  1E3R A;  1Q7H A;  4O8S A;  1BNS A;  1S72 3;  1FW7 A;  3SVA A;  2QGU A;  1Q81 4;  1Q42 A;  3NM7 A;  2CFG A;  4AEQ A;  1RDS A;  3FGY A;  3JUQ A;  3WOD G;  2FNQ A;  2XGN A;  4EW5 A;  2HMN B;  1OUN A;  5IG5 A;  1A2K A;  3SED A;  1BRG A;  3VF1 A;  1A2V A;  2A15 A;  3KCH A;  3WA2 X;  1BVI A;  1VQM 3;  1O7G B;  1WQL B;  3OWS A;  3UL6 A;  1DMM A;  2K3D A;  3SLU A;  4HAA A;  1O7W B;  2PZV A;  1JKG A;  1EQK A;  1JB5 A;  3SX1 A;  1KQS 2;  1EG9 B;  1M9G A;  1YHQ 3;  1QVF 2;  4GSP A;  4N6N B;  1AR0 A;  1LRA A;  5IG3 A;  2W03 A;  3RDE A;  2K0M A;  3H51 A;  2UUG C;  3CC4 3;  2R41 A;  2GEX A;  2HMM B;  2XSH B;  3MG2 A;  5IER A;  1WTH A;  2ZL8 A;  3AGN A;  1JZO A;  5G2G A;  2SAR A;  2FGT A;  4FMC A;  1UGH I;  3RGR A;  2Y73 A;  2K54 A;  3NV0 A;  3EBY A;  2RBI A;  5TGN A;  2W9Q A;  2C4B A;  2W6J H;  2Q07 A;  4HM7 B;  1RNT A;  1MWT A;  6STD A;  4TX4 A;  1LQG C;  3IPT A;  1QAK A;  2KAA A;  4L8P A;  4XDW A;  2KF6 A;  2OTL 3;  3MG1 A;  3NQZ A;  2MC8 A;  1B27 A;  1RGF A;  1B2S A;  2KF4 A;  4HBR A;  2UX0 A;  1VQ6 3;  1OHS A;  3B8L A;  3N9H A;  3E99 A;  1I2G A;  3HZP A;  3LYG A;  5AIH A;  5EQL A;  1MWR A;  4KFE A;  3DGL A;  3BLZ A;  4HM2 B;  4ORL A;  2E2V A;  3CC2 3;  1GS3 A;  3WA3 A;  1BNG A;  7GSP A;  3WOE B;  2GBX B;  1UI7 A;  1SQW A;  3OXA A;  1BNE A;  3DMC A;  1KSI A;  1IV7 A;  2XH9 A;  2Z76 A;  3BNE A;  3HOH A;  1GMP A;  2YX9 A;  1X1Y A;  1NJI 4;  1G0T A;  2CWV A;  1F8N A;  3G0K A;  4EV2 A;  1MOL A;  4OK0 A;  2RSX A;  5JPP A;  1VQ5 3;  4N6M A;  4HM3 B;  5A0O B;  1D6Z A;  2KF5 A;  3STD A;  2F5W A;  4ILF A;  2O9U X;  1B21 A;  3NV0 B;  2I9W A;  3WR2 A;  4AKY A;  1KWI A;  4LSO A;  2WOF A;  2L1S A;  4L7K A;  4I4K A;  2O3O A;  1FGR A;  2IYJ A;  1BSC A;  3FKA A;  1EUI C;  4N6T A;  1CYU A;  3OWY A;  2F98 A;  3GZY B;  1TP6 A;  5D83 A;  4KT3 B;  1BRS A;  5KP4 A;  3T8N A;  2CK3 H;  1IYY A;  2XF3 A;  3DM8 A;  3CXC 2;  4IPB A;  3G6E 3;  1OGZ A;  1QAF A;  1OHP A;  1QMA A;  3SOY A;  1OH0 A;  1LQM B;  3DXO A;  3EJV A;  3A5E A;  1E97 A;  1RGC A;  3FZW A;  1W6Y A;  2BT3 A;  4CDL A;  4IT7 A;  2AAD A;  1JB4 A;  2CFW A;  3MKI A;  1TIJ A;  3CPO A;  3D4A A;  1R4Y A;  1JKG B;  4ZM8 A;  5BIR A;  1K73 4;  4FMA A;  1VQP 3;  2BMR B;  4HM4 B;  3CPW 2;  1OF5 B;  1PYL A;  4G1M B;  1STF I;  3ZG5 A;  1C54 A;  1DMQ A;  1NNV A;  3EHC A;  1BIR A;  1JB2 A;  3GRD A;  4KFD A;  4O3V A;  2LYX A;  1US1 A;  1RRL A;  4GHO A;  9RNT A;  3UB1 A;  1FZU A;  1WMO A;  1LNI A;  3BB9 A;  1N8R 4;  4XBT A;  2F5M A;  1Y4K A;  2H0I A;  2CG0 A;  4I5Q A;  1LOY A;  1V58 A;  2GSP A;  2BHM A;  2GXF A;  2P09 A;  4BL2 A;  5CF1 A;  3T0U A;  4Q53 A;  1BAO A;  1IT7 A;  1N8Q A;  1BAN A;  3FG4 A;  1IVV A;  5DRE A;  1UCI A;  3S29 A;  2RNT A;  5M18 A;  1BNJ A;  1RGL A;  2IA7 A;  2B1X B;  5IEO A;  3LXU X;  4EV5 A;  2CX0 A;  3ER7 A;  2C10 A;  1N5H A;  2AAE A;  3PYJ A;  3BND A;  1VQ4 3;  1NO3 A;  3U1W A;  2HMK B;  1SII A;  1BSB A;  3G4S 3;  4DKI A;  3B4P A;  3NBR A;  1LXE A;  3BIR A;  8CHO A;  1JV2 B;  3SOA A;  1E3V A;  1VQ9 3;  1A90 A;  2HOH A;  2OOV C;  1Q86 4;  1BUJ A;  1UUG B;  4BU4 A;  1MWS A;  3ZFZ A;  2JDI H;  3CD6 3;  2QEX 3;  1OF5 A;  4JRF A;  1W01 A;  4FCJ A;  3EC9 A;  3GSP A;  1AY7 A;  3BNC A;  1IQY A;  2XSO B;  3I0Y A;  2L4V A;  3JVC A;  3OV4 A;  3J7Y d;  5HGR A;  5AEU B;  1I70 A;  1V57 A;  1WNH A;  1JN5 A;  1B2Z A;  3URP A;  2WGO A;  3NUV A;  1ULI B;  4WYK A;  3GWR A;  3G16 A;  1B2U A;  2RFR A;  1Z1S A;  2Z77 A;  3A76 A;  1W2Z A;  3KSP A;  2W2C A;  3NX0 A;  1Q40 B;  3AGO A;  5IF6 A;  1RJO A;  1ASK A;  2CFK A;  4IIA A;  5AYR B;  1BRH A;  2XR8 B;  4FMD A;  4JF8 A;  2F56 A;  1D6Y A;  1IQ8 A;  1IVW A;  4KVH A;  5IEN A;  2PNC A;  1DET A;  2LQV A;  3VSY A;  4RBN A;  4WWU C;  3F8X A;  3KE7 A;  1FYS A;  4HZ9 B;  1IV9 A;  4LYL B;  1MGR A;  3NM2 A;  2ML6 A;  2KCD A;  4O2H A;  1IK3 A;  1SPU A;  3Q1C A;  1RCL A;  3F7S A;  2OOV A;  1X1X A;  3NXJ A;  3S28 A;  3KN4 A;  1MNL A;  1S5A A;  1NB5 I;  2IMJ A;  1SAR A;  1HKX A;  3Q3F A;  1YJN 3;  1G02 A;  2KXG A;  4HM0 B;  4R4K A;  1O7P B;  1RGK A;  4HZB B;  1K41 A;  1ZX2 A;  1A67 A;  1GD3 A;  1QVG 2;  4BTX A;  1TJD A;  1UI8 A;  4RNY A;  1JNQ A;  1GSP A;  3BU4 A;  5FGO A;  1OGX A;  1JJ2 2;  1RGG A;  6GSP A;  4GB5 A;  5ELU A;  5M1A A;  3PGB A;  7STD A;  3UL5 A;  5KP1 A;  5AI1 A;  3CC7 3;  2CIU A;  4WYK B;  3CCV 3;  3N54 B;  3CCM 3;  1JZD A;  3F8H A;  3F9S A;  1DVC A;  5GSP A;  2CWT A;  3M8C A;  3CCJ 3;  1TFK A;  3OX9 A;  3LTD A;  3F7X A;  1I3I A;  1ZS7 A;  4MMZ B;  4MMX B;  1DYU A;  1GYB A;  1T3B A;  3CCE 3;  1RRH A;  3OWU A;  1FA3 A;  2KRT A;  3K0Z A;  2INX A;  5IG4 A;  2F99 A;  5AII A;  1B2M A;  1TFO A;  3UJM A;  2J8X B;  1OCV A;  1BNF A;  1MGW A;  1MWU A;  4GL6 A;  1Q9E A;  2H0G A;  3HX8 A;  4O02 B;  3AMO B;  1JBR A;  2YFI B;  2Z6B A;  3H3H A;  4K1V A;  1UDI I;  3MWZ A;  1RN7 A;  5G1K A;  2CG1 A;  3CCS 3;  4HM6 B;  1DE3 A;  3WMD A;  3D3L A;  5BXQ A;  1VQ8 3;  1B20 A;  3K9M C;  4HM5 B;  1Q82 4;  1LOX A;  1UCK A;  2ML5 A;  1BGS A;  1TRP A;  3DY5 A;  2CFD A;  1LVN A;  2D42 A;  1UCL A;  4WFO A;  4N6O B;  5EEO A;  1FUS A;  1YJ9 3;  1CH0 A;  4CPK A;  2SBL A;  3X42 A;  1RN1 A;  3EX9 A;  4H61 A;  3AHS A;  5CXO A;  1IDP A;  2HML B;  1OPY A;  1AVK A;  3MYT A;  4CJN A;  2OTJ 3;  1ZGX A;  4AKZ A;  3NBJ A;  1BOX A;  1CQS A;  1VQQ A;  1SJW A;  4FMB A;  1STD A;  1RHL A;  1J2B A;  3JUN A;  3O8Y A;  1BSD A;  2CWU A;  3SYU A;  4J9A A;  1ROA A;  3EB8 A;  1GY5 A;  3JUM A;  3JUO A;  1BRK A;  1VQN 3;  3PCS A;  1JBT A;  1FGM A;  2W56 B;  2BMQ B;  3HIG A;  4WHA A;  4RZM A;  3HII A;  4XBY A;  3PS8 A;  3CCL 3;  3EQQ B;  4LMI A;  1GY6 A;  3U97 A;  1AV4 A;  3QRD A;  3FH1 A;  1TTO A;  3LTB A;  3UNL A;  3CCU 3;  3ROB A;  1R4C A;  2P38 A;  1NDO B;  3V99 A;  4K1U A;  4J5G A;  4OVM A;  1O7N B;  3PCR A;  2RCD A;  1PU4 A;  3B7C A;  1I3F A;  3LT9 A;  5DRV A;  3NQY A;  4OUQ A;  1VZZ A;  3HK4 A;  1BSA A;  2CFL A;  1FGT A;  1YGE A;  3NBB A;  4R80 A;  2OCT A;  3DGO A;  1G96 A; 
#chains in the Genus database with same CATH homology
 1G0T A;  4ILF A;  2IYJ A;  1T3B A;  1TJD A;  2H0H A;  2H0I A;  4I5Q A;  1V58 A;  2H0G A;  5G1K A;  4NPB A;  5G1L A;  2IY2 A;  1V57 A;  1JZD A;  1JZO A;  1EEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...