2IY4A

X-ray structure of dps from listeria monocytogenes
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
151
structure length
151
Chain Sequence
SVDTKEFLNHQVANLNVFTVKIHQIHWYMRGHNFFTLHEKMDDLYSEFGEQMDEVAERLLAIGGSPFSTLKEFLENASVEEAPYTKPKTMDQLMEDLVGTLELLRDEYQQGIELTDKEGDNVTNDMLIAFKASIDKHIWMFKAFLGKAPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Mutations Lys 114 --> Gln and Asp 126 --> Asn Disrupt an Intersubunit Salt Bridge and Convert Listeria Innocua Dps Into its Natural Mutant Listeria Monocytogenes Dps. Effects on Protein Stability at Low Ph.
pubmed doi rcsb
molecule keywords NON-HEME IRON-CONTAINING FERRITIN
molecule tags Metal binding protein
source organism Listeria monocytogenes
total genus 64
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, X, Y
ec nomenclature
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2iy4A00
5D8YA 2Z90A 2FHAA 2BKCA 2WTLA 4CYBA 1HRSA 1LKPA 3GVYA 1XZ3A 3KX9A 4XKSA 1OTKA 4CMYA 3PWFA 2YW7A 1GWGA 4ZL5A 4M35A 5I4JA 1SQ3A 2GYQA 1MOJA 1TKOA 4RC7A 2C41A 5E2DA 1NFVA 3MPSA 4CYAA 4LQJA 1JGCA 2FJCA 1JKVA 4DZ0A 4MUDA 4RC7B 4CVPA 3ISFA 2BW1A 2IY4A 5JKLG 4ERUA 3E1MA 4ZJKA 2Z5PA 4CMYV 4ZTTA 3E1NA 3F38A 3TA8A 1RCEA 3OJ5A 1S30A 1QYBA 3E6SA 2JD80 3AF7X 3FI6A 5CMQA 3R2RA 4AM2A 5J93A 4EVEA 2VZBA 2IU2A 4ISPA 2XJMA 5JACA 1IERA 5FFDA 1IESA 3F32A 3R2KA 5ERJA 2V2LA 3E1JA 4ML5A 1O9RA 2PYBA 3FSEA 3QB9A 1ZUJA 4ISMA 4LYXA 1S2ZA 4XGSA 3T9JA 4CVTA 2F7NA 3PVTA 5C6FA 4AM5A 5K52A 4M34A 4M33A 1QGHA 2CF7A 4PGIA 1XZ1A 2V2OA 3IQ1A 1AEWA 5JKLA 3PVTB 1O9IA 3R2OA 1RCCA 2YW6A 3PVRA 4DASA 4M32A 3WVWA 1VEIA 2Z5QA 3KA8A 3PW1A 3ERZA 4IXKA 1H96A 3A68A 4ZL6A 1L8IA 3PVRB 4Z5SA 1VJXA 3AJPA 5CZUA 3PW1B 5CMRA 4TOAA 4MKUA 4RC8A 3PZAA 2IB0A 2ITBA 5HJFA 1RCGA 2C6RA 1DVBA 2WLUA 2G4HA 4II4A 3R2SA 3Q4OA 2C2JA 2Z5RA 3U90A 2VXIA 5D8RA 4II4B 1Z4AA 2W0OA 2BK6A 4TODA 1LB3A 1VEQA 2FZFA 3O7RA 4PG0A 1MFRA 5GU2X 4EVBA 1TKPA 1JIGA 3UOFA 1TK6A 5D8SA 4E6KA 3AF9X 4CVRA 1RCIA 5D8QA 3IS7A 5D8XA 3RD0A 2CHPA 2V2JA 4ZLWA 3O7SA 3RBCA 3EZUA 4MN9A 2C2FA 1JTSA 4TOFA 1Z6OM 4RC6B 1JREA 3EGMA 2CLUA 1NF4A 5LG8A 2XKQA 3AJOA 3AK8A 1FHAA 3NOZX 3KXUA 3SH6A 5GU0X 3H7GA 3UOIA 2ZA6A 4EVDA 2ZG8X 3QVDA 5AXSA 3AF8X 5FEJA 3BVLA 3NP0X 4LQNA 3Q4RA 3WNWA 3WVVA 4DE6A 5LBHA 4DI0A 2V2MA 2CHIA 3R2MA 2CN6A 2UX1A 3A9QA 2QQYA 3E1PA 3HIUA 5JKMG 1R03A 2V2RA 2OC5A 2GS4A 3F37A 4TOHA 3EZ0A 5LS9A 1YV1A 4ZMCA 4ITTA 4Z3BA 5FFEA 1LKOA 5D8PA 5J8SA 2ZG7X 2Z6MA 4PG1A 2V2IA 3PWQC 5GU3X 3GE4A 4REUA 4LPMA 1ZS3A 2V15A 3PW8C 4TW3A 2YJKA 1Z6OA 2ZA8A 2JD70 4DYXA 4DYZA 2YJJA 3QD8A 5ERKA 4P18A 4QUWA 2HR5A 3BKNA 1SOFA 4LYUA 3RAVA 4LQVA 2ZG9X 5HJHA 4MY7A 1F33A 1BG7A 3R2LA 2OH3A 2FL0A 2BJYA 2XGWA 1F30A 4OYNA 4XKTA 1J30A 3F34A 1YUXA 2HTNA 3FVBA 5JKMA 4MJYA 3KA6A 3BVKA 1UMNA 3GHQA 2D5KA 2C2UA 3BVEA 3SHXA 4RC6A 3E1QA 2CEIA 1BCFA 3E6RA 3QHCA 5E1UA 4DYYA 3R2HA 5GOUA 2WLAA 3F33A 3Q4QA 2ZA7A 2FKZA 4KVSA 1L8HA 3F35A 2V2SA 4TOBA 1NNQA 4CY9A 1RCDA 1RYTA 2ZURX 2V2NA 5GN8A 5LG2A 3SE1A 5D8OA 1BFRA 1NF6A 4TOEA 4TOCA 1N1QA 4LQHA 1KRQA 2FG8A 1VLGA 3ES3A 4YKHA 1S3QA 4R42A 3QZ3A 3KA3A 4CVSA 4KVQA 1LKMA 5GN8B 2FG4A 2VXXA 3NP2X 4RC5A 2X170 1DATA 2JD60 4LPNA 4AM4A 1UVHA 5K53A 5IX6A 4U3GA 1VELA 3WVUA 3E1OA 2QF9A 2CLBA 5FFBA 2V2PA 1B71A 3BT5A 4RC5B 3UNOA 3F36A 3E1LA 1JKUA 2CN7A 5GU1X 2RBDA 4DYUA 5J9VA 4IWJA 2Y3QA 3KA4A 3ISEA 3AK9A 5HQOA 3F39A 4EVCA 3PVYA 3PWQA 5J8WA 5FFAA 1JI4A 3KA9A 4IWKA 4LPJA 4ETRA 3SIDA 3E2CA 3Q4NA 3PW8A 4TO9A 4ZKHA 1JI5A 1YUZA 3BVFA 3PVYB 3AJQA 4ITWA 2GYDA 3BVIA 4ZKWA 1DPSA 3RE7A 2CIHA 4XKUA 3OGHA 2XJNA 5FFCA 4TOGA 3KWOA 4KVRA 4PGKA 2XJOA 3RGDA 3IS8A 3VNXA 3HL1A 3QHBA 1TJOA 1EUMA 4ZKXA 1JYBA 4Y08A 2FFXJ 4A25A
chains in the Genus database with same CATH superfamily
5D8YA 2Z90A 2FHAA 5JDOB 2BKCA 2WTLA 4CYBA 1HRSA 1LKPA 3GVYA 1XZ3A 3KX9A 4XKSA 1OTKA 4CMYA 3PWFA 2YW7A 2MGYA 1GWGA 4ZL5A 4M35A 5I4JA 1SQ3A 2GYQA 1MOJA 1TKOA 4RC7A 3VV9A 2C41A 5E2DA 1NFVA 3MPSA 3JZ9A 2AR0A 4CYAA 4LQJA 4YXMA 1JGCA 2FJCA 1JKVA 4DZ0A 4MUDA 4RC7B 4CVPA 3ISFA 2BW1A 2IY4A 5JKLG 4ERUA 3E1MA 4ZJKA 2Z5PA 4CMYV 4ZTTA 3E1NA 3F38A 3TA8A 3V3KB 1RCEA 3OJ5A 1S30A 1QYBA 3E6SA 2JD80 3AF7X 3FI6A 5CMQA 3R2RA 4AM2A 5J93A 4EVEA 2VZBA 2IU2A 4ISPA 3D19A 2XJMA 5JACA 1IERA 5FFDA 1IESA 3F32A 3R2KA 5ERJA 2V2LA 3E1JA 4ML5A 1O9RA 2PYBA 3FSEA 3QB9A 1ZUJA 4ISMA 4WJG4 4LYXA 1S2ZA 4XGSA 3T9JA 4CVTA 2F7NA 3PVTA 5C6FA 4AM5A 5K52A 4M34A 4M33A 1QGHA 2CF7A 4PGIA 4YVZA 1XZ1A 2V2OA 3IQ1A 1AEWA 5JKLA 3PVTB 1O9IA 3R2OA 1RCCA 2YW6A 3PVRA 3KHKA 4DASA 4M32A 4W4KB 3WVWA 1VEIA 2Z5QA 3KA8A 3PW1A 3ERZA 3N6OA 4IXKA 2G38B 1H96A 3A68A 4ZL6A 1L8IA 3PVRB 4Z5SA 1VJXA 3AJPA 5JDOA 5CZUA 3PW1B 5CMRA 4TOAA 4MKUA 4RC8A 3PZAA 2IB0A 2ITBA 5HJFA 1RCGA 2C6RA 1DVBA 2WLUA 2G4HA 4II4A 3R2SA 3Q4OA 2C2JA 2Z5RA 3U90A 2VXIA 5D8RA 4YXJA 4II4B 1Z4AA 2W0OA 2BK6A 4TODA 1LB3A 1VEQA 2FZFA 3O7RA 3UFBA 4PG0A 1MFRA 5GU2X 4EVBA 1TKPA 1JIGA 3UOFA 1TK6A 5D8SA 4E6KA 3AF9X 4CVRA 1RCIA 5D8QA 3IS7A 5D8XA 3RD0A 2CHPA 2V2JA 3C23A 4ZLWA 3O7SA 3RBCA 3EZUA 4MN9A 2C2FA 2V8TA 1JTSA 4TOFA 1Z6OM 4KXRB 4RC6B 1JREA 5HU6D 3KDQA 3EGMA 2CLUA 4MXPA 3FRSA 1NF4A 5LG8A 2XKQA 3AJOA 3AK8A 1FHAA 3M6JA 3NOZX 3KXUA 3SH6A 5GU0X 3H7GA 3UOIA 2ZA6A 4EVDA 2ZG8X 3QVDA 5AXSA 3AF8X 5FEJA 3BVLA 3NP0X 4LQNA 3Q4RA 3WNWA 3WVVA 3C1YA 4DE6A 5LBHA 4DI0A 2V2MA 2CHIA 3R2MA 2CN6A 2UX1A 3A9QA 2QQYA 3E1PA 3LKDA 3HIUA 5JKMG 1R03A 2V2RA 2OC5A 2GS4A 3F37A 4TOHA 3EZ0A 5LS9A 1YV1A 4ZMCA 4ITTA 4Z3BA 5FFEA 1LKOA 3W54A 5D8PA 5J8SA 2ZG7X 2Z6MA 4PG1A 2V2IA 3PWQC 5GU3X 3GE4A 4REUA 4LPMA 1ZS3A 2V15A 3PW8C 4TW3A 3C1ZA 2YJKA 1Z6OA 2ZA8A 2JD70 2OKCA 3GGZA 3L0MA 4DYXA 4DYZA 2YJJA 3QD8A 4X0JA 5ERKA 4P18A 4QUWA 2HR5A 3BKNA 1SOFA 4LYUA 3RAVA 4LQVA 2ZG9X 5HJHA 2WWXB 4MY7A 1F33A 1BG7A 3R2LA 2OH3A 2FL0A 2V8UA 2BJYA 2XGWA 1F30A 4OYNA 4XKTA 1J30A 3F34A 1YUXA 2HTNA 3FVBA 5JKMA 4MJYA 3KA6A 3BVKA 1UMNA 2CWLA 3C21A 3GHQA 2D5KA 2C2UA 3BVEA 3SHXA 4RC6A 3E1QA 2CEIA 1BCFA 4W4LB 3E6RA 3QHCA 5E1UA 4DYYA 3R2HA 5GOUA 2WLAA 3F33A 3Q4QA 2ZA7A 2FKZA 4KVSA 1L8HA 3JZAB 3F35A 2V2SA 4TOBA 1NNQA 4CY9A 1RCDA 1RYTA 2ZURX 2V2NA 5GN8A 5LG2A 3SE1A 5D8OA 1BFRA 1NF6A 4TOEA 4TOCA 1N1QA 4LQHA 1KRQA 2FG8A 1VLGA 3ES3A 4YKHA 1S3QA 4R42A 3QZ3A 3KA3A 4CVSA 4KVQA 1LKMA 5GN8B 2FG4A 2VXXA 3NP2X 4RC5A 2X170 1DATA 2JD60 4LPNA 4AM4A 1UVHA 5K53A 5IX6A 4U3GA 1VELA 3WVUA 3E1OA 2QF9A 2CLBA 5FFBA 2V2PA 1B71A 3BT5A 4RC5B 3UNOA 3F36A 3E1LA 4E40A 1JKUA 2CN7A 5GU1X 2RBDA 4DYUA 5J9VA 4IWJA 2Y3QA 3KA4A 3ISEA 3AK9A 5HQOA 3F39A 4EVCA 3PVYA 3PWQA 5J8WA 5FFAA 1JI4A 3KA9A 4IWKA 4LPJA 4ETRA 3DBYA 2Y44A 3SIDA 3VVAA 3E2CA 3FRRA 3Q4NA 3PW8A 4TO9A 4ZKHA 1JI5A 1YUZA 3BVFA 2N02A 3PVYB 3AJQA 4ITWA 2GYDA 3BVIA 4ZKWA 1DPSA 3RE7A 2CIHA 4XKUA 3OGHA 2XJNA 5FFCA 4TOGA 3KWOA 4KVRA 3GGYA 4PGKA 2XJOA 3RGDA 3IS8A 3VNXA 3HL1A 3QHBA 1TJOA 1EUMA 4ZKXA 1JYBA 4Y08A 2FFXJ 4A25A
chains in the Genus database with same CATH topology
5D8YA 2Z90A 2FHAA 5JDOB 2BKCA 2WTLA 4CYBA 1HRSA 1LKPA 3GVYA 1XZ3A 3KX9A 4XKSA 1OTKA 4CMYA 3PWFA 2YW7A 2MGYA 1GWGA 4ZL5A 4M35A 5I4JA 1SQ3A 2GYQA 1MOJA 1TKOA 4RC7A 3VV9A 2C41A 5E2DA 1NFVA 3MPSA 3JZ9A 2AR0A 4CYAA 4LQJA 4YXMA 1JGCA 2FJCA 1JKVA 4DZ0A 4MUDA 4RC7B 4CVPA 3ISFA 2BW1A 2IY4A 5JKLG 4ERUA 3E1MA 4ZJKA 2Z5PA 4CMYV 4ZTTA 3E1NA 3F38A 3TA8A 3V3KB 1RCEA 3OJ5A 1S30A 1QYBA 3E6SA 2JD80 3AF7X 3FI6A 5CMQA 3R2RA 4AM2A 5J93A 4EVEA 2VZBA 2IU2A 4ISPA 3D19A 2XJMA 5JACA 1IERA 5FFDA 1IESA 3F32A 3R2KA 5ERJA 2V2LA 3E1JA 4ML5A 1O9RA 2PYBA 3FSEA 3QB9A 1ZUJA 4ISMA 4WJG4 4LYXA 1S2ZA 4XGSA 3T9JA 4CVTA 2F7NA 3PVTA 5C6FA 4AM5A 5K52A 4M34A 4M33A 1QGHA 2CF7A 4PGIA 4YVZA 1XZ1A 2V2OA 3IQ1A 1AEWA 5JKLA 3PVTB 1O9IA 3R2OA 1RCCA 2YW6A 3PVRA 3KHKA 4DASA 4M32A 4W4KB 3WVWA 1VEIA 2Z5QA 3KA8A 3PW1A 3ERZA 3N6OA 4IXKA 2G38B 1H96A 3A68A 4ZL6A 1L8IA 3PVRB 4Z5SA 1VJXA 3AJPA 5JDOA 5CZUA 3PW1B 5CMRA 4TOAA 4MKUA 4RC8A 3PZAA 2IB0A 2ITBA 5HJFA 1RCGA 2C6RA 1DVBA 2WLUA 2G4HA 4II4A 3R2SA 3Q4OA 2C2JA 2Z5RA 3U90A 2VXIA 5D8RA 4YXJA 4II4B 1Z4AA 2W0OA 2BK6A 4TODA 1LB3A 1VEQA 2FZFA 3O7RA 3UFBA 4PG0A 1MFRA 5GU2X 4EVBA 1TKPA 1JIGA 3UOFA 1TK6A 5D8SA 4E6KA 3AF9X 4CVRA 1RCIA 5D8QA 3IS7A 5D8XA 3RD0A 2CHPA 2V2JA 3C23A 4ZLWA 3O7SA 3RBCA 3EZUA 4MN9A 2C2FA 2V8TA 1JTSA 4TOFA 1Z6OM 4KXRB 4RC6B 1JREA 5HU6D 3KDQA 3EGMA 2CLUA 4MXPA 3FRSA 1NF4A 5LG8A 2XKQA 3AJOA 3AK8A 1FHAA 3M6JA 3NOZX 3KXUA 3SH6A 5GU0X 3H7GA 3UOIA 2ZA6A 4EVDA 2ZG8X 3QVDA 5AXSA 3AF8X 5FEJA 3BVLA 3NP0X 4LQNA 3Q4RA 3WNWA 3WVVA 3C1YA 4DE6A 5LBHA 4DI0A 2V2MA 2CHIA 3R2MA 2CN6A 2UX1A 3A9QA 2QQYA 3E1PA 3LKDA 3HIUA 5JKMG 1R03A 2V2RA 2OC5A 2GS4A 3F37A 4TOHA 3EZ0A 5LS9A 1YV1A 4ZMCA 4ITTA 4Z3BA 5FFEA 1LKOA 3W54A 5D8PA 5J8SA 2ZG7X 2Z6MA 4PG1A 2V2IA 3PWQC 5GU3X 3GE4A 4REUA 4LPMA 1ZS3A 2V15A 3PW8C 4TW3A 3C1ZA 2YJKA 1Z6OA 2ZA8A 2JD70 2OKCA 3GGZA 3L0MA 4DYXA 4DYZA 2YJJA 3QD8A 4X0JA 5ERKA 4P18A 4QUWA 2HR5A 3BKNA 1SOFA 4LYUA 3RAVA 4LQVA 2ZG9X 5HJHA 2WWXB 4MY7A 1F33A 1BG7A 3R2LA 2OH3A 2FL0A 2V8UA 2BJYA 2XGWA 1F30A 4OYNA 4XKTA 1J30A 3F34A 1YUXA 2HTNA 3FVBA 5JKMA 4MJYA 3KA6A 3BVKA 1UMNA 2CWLA 3C21A 3GHQA 2D5KA 2C2UA 3BVEA 3SHXA 4RC6A 3E1QA 2CEIA 1BCFA 4W4LB 3E6RA 3QHCA 5E1UA 4DYYA 3R2HA 5GOUA 2WLAA 3F33A 3Q4QA 2ZA7A 2FKZA 4KVSA 1L8HA 3JZAB 3F35A 2V2SA 4TOBA 1NNQA 4CY9A 1RCDA 1RYTA 2ZURX 2V2NA 5GN8A 5LG2A 3SE1A 5D8OA 1BFRA 1NF6A 4TOEA 4TOCA 1N1QA 4LQHA 1KRQA 2FG8A 1VLGA 3ES3A 4YKHA 1S3QA 4R42A 3QZ3A 3KA3A 4CVSA 4KVQA 1LKMA 5GN8B 2FG4A 2VXXA 3NP2X 4RC5A 2X170 1DATA 2JD60 4LPNA 4AM4A 1UVHA 5K53A 5IX6A 4U3GA 1VELA 3WVUA 3E1OA 2QF9A 2CLBA 5FFBA 2V2PA 1B71A 3BT5A 4RC5B 3UNOA 3F36A 3E1LA 4E40A 1JKUA 2CN7A 5GU1X 2RBDA 4DYUA 5J9VA 4IWJA 2Y3QA 3KA4A 3ISEA 3AK9A 5HQOA 3F39A 4EVCA 3PVYA 3PWQA 5J8WA 5FFAA 1JI4A 3KA9A 4IWKA 4LPJA 4ETRA 3DBYA 2Y44A 3SIDA 3VVAA 3E2CA 3FRRA 3Q4NA 3PW8A 4TO9A 4ZKHA 1JI5A 1YUZA 3BVFA 2N02A 3PVYB 3AJQA 4ITWA 2GYDA 3BVIA 4ZKWA 1DPSA 3RE7A 2CIHA 4XKUA 3OGHA 2XJNA 5FFCA 4TOGA 3KWOA 4KVRA 3GGYA 4PGKA 2XJOA 3RGDA 3IS8A 3VNXA 3HL1A 3QHBA 1TJOA 1EUMA 4ZKXA 1JYBA 4Y08A 2FFXJ 4A25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D8Y A;  2Z90 A;  2FHA A;  2BKC A;  2WTL A;  4CYB A;  1HRS A;  1LKP A;  3GVY A;  1XZ3 A;  3KX9 A;  4XKS A;  1OTK A;  4CMY A;  3PWF A;  2YW7 A;  1GWG A;  4ZL5 A;  4M35 A;  5I4J A;  1SQ3 A;  2GYQ A;  1MOJ A;  1TKO A;  4RC7 A;  2C41 A;  5E2D A;  1NFV A;  3MPS A;  4CYA A;  4LQJ A;  1JGC A;  2FJC A;  1JKV A;  4DZ0 A;  4MUD A;  4RC7 B;  4CVP A;  3ISF A;  2BW1 A;  2IY4 A;  5JKL G;  4ERU A;  3E1M A;  4ZJK A;  2Z5P A;  4CMY V;  4ZTT A;  3E1N A;  3F38 A;  3TA8 A;  1RCE A;  3OJ5 A;  1S30 A;  1QYB A;  3E6S A;  2JD8 0;  3AF7 X;  3FI6 A;  5CMQ A;  3R2R A;  4AM2 A;  5J93 A;  4EVE A;  2VZB A;  2IU2 A;  4ISP A;  2XJM A;  5JAC A;  1IER A;  5FFD A;  1IES A;  3F32 A;  3R2K A;  5ERJ A;  2V2L A;  3E1J A;  4ML5 A;  1O9R A;  2PYB A;  3FSE A;  3QB9 A;  1ZUJ A;  4ISM A;  4LYX A;  1S2Z A;  4XGS A;  3T9J A;  4CVT A;  2F7N A;  3PVT A;  5C6F A;  4AM5 A;  5K52 A;  4M34 A;  4M33 A;  1QGH A;  2CF7 A;  4PGI A;  1XZ1 A;  2V2O A;  3IQ1 A;  1AEW A;  5JKL A;  3PVT B;  1O9I A;  3R2O A;  1RCC A;  2YW6 A;  3PVR A;  4DAS A;  4M32 A;  3WVW A;  1VEI A;  2Z5Q A;  3KA8 A;  3PW1 A;  3ERZ A;  4IXK A;  1H96 A;  3A68 A;  4ZL6 A;  1L8I A;  3PVR B;  4Z5S A;  1VJX A;  3AJP A;  5CZU A;  3PW1 B;  5CMR A;  4TOA A;  4MKU A;  4RC8 A;  3PZA A;  2IB0 A;  2ITB A;  5HJF A;  1RCG A;  2C6R A;  1DVB A;  2WLU A;  2G4H A;  4II4 A;  3R2S A;  3Q4O A;  2C2J A;  2Z5R A;  3U90 A;  2VXI A;  5D8R A;  4II4 B;  1Z4A A;  2W0O A;  2BK6 A;  4TOD A;  1LB3 A;  1VEQ A;  2FZF A;  3O7R A;  4PG0 A;  1MFR A;  5GU2 X;  4EVB A;  1TKP A;  1JIG A;  3UOF A;  1TK6 A;  5D8S A;  4E6K A;  3AF9 X;  4CVR A;  1RCI A;  5D8Q A;  3IS7 A;  5D8X A;  3RD0 A;  2CHP A;  2V2J A;  4ZLW A;  3O7S A;  3RBC A;  3EZU A;  4MN9 A;  2C2F A;  1JTS A;  4TOF A;  1Z6O M;  4RC6 B;  1JRE A;  3EGM A;  2CLU A;  1NF4 A;  5LG8 A;  2XKQ A;  3AJO A;  3AK8 A;  1FHA A;  3NOZ X;  3KXU A;  3SH6 A;  5GU0 X;  3H7G A;  3UOI A;  2ZA6 A;  4EVD A;  2ZG8 X;  3QVD A;  5AXS A;  3AF8 X;  5FEJ A;  3BVL A;  3NP0 X;  4LQN A;  3Q4R A;  3WNW A;  3WVV A;  4DE6 A;  5LBH A;  4DI0 A;  2V2M A;  2CHI A;  3R2M A;  2CN6 A;  2UX1 A;  3A9Q A;  2QQY A;  3E1P A;  3HIU A;  5JKM G;  1R03 A;  2V2R A;  2OC5 A;  2GS4 A;  3F37 A;  4TOH A;  3EZ0 A;  5LS9 A;  1YV1 A;  4ZMC A;  4ITT A;  4Z3B A;  5FFE A;  1LKO A;  5D8P A;  5J8S A;  2ZG7 X;  2Z6M A;  4PG1 A;  2V2I A;  3PWQ C;  5GU3 X;  3GE4 A;  4REU A;  4LPM A;  1ZS3 A;  2V15 A;  3PW8 C;  4TW3 A;  2YJK A;  1Z6O A;  2ZA8 A;  2JD7 0;  4DYX A;  4DYZ A;  2YJJ A;  3QD8 A;  5ERK A;  4P18 A;  4QUW A;  2HR5 A;  3BKN A;  1SOF A;  4LYU A;  3RAV A;  4LQV A;  2ZG9 X;  5HJH A;  4MY7 A;  1F33 A;  1BG7 A;  3R2L A;  2OH3 A;  2FL0 A;  2BJY A;  2XGW A;  1F30 A;  4OYN A;  4XKT A;  1J30 A;  3F34 A;  1YUX A;  2HTN A;  3FVB A;  5JKM A;  4MJY A;  3KA6 A;  3BVK A;  1UMN A;  3GHQ A;  2D5K A;  2C2U A;  3BVE A;  3SHX A;  4RC6 A;  3E1Q A;  2CEI A;  1BCF A;  3E6R A;  3QHC A;  5E1U A;  4DYY A;  3R2H A;  5GOU A;  2WLA A;  3F33 A;  3Q4Q A;  2ZA7 A;  2FKZ A;  4KVS A;  1L8H A;  3F35 A;  2V2S A;  4TOB A;  1NNQ A;  4CY9 A;  1RCD A;  1RYT A;  2ZUR X;  2V2N A;  5GN8 A;  5LG2 A;  3SE1 A;  5D8O A;  1BFR A;  1NF6 A;  4TOE A;  4TOC A;  1N1Q A;  4LQH A;  1KRQ A;  2FG8 A;  1VLG A;  3ES3 A;  4YKH A;  1S3Q A;  4R42 A;  3QZ3 A;  3KA3 A;  4CVS A;  4KVQ A;  1LKM A;  5GN8 B;  2FG4 A;  2VXX A;  3NP2 X;  4RC5 A;  2X17 0;  1DAT A;  2JD6 0;  4LPN A;  4AM4 A;  1UVH A;  5K53 A;  5IX6 A;  4U3G A;  1VEL A;  3WVU A;  3E1O A;  2QF9 A;  2CLB A;  5FFB A;  2V2P A;  1B71 A;  3BT5 A;  4RC5 B;  3UNO A;  3F36 A;  3E1L A;  1JKU A;  2CN7 A;  5GU1 X;  2RBD A;  4DYU A;  5J9V A;  4IWJ A;  2Y3Q A;  3KA4 A;  3ISE A;  3AK9 A;  5HQO A;  3F39 A;  4EVC A;  3PVY A;  3PWQ A;  5J8W A;  5FFA A;  1JI4 A;  3KA9 A;  4IWK A;  4LPJ A;  4ETR A;  3SID A;  3E2C A;  3Q4N A;  3PW8 A;  4TO9 A;  4ZKH A;  1JI5 A;  1YUZ A;  3BVF A;  3PVY B;  3AJQ A;  4ITW A;  2GYD A;  3BVI A;  4ZKW A;  1DPS A;  3RE7 A;  2CIH A;  4XKU A;  3OGH A;  2XJN A;  5FFC A;  4TOG A;  3KWO A;  4KVR A;  4PGK A;  2XJO A;  3RGD A;  3IS8 A;  3VNX A;  3HL1 A;  3QHB A;  1TJO A;  1EUM A;  4ZKX A;  1JYB A;  4Y08 A;  2FFX J;  4A25 A; 
#chains in the Genus database with same CATH topology
 5D8Y A;  2Z90 A;  2FHA A;  5JDO B;  2BKC A;  2WTL A;  4CYB A;  1HRS A;  1LKP A;  3GVY A;  1XZ3 A;  3KX9 A;  4XKS A;  1OTK A;  4CMY A;  3PWF A;  2YW7 A;  2MGY A;  1GWG A;  4ZL5 A;  4M35 A;  5I4J A;  1SQ3 A;  2GYQ A;  1MOJ A;  1TKO A;  4RC7 A;  3VV9 A;  2C41 A;  5E2D A;  1NFV A;  3MPS A;  3JZ9 A;  2AR0 A;  4CYA A;  4LQJ A;  4YXM A;  1JGC A;  2FJC A;  1JKV A;  4DZ0 A;  4MUD A;  4RC7 B;  4CVP A;  3ISF A;  2BW1 A;  2IY4 A;  5JKL G;  4ERU A;  3E1M A;  4ZJK A;  2Z5P A;  4CMY V;  4ZTT A;  3E1N A;  3F38 A;  3TA8 A;  3V3K B;  1RCE A;  3OJ5 A;  1S30 A;  1QYB A;  3E6S A;  2JD8 0;  3AF7 X;  3FI6 A;  5CMQ A;  3R2R A;  4AM2 A;  5J93 A;  4EVE A;  2VZB A;  2IU2 A;  4ISP A;  3D19 A;  2XJM A;  5JAC A;  1IER A;  5FFD A;  1IES A;  3F32 A;  3R2K A;  5ERJ A;  2V2L A;  3E1J A;  4ML5 A;  1O9R A;  2PYB A;  3FSE A;  3QB9 A;  1ZUJ A;  4ISM A;  4WJG 4;  4LYX A;  1S2Z A;  4XGS A;  3T9J A;  4CVT A;  2F7N A;  3PVT A;  5C6F A;  4AM5 A;  5K52 A;  4M34 A;  4M33 A;  1QGH A;  2CF7 A;  4PGI A;  4YVZ A;  1XZ1 A;  2V2O A;  3IQ1 A;  1AEW A;  5JKL A;  3PVT B;  1O9I A;  3R2O A;  1RCC A;  2YW6 A;  3PVR A;  3KHK A;  4DAS A;  4M32 A;  4W4K B;  3WVW A;  1VEI A;  2Z5Q A;  3KA8 A;  3PW1 A;  3ERZ A;  3N6O A;  4IXK A;  2G38 B;  1H96 A;  3A68 A;  4ZL6 A;  1L8I A;  3PVR B;  4Z5S A;  1VJX A;  3AJP A;  5JDO A;  5CZU A;  3PW1 B;  5CMR A;  4TOA A;  4MKU A;  4RC8 A;  3PZA A;  2IB0 A;  2ITB A;  5HJF A;  1RCG A;  2C6R A;  1DVB A;  2WLU A;  2G4H A;  4II4 A;  3R2S A;  3Q4O A;  2C2J A;  2Z5R A;  3U90 A;  2VXI A;  5D8R A;  4YXJ A;  4II4 B;  1Z4A A;  2W0O A;  2BK6 A;  4TOD A;  1LB3 A;  1VEQ A;  2FZF A;  3O7R A;  3UFB A;  4PG0 A;  1MFR A;  5GU2 X;  4EVB A;  1TKP A;  1JIG A;  3UOF A;  1TK6 A;  5D8S A;  4E6K A;  3AF9 X;  4CVR A;  1RCI A;  5D8Q A;  3IS7 A;  5D8X A;  3RD0 A;  2CHP A;  2V2J A;  3C23 A;  4ZLW A;  3O7S A;  3RBC A;  3EZU A;  4MN9 A;  2C2F A;  2V8T A;  1JTS A;  4TOF A;  1Z6O M;  4KXR B;  4RC6 B;  1JRE A;  5HU6 D;  3KDQ A;  3EGM A;  2CLU A;  4MXP A;  3FRS A;  1NF4 A;  5LG8 A;  2XKQ A;  3AJO A;  3AK8 A;  1FHA A;  3M6J A;  3NOZ X;  3KXU A;  3SH6 A;  5GU0 X;  3H7G A;  3UOI A;  2ZA6 A;  4EVD A;  2ZG8 X;  3QVD A;  5AXS A;  3AF8 X;  5FEJ A;  3BVL A;  3NP0 X;  4LQN A;  3Q4R A;  3WNW A;  3WVV A;  3C1Y A;  4DE6 A;  5LBH A;  4DI0 A;  2V2M A;  2CHI A;  3R2M A;  2CN6 A;  2UX1 A;  3A9Q A;  2QQY A;  3E1P A;  3LKD A;  3HIU A;  5JKM G;  1R03 A;  2V2R A;  2OC5 A;  2GS4 A;  3F37 A;  4TOH A;  3EZ0 A;  5LS9 A;  1YV1 A;  4ZMC A;  4ITT A;  4Z3B A;  5FFE A;  1LKO A;  3W54 A;  5D8P A;  5J8S A;  2ZG7 X;  2Z6M A;  4PG1 A;  2V2I A;  3PWQ C;  5GU3 X;  3GE4 A;  4REU A;  4LPM A;  1ZS3 A;  2V15 A;  3PW8 C;  4TW3 A;  3C1Z A;  2YJK A;  1Z6O A;  2ZA8 A;  2JD7 0;  2OKC A;  3GGZ A;  3L0M A;  4DYX A;  4DYZ A;  2YJJ A;  3QD8 A;  4X0J A;  5ERK A;  4P18 A;  4QUW A;  2HR5 A;  3BKN A;  1SOF A;  4LYU A;  3RAV A;  4LQV A;  2ZG9 X;  5HJH A;  2WWX B;  4MY7 A;  1F33 A;  1BG7 A;  3R2L A;  2OH3 A;  2FL0 A;  2V8U A;  2BJY A;  2XGW A;  1F30 A;  4OYN A;  4XKT A;  1J30 A;  3F34 A;  1YUX A;  2HTN A;  3FVB A;  5JKM A;  4MJY A;  3KA6 A;  3BVK A;  1UMN A;  2CWL A;  3C21 A;  3GHQ A;  2D5K A;  2C2U A;  3BVE A;  3SHX A;  4RC6 A;  3E1Q A;  2CEI A;  1BCF A;  4W4L B;  3E6R A;  3QHC A;  5E1U A;  4DYY A;  3R2H A;  5GOU A;  2WLA A;  3F33 A;  3Q4Q A;  2ZA7 A;  2FKZ A;  4KVS A;  1L8H A;  3JZA B;  3F35 A;  2V2S A;  4TOB A;  1NNQ A;  4CY9 A;  1RCD A;  1RYT A;  2ZUR X;  2V2N A;  5GN8 A;  5LG2 A;  3SE1 A;  5D8O A;  1BFR A;  1NF6 A;  4TOE A;  4TOC A;  1N1Q A;  4LQH A;  1KRQ A;  2FG8 A;  1VLG A;  3ES3 A;  4YKH A;  1S3Q A;  4R42 A;  3QZ3 A;  3KA3 A;  4CVS A;  4KVQ A;  1LKM A;  5GN8 B;  2FG4 A;  2VXX A;  3NP2 X;  4RC5 A;  2X17 0;  1DAT A;  2JD6 0;  4LPN A;  4AM4 A;  1UVH A;  5K53 A;  5IX6 A;  4U3G A;  1VEL A;  3WVU A;  3E1O A;  2QF9 A;  2CLB A;  5FFB A;  2V2P A;  1B71 A;  3BT5 A;  4RC5 B;  3UNO A;  3F36 A;  3E1L A;  4E40 A;  1JKU A;  2CN7 A;  5GU1 X;  2RBD A;  4DYU A;  5J9V A;  4IWJ A;  2Y3Q A;  3KA4 A;  3ISE A;  3AK9 A;  5HQO A;  3F39 A;  4EVC A;  3PVY A;  3PWQ A;  5J8W A;  5FFA A;  1JI4 A;  3KA9 A;  4IWK A;  4LPJ A;  4ETR A;  3DBY A;  2Y44 A;  3SID A;  3VVA A;  3E2C A;  3FRR A;  3Q4N A;  3PW8 A;  4TO9 A;  4ZKH A;  1JI5 A;  1YUZ A;  3BVF A;  2N02 A;  3PVY B;  3AJQ A;  4ITW A;  2GYD A;  3BVI A;  4ZKW A;  1DPS A;  3RE7 A;  2CIH A;  4XKU A;  3OGH A;  2XJN A;  5FFC A;  4TOG A;  3KWO A;  4KVR A;  3GGY A;  4PGK A;  2XJO A;  3RGD A;  3IS8 A;  3VNX A;  3HL1 A;  3QHB A;  1TJO A;  1EUM A;  4ZKX A;  1JYB A;  4Y08 A;  2FFX J;  4A25 A; 
#chains in the Genus database with same CATH homology
 5D8Y A;  2Z90 A;  2FHA A;  5JDO B;  2BKC A;  2WTL A;  4CYB A;  1HRS A;  1LKP A;  3GVY A;  1XZ3 A;  3KX9 A;  4XKS A;  1OTK A;  4CMY A;  3PWF A;  2YW7 A;  2MGY A;  1GWG A;  4ZL5 A;  4M35 A;  5I4J A;  1SQ3 A;  2GYQ A;  1MOJ A;  1TKO A;  4RC7 A;  3VV9 A;  2C41 A;  5E2D A;  1NFV A;  3MPS A;  3JZ9 A;  2AR0 A;  4CYA A;  4LQJ A;  4YXM A;  1JGC A;  2FJC A;  1JKV A;  4DZ0 A;  4MUD A;  4RC7 B;  4CVP A;  3ISF A;  2BW1 A;  2IY4 A;  5JKL G;  4ERU A;  3E1M A;  4ZJK A;  2Z5P A;  4CMY V;  4ZTT A;  3E1N A;  3F38 A;  3TA8 A;  3V3K B;  1RCE A;  3OJ5 A;  1S30 A;  1QYB A;  3E6S A;  2JD8 0;  3AF7 X;  3FI6 A;  5CMQ A;  3R2R A;  4AM2 A;  5J93 A;  4EVE A;  2VZB A;  2IU2 A;  4ISP A;  3D19 A;  2XJM A;  5JAC A;  1IER A;  5FFD A;  1IES A;  3F32 A;  3R2K A;  5ERJ A;  2V2L A;  3E1J A;  4ML5 A;  1O9R A;  2PYB A;  3FSE A;  3QB9 A;  1ZUJ A;  4ISM A;  4WJG 4;  4LYX A;  1S2Z A;  4XGS A;  3T9J A;  4CVT A;  2F7N A;  3PVT A;  5C6F A;  4AM5 A;  5K52 A;  4M34 A;  4M33 A;  1QGH A;  2CF7 A;  4PGI A;  4YVZ A;  1XZ1 A;  2V2O A;  3IQ1 A;  1AEW A;  5JKL A;  3PVT B;  1O9I A;  3R2O A;  1RCC A;  2YW6 A;  3PVR A;  3KHK A;  4DAS A;  4M32 A;  4W4K B;  3WVW A;  1VEI A;  2Z5Q A;  3KA8 A;  3PW1 A;  3ERZ A;  3N6O A;  4IXK A;  2G38 B;  1H96 A;  3A68 A;  4ZL6 A;  1L8I A;  3PVR B;  4Z5S A;  1VJX A;  3AJP A;  5JDO A;  5CZU A;  3PW1 B;  5CMR A;  4TOA A;  4MKU A;  4RC8 A;  3PZA A;  2IB0 A;  2ITB A;  5HJF A;  1RCG A;  2C6R A;  1DVB A;  2WLU A;  2G4H A;  4II4 A;  3R2S A;  3Q4O A;  2C2J A;  2Z5R A;  3U90 A;  2VXI A;  5D8R A;  4YXJ A;  4II4 B;  1Z4A A;  2W0O A;  2BK6 A;  4TOD A;  1LB3 A;  1VEQ A;  2FZF A;  3O7R A;  3UFB A;  4PG0 A;  1MFR A;  5GU2 X;  4EVB A;  1TKP A;  1JIG A;  3UOF A;  1TK6 A;  5D8S A;  4E6K A;  3AF9 X;  4CVR A;  1RCI A;  5D8Q A;  3IS7 A;  5D8X A;  3RD0 A;  2CHP A;  2V2J A;  3C23 A;  4ZLW A;  3O7S A;  3RBC A;  3EZU A;  4MN9 A;  2C2F A;  2V8T A;  1JTS A;  4TOF A;  1Z6O M;  4KXR B;  4RC6 B;  1JRE A;  5HU6 D;  3KDQ A;  3EGM A;  2CLU A;  4MXP A;  3FRS A;  1NF4 A;  5LG8 A;  2XKQ A;  3AJO A;  3AK8 A;  1FHA A;  3M6J A;  3NOZ X;  3KXU A;  3SH6 A;  5GU0 X;  3H7G A;  3UOI A;  2ZA6 A;  4EVD A;  2ZG8 X;  3QVD A;  5AXS A;  3AF8 X;  5FEJ A;  3BVL A;  3NP0 X;  4LQN A;  3Q4R A;  3WNW A;  3WVV A;  3C1Y A;  4DE6 A;  5LBH A;  4DI0 A;  2V2M A;  2CHI A;  3R2M A;  2CN6 A;  2UX1 A;  3A9Q A;  2QQY A;  3E1P A;  3LKD A;  3HIU A;  5JKM G;  1R03 A;  2V2R A;  2OC5 A;  2GS4 A;  3F37 A;  4TOH A;  3EZ0 A;  5LS9 A;  1YV1 A;  4ZMC A;  4ITT A;  4Z3B A;  5FFE A;  1LKO A;  3W54 A;  5D8P A;  5J8S A;  2ZG7 X;  2Z6M A;  4PG1 A;  2V2I A;  3PWQ C;  5GU3 X;  3GE4 A;  4REU A;  4LPM A;  1ZS3 A;  2V15 A;  3PW8 C;  4TW3 A;  3C1Z A;  2YJK A;  1Z6O A;  2ZA8 A;  2JD7 0;  2OKC A;  3GGZ A;  3L0M A;  4DYX A;  4DYZ A;  2YJJ A;  3QD8 A;  4X0J A;  5ERK A;  4P18 A;  4QUW A;  2HR5 A;  3BKN A;  1SOF A;  4LYU A;  3RAV A;  4LQV A;  2ZG9 X;  5HJH A;  2WWX B;  4MY7 A;  1F33 A;  1BG7 A;  3R2L A;  2OH3 A;  2FL0 A;  2V8U A;  2BJY A;  2XGW A;  1F30 A;  4OYN A;  4XKT A;  1J30 A;  3F34 A;  1YUX A;  2HTN A;  3FVB A;  5JKM A;  4MJY A;  3KA6 A;  3BVK A;  1UMN A;  2CWL A;  3C21 A;  3GHQ A;  2D5K A;  2C2U A;  3BVE A;  3SHX A;  4RC6 A;  3E1Q A;  2CEI A;  1BCF A;  4W4L B;  3E6R A;  3QHC A;  5E1U A;  4DYY A;  3R2H A;  5GOU A;  2WLA A;  3F33 A;  3Q4Q A;  2ZA7 A;  2FKZ A;  4KVS A;  1L8H A;  3JZA B;  3F35 A;  2V2S A;  4TOB A;  1NNQ A;  4CY9 A;  1RCD A;  1RYT A;  2ZUR X;  2V2N A;  5GN8 A;  5LG2 A;  3SE1 A;  5D8O A;  1BFR A;  1NF6 A;  4TOE A;  4TOC A;  1N1Q A;  4LQH A;  1KRQ A;  2FG8 A;  1VLG A;  3ES3 A;  4YKH A;  1S3Q A;  4R42 A;  3QZ3 A;  3KA3 A;  4CVS A;  4KVQ A;  1LKM A;  5GN8 B;  2FG4 A;  2VXX A;  3NP2 X;  4RC5 A;  2X17 0;  1DAT A;  2JD6 0;  4LPN A;  4AM4 A;  1UVH A;  5K53 A;  5IX6 A;  4U3G A;  1VEL A;  3WVU A;  3E1O A;  2QF9 A;  2CLB A;  5FFB A;  2V2P A;  1B71 A;  3BT5 A;  4RC5 B;  3UNO A;  3F36 A;  3E1L A;  4E40 A;  1JKU A;  2CN7 A;  5GU1 X;  2RBD A;  4DYU A;  5J9V A;  4IWJ A;  2Y3Q A;  3KA4 A;  3ISE A;  3AK9 A;  5HQO A;  3F39 A;  4EVC A;  3PVY A;  3PWQ A;  5J8W A;  5FFA A;  1JI4 A;  3KA9 A;  4IWK A;  4LPJ A;  4ETR A;  3DBY A;  2Y44 A;  3SID A;  3VVA A;  3E2C A;  3FRR A;  3Q4N A;  3PW8 A;  4TO9 A;  4ZKH A;  1JI5 A;  1YUZ A;  3BVF A;  2N02 A;  3PVY B;  3AJQ A;  4ITW A;  2GYD A;  3BVI A;  4ZKW A;  1DPS A;  3RE7 A;  2CIH A;  4XKU A;  3OGH A;  2XJN A;  5FFC A;  4TOG A;  3KWO A;  4KVR A;  3GGY A;  4PGK A;  2XJO A;  3RGD A;  3IS8 A;  3VNX A;  3HL1 A;  3QHB A;  1TJO A;  1EUM A;  4ZKX A;  1JYB A;  4Y08 A;  2FFX J;  4A25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...