2IY7A

Crystal structure of the sialyltransferase pm0188 with cmp-3fneuac
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
389
structure length
377
Chain Sequence
SKTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKDNRPTEALFTILDQYPGNIELNIHLNIAHSVQLIRPILAYRFKHLDRVSIQQLNLYDDGSMEYVDLEKEENKDISAEIKQAEKQLSHYLLTGKIKFDNPTIARYVWQSAFPVKYHFLSTDYFEKAEFLQPLKEYLAENYQKMDWTAYQQLTPEQQAFYLTLVGFNDEVKQSLEVQQAKFIFTGTTTWEGNTEVREYYAQQQLNLLNHFTQAEGDLFIGDHYKIYFKGHPRGGEINDYILNNAKNITNIPANISFEVLMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTNNPYVKVMRRLGIIDESQVIFWDSLKELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Sialyltransferase Pm0188 from Pasteurella Multocida Complexed with Donor Analogue and Acceptor Sugar.
pubmed rcsb
source organism Pasteurella multocida
molecule tags Transferase
molecule keywords LPHA-2,3/2,6-SIALYLTRANSFERASE/SIALIDASE
total genus 126
structure length 377
sequence length 389
ec nomenclature
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11477 PM0188 Sialyltransferase PMO188
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2iy7A02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2iy7A01
2ILVA 4V2UA 2Z4TA 4V38A 4R84A 4V3CA 4V3BA 3S44A 4R9VA 2IY8A 2EX0A 4V39A 2IIQA 2IY7A 2ZWIA 2IHZA 2IHKA 2IHJA 4R83A 2EX1A 2C83A 2II6A 2IIBA 2C84A
chains in the Genus database with same CATH superfamily
2X23A 1TQ2A 2ZR7A 3KKEA 1H2AS 2JIZD 5FUBA 3ASZA 4F97A 2PYDA 1SCUA 4TYWA 4KCGA 2GSDA 2JGAA 1IUOA 4RM3A 3M1YA 3G0IA 2QTFA 2R4UA 3D2LA 4MGZR 1SZCA 2G76A 1L7VC 4KFTA 4IUDS 3H0CA 3GFSA 3T9BA 4YRLA 5A4KA 4TL7A 2R5NA 2ZIXB 2ZPTX 1N92A 4QE3A 2FWIA 3RVLA 1L4YA 4E5KA 4CM8A 4H0CA 1DADA 3K9HA 2QAIA 2JFOA 3VPSA 3ZEIA 3HBJA 4A27A 2AI3A 5JTTA 4GNKA 2DGDA 4HNQA 5H81A 1M6WA 1JDNA 2R6GA 2PXAA 4J0HA 1QSGA 1ILWA 1XPOA 3K1JA 3FRHA 3HUDA 1I32A 1BQEA 2ZQYA 3BG5A 2OV3A 4RF5A 3CIOA 4QBKA 2AFVA 2GCPA 1AZWA 3ZHUA 4F6RB 5KWEA 2CUZA 4F56A 3U6BA 1S9HA 2ZFUA 3TUZC 3EZYA 5J1SB 4AS3A 4RQTA 3F9RA 4R2MA 4M1OA 3ZGNA 1R6UA 3GGPA 1XKTA 2PLNA 4MWDA 4U2DA 2ES4A 3U7QA 4KRGA 3KQOA 4XDYA 1RQRA 2CXPA 1C1XB 3DSRA 1XU4A 2Q27A 4BO0A 2A0XA 1Y8AA 4ZO7A 1ILEA 2YC2C 1E9RA 5C8XA 2GNOA 5JJKA 3R75A 4YT4A 2GJSA 2ZYWX 1BWPA 3AOGA 3B1XA 1OI4A 4H7FA 3RRBA 3RUFA 1AHIA 2H16A 3DB2A 1GPLA 1E58A 2E2WA 2D5BA 3HPQA 5K0LA 1DXQA 3FPBA 5ETJA 4NOJA 3V7FA 5EKUA 5DX0A 4TRRA 2PQ2A 2IF0A 4YIHA 4B80A 1ORTA 4JBNA 1C9JA 2I5PO 2QR5A 2DPMA 1PYOA 2JFYA 2ZB7A 3EISA 1CFJA 1HZJA 3K30A 1SBTA 1DI0A 1OJ7A 2X0KA 2XVYA 3G2QA 3P1JA 4PFJA 4Y9DA 3AEKB 2O8DA 1UKZA 2JJ1A 2VNKA 3ITKA 5ALRA 3RSZA 3SOPA 5JC1A 1QCYA 1M2VB 1L2TA 3S99A 1V5IA 1EZ4A 1Z5WA 2RK3A 2VSXA 4TWJA 4ZEVA 1GV1A 1I0IA 4EENA 5GZ3A 5C46F 1QBKC 2CB9A 3FYDA 3H6HA 4D9JA 1Q3TA 5C2JB 1HG0A 1RKXA 1E5QA 4DTIA 4EI7A 4WD3A 5EJGA 1L7QA 4MWCA 1XMQB 1WW8A 5FH9A 1YDHA 3D3KA 4GDFA 4OFZA 5C5EA 2IYQA 9LDTA 5JROA 1C0EA 1CZRA 4HGNA 4YQYA 2VJCA 4ZVLA 5HCUA 4QKQA 4QWWA 1ZJ5A 2Z0MA 3E18A 5EGNA 3SN6A 3WB9A 1QZUA 2VYVA 3PFWO 1EGHA 2ZRLA 3CX3A 3SSNA 3BHNA 1Y9ZA 1FYVA 3DT6A 5E3HA 1JXOA 3WS7A 2PX3A 4J2HA 3RFXA 3F4KA 1GG5A 2XQFA 3DOIA 1KE1A 4HNGA 3SHVA 2VT2A 5DTQA 3S7TA 4EZEA 3VZQA 1U5AA 1Z0UA 1QQTA 3CWQA 3VR5D 4LMBA 3VX4A 1RSZA 1ZICA 1E1QD 1NVVR 2QNRA 3DPUA 5LBIA 1TKAA 4I81A 3OECA 4G0VA 3TZQA 4LF8B 2UYGA 4HADA 5BSVA 1JGTA 2GNAA 2NG1A 2A1UA 4WLUA 4WOBA 4N3NA 1HGXA 4UTRA 3WL5A 5E9AA 2VOEA 3BB3A 3UHOA 3A9RA 1PL8A 4ZYXA 1FY2A 4L76A 4V1CB 5JRJA 1TA9A 3S55A 2HL6A 1VG8A 3DZJA 4G26A 3CW8X 5A62A 1E3QA 3B6EA 5K8CA 3F3YA 2MSKA 1TJPB 1XAIA 3A4IA 3H9UA 3H2HA 3RRNA 3MRSA 2ARKA 3U4DA 1GCGA 2Y4NA 1KI4A 3FVRA 4RPIA 3GLFA 3O95A 1JQ3A 1MJFA 1V26A 2X9QA 1HKHA 1QHHA 2JATA 4C6TB 1LU9A 2ZBEA 1KI1A 2H9AA 3PHJA 3EQ8A 4Y67A 2QKYA 5FRDA 1KGDA 2VLBA 3VC2A 4K6MA 4PTYA 2XITA 3UAOA 3V4ZA 3ZK8A 4GS5A 5K0EA 5CVUA 1VYUA 3NV7A 2GCOB 1L5RA 2NSLA 2ODAA 1TAUA 3HGTA 1RXEA 3KUUA 4KE7A 5FBRB 3O83A 1ZH6A 3GJ6A 3P94A 3UAGA 2Y71A 3FPLA 2PS0A 4A4DA 4C7MA 3SLGA 1RYFA 4EI9A 2DFNA 2QUKA 2VF4X 3QWFA 3Q88A 1F2UB 1D6SA 5DP2A 1VJRA 3ILXA 5DCYA 4BYMA 1CB0A 2F90A 1NF9A 1ZD9A 4CIBA 4PC6A 1WUHS 4ZVMA 3RSSA 3U61B 4K5QA 3A1TA 3IOBA 4EX7A 3DZFA 3LP5A 5KYVA 4BNJA 4Q7QA 3AUXA 1NXTA 5B36A 1OX4A 3EN0A 4GC5A 3W6UA 1NM5C 1PJRA 1EE2A 4CMHA 4NAVA 3DAYA 2C5EA 4EW1A 2NPFA 1F5SA 2D2VA 3BT7A 3DLCA 1NR5A 1UPAA 2UUOA 3PT9A 3PDUA 3LUAA 1GGMA 1WU8A 1WCIB 1YCHA 3V7YA 3BFKA 5SY9A 2IBTA 1U5BB 3V55A 5LMCA 3LKBA 3BJRA 1WF6A 2Q5HA 1UP7A 5B2EA 4BY9E 2CXUA 2QA5A 5ALYA 1E6LA 4LIPD 3BGWA 2EKPA 3U7JA 2XOKD 1P2SA 1U2DA 3EUEA 1N8NA 4B6OA 3IUJA 4Z4GA 3FNGA 3S2FA 4WNAB 4MS3A 4U5XA 5UKDA 1J8DA 2Q8QA 3GOQA 4GWKA 2CJWB 3T5PA 1XLWA 2CE2X 1GZ5A 2DKFA 3NWOA 3K05A 2BFEB 5CPFA 3WIDA 1W2WB 2W42A 4N03A 4CTJA 2HWUA 2I4OA 2JPDA 4ZRNA 2BFCB 1GKUB 2ZYUX 2OXEA 3J81k 2SCUB 4UHBA 1OU4A 3WFJA 4EF4A 2WQ7A 2CCGA 3DOJA 2C7RA 3IEMA 5T57A 4LVUA 3W7BA 1DOHA 2QMEA 4IIDA 2HPHA 2VF7A 4F46A 5JAPA 1T1SA 4JKYA 1S0UA 4QUBA 1EX1A 3VSCA 3WK9A 4QXQA 4BFZA 3GX1A 3RYCB 5LNK6 2OPBA 1UF9A 1Z2NX 3S4YA 3FAKA 3GCDA 2ZUDA 5LL6P 1DCTA 2HBYA 4QDTA 1IK6A 1CUBA 1SBYA 2ENWA 3EGXA 4QTXA 4BTEA 1YQWA 4I55F 2JFNA 4F12A 4GAEA 3ICPA 2CFRA 1PK8A 3NAGA 4MKRA 5JOQA 3BWDD 2GZDA 2BH9A 1GQRA 1YS7A 3JD0A 4FX2A 3ZCXA 2QZPA 3N70A 3QEMA 3DFKA 3F6EX 1O94D 3IUYA 1GNSA 2B4AA 2EOAA 3FLMA 4Q24A 1XNHA 5U4XA 4OK5A 3DKVA 1QHIA 3G17A 3SJ7A 3D0KA 3IUBA 2VJPA 4Q4HB 5TDHA 5F2EA 3UATA 2EHDA 4Q1AA 5C7YA 2P2NA 2CW5A 1FS4A 1N2CB 2GKGA 4QTZA 2W2NA 1G21E 2CCKA 3AB8A 4MWZA 1YR1A 1VKNA 2QD3A 3O84A 1CXZA 2I78A 3LUJA 4D9EA 1Q5PA 4Z9XA 4GSLA 3H8VA 1WSDA 4RD3A 1MO2A 1L7XA 3MYYA 3OCWA 1YBFA 4GEGA 1FVHA 4XIJA 5BSRA 3BUSA 3CISA 3B6IA 4G36A 1B8UA 3KZXA 3LWBA 1Z2OX 3ZHXA 1W4BA 3GP3A 4BMNA 4DQVA 2HRCA 4OQQA 2ZJ4A 2J32A 3CX6A 4P3OA 1GLNA 2FZEA 2CLMB 3OPYB 1FDRA 2XB6A 2XUFA 3B5EA 4LISA 4P4LA 3ZHVA 4D8YA 4EYGA 2RD2A 4PQRA 5HW0A 2XCUA 1WE2A 3V7UA 1N5RA 1J99A 5IJXA 5C53B 2DH5A 2DPGA 5IXYA 1MO3A 5CIWA 4IP0A 1Q0ZA 2X4DA 2XSZA 2XVAA 3EBOA 3UJ3X 1Q44A 1ENZA 3SFZA 1W1WA 4IHAA 1ZRMA 1JJBA 1QFSA 1L5HB 3ICVA 2LIVA 2D1TA 4BNWA 4OP3A 3QVSA 3V1LA 1H0HA 5J47A 2FRXA 1HRDA 1FU7A 2P9FA 2UVDA 1UXIA 1WXDA 2B1IA 3MRXA 4EMSA 1BRMA 3MC1A 1DBSA 3C6KA 2NO0A 2LBPA 1QG0A 3C43A 2QN2A 3A3KA 3TFQA 1E4OA 5DWVA 4JJ8A 4DR7B 4XM1A 1JJ7A 4WAUA 1IXSB 1CULC 3EZ6A 2XMPA 5TR9A 3AVWA 1E4EB 2Q28A 2YIMA 3BF7A 3N28A 3HJGA 4OHCA 5EHGA 3SD7A 3UW3A 4TYNA 4FYMA 3E2MA 3H97A 1YZGA 3O8DA 1FRVA 1TZJA 1A2BA 2G7MC 2Q3HA 2OA0A 3K3PA 3KE8A 5IJ0B 1VMEA 3E03A 3EF1A 4OHYA 2NVWA 3SS9X 1SUCA 1VRWA 3IHLA 4UHHA 1VE5A 3DEKA 1P4RA 3G8DA 1F1BA 5FNZA 3K16A 5LVAA 3STYA 4K9RA 1C3LA 1SVNA 4QGFA 4TMWA 1CRQA 1IXKA 1LBHA 1XYVA 3I0NA 4BS9A 4DUZB 3HJFA 2VUUA 1W88A 2IFTA 5H80A 4C03A 4N5LA 1FK8A 3GXBA 3O0DA 1PWEA 1IVNA 2QTTA 4ND8B 1MZVA 2P2SA 3TO5A 1D6MA 2YWFA 1VHJA 1SO8A 4U6SA 5ENDA 3UBMA 4BASA 4BEJA 4DSOA 1JAHA 4YMHA 3A37A 5CFPA 3GJ4A 3HZRA 3GP8A 2ERYA 1TQ4A 3LWZA 2QRKA 1HE1C 3OZEA 3FSGD 4Z4HA 3MIZA 4MDFA 2NQ8A 1CY1A 3HB4X 2DB3A 2YC4C 2ZT6A 3DDOA 3E7XA 5B1DA 3VVMA 4B32A 5FLKA 2PMEA 2VAVA 4PQYA 3TG2A 4P93A 2J08A 2DWPA 4QYSA 4ZANA 3PX7A 3VR4D 1JLSA 3AVYA 4TTRA 4TYMA 1Q6YA 2XYVA 3ILHA 3NJ8A 4PLPA 3CZ4A 2O2IA 3W34A 4PPFA 4AJ9A 4PNHA 5BUZA 5IUJC 4IRMA 2CFOA 3OTGA 4U00A 1OAOC 2C31A 4DJTA 1NXPA 4FJ1A 3GJXC 3JR7A 5G02A 1F5NA 4IV0A 3SSOA 2JFWA 4FM9A 1V1MA 3IPYA 3N76A 1AG9A 5CDSA 2XTMA 1VM6A 3OLVA 2F8LA 4C0SA 2XEXA 2GVZC 2QRLA 4M99A 5JZMA 4ENWA 2DR3A 5SZJA 4C87A 1APBA 3QMVA 4KVAA 3WB0A 3FNHA 2ZZMA 1GRCA 4KO3S 1UOOA 4D6YA 3KZNA 3ZC3A 2XMQA 1QHEA 1PK9A 3P9QA 4PXAA 3EZ7A 4QEZA 2A35A 4XUCA 3ZGXA 2G36A 4EYEA 3MILA 4MLZA 5EJ5A 4WCFB 4RFSB 4PLZA 1Z33A 4Q03A 3ZHTA 1KU0A 4JV5B 3OWHA 4YAFA 3T9CA 3V1TC 1WA5A 3PJGA 3CE6A 4JI2B 1KS9A 4ZQHA 2PT9A 4TVKA 1R6DA 3TWOA 3VBCA 2OCIA 1XZCA 3FHLA 4R8RA 2PL5A 3A9TA 5C0OE 3O93A 1JL3A 4JWTA 1DIBA 2PD3A 2ODEA 4WESA 4C4ZA 4ZRMA 1N8SA 4TRNA 2E4ZA 1JEYB 4C06A 4A26A 3A6JA 1JJAA 2B5WA 1KBOA 4QQRA 1H8HA 2H2GA 2YWHA 5LDGA 3T5BA 4B46A 1E4VA 4OGKA 3K1TA 5AHKA 3BYZA 4WLVA 1TC2A 5HNKA 1LLCA 1KRHA 4L5BA 2J4FA 4MV3A 1FFSA 1B93A 3ZGLA 3TYXA 1NG9A 1MQAA 1NW3A 1QGUB 3F46A 3WB2A 4R71A 2C83A 3EUAA 5IZCC 4PQEA 4CLDA 3DOOA 3MCAA 4PO8A 3K15A 1Y7HA 4PYLA 5EQTA 4DR1B 4IIUA 1WABA 3L7DA 1J90A 3M83A 1VA4A 1ODKA 1L5LA 1DS6A 3L41A 3M6VA 2BHLA 3T7EA 3PRYA 1YDGA 3E4DA 4IHKA 5FBWB 3GT4A 5A7FA 5JSFA 3RS2A 4QU8A 1YMVA 4RM2A 4DRXB 2EZTA 2X2EA 2IWRA 1DQRA 4JENA 3EAQA 3FFTA 3P52A 4JUCA 1U0HC 3K09C 3LG2A 1BGWA 5FHQA 2NO1A 1IU9A 1XU9A 5TGDA 2ODQA 3H8JA 1YZTA 2ZAGA 4DJJA 4AU1A 1UKYA 4KWIA 3AVPA 3L8DA 4PV7A 3NALA 3FB1A 4C7OB 1QJ4A 3QU9A 2I4LA 1XTZA 1SKYB 1YZVA 4YP0A 3ZG6A 4ASUD 4D99A 4JBIA 1PYGA 2FH5B 2W48A 1VE6A 1ZRNA 2C4KA 5EYPA 2XKBA 2P0YA 1HEUA 4GGPA 4PICA 2NMVA 3ZWOA 3DCIA 4R1MA 5LPNA 4F2HA 2IOQA 1UMDB 3KT6A 3PZBA 3TOSA 3UPUA 3H8SA 1UFOA 5FR1A 5CX1A 1HT1E 2H4HA 2I7VA 1XFDA 4FVTA 3K6SA 1IN8A 1JFLA 1TQ6A 4R31A 4YAIA 2Y1FA 3GLHA 3OIVA 3M0EA 5LB2A 3U44B 2IY9A 1GA4A 3IAEA 3DC2A 1ZJ6A 5CNMA 3I1YA 5MN5A 4WN3A 3TJZA 3UT0A 2A1TS 4NE7A 2MMGA 5HIKA 3R3WA 3NTXA 1ITZA 4MLDA 2VPTA 4BMDA 4RVOA 3B13B 1JIIA 3ELYA 5J1TB 1NOIA 1QZ3A 1VDMA 3JQEA 1E7QA 1D2NA 4QJBA 3W8RA 2XYPA 1GPDG 4CEIB 1ST3A 3H5OA 3G6WA 4TYPA 1BDHA 2XYRA 2Q07A 3Q8XB 1P5JA 1GWNA 1QQ7A 1XU7A 2RDMA 1GTJ1 1ZBQA 4GOLD 2F1HA 2EWMA 5A5VA 5I9IA 3PNQA 3CTPA 4PR3A 1XXHA 7REQB 2QE7A 2R6ZA 3NOVA 1V4VA 1U3TA 3IKJA 4N3GA 1U28A 4PLHA 2H4FA 2C00A 1GR1A 1PFGA 1QWOA 1ECFA 4K9DA 4WLFA 1ORVA 4CCAA 4JT9A 5D3MB 2TECE 4LBWA 1F8YA 3C2QA 5HUJA 5AW6A 1YDFA 2OHIA 3BL5A 2BFBB 4RKRA 1IG3A 1AS0A 1XQ1A 1YDEA 1ZA1A 2YFYA 3EWAA 4TUYB 4AMYA 5LZ9A 1O0CA 4ZZ1A 2ZT7A 3NM4A 1KMHA 1PJZA 2AIRA 2E4YA 3PXDA 2O1WA 1EDOA 3H2IA 3LP6A 1VJDA 4CCYA 4EA9A 4EHLA 4I4IA 4CRWB 2HI0A 1JIQA 4G2NA 3S8YA 1IY1A 2JJQA 2CDCA 1A71A 2C4UA 3A58B 1OCEA 1JDTA 1UAAA 1L4HA 2HMUA 3M5DA 5JO9A 2FVYA 2LV8A 4TS9A 4N3BA 3MWYW 5G1OA 2CVPA 2HK8A 4OTZA 5D51S 2J07A 3RYTC 1KMNA 2VJBA 5JH7F 2I34A 3DZIA 1U3VA 1D4FA 1O4WA 1SCAA 1XCMA 2G25A 1RFLA 1N1GA 1U7ZA 2VP6A 4RC9A 4X7PA 5LA6F 4CM7A 4DSNA 5HTOA 2BYTA 4B82A 2QBYA 4FC6A 1U0GA 1EBBA 1QAOA 4KV9A 4DZZA 1LK0A 4YMGA 2JK0A 4LYAA 2B7BA 2EKZA 2D0DA 1AZLA 2AUMA 3CSUA 4NFYA 5DSTA 1NXVA 2MYTA 3DZCA 1T9GS 5AW3A 5BORA 3M6LA 5IJ0A 5HBGA 4PTLA 4UVIA 2G9UA 2FNAA 4IO1A 4X3CA 2Z1MA 2D59A 1X9IA 4Q02A 1OFUA 4FGZA 5E6SA 5KNBD 3VYRB 2W2QA 3CRW1 2XCIA 1E3SA 1TYDE 5CM9C 4KBFA 8LDHA 1UJNA 4CTOA 1P9OA 4F60A 3O1JC 4QC2A 4DKXA 3PD0A 2WJHA 4RJKA 1XJ5A 3ET5A 2HRDA 5TPZA 3CUSA 2Y9MB 3UXEA 2FZLA 2IU4A 3AM3A 4GOMD 1RDFA 1ZY2A 3EXFB 5AI9A 5AM4A 5ER9A 2AG0A 1SXJC 1GQSA 2VWPA 2M1XA 4DILA 1GSOA 1MAWA 2YXPX 1IL0A 4HQFA 3JVDA 4FDLA 4JJ6A 4ZCSA 4BNLA 2IXFA 5A5FA 3IAM1 4GKBA 4J29A 1J9EA 1NQUA 1DAOA 2ECOA 4MP8A 3ZWQA 1VL6A 3DM9B 3ZW7A 1UC5B 4BXOA 5GOZA 3ZE0B 5GJCA 5ALPA 3N2GA 1M34A 3SHWA 4EJSA 4IIGA 1X92A 2R0QC 4R1UA 3CN7A 1I7QB 2FW9A 3GHYA 1SUBA 1EVYA 1BVUA 1KMQA 2HD4A 1N2ZA 2PSDA 4M37A 3RUIA 4XDGA 5CA0A 4XLLA 4G5YA 4WOJA 3QIAA 1XD8A 1EVJA 2OXCA 3A7DA 2C9OA 2JFQA 4B81A 2FWRA 1KARA 3ST7A 5IHPA 1FJHA 4YP5A 1J6UA 2C3UA 3RSGA 3NYRA 3M5CA 1AGRA 1XG5A 3G68A 2ASVA 3T52A 1AUVA 1EG7A 4EUFA 3NHZA 4R6XA 4INJA 2IU3A 2HCJB 4F2WA 1TOAA 1KJQA 1DG3A 3FYUC 3OA0A 4DIMA 3PZRA 2IYTA 3QMWA 4CQMD 2B2XA 4MVJD 4R5MA 5TF0A 3SSMA 4B6JA 3VJRA 2HREA 2QTVB 3RYIA 1OH8A 1N5DA 3U4QA 4OQXA 1XDBA 4OXXA 4BKQA 2GN9A 2BFFA 4BO5A 5DI3B 2W9XA 4KQ6A 1Z7YA 1HOXA 2EYUA 3RUDA 3T4UA 5BR4A 4NR0A 2C5BA 1KDPA 5CH8A 1YIDA 4Y6PA 2W11A 3SXJA 3EGIA 5CB6A 1XLUA 7MHTA 4H3VA 1ZCBA 1P4SA 1C0PA 4B6FA 3RVRA 2CXHA 4YCSA 2NU9A 1E2NA 1GYQA 1XRPA 1E3JA 1CUEA 4EY6A 4JWKA 3AOEC 2ZREA 1CYEA 1XXLA 3OIDA 3PFBA 4P9NA 4RK6A 2WWHA 3ON5A 4MIKA 1LJUA 3JVIA 5KHAA 4DWJA 3D2AA 3RVSA 3VC3A 3MLAA 1HYHA 2DBVO 4WGFA 3OCVA 5JBIA 2QE7D 1PI3A 1G64A 1GADO 1N1DA 5JS2A 5KNBH 2BD0A 6NULA 1NVTA 4WL0A 4Z0HO 5BMVF 5DHRA 1HNNA 3E5HA 1VG9B 1FDTA 1YMQA 1A27A 2B8WA 2WVGA 3HJNA 4BO6A 1OLUB 1S2MA 1REQA 5BN3B 1CRPA 4UUOA 4X62B 4BDTA 5I9SA 4B47A 5LUAA 4MUXA 2G67A 2WYWA 3CMMA 2ECFA 3WLSA 1W9MA 5LYJF 4ALKA 3DQQA 1DC6A 2WD7A 1TIBA 1PIWA 3CH7A 1ADGA 1UT6A 3TAHA 4EUKA 2L2QA 2PMBA 4FFDA 2O1XA 4G5OA 1QHSA 1IRXA 1YCDA 1GR0A 3RF6A 1KO5A 5J40A 1DC5A 4QTUB 5EZ6B 2J3MA 2YHIA 3A1UA 2AE2A 1VPEA 2XWPA 1OA0A 3R7WB 1BMFA 4CDGA 3ZZ0A 2YRWA 4BPRA 4EPRA 1HH4A 1LBSA 2PX8A 2D4HA 1JWLA 1PVVA 2GF9A 3EX7C 2V9CA 2QAGA 1E66A 1H2YA 2X0NA 4KQ9A 3C98A 3G5MA 3C3KA 4MARA 2GF0A 2O20A 5HUHA 1LC0A 2GPJA 4WY8A 5DLYA 1UH5A 2X4IA 5FPTA 3VR2A 2IZ1A 4FFVA 3JQCA 3V9PA 2VHTA 5LQAA 4U2FA 3EOZA 2YMPA 2GZ1A 2WJAA 4LF5B 1F8XA 1LDEA 4Q0MA 3P9ZA 4J0QA 1NV9A 3CLSC 1OV6A 4LXQA 4WGGA 1SHTX 2GZ3A 3FNRA 4HR7A 4IEIA 4W1SA 4G0XA 2JIOA 1JR6A 2HT6A 1NW4A 2RB5A 3H2KA 3ISVA 4MWSA 3BBLA 4HPWA 4WH0A 2WKSA 4ARZB 4INZA 3I34X 1VL2A 1E1MA 3S2YA 4ALNA 1JSRA 4ZI7B 3VJLA 3D4PA 2BFPA 5JZ9A 1W8DA 4CT0A 3ZGYA 3ZCTA 5AQEA 3VOTA 1C9KA 1DAFA 3HXPA 1X8KA 2YZMA 3KZKA 3ODPA 3AU9A 4I50A 3SE0A 4AY2A 2C3MA 1I0LA 3PUYA 4RTQA 1O0SA 3K6SB 2NQTA 2IOFA 3TW4A 3X1JA 4TTIA 5DYWA 3VTAA 4KIGA 1YK0A 3PNPA 4Q4HA 2IPAB 3R40A 1WUKS 2ISCA 4H3HB 1HT3A 2CNLA 3QBEA 4WN9B 1VGVA 2NZYA 5CU7A 2HU7A 4JJKA 3FPFA 3QLVA 4QDJA 1Z6TA 2PH5A 3CRVA 3QBVA 1SXJE 4FFSA 3RO7A 3ZY6A 1FCJA 1UWCA 1UPCA 1VJ5A 3B3AA 4BVFA 4CKZA 3URMA 5K4AA 5JJCA 3DDZX 3FZEA 3MUNA 1WQ3A 3N3BC 4WPGA 4R2KA 3VRHA 5AVVA 1G20B 1E63A 1L9XA 3KSMA 1GYPA 3HVJA 3KZOA 1AU9A 2AG5A 4JQZA 4OM8A 3U81A 5JYDA 5CFOA 3L1JA 3ID6C 3CVXA 1XZGA 1Y9DA 3HRIA 2BEWB 4KQMA 1U6IA 2XW6A 3Q5DA 4LHSA 2JGIA 4O2BF 3SVLA 1DBWA 4WZAA 2XMRA 4EKGA 3B51X 1FYXA 3SLKA 5IK2D 2GRUA 2D00A 2VL7A 2FEWB 4FKMA 1NJSA 3NNDA 2JB9A 1JDBC 4J0GA 4BNXA 4LHZA 1U2PA 3LGXA 4W7IA 3OQIA 1J2UA 3FCYA 4MTCA 2JZOA 2O2JA 1XPRA 1XPUA 4LJ6A 4OL0A 5FD8A 2ZJAA 1P7YA 5LMNB 5JD4A 3UUGA 3EZNA 4V0KA 1JLMA 3E5RA 3W3AA 2B0CA 4ZVUA 2JZCA 4WKGA 2DF8A 3V34A 1OZ0A 3CZ9A 3VA7A 3GH1A 3IVXA 4QUAA 4JEUA 4FYHA 4LRWA 3NTVA 1PZHA 5FADA 1UDCA 2BFCA 4L8WB 3E9RA 4L08A 3FYHA 4NF2A 3KSBC 4ND3A 4NOKA 4C3OB 3QKRB 1KRWA 4DF3A 4XRRA 2FR8C 2PNFA 3JQFC 2FKNA 2PUHA 3HGMA 4BN4A 4ZMRA 4A8JA 1SCBA 3DWIA 1NVGA 2ZG6A 4YX9A 4M0UA 2A1IA 4ZJPA 4NFHA 1J0AA 4PW0A 2KBEA 3FI0A 1QYIA 1G3IA 4XXHA 4XWKA 4FGKA 2HF2A 1DFIA 1O1YA 2FEPA 1Z2EA 2HFKA 2P75A 3N39C 3I2YX 1HDIA 4NZYA 1KJNA 1LBEA 4JYBA 1JQBA 3CF0A 1Y6FA 3DS8A 2GNPA 2WHYA 3GUYA 4NESA 4HNRA 3ZOZA 3T4PA 3FOAA 4N47A 1JMYA 1JBKA 3FSGA 4GBJA 4M88A 3T34A 1E3MA 4PS1A 1G6OA 3Q4GA 4QUJA 5TGTA 1HZZC 5L3SA 2R9VA 1F6BA 2REQA 2WUGA 3AZOA 2AZMA 2P41A 2QD5A 3KXPA 1O57A 1Z8FA 1E2GA 1M33A 2ZYRA 3HFJA 4LG1A 1AKEA 2J9GA 3NRBA 5IBRA 1XA4A 2HWKA 4NV1A 3ROGA 2HA0A 3PFIA 2QIPA 4GT1A 4FB4A 4C0QC 1A04A 1CNEA 3LXUX 2ZLBA 3SM9A 1EFCA 1NT4A 1W0JA 2GVDC 1ISGA 1T29A 1NLFA 4BLOA 3B89A 3HPRA 1E7YA 1RAGA 2HLPA 2BLNA 4DWWA 5JAQA 1SQ5A 3PIRA 4F6LA 4Y1RA 2AR7A 3WQBA 5BYBA 1VKZA 3E1SA 2WZCA 4FNOA 2A5GA 5FKJA 3GU3A 2VBCA 1CTQA 1V11B 3N7TA 4J9VA 4BV3A 1X70A 1MJGA 2B82A 4D02A 3UWOA 4Y2VA 3L04A 1SCKA 3N2IA 4D8TA 4NBKA 4P84A 2ONJA 1DO8A 2Z8XA 3AR3A 2N1MA 2WICA 3DHYA 3FPCA 3L0PA 1QFMA 1FXWA 3U7EB 3KLNA 5HZHA 1TRKA 4M6WB 3GJTA 2VLIA 1UQUA 3D7RA 4XUGB 4D9BA 2HA7A 3LKZA 4LXTA 1S89A 4MUNA 4WZ6A 5E4TA 3QRWA 3WLJA 4A0FA 2BZGA 5ICSA 3FOCA 3G8AA 1N0IA 2QVCA 1A5SB 4O1HA 2P4SA 1CZOA 1L5SA 2I3GA 2XUKA 4KR7A 4DYVA 3NWBA 2CLIB 4LZPA 4WK0B 3PTLA 1EGAA 3PUWA 4HQOA 1N2GA 2WAYA 3H5VA 4DMGA 3LUBA 1YZLA 4DLVA 4EG6A 8GPBA 3LNCA 4Q1CA 4ZV9A 6GPBA 3WLMA 3QVGB 1RLUA 4Y8VA 5DT9A 2D3TA 1ISMA 3TTXA 4E12A 2OUIA 3ESAA 5FV7A 3I9JA 4EGJA 1JILA 1R18A 2UVPA 1H2HA 4UU8A 1C9YA 2CC2A 4G97A 2RAPA 4WW0A 1G5RA 5E2AA 4ZU1X 3P0EA 2DT8A 2XDWA 1EQAA 4I4TF 4UXHA 5G0SA 3LL4A 4V2IA 4W5NA 4FFBB 2WA1A 2NVUB 4JGIA 2LGJA 2G5TA 2HQOA 5DB4A 1Q0QA 1E2FA 2NTYC 1R3UA 1SBIA 4HEA6 1NF8A 4KI7A 4BZZA 1AZSC 4IQ8A 2O2ZA 2QM8A 3PHIA 1V4NA 5CDFA 2HSWA 4BQPA 1YR2A 1P72A 2PWBA 2F6RA 2Z3ZA 3MTGA 2P65A 1RI3A 1NONA 4RACA 1OX6A 4IS3A 5FPYA 1KIFA 5K9ZA 4J94A 2AHOA 2B2NA 4ZOBA 3UT5A 1YUNA 3GFFA 2VNIA 4G09A 3UC5A 3A2MA 4UHCA 3HV0A 1KBQA 3G0GA 4UDNA 3MFQA 3DLIA 4HZIA 2WD7B 3NASA 4I9NA 5K3BA 2XNDA 2JH8A 1RE1A 4BMOB 1NKSA 4YECA 4KR2A 1SC1A 1SHKA 2QV7A 3FKSA 5K8TA 2P5TB 1I2AA 1OYYA 4FSDA 3FMIA 5IULC 3CGWA 1EFDN 1T2DA 2D2XA 3V8PA 3PDHA 5HKLA 2HM7A 2OLJA 3UUFA 1Q21A 4RW0A 2A30A 4PO3X 2DLDA 4U02A 3RASA 4JXJA 1XEXA 2QJRA 1UP6A 2VHQA 4O5AA 2E0IA 3LIIA 4I6GA 2OZLA 3L8GA 5JYEA 3ENVA 1NBAA 4C01A 1FU8A 1KFKB 2P8JA 1GQ2A 4JR1A 4NX2A 4WV3A 5B7PA 4Q15A 1D1QA 4KPYA 4A2WA 1EM8A 2ADFA 3IOYA 4ECAA 4TXMA 1LRKA 1ULAA 1P2BA 1YWGO 3NIFB 1T6BY 2XZLA 2X41A 3HSSA 1T2UA 4LSWA 4KN9S 1X8XA 2IY8A 3LY7A 4MS1B 3N9IA 5BYJA 4G8CA 4B73A 5DASA 3PHBE 5JXJA 2RH8A 3FTEA 2JFVA 1Z82A 3COPA 3P2KA 3KJHA 4NC9A 2ILTA 4RL6A 1C0IA 3EDOA 3GZTB 3ONVA 3OZTA 4IJ6A 1NJFA 1PZMA 3TPZA 1OFTA 3FWHA 2BSXA 3REOA 4KBGA 4B6EA 4E2XA 5EJ9A 1D4AA 3U4QB 4BEBA 4AM8A 3O91A 3HFSA 3CM0A 4ID3A 1ZIXA 2AW3A 2JJYA 2I03A 1T25A 5BVHB 5EWLA 1W5FA 5CHEA 4Y2PA 1E99A 2XCLA 2ZBVA 2AMLA 4YH1A 5H0IA 3RVBA 3WIEA 1QE3A 1V1MB 1QJCA 3O4VA 3S68A 1P0CA 5G53C 1SXHA 4WZAB 2P2ZA 1DELA 3A11A 4TV8A 5F2OA 3UK0A 4CM9D 1DLIA 1C4XA 3B9QA 3D1VA 2W71A 3JQ8A 4RD6A 4BZPA 2J0SA 2I8AA 1L8XA 1J2JA 1Z7EA 2RH4A 2VSQA 3AFOA 4N4AA 3MWEA 4O2LA 3Q0EA 4UDOA 4BEWA 2DPLA 2SKCA 3GZNB 2I4NA 3RJZA 3COYA 4BQQA 1XALA 1M2JA 5BNZA 2JCGA 4S0ZA 4TXLA 3R0ZA 3CLVA 2IL1A 1E0JA 4G37A 5JHGB 3ETHA 4YAGA 3SJAA 3KOYA 5JI2E 1J24A 3BJMA 5CPBA 1R0WA 1OTHA 1G7RA 4MVJE 2GLUA 1UQRA 2CL6X 1CDZA 2G9ZA 2HTFA 2YV4A 2ZUWA 3IOMA 4O3MA 3UJHA 5FQNA 4I6EA 1VIYA 1ZD8A 1DAIA 2A94A 2ODTX 2PPLA 4JC4A 1GHTA 4RBNA 3ZH2A 1UJ5A 5AVZA 4Z0TA 3EQ7A 3RTDA 1NJ6A 3VKVA 3N2KB 1U1FA 3N8HA 1KL7A 5K45A 2PH7A 4I5EA 4EHIA 1RBQA 2XH8A 3DT8A 3IKLA 3MQ4A 4KXNA 4Q05A 4D44A 4YCMA 4ZYYA 2G9NA 2P1DA 3IT3A 3HBAA 3PK0A 3QXCA 4WFKA 5E7MA 5KREA 3OFNA 3PE4A 1SA0B 5KQRA 2NTEA 4YR9A 2Q6VA 1C7JA 1QDLB 3Q7EA 1G6HA 1U4SA 2Q4BA 4MUGA 2AT1A 3UJ8A 4PX3A 3WY9A 5E1MA 1E1KA 3FD8A 4OKSA 4W63A 5BSWA 1D6JA 3OUZA 4X97A 4XYLA 1MORA 3F7TA 3OKAA 4E03A 1YACA 3G2KA 5DYTA 4YRNA 5A4IS 3BTSA 3NC4A 2A0YA 2XF8A 3EEBA 4NBVA 1J56A 1JR2A 1L5ZA 1M8PA 2BEVA 4QAQA 2YY7A 3W06A 1E62A 1J8FA 1E9CA 4L75A 5KTSA 5IAJA 4BVJA 3ZYZA 4LJAA 4YMSA 1X1BA 2XMDA 1R9GA 5JS6A 1Z6AA 2MINA 3SQOA 4WBSA 3A4NA 1DOAA 3AF4A 2NV2B 1HQYE 3R6WA 2Q7DA 4EZIA 5IEJA 2JGNA 2RI1A 1CE8B 2WK1A 3A1DA 3VR5A 4ML3A 4YAOA 2ZUBA 3DBHB 4RLFA 3L6EA 1KJJA 3QVXA 2VDLB 3H84A 4BV2A 1QHNA 2B1JA 3HYTA 1N77A 3L6CA 4M83A 2FW7A 3ANXA 2FE1A 1Z5PA 3RG2A 4RNCA 2JLWA 1C4KA 4KXVA 3OZSA 3TTYA 3ZWVA 1J2YA 2PX6A 3EBPA 3PUVA 4Q4LA 1IG0A 1VPLA 1RP7A 1ZH8A 4M8KA 5AKXA 3W78A 5AXAA 5KC9A 2XT6A 3RWMB 2V7TA 4CKBB 4L3WA 1B26A 3UQYS 1YVPA 2X5NA 4WSOA 1UKCA 1UMDA 2QN6A 3FOBA 2O5EA 1F6WA 2JLCA 4O8CA 5FUXA 5A4FS 3OIUA 3GUZA 5BV8A 1PZXA 4Y6GB 5F12A 5HQ3A 3N59A 1H6AA 4Q3KA 1DC3A 3V8VA 4EPWA 2H54A 3IEVA 4DQUA 2OYCA 3SKVA 1T8RA 4RQAA 4WLNA 1OHHD 5B2ZA 4C3UA 2ZXEA 2R7KA 3T5DA 2JD1A 5M7EA 4NZ9A 2JAUA 1J4AA 1XDDA 1CCWA 1H2ZA 1UBTS 2EBFX 2VJLA 1G3RA 2FSHA 3S2EA 7ABPA 2GK6A 2EJBA 4G9GA 5DVZA 3W5BA 4DDKA 1HE2A 5KOHB 2H29A 2AVDA 1STOA 2C2HA 2FQWA 5CDFE 2R6CA 4D4MA 1NVVQ 3UK7A 3EZFA 3GAAA 2QJOA 3P7MA 5ED0A 4TMXA 1DX9A 3HY6A 3ZY5A 5P8WA 1Y5NA 4RANA 3RK1A 5KTYA 1XZEA 3ELWA 4TTAA 1QCZA 1PJSA 2PZGA 3D6FA 4R7ZA 4LOJA 2ZWVA 1XPJA 1XJQA 1YV9A 4V0MA 2BGMA 2Y3IA 3QW2A 5IBCA 5JSQA 2QRJA 4X84A 3OQ6A 1F17A 1Q6ZA 1WZUA 3BMCB 4LRTB 3OCJA 1ZU5A 5LSAA 1JU3A 1MD9A 2IA5A 1QR6A 2IVFA 3NI2A 3UANA 4P3YA 5BY2A 4UZFA 4CTMA 4CL2A 2UUCB 1PN3A 4GM1A 2QBYB 2Z58A 3K73O 5I4KA 2N0SA 4WJZA 1D0VA 4KTTE 4OMFG 3TCKA 1V0JA 2HU8A 1RXVA 1CRLA 4RTMA 4C22A 1DUSA 2E4WA 3RQSA 4ER6A 3EVFA 2PKRA 3DYBA 3DFMA 4MYRA 4IH4A 4LE0A 1VLZA 2WB4A 5IAOA 3RAEC 2VDVE 3SNKA 2FQXA 4PNZA 3VQTA 3KB1A 3W9UA 1J07A 2OYSA 3KTDA 3HCBA 4E7PA 1H69A 2QX6A 3EMBA 1FMFA 1ISIA 2C1EA 2FPRA 1SKUA 3KTOA 4QLBA 2YVQA 1PD1A 3PC4A 5G2OA 1MW9X 3BFVA 1TLLA 1EU1A 1NVXQ 3VHXB 2NTVA 4Y2UA 5J5VA 3S2UA 4DIBA 3KQKA 3K4HA 2AYZA 4QSMA 1J06A 2JIZA 1HRKA 3CNEA 1WXQA 1ZGGA 3V1MA 1Q7RA 3T95A 3DTYA 4AWXA 3MQFA 3MJTA 4K9OA 4RGYA 1KWKA 2QD1A 2G4CA 3CX4A 4Q7EA 4X20A 3FFWA 4OHVA 1FXSA 1K7CA 1TGYA 3Q7RA 4QGHA 4OUKX 4C9BA 2LE0A 3GR6A 1F7VA 4DMUB 3RYCA 3E9MA 3QWAA 5H3LA 1E9DA 3OOWA 3TZEA 5BRNA 1P6UA 5KTMA 1NRWA 4OHKA 1SBQA 1M83A 4M9RA 3TBHA 1JTVA 4KH0A 3E9CA 3THOA 2JHGA 4HRAA 3A70A 1DRJA 1JSXA 2BCGY 1RNLA 3R7AA 4B45A 3RHZA 4ZMBA 5JFTA 3GQBB 5TJ9A 2PH1A 1POWA 1T24A 1XVTA 2EHJA 5I4CA 2NP6A 1NYQA 2O4UX 1Z5OA 2P9EA 1VLVA 3G5TA 1PO7A 3ROEA 2H2IA 4U7DA 3ZWAA 1C1DA 1PFWA 5TQ2A 1GXSA 5GV7A 4B3RB 3Q1LA 1RJGA 4M8IA 1G2QA 3H7IA 4I7EA 4DMFA 2OAP1 5ICGA 2R00A 2ZVDA 1Y1LA 5A1JA 5JNTA 1GNVA 5AOBA 2WTNA 1JYFA 1BKYA 1ZSVA 3RIGA 1TJ4A 4WEOA 1Q83A 1TJ3A 3WVNA 1PZNA 3H87A 2FSPA 4HDCA 1WBJB 5HCIA 2PQ0A 1G1AA 5FBKA 3DGFC 5COAA 4DMLA 2HB6A 2WSMA 1Z47A 3BGOS 4GQIA 5AFSA 3LPAA 4MITA 4Q3DA 4EY5A 1Y8ZA 1WNTA 5HE9A 4DNFA 2P40A 3HUTA 3NW9A 1U3WA 4FTWA 4O4LB 4WMLA 1B3BA 5BR7A 2FLKA 5TX7A 5CA1A 3SC3A 1OX4B 4F3NA 4PFSA 3FVQA 2H2HA 3FDJA 3RPEA 1NOJA 1NBOA 2J0UB 3REQA 4XPIB 1LY1A 2X76A 2EZ4A 2JI4A 3O8OA 3S1SA 1U8FO 3ACBA 2A9OA 4Q1DA 5IAKA 2O3TA 1C4OA 1X38A 3MCTA 1S7CA 4ZTBA 1CJVC 1Y3FE 3W7VA 1X7ZA 2FZWA 2W6ID 1E2EA 3LX5A 1RI4A 3Q6NA 3QHPA 2WZQA 3ORSA 4H7IA 3QPDA 3NR2A 3GZNA 5DYNA 5K6AC 3SJZA 3Q8WA 3R9XA 1O8CA 1C7EA 3IDZA 2PMFA 1FP1D 3F67A 1ZI8A 2VHEA 5HE8A 4KO2S 3W5UA 2G1PA 2J5KA 1OYOA 5HRUA 3KJGA 5EP4A 2KE5A 1DQZA 1Z0FA 3CO0S 3DL4A 1Y5IA 3IXMA 5HF9A 4BX0A 4Z7QB 3VSEA 1JHRA 4LC9A 3LIPA 3I83A 5EJMA 1TEZA 5PNTA 1E0AA 1QIMA 1K6IA 1S5PA 3EASA 1JHXA 2H1IA 2R6JA 3IIJA 3QA3E 3WGNA 4M9UA 4JUDX 1B3RA 5KSPA 2G1AA 2O52A 1XLTC 4WA7A 1RPJA 3SX0A 3THWB 1QH0A 3W6ZA 4D92A 4RA9B 2X0DA 3U62A 3GLUA 3WBJA 2OBYA 3E53A 3DQPA 4E5UA 8AT1A 1QV9A 2VSNA 4KXYA 3WYDA 2DMRA 2HSGA 3S1AA 4AD8A 4B35A 4NRDA 2PX4A 4AJHA 3SQXA 1GU7A 2L82A 1Q0SA 2AWOA 3L4SO 3HYSA 4TT3A 3K0HA 1M6YA 4G3XA 3TH5A 4N48A 4YWJA 4BJ3A 3LFTA 1U8EA 4POAA 3CR7A 5FWXB 5LOVA 1T4DA 1ZM4A 3HO1A 1R5OA 2QQFA 3HR8A 16PKA 1UINA 2MINB 3D1LA 4HXGA 2VP9A 2OUKA 4FR2A 2X0EA 3X1WA 4CZ2A 5B1YA 1JSZA 1LPOA 2DVMA 1NJGA 4C5CA 1MC1A 2PIAA 4WFIA 1QHXA 3AO0B 4NU5A 3WL6A 5DYIA 2VDRB 1SG6A 4K3UA 3RAJA 3V1NA 4ER5A 4L85A 1VFPA 2WU0A 1QVWA 4YRQA 3PPIA 4IV8A 4FB5A 1JFRA 2A9VA 1A2OA 2J30A 3DE1X 3THRA 1TJ5A 4NE2A 1ZVVA 3R0QA 5G3YA 4RZ2A 4JOSA 2XB4A 3BFJA 1XMOB 3KJZA 3IQWA 3F90A 4YDQA 5EMMA 1RKVA 2R8OA 4DCMA 1QKKA 2I62A 5TXGA 1PG2A 4OU5A 4UNNA 3I28A 3OPYA 2G72A 4PX2A 1ZC4A 3AM4A 3KL2A 2WJ6A 4FBLA 1U6KA 2WJGA 3N8NA 1CIVA 5IU6A 4AUKA 1ORWA 3L6DA 4CG2A 4MUYA 4ER3A 4XSVA 1UXJA 4BECA 1ZITA 2BFMA 2NP7A 2P27A 2BCEA 3PCRB 2C8KA 2IEGA 3BGSA 1GGEA 4QA9A 3DFUA 4ZC8A 3T1QA 3ZKWB 5A2QA 3ETLA 4HATA 4C88A 2Y6VA 4GOND 2IT1A 3DKRA 4AN1A 4YRRA 1U9ZA 3GLIA 2OK7A 1UT8A 3D0QA 2XGSA 1EXVA 1AJEA 4H4CA 3LDHA 4RJJA 5ERXA 3UCXA 5J4VA 3OD5A 4O63O 3UMBA 5JS7A 2G80A 2YIDA 5ESXA 2WUEA 4D45A 1FP6A 4MP6A 4NCHA 5KX5F 3L7LA 4Q9IA 4EFLA 3NDBB 4IFBA 3EA0A 4XJXA 5JQGB 1NBHA 4CEJB 1FP2A 2QN1A 1UZLA 3OZUA 4YJ3B 5U1PA 2HHHB 1VP3A 3FZYA 1P7PA 1QIDA 1IM8A 2A0WA 3IUEA 1S3SA 1TK9A 2BKVA 2BUBA 1ZVJA 2QOEA 4TXJA 5EUBA 4CODB 5BMVA 3ZDCA 4QYXA 1XWWA 3C6BA 5BQ5A 2R8PA 3CLTD 3PNOA 3VYWA 1ZK3A 4MS4A 4IDEA 3MSCA 2CNWA 4EEKA 6Q21A 4P4NA 1QLHA 3P4YA 3IQEA 1N5IA 2GAFA 1SG0A 2ZYDA 3JSAA 4W5JA 5EIAA 4P4UA 4EBFA 3OCCA 4GMGA 4DHEA 5KNCH 3LSYA 2XDQB 3L7YA 2WJZB 4PLGA 4Q3AA 2ZVQX 1DG9A 2KS6A 3HUUA 1LSSA 4OYYA 1JH9A 3FHOA 2BOVA 4PINA 3UV6A 5C18A 1YQTA 3B7PA 4RDIA 3A4MA 1ZXLA 3NBFA 3H19A 3RYFB 5CFQA 1ULSA 1U8UA 2UVQA 4AJIA 5JSZB 2O8CB 3G2LA 4LY3A 5SYMA 4UTPA 2DQ4A 1U0FA 4M0CA 2CJYA 3U4GA 4XUEA 2A9JA 4JB2A 3FGZA 1FUEA 2OPHA 4O2BB 3LBFA 4C89A 1VPWA 1DBRA 3I32A 3PTAA 3IMCA 4XZ3A 1JE1A 4R3UC 5T4EA 3SQDA 1X7XB 2ZJZA 4RHYA 2HJRA 2AWNA 2WPDA 3GOHA 2PGAA 1LVUA 1VL0A 1TD1A 3GL9A 3OP1A 3ZWPA 4DEXA 3HKBA 1V8OA 5L3QA 3BHJA 4CJXA 4D0LB 1H85A 4HSGA 3VO8A 3VR6A 4FC7A 4WY5A 4WBNA 2FDCA 1XZPA 3QE4A 4QIHA 2RJNA 4FMCB 5I45A 2HWYA 4GLBA 4RH3A 1DXHA 2ZTMA 2P4UA 3BMNA 3FSRA 1Z63A 1CVLA 4FNGA 2VJQA 3U37A 1EK6A 5L3SB 1JNXX 4O4HF 4MI9A 5SY4A 4WXEA 4AP5A 2GN1A 2MSWA 5FLXA 1CUHA 2BISA 1QS0B 5JDCC 3RRZA 4LPSA 2R97A 4A91A 3CNLA 4G0QA 5IJ9A 1E1YA 4EY8A 1WZNA 4QUHA 3OHMA 2CNOA 4JD5A 1V6AA 3KEFA 4BVGA 4ZPXA 1ZWLA 4Z1MA 4PN3A 2HHLA 3C6MA 3LL7A 2WWYA 5BSTA 5IEBA 3U7GA 2MR5A 2GRJA 2RGNC 4KZKA 4IYJA 3I1JA 3ZW8A 4GM0A 5K51A 4QG3A 2CHGA 5TQ0A 4P34A 5CLHA 2FPUA 1DB3A 2F4VB 1C1DB 2W6MA 5TQ2B 2VRWA 1GSIA 2I55A 3E7PA 4LCEA 2QUJA 4P7JA 4B3GA 1ABFA 2J3KA 3BOSA 4CE6A 4YK7A 2I2WA 1L5NA 1FX0A 1XTBA 4J1NA 4KJXA 4ZJZA 2GBPA 4KK4A 1JKJA 3CMCO 4YLYA 3IBTA 3PFHA 4MKHA 1NBEA 3HU5A 2DT5A 3SP1A 4WXYB 2UAGA 3NHKA 2H57A 2QR3A 5K3DA 4D7AA 4G0ZA 1SUAA 4PZ0A 3U2QA 1OWNA 2QRHA 4FOOA 4D57A 1RP1A 4R6WA 2OYRA 2E5LB 5ES4B 3LYHA 3OTIA 3R5FA 4L57A 2C8JA 1Q84A 3GJSA 2G40A 2V45A 1UWLA 3BS4A 5D5PA 4FHCA 1G0OA 1UC9A 3CZPA 4PPNA 5J59A 4ZHQF 1Q1AA 1BO6A 2VQFB 4LXIA 4KBYA 1N33B 4EKEA 1NQTA 4YREA 4HVAA 1H0KA 4BO1A 1DWQA 5ELXA 3T3EA 3ZVRA 1QBGA 3Q9LA 1CZUA 6REQB 4BE9A 2FN3A 5KJ6A 1H5QA 1OLOA 3A4TA 5DOZA 3E9ZA 1RRVA 2BUAA 2I76A 1J22A 4QPCA 4HG2A 1RQPA 1Z34A 3KXDA 5LUBA 1U5BA 3WWEA 1T2EA 5CXUA 2KX7A 1MOSA 1KKUA 2GXQA 4DMCA 1WCXA 1ODSA 4UPEA 4F91B 2Y6UA 4MQ4A 4IM7A 3WGKA 1PR3A 3IUSA 2GS9A 3DDHA 2XDQA 5E4YA 1ZNZA 1AO3A 1ZJJA 3B3FA 3CX7A 2Y05A 4LOHA 4V0QA 1CUIA 4H2DA 1I6KA 3C41J 3HUEA 4B2PA 2Q1XA 3TXXA 2C9BA 1DUVG 1TA4A 4IQ0A 1CF2O 1ISSA 2AN1A 2UXBB 5IM4F 5FWYA 2QLTA 2O23A 3A1WA 4MW0A 3WIVA 3RFUA 2XWQA 4ZTUB 1GPAA 3F98A 4BBZA 1RLOA 2R751 3L2OB 1Y98A 3GJYA 4N5NA 3TBFA 1BHSA 1DT5A 2R8YA 2Z1NA 4MO9A 4RHEA 1F9AA 1QWSA 5DOVA 4LZLA 1L6IA 4XIYA 1AKQA 5LZ7A 2Q1UA 1KP2A 1TEXA 1EJ2A 2CWWA 3VNQA 4E09A 5JAUA 1F7UA 2OD2A 4GLOA 4MUJA 1OILA 4A3SA 4OXKA 5K0CA 1OBCA 2PFGA 5DYGA 3WGQA 1D7AA 3O74A 4LZJA 1G2IA 2VF2A 4JL5A 1FFHA 5I7AA 3UFXB 3E05A 2A7XA 1CJUC 1KDYA 2C8LA 1NXWA 3Q9NA 5DBHX 5CGZA 1E32A 2R8XA 3H2ZA 3SU8A 1LQ2A 5I7FA 3UFBA 3WGOA 5GJVC 2A0UA 4R69A 4FWIB 5K6TA 2V3WA 2R87A 3BMQB 2OFXA 3R4VA 5HJ7A 1Z26A 3FM9A 5ADUS 3EIXA 4H27A 4BB9A 2ETXA 3ASVA 1YL6A 3V2UA 3Q41A 5F2NA 1K8XB 2IYXA 3I01M 2NUBA 3C8MA 4ETIA 1T9CA 4FS8A 4L7QA 1I10A 4RVGA 4UATA 4TKVB 3ZDBA 1FRNA 1MJHA 2O5VA 1S8AA 2Q8PA 3ETGA 4OQDA 1ZQ1A 2QQ0A 3E22B 1A9OA 1KOJA 1RWQA 4PZCA 2F9MA 4UW9A 4Y1GA 4CIWA 1O3YA 1QGED 3R44A 4KH1A 1F0KA 2WLSA 1TKRA 1XF1A 2XTZA 3HZOA 4GHWA 4GQAA 5J2TA 2WWVD 4RS4A 4U0KA 2NLOA 3TM4A 4MV8A 1ZPDA 3EVNA 3GMSA 5EQFA 1OSNA 2AN5A 1ZM9A 1GDDA 3KPVA 4KFRA 3M1LA 3ULKA 1E5LA 2N3ZA 3H17A 2RHTA 1YZHA 2AFHB 3V4OA 4E5SA 4ESHA 3VU3A 2CY0A 3HNOA 1O95D 2XVMA 1Z07A 1JVNA 3TQFA 3C4QA 5JALA 2IH2A 2DUMA 1JT2A 2GD6A 5E0KB 3SX4A 5HQTA 2BBSA 4MHTA 5JECA 5AD1A 3RU2A 1R50A 3LLSA 4LMPA 4MQUA 3MB5A 1G8YA 4OQYA 4KQXA 4JELA 3RTCA 2Q7XA 2QHXA 5EXXA 3M3HA 2OO5A 1KHTA 3NHWA 4Y3UA 5IUKC 5JH7B 1M6VB 3LYAA 3M4JA 1NKVA 5JXWA 5KOJB 2BFOA 3QOWA 3ZIAA 2XZOA 1ZCZA 4M7WA 4B6QA 3U1TA 4V0LA 4NECA 3CH6A 4AJNA 1FMTA 4UCFA 4DDUA 5IJZA 2AMFA 4P7GA 2R86A 3R23A 4C76A 1YGYA 3SJBA 1MB4A 2A33A 2ODNA 2HBZA 5EY5B 1QV7A 1L1QA 3OO0A 3CJTA 4DS3A 4I2NA 1T8WA 4JI8B 2HADA 4LHYA 1N9GA 1MQ8B 4DE5A 1IC6A 2YV2A 2YXBA 3UCFA 1DJNA 1SUSA 2KYRA 2J5BA 3NH6A 4OM7A 1OT5A 3DO6A 3R3UA 3E5MA 4GXTA 4LDPA 3DF9A 3HYLA 5TGZA 2QVYX 1MC4A 4IS2A 4LA4A 1Z0IA 4QOJA 1LPNA 2D06A 3ZH9B 1N6RA 2V4ZA 5C5DA 3MW8A 3G1WA 5AJHA 2I4MA 4CV2A 4K0KB 5U4QA 3DQZA 3TBKA 4JXKA 2EGUA 2YV5A 1E1LA 5FTJA 4UU1A 4OJMX 3LWDA 4TXHA 1I6LA 2WD9A 1WKVA 3TQQA 4V0ME 5EEGA 1YTLA 4DLZA 3GJQA 4UTZA 2XGJA 1JLLA 5EKXA 4NSNA 3TSCA 3GLQA 2XKAA 4BBAA 2XHEA 1NURA 2IPLA 3DOCA 3FR7A 2A0FA 1I3LA 1WDWB 4QRDA 2F8SA 1NC3A 4IRXA 1MJGM 3RU7A 1XCPA 3TLEA 1N9KA 1SUFA 2YZ2A 3Q7QA 4MHSA 1HR0B 4ZGGA 4N65A 1BX0A 2LP4Y 1M8GA 2Q6KA 3QUAA 1P4HA 1OASA 1OXKB 2XUZA 4K87A 4M1ZA 5L4LA 3R8FA 4E3WA 3HXLA 4DNPA 4W5TA 5DRYA 1YDMA 3L0CA 1W35A 4B09A 1T1JA 5F33A 3IODA 2RCYA 3AR7A 1WU7A 3KEQA 4MW1A 4BCDA 4BFCA 3D1JA 4ZZ3A 4ZOLB 1EZZA 3IPAA 4K03A 4JBWA 1ZVKA 1PGOA 4GX0A 4Q1BA 3KDAA 2D7CA 1RWVA 1GN8A 5H83A 3EEYA 5BW8A 3DH0A 4OHZA 1BE8A 3SC6A 3ZQUA 2X2OA 4QGGA 4O1IA 2BDTA 5KUTA 2AG6A 2WIKA 2XMSA 3N6XA 1GITA 1TUBA 1ZN9A 3QTBA 4I66A 2GQ0A 3EXAA 2H18A 3L3BA 4R51A 5TQVA 3UQZA 4BB5A 4D4IA 5K0FA 2W2KB 2YINC 1QIJA 4BQIA 2ZB3A 1JALA 2D1FA 2NO5A 3K9GA 4E30A 3R6TA 1QPGA 4MR7B 3RS3A 3P0JA 4EWLA 4JI0B 3JU3A 2XMZA 4K1LA 2WD8A 2BM1A 3LUFA 1IN4A 8ATCA 2VDKB 1UBGA 3DAHA 2AOUB 4PYOA 3FKQA 4AIRA 4WVFA 3KLOA 5F5NA 1GPH1 2ZIWB 3WZMA 3MGKA 4MDYA 1JFFB 2H1HA 2AN3A 3H6GA 3PA6A 4F4IA 2DJ5A 4O4IB 4TGLA 4Y0VA 3THSA 3EMKA 3T54A 4DA9A 3MPOA 3DMFA 3IEKA 3QBTA 1WHTA 3AMVA 4CETA 3I92A 4I36A 4Q18A 5BN3A 5I8ZA 4PZZA 3USCS 2CFCA 1BJRE 2VCHA 2XI4A 4N6NA 3DJYA 2P5YA 4DAOA 4DCPA 3GCGA 1RE0A 1AKVA 5F9HA 1CDEA 2OCAA 2QS9A 3TN7A 3WOHA 3L4BC 1KKMA 4N49A 5CFRA 2CSUA 3M4NA 2ZU0C 3GG2A 2V1XA 5IKMA 5FTKA 2ECKA 3FF4A 4REQB 4CFSA 2NSJA 3ITNA 4ZALA 2WF7A 3V8MA 1RM0A 3O4IA 2A5JA 3PSAA 4ZD6A 4N0PA 2QY6A 3VXKA 1KYIA 1XFAA 4FMPA 1H9CA 3VI3B 4D2IA 1DU4A 1SB9A 2QLMA 4QWMA 3MJSA 3RYHB 5IVPA 2JLQA 1N1EA 4CWAA 4YI5A 5TRTA 2E4VA 5FT9A 2ZJYA 2BF7A 2W8ZA 3G0BA 3G0CA 3K6JA 5FWYB 5KDOA 4NH4A 2HNAA 3EXHB 1QYDA 4LYGA 1UBLS 1RVV1 2AQKA 5EHZA 4I0WB 1OY1A 4DLUA 4GBED 4H9GA 4XRGA 1SKMA 3IB3A 2REQB 2WE7A 4KW7A 1P5ZB 1QIKA 1IATA 3TI9A 3DUFA 1Q17A 4JOQA 4MR8B 1DIGA 3ELDA 3KCQA 2J59A 4F5YA 3DLTA 4MO2A 4EG0A 2YVLA 2C2YA 3TKLA 2VFAA 1D2RA 3F3MA 4BLRA 2PEZA 5HEKA 3ZPXA 1X1EA 2HUPA 3QTTA 4RY2A 5L3VA 2HDWA 3PJFA 3DKKA 4H16A 1KEKA 1UWKA 2IV2X 4BL5A 3ZDQA 4CEHB 2AXNA 1JDZA 3BL8A 4JZKA 1C1YA 2CKDA 3SZUA 2FWJA 2AOWA 5IF3A 2VH5R 3IAS1 1GUAA 3JASB 5I9NA 4MPRA 3G02A 4IGFA 3V2HA 3ABIA 5FWXA 4WACA 4K2HA 3F5MA 2R6FA 5EP2A 1FIUA 1QTIA 2QW8A 3QWIA 1ODFA 5DMXA 1WD5A 3W5VA 1NIJA 1KE2A 1CQJB 4KEAA 2PZFA 2VF8A 4N82A 3K5WA 4CEIA 4CM5A 2D2IA 4RXTA 3W2EA 2NADA 1ZRSA 3P2JA 4J43A 1QO0D 2ZZNA 1D2GA 1M73E 2NZWA 3AM1A 4MJ3A 4QODA 1GDTA 3W2TA 5FJIA 1TFRA 4OCZA 3OQPA 1MEOA 1B0AA 5KSYA 3I64A 2XQIA 5H68A 2Q41A 3CLSD 3H04A 4MQLA 4PSKA 1NJ5A 5DGIA 5A05A 2AMVA 2B2CA 2B6HA 3I53A 4L72A 4AN0A 5BW4A 2V7GA 1G17A 4PBRA 1Z68A 3HEBA 3ZLVA 2QUBA 2X1MA 3N07A 4IDHA 4Y2JA 5F52A 1NJ8A 3WOVA 5JU6A 2L0XA 4B4DA 3TIVA 3FGNA 1QGDA 3UMJA 3WGYA 5KYKA 3TOXA 2WKPA 2PUBA 2J7PD 2ZSFA 4LZNA 3KOXA 2AEFA 4BMXA 1WP4A 1AN9A 1NDHA 5BVHA 2CWDA 1SHZA 4HDNB 2AN4A 4WKNA 3P27A 2HLDA 4JSTA 5LU9A 2QAGC 1ZX1A 1HXHA 1NPDA 4MMYB 2VJAA 3I04A 4NICA 4CL8A 2Q4OA 5EJ8A 5F3DA 4WJLA 3WX0A 2B8EA 1JEYA 4IDOA 2BHSA 1EG2A 4ZQBA 3MJCA 4P0QB 1C50A 3W5SA 1SK8A 1U0SY 1HLDA 3KVOA 4BGEA 3GYBA 2FJUA 2GZSA 1GPWB 4XD7A 5D01A 4ZVNA 3JYLA 1GY8A 2CD7A 5CEFA 3FFBA 3ZZNA 4GYYA 1P1HA 1QIEA 3FWKA 3ODGA 2P4EA 1WD7A 4MVCA 3D3WB 3KD3A 2APJA 1RYHA 4Y1FA 5DNDA 3ZX5A 2DAPA 4HLDA 1FNMA 1U0LA 3NC1C 1BH6A 4FEAA 4QQNA 4EJFA 3B7WA 5K05A 1GFIA 5IMBA 4C4RA 3K0BA 3QNMA 5AO9A 4WXRA 4FOPA 5JFGA 1N34B 5JCOA 1G3QA 3UT5B 3F96A 2PVPA 3BWVA 4MW6A 3UB3A 1GPBA 5CD9A 3P9IA 4I4TA 3FNQA 1OFVA 4BP3A 5MF6A 1GAWA 2WF8A 3D7NA 3AF5A 1UK7A 4JUAA 2BSQA 1DTSA 3EDCA 3GEEA 3OSZA 1UBCA 1KAEA 4UZEA 1BYUA 5HIAA 3OQ1A 3KC2A 4Q7KA 3S29A 1ZMXA 4URZR 2VEOA 3RHTA 2KSQA 5FCDA 1BXZA 4ESVA 4CDMA 1TO6A 2DWQA 3F49S 4MA5A 5H16A 3S5UA 4D43A 2JG3A 3K9CA 1NMEA 3DZHA 2AJTA 3WV4A 1X7WA 1ZAKA 3A26A 5E3IA 4AL4A 3EGXB 2A2ZA 4GR4A 2R96A 3E0QA 4GRAA 3II6X 1IHOA 4ND2A 3TTSA 1R6VA 4EPYA 3G0HA 1BDIA 4BWVA 1V3QE 2BTOA 3HZZA 1W0KA 3WLRA 4F04A 5JSZA 4H77A 3ENKA 4ZT6A 1MRZA 3DBVO 4QREA 3U31A 2YXNA 4O4JB 1IWBB 2C7GA 3PI6A 5AHXA 1H1DA 4ZXPA 2JGLA 3HB1A 4DPLA 5IFLA 3A9CA 4BXOB 1JJIA 1Q22A 3A1FA 1Z74A 1KEUA 5DMHA 3HU2A 4UEOA 1AKWA 5B37A 3BTVA 1MNQA 2O1SA 1PQUA 3GLHB 3OEWA 4KSYA 3EQ6A 2F62A 2IOHA 3EWIA 3UTDA 1G7CA 1HNWB 1Z4MA 3F6CA 4HL6A 4ALJA 1WEKA 1XROA 2DTEA 2ZWAA 3M1IA 4GNRA 3W6NA 3RFFA 3ZDDA 4EVIA 4RTLA 4QJIA 4I3GA 3X2SA 4F93B 5JARA 2JEYA 1LH0A 2WU1A 3ZK7A 3IIIA 3QJ5A 5C7LO 3GVPA 5CAEB 4X44A 3LCMA 1WZIA 1GNLA 1I36A 3JYQA 4E70A 3CWCA 1LPMA 1JUDA 4JCCA 1Y8RA 5KJ1A 4MYDA 1FJ2A 1R4NB 4FE3A 4G0YA 4G1EB 5FBHA 4PG5A 5B58T 1SPBS 2X9VA 2VCYA 4JNCA 4TWRA 5CIQA 3HB5X 4HVLA 1PJCA 2BMJA 4MX8A 4GKVA 2ZJ6A 3AF1A 5LQSA 2NZJA 4G1BA 5BQPA 2ANCA 3ROQA 3LXMA 2ESRA 4X66B 3NT4A 1I7LA 4R2XA 5JD6A 3QE9Y 4I55B 2V7PA 1W76A 3MWLA 2WHRA 3EG9A 5JJIA 2DLNA 2GDJA 3Q8MA 2H92A 4DVJA 4G8DA 5HGJA 2W2LD 3OEHA 4X91A 2B25A 3TRKA 4FHGA 1T0JB 4LY9A 1IN1A 1WB6A 5A5EA 4WKCA 3H5AA 3PFKA 4WA8A 4RJIA 2QVBA 3OBIA 1ZW6A 4RADA 3SK0A 3F8TA 2JBAB 4GMDA 4X8OA 3ZWKA 2OESA 4DCOA 5HYVA 2HRZA 4PPGA 1W9HA 2AV6A 4UASA 1NQAO 1KDOA 3KE9A 1BTOA 1V48A 5E38A 3ZYCA 3C5VA 3PXUA 4OHMA 2AFRA 4MAMA 3CVUA 3TNDA 3P5SA 4RIFA 2CLCX 2BHRA 3WDKA 4CKXA 3K4QA 4AKTA 4F45A 2UYHA 1CF9A 3V1UA 4BO3A 2HEGA 4S24A 1PT6A 4H18A 1ZD5A 3QLTA 4XX1A 5FR2A 3O8RA 3CFYA 4DLAA 4UE6A 4EDHA 4FZJA 2OHVA 3R5KA 4BNGA 1QPBA 3ZHRA 1N2JA 4Y0NA 3FMGA 4OXNA 5HHTA 4PO1A 2GJ8A 3L1VA 3GLGB 4Y30A 3AY0A 4LYDA 2W6OA 1GCIA 4EY4A 4JXXA 1NUAA 2XJ9A 4UFNA 5GM2A 1NVEA 2M32A 1ZESA 3GLRA 1O5OA 5B1EA 5C3MA 2OE2A 2ZM6B 2Z30A 4UJ5A 1Z9BA 4MR8A 1UZNA 5KVQA 1R27A 1WPXA 3H7AA 4R9NA 2B1GA 3QA9A 2DBZA 5GONB 1XZIA 4F96A 2NZUG 5C51B 1K2VN 5F64A 1I1NA 3RC7A 4QEDA 2KLHA 4HH4A 5FULA 1NUQA 2CV0A 1PT8A 4E1VA 1XEXB 4HWSA 2IC5A 4G56A 4DQXA 3PC8C 1Z6QA 5CEEA 1M7GA 2QRVA 5M04A 8ADHA 3TEJA 2E1RA 4K40A 2YRFA 3B1KA 3CH4B 4PLVA 3R5JA 3AJEA 1A0OA 5DK4A 3RDPA 3LK6A 2J3DA 3T9AA 1LDYA 3I12A 1M66A 1ZWKA 2QI9C 4QYIA 3VPAA 3W79A 4ND8A 4I50F 2XODA 4L07A 3EXEA 1V7CA 1GGJA 3NHJA 1BGXT 4IIYA 4TVBA 5ERGB 4RTNA 1Z0SA 4MH0R 4YLEA 3HE3A 5KO2A 10MHA 3FROA 4HX9A 4KN8A 4G1CA 1KIAA 2H06A 1J97A 3MTBA 1VSVA 3S81A 1HF3A 3THXA 2FPPA 1N8KA 3OZ7A 3G49A 3QMMA 1F51E 1RBYA 1VKJA 3R3YA 4R41A 3WRVA 4JYAB 4TZ6A 1DMRA 3LDAA 1TK3A 4P86A 5AJUA 3ZGZA 4F4JA 1MABB 3PEEA 1FDWA 3GRAA 3PXCX 3UUEA 3V7WA 1YRQA 4DCCA 1TIPA 1UZMA 2MCFA 4CTNA 1W7AA 5WRFA 3R0IA 2B83A 2JL1A 2AC2A 1BVYF 3GNQA 5T6MA 2GERA 3WQRA 2QLBA 2OHXA 4HDSB 3DMRA 4ZAWA 2XE6A 4RESA 4TZTA 3GFOA 4HQNA 2WKQA 3A2LA 1MP0A 2OFWA 3HDJA 3GPDG 3A6HA 3I8SA 1TK2A 2R00C 4DQ0A 2IEAA 3BKWA 2ECPA 1UBJS 3E8SA 1QFZA 1L4MA 2L69A 3V80A 4ZDKA 3B82A 1R4ZA 4OAOA 2MSDB 2PAFA 3K4PA 4Y6RA 4Z54A 1U3FA 1Y63A 3CLRD 1EDEA 4ND4A 4QYWA 4B31A 5FTLA 2ZITA 1VB5A 4US1R 1EFRA 2PLRA 1J00A 1MX5A 3HCFA 4G86A 5CK5A 9LDBA 2XUQA 3JAWB 3R24A 2FMTA 1J2TA 2HLNA 1FPQA 1P1CA 1P8AA 2YS7A 3PA8A 4CUKA 1IOLA 2IEYA 3PEFA 2DCUA 2BHTA 2HLHA 5ALUA 3MJVA 1MA0A 3SHTA 1VDZA 1DDGA 1KHHA 4YRPA 5LP6C 1ZINA 1K9SA 1N6NA 2ILVA 4Z8XA 2J9YB 4JEHA 2WFZA 3ED5A 5B3KA 1OGIA 1BXKA 4ZHQA 1OPXA 5J4LA 3J81A 1XK6A 2ZJ0A 4G0NA 1VGQA 1GTG1 4L8VA 3OTOB 3MGCA 4ALMA 1EGMB 1MC8A 3DAOA 3R3SA 1QRSA 4AKHA 5K2OA 1YE5A 3DMHA 1C29B 1GUDA 2XVXA 3OJCA 4ZI2A 1GTSA 3V4PB 5B3AA 2I7XA 2HA4A 2A88A 1I01A 1GTL1 1Z4JA 2GT1A 2NU6A 3KYDB 1XZKA 2IHJA 3OZAA 4GI5A 4HRYA 4IJKA 4JJ7A 3W4IA 4M1EA 4DRZA 1OWPA 1VE9A 3IESA 3K0FA 1S4QA 2PUFA 1U90A 1YZQA 3RVPA 5KHOC 1TNDA 5IFKA 1DZIA 4KC0A 4UHJA 2ZUVA 3JRXA 1MAVA 1IDN1 5BN4B 4GL2A 3AY3A 1MO4A 4JI7B 3L6BA 5HA5A 3R3JA 1MGPA 1KYTA 3A6DA 4OV6B 1A95A 4JXZA 3SF8A 4O2AB 5GGYA 4AG5A 4DA7A 1G5QA 4LDRA 1K27A 3PQ6A 1KYWA 4B8YA 2IH5A 3NTQA 2B3DA 1QF9A 1U7WA 3JQ7A 1S4MA 1SGWA 3BWBA 2OFFA 2Q2QA 1NQXA 2VA8A 3E84A 2HXYA 4PSVA 4YT5A 2NYRA 4QBGB 5JBNA 2H1CA 1KO8A 4FGSA 4J2OA 5JT1A 2FDXA 5LQCA 2QRZA 2ZTSA 1LI5A 2V6GA 3F5QA 1RLJA 2Y2VA 5FEMA 1NUPA 2JC3A 2Q0SA 4CKWA 3UKOA 2VPWA 3BFXA 1G9TA 1KVRA 3K53A 3PC2A 4N8EA 4A0QA 1I5OA 3A9VA 3ZU5A 4AJOA 5JNWA 3U44A 4WDQA 4JLPA 1ZUNB 4HDOB 3GNLA 4JUIA 3AKEA 2Z2XA 3OU6A 3UV7A 3DKIA 5I48A 3JQFA 4TWAA 4ZVTA 1ZCJA 2PM8A 3CB4A 3UWKA 1E6KA 3A3PA 1HL7A 3MJDA 3WXBA 3MXOA 2EKLA 5K8JB 1OE0A 3GVCA 5DTJA 5IABA 4BKOA 2AKEA 3ROTA 1X77A 3DEZA 5BSFA 3GFRA 3G5LA 1XJCA 3PUIA 1DAHA 5F3RA 4DSAA 1YU6A 4HAYA 4KQKA 1CEQA 3QXHA 2CT8A 1V37A 2F8TA 2C59A 3GFVA 3HKCB 1Q14A 2BKAA 2OGZA 2GD2A 3KJNA 1BNCA 2J9RA 2P9YA 4YV1A 3EWNA 5CAEA 5CM2Z 4PZEA 4M7OA 3AILA 3T1HB 1KY4A 4P98A 1KQ3A 3LQQA 4WZZA 4XQ0A 3L4KA 4BX9A 5IUNC 3VZSA 3HA2A 5DIZA 3PPXA 4UU0A 5HIJA 1P0FA 4KGXA 1VBKA 4WZBE 3U0VA 2DFVA 2PX5A 2YYYA 5LBUA 2WAXA 3Q8KA 2WQ6A 1PW7A 2FQQA 2EAUA 4R0MA 3IUPA 2JIPA 1R74A 2O57A 3DV9A 1NPYA 3Q10A 3I61A 3QZUA 2ZVPX 3BXOA 1UFKA 3DHWC 1X7GA 1UJ4A 1KDVA 2RH5A 2YZNA 3TQIA 5KTRA 3TVYA 3D0OA 4BNDA 4DIKA 4C0LA 3PQDA 4DBZA 4B7CA 1RCUA 4MRPA 4RVSA 4ALLA 3O0TA 3PI7A 4B1FA 5I4IA 1O77A 1BWRA 2G06A 1A8UA 3L7CA 3IPCA 3N74A 1B76A 1P5HA 1XZ8A 4RAQA 2OMEA 4YMIA 5AUPB 2BH2A 3KRTA 2QMQA 2XTJA 3V7NA 1ZN7A 3GJZA 4RF2A 1J39A 4CN9A 621PA 3GLFE 1HQDA 4ARAA 3HI6A 1ISHA 1UBOS 4E07A 1EUYA 1QP8A 4G8BA 1S2LA 3A28A 4Y2GA 1E1CB 1NGSA 3BIJA 5EZYB 3C45A 3SXPA 421PA 3KHKA 1N6PA 3OIFA 3VYSB 2H1SA 3UGKA 4LFAB 1UKBA 4CCSA 5FXMA 4R8SA 2ACKA 2N75A 3E58A 1A1VA 3KZ1E 4AC9A 1UBHS 1XVIA 4R83A 2YN2A 2QTAA 2FV8A 1OV4A 3DFFA 2IKSA 1TUEA 4GU5A 4QXMA 4I5FA 2QQ5A 1EUCA 2P6PA 3LA6A 3M7IA 1ADFA 1LI4A 1ND6A 1G4UR 2AYYA 1IJFA 3LW7A 1G8PA 3PGLA 3GFPA 4JUFA 2UZIR 4HOYA 1T1RA 2GRAA 1QLJA 3IMKA 2VZ9A 4KWHA 3KAQA 1JKXA 3PDIB 3UJ6A 4PYMA 3DLBA 1M74A 2ZAOA 2EWVA 3MD0A 4WNAA 3RIEA 3KR2A 5REQA 4C6HA 1NQVA 1KS2A 2OZLB 3R8CA 3DW3X 1K2WA 2B0JA 1Y81A 3BD6A 4EF5A 2V65A 4O08A 4IOLA 1A9TA 4IFTA 2YRXA 3OU7A 2CCJA 1RYZA 2OCKA 2R1ZA 1D0SA 5HS4A 5ESRA 1UDWA 3K1YA 1P1BA 5AH0A 2VHWA 5A9SB 3O2QB 5AVTA 3E5NA 2NYAA 4FE7A 1LFAA 2BRUA 1FLNA 4B9AA 5L53A 3OWOA 1V39A 2D5LA 1ODCA 1HDOA 1SVMA 2JCSA 2QSYA 3B6ZA 3HBNA 5CNIA 5FOSA 1E79D 2VDQB 2V7BA 5IPFA 1DKPA 4UNQA 3HUFA 5CTJA 2BUCA 4CMCA 3REFA 2G1UA 2O8EA 4NKRA 1TZ2A 4CMEC 2XE4A 1CEEA 2PQ6A 3RVOA 4UJ3A 1SFRA 4NARA 3G6KA 1AK9A 1VC2A 4CGYA 3H1GA 4C05A 5IKXA 3B3QA 2PLAA 2RHRA 2NXWA 1F2VA 2NUPA 4ZI7F 1GOTA 2Z2IA 3EAFA 2FFRA 2HC9A 2JANA 2R8RA 3C1UA 3M3DA 1KZ9A 3LQ2A 4JLSA 2QTVA 1VLLA 3PSHA 3C39A 3ND8A 2WYOA 3OY7A 4H17A 4D3SA 3C1TA 2WNSA 2JFGA 2P9HA 1T3SA 3ESCA 4LWQA 4S1VA 4KE6A 3SZRA 3VTFA 4BLQA 2FWMX 2XKJE 2XQJA 2ZU6A 4QAJA 3N5KA 3SM3A 1DX4A 5CT9A 2FHSA 4N76A 1XZAA 4K86A 2PMCA 4WIAA 2ZBDA 3QY9A 1NSYA 1PQPA 2G3YA 2WAOA 3IERA 3NTUA 4CU5A 2LXNA 4XW2A 2DQKA 2FG7C 3PC8A 2R6HA 1KQFA 2P8SA 2XCQA 5AT1A 3ZQJA 4XCXA 4X1OA 2WTEA 3LM8A 4CQLA 2Z98A 2IXAA 2XUPA 3I2FA 1AF7A 2AL7A 1YKFA 2QUHA 2O06A 2QWXA 3DVAA 2E3JA 1PT7A 3EWSA 3JD1A 3LGSA 3TQTA 3N5CA 1U9JA 3SYTA 4DM7A 2TMGA 4PGAA 2HDHA 2ONYA 3WBKA 3WNQA 5KMGB 4B7AA 2HN9A 2G08A 4HDKA 4AW9A 3GLGE 1N7IA 2MOKA 1EFLA 2H4ZA 5ITZA 1VMKA 2WSSA 3AKYA 1YI1A 3PHLA 4IMIB 4YP9A 1YD7A 4URUR 2IF2A 1PTJA 3LTNC 2RGYA 1KR5A 3T41A 5KYYA 5C4GB 3T7SA 3ZGVA 4CM1A 1B43A 3BILA 3EPKA 1WULS 3AXSA 4QU9A 4BO9A 5E9QA 1JVBA 1KI2A 3T7DA 3IQHX 1Z13A 3QPBA 5L4NA 1R00A 3DR5A 3OMXA 3WGIA 4X7MA 4UOEA 3FMPB 3VO1A 1M75A 2HO5A 3IAXA 1GL6A 4P83A 4CI9A 1BJTA 4RA9A 3DF7A 1EVKA 3DZGA 4KQIA 5F73A 2SICE 2G88A 4ZODA 2B1RA 1U98A 2OMKA 3ZY4A 3HM9A 3A6GA 1AQUA 1GPYA 2C4WA 1QHYA 1C1HA 2OV6A 3DC7A 1CR4A 1NHGA 3GN2A 3EBLA 2ZK7A 3PGKA 3HXQA 2ORVA 3S2SA 2C3OA 2DKOA 4ACBA 3BKXA 1P4GA 3FCOA 1O9BA 3GCXA 1KK3A 4YJHB 2KJQA 1A9YA 3KAJA 3HACA 4KPFC 2BGUA 4AMGA 3GVIA 5IBQA 3TVTA 2F43B 1HDGO 2G1JA 3KHUA 2B4QA 1BFUA 3OHSX 4HQLA 3D8NA 3WL8A 2IU0A 1T0PA 5G4LA 1PG0A 1WMBA 2GK3A 2ZE6A 3L05A 4UQLA 2OZPA 5GVSA 3EPJA 1IK4A 1K92A 5EJ7A 1OIXA 2GZRA 3JD4A 3PJEA 4M86A 3R7WA 5H3CA 1USUA 4L4UA 4J4TA 4Q3EA 1L5KA 1EK5A 1JKIA 3SYMA 4BNHA 2XNCA 1T15A 3F78A 3F6BX 3GB9A 2LW7A 4EG4A 2RGCA 4QU5A 1IXYA 3NPMA 1T2VA 1I80A 3KQQA 2Q4TA 3JQDA 3QX8A 4PM4A 5EESA 4FYWA 3BJEA 3KSDO 1JBQA 1Q2UA 1ZOLA 2NO4A 1DTWA 3B78A 3RARA 3ZI7A 3RUEA 4K0RA 1SUPA 3K8OE 2B78A 4AUNA 4GUDA 4AUEA 1NP6A 1Y5MA 2YWCA 1CS4C 4YT2A 3T7TA 1ULBA 4R2JA 4U9IS 1KDTA 1MENA 1FXUA 2D5IA 3G8BA 5A6VA 2YHUA 2QTCA 5ITSA 2QX7A 1PUJA 5FWDA 1D07A 4M9CA 1ELOA 4UUMA 1JHPA 2K2QB 2QX8A 3AK4A 4YRMA 2CMGA 2HXGA 2XBLA 4RY9A 1P4AA 3RC2A 1XYGA 2AQ8A 3P8ZA 1K8QA 5A2GA 4LC0A 2IHUA 4C0WA 5BOSB 4AQ7A 3JWPA 2HBQA 5FOTA 1AH2A 1AUQA 2P9GA 1JECA 4L95C 4J4HA 2C4HA 3SHOA 2CB0A 4DR4B 5ICMA 3PQ2A 2ZZKA 2O3SA 1E8DA 1T6ZA 1XQXA 3LPNA 4JKOA 2Y0DA 4DJDC 4EQ6A 3T1YB 4RS3A 3LHDA 4E0BA 1HQKA 2FRDA 1Y1PA 3H9QA 5AJVB 1ATZA 1C41A 3E9QA 2VK8A 1AV6A 2MWMA 5IDXA 3D6AA 1OVMA 2FWPA 4AX4A 1E0SA 3T3PB 2B7CA 4RVUA 5CJJA 2VDJA 5JQGA 2CV2A 3HL4A 4JQYA 2FZGA 3UTCA 4DA4A 4XWGA 2VJYA 1EQ2A 1LPBB 1MTZA 1U2GC 2IKQA 3R5XA 1ZIYA 2ZSAA 3FW1A 4FGUA 4L9RA 4CL3A 4LBZA 4D3XA 5BUSA 2IP2A 1FSPA 4KDEA 5KIAA 3VR6H 1J7JA 2Z6VA 1XHFA 4NCBA 1WSAA 2B3TA 2EEPA 1ZP6A 2DUJA 3H5WA 4LDNA 3CF4G 3SYRA 3N2YA 3WBFA 3WISA 1T4BA 2ZR9A 2VAPA 3NKVA 5AJTA 2JLUA 4X6UA 1F4LA 1RPAA 4NJEB 4ZREA 5SV2A 2ZJOA 1UXHA 2YNMC 5ADHA 1NI5A 4MDEA 4OB8A 2FX5A 2JBWA 2LKCA 3GPIA 4YC7A 2JAHA 1OZAA 2X4LA 4L51A 4MGKR 4AJEA 1R8QA 4AECA 2FSVA 3B9RA 4QZVA 1PJQA 1V47A 4E5MA 4M36A 3R0JA 4B6PA 1XRNA 4QICA 4ZN6A 5JJ5A 3C24A 3ETNA 3A6ZA 4GYKA 1M6VA 4YAJA 3V4FA 4FT4A 3WLQA 3HCWA 4QX6A 3I5YA 3UMRA 4HQRA 1FL9A 4R2LA 4XYGA 2DETA 2FUG6 4OUDB 3AIOA 1PFUA 1J0CA 3HB0A 4B4UA 2UYOA 5D87A 3W5DA 3RVNA 2HYDA 4AYTA 3GLGA 2AR0A 2H5JA 3QQ5A 1I7DA 4BMZA 1R5BA 3CVOA 1M76A 3DDWA 4YVFA 4BEVA 4FWBA 2G28A 4M1YA 1FTYA 1HE5A 1XTQA 4RTPA 3CX8A 2NXNA 1WMEA 2ACEA 2UUAB 4KV7A 3SHFA 2HIHA 1NAIA 3CUYA 4LDQA 3UXHA 1DMSA 1RLMA 4ZAGA 4LY6A 4LVCA 4IVNA 4JYCA 1U11A 3GLVA 3CUKA 2BGNA 2A5YB 2NWQA 5CW1A 5AI8A 5BQOA 2NQ2C 5TPWB 3T3DA 1EA5A 2L18A 5JMWA 1SXJA 2IGTA 3BXXA 3HEMA 4RVCA 4BQSA 3FYUB 2DX7A 3GRKA 4A8TA 2PE5A 4PS0A 1IBMB 1EAYA 4JA2A 1KK0A 3PQCA 3KQLA 3WYNA 4XA8A 4P82A 4A5SA 3QXJA 5AESA 3TINA 1Y3AA 5AKHA 1CJBA 1Z6XA 3HXTA 5JNRA 2VKQA 1NDUA 1RCTE 2H31A 2SHKA 1LZKA 2PYZA 2CXTA 3G2MA 4MW2A 3Q3VA 4ROTA 4RZSA 4OLAA 1T8YA 2ATCA 5KVCA 1YB1A 5ALVA 1J5EB 5AK6A 4TL9A 4OGGA 2OEPA 3RRFA 2COUA 1RWWA 2PG3A 4X1YB 4KITB 3SY8A 3ROMA 2FW8A 3OOEA 2G1KA 2WW8A 4EEXA 1E2UA 5KDDA 2Y9PB 3H9JA 4KVZA 5BO5A 3IHTA 1K6JA 1E3WB 1JN0A 1VRCA 1TFUA 1UMBA 2ZJ8A 4UBJA 4WERA 1PR9A 2WIBA