2IYNA

The co-factor-induced pre-active conformation in phob
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
119
structure length
110
Chain Sequence
RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGETGADDYITKPFSPKELVARIKAVMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Cofactor-Induced Pre-Active Conformation in Phob.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY PROTEIN PHOB
total genus 35
structure length 110
sequence length 119
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2iynA00
3JS5A 3LUAA 2RJNA 5HSGA 3QEMA 5TPZD 1LJLA 1YS6A 2RGYA 4PE5B 4ZJPA 2A9RA 4G0ZA 4KK3A 2HQRA 4UHKA 3SAJA 1C0EA 2X7XA 3L49A 4TLMB 1QQAA 1ZGGA 3KLNA 1JWLA 2PUAA 3T95A 2NT3A 2QW1A 4GNRA 4PZ0A 3G1WA 2CHEA 5DTEA 4MR8A 4KZKA 1Z25A 1ZN2A 2QR3A 4D6XA 3M9XA 4Y9TA 2FMFA 1BVHA 4WXMA 4QYWA 2GI4A 3MMNA 2FQWA 4KQ9A 4JASB 4MR9A 2M98A 1E6KA 1BA2A 1FQWA 2YHAA 3GA5A 4RKQA 4ETMA 4JB2A 3RVNA 1USGA 1XHFA 4KREA 3DGFC 2PAFA 3FFWA 1MAVA 3LKVA 4KRFA 1LBIA 4H3HB 4DN6A 2WRZA 1JYFA 1ZHHA 3HDGA 2GWRA 5JNSA 1QO0A 3KKEA 4NICA 4XAQA 5KC8A 1GUDA 5BR1A 4RDCA 3H5LA 1PHRA 2HSGA 3A0RB 3GYBA 2FKAA 2IKSA 4TN5A 3N0XA 4DQDA 3UUGA 1YK1A 4YGXB 1Y1LA 3JVIA 3LUFA 5HQJA 2QVCA 5DCLA 5BRJA 1CEYA 3O2SB 3CRNA 3IPCA 4LX8A 1TJYA 1NATA 4MS1A 2QXYA 3LTEA 2QZJA 4IMIB 3Q15C 1U04A 4YP9A 2FLWA 4KNYA 4Q7EA 4Z4IA 1DCFA 2XDYA 3MYYA 2LPMA 4D6YA 3OQNA 3FGZA 3KYIB 5KQLA 3CFYA 3BRQA 1ABEA 4EY3A 4Z4GA 3BILA 1HEYA 3K4HA 2MYPA 3HSYA 4IGAA 3QEMB 3FFXA 5IUJC 1RXIA 2B1JA 3O1HB 4G86A 2F8TA 2PL1A 3NHZA 4NQRA 4QPJC 4RK0A 4WXEA 5IC5A 5GOTA 1TM2A 5KI6A 2LIVA 2LUOA 3H1GA 1A0OA 4ETNA 5JNUA 2E4VA 4MS3A 1ABFA 1D5WA 5GQSA 3UK0A 3DLHA 3ILHA 1DC7A 2FMKA 3E3MA 3IP6A 3HV2A 4MLDA 3CZ5A 2WMYA 4Q6WA 5IEBA 3T6KA 1EFAA 3OO0A 2JVJA 2NUBA 4YWHA 5DKFA 2PUEA 1RZRA 1ZITA 1E6LA 3Q9SA 4Z4EA 2CWDA 4IF4A 2R25B 3H5IA 3LUCA 4EVRA 4FE7A 1FSPA 4PYRA 3CZCA 1NXPA 3QX9A 4TLLB 1L5ZA 4L4UA 5FWXA 3VNBA 5TPWA 3ILYA 1EWKA 1JX6A 1DZ3A 5ED4A 3EGCA 5JS1A 3C6QA 3O75A 1KMIY 3O21A 4HNQA 4ZPJA 1P8AA 3SY8A 1GCAA 2CHFA 4LRQA 3I5AA 2PUGA 3MM4A 4IILA 4JAVC 2F8SA 4HNRA 2A9PA 1JF8A 1F51E 5TQ0B 2L18A 5DGCA 2MYNA 2QVGA 5D2CA 3OM1A 3M9WA 4KQCA 3CKMA 3HO1A 2E4WA 2PLNA 4RSMA 2ZAYA 4P98A 5EWJB 2JB9A 2MSKA 1ZH2A 3KJXA 4H60A 4MR7A 5E3JA 2AYXA 2H0AA 1P2FA 4ZMRA 3GWGA 1ISSA 1S8NA 4OATA 3HK2A 3MA0A 3H75A 3LFTA 4FE4A 4KV7A 4RXMA 3Q7SA 5JNTA 1VRVA 4TMYA 2IOYA 3LUJA 1OXKB 3BREA 1PEAA 2OQRA 4E7OA 1P6QA 4XLTA 1VKRA 1ZESA 6CHYA 5CHYA 4OTZA 1SD5A 4OG2A 9ABPA 3GL9A 4B09A 1BDJA 1K68A 1DC8A 3KCNA 5JNVA 1FFSA 2PUFA 1LBHA 2E4UA 1F4VA 1EHCA 3Q7TA 4W5NA 3JTEA 1GLGA 5IULC 4KVFA 5KQGA 1PNRA 2NZVG 4O5AA 3TO5A 1NXVA 1M2EA 3KSMA 3QK7A 1NY5A 3G85A 3QLUA 5CNKA 3DBIA 4RK6A 5KWSA 1BAPA 1QPZA 3QLUC 1KRWA 4KFCA 4IRXA 4M88A 3KTOA 3EULA 1NXWA 2N9UA 1USIA 4F11A 2MYTA 4NV3A 2FTKE 2JCGA 3CHYA 2H3HA 5TPWB 3HJFA 1QKKA 2PUBA 1Z2EA 3CNBA 3OMWA 4H3KB 5KQPA 2V0NA 1DCMA 4DADA 1J56A 1OXBB 3F73A 3F7NA 2VUHB 3N75A 1QP7A 1D1QA 3RVSA 3CG4A 4G97A 1DBPA 3O74A 4WT7A 2E4ZA 3RVJA 2RDMA 3FFTA 3TMYA 1URPA 4MS1B 4CBVA 1DP4A 4N0PA 2R4QA 1ZAYA 3SNKA 1H9CA 5ABPA 3HS3A 3R0JA 4W5QA 1DBWA 1DRKA 2GBPA 4RV5A 3JY6A 4QICA 1YMVA 4RWEA 4JOQA 4L85A 3N8IA 4Z99A 1USKA 1T34A 5T7BA 5FBKA 2L2QA 3MF4A 2VUIB 2MSLA 2HQBA 3IDOA 1JHZA 3H6HA 5KC9A 1ZY2A 3H5OA 3LUKA 1MB3A 4HYEA 5FBHA 1KRXA 2FEPA 1BDIA 2JBAA 4N41A 3HXMA 1FFGA 3LUGA 1MIHA 3QX8A 4KMRA 1R8JA 3HDVA 1JH9A 1U2PA 4EYOA 1FFWA 1SRRA 3NHMA 2FQXA 2WWVD 3RVLA 2VYCA 4OLBA 3H5VA 3EODA 1RXEA 2LP4Y 4RS3A 1JFTA 1BDHA 5TQ0A 4Z4HA 1JBEA 3KLOA 1U2QA 4G0XA 1TLFA 3K9CA 4P1ZA 4O1HA 1U8TA 3OLXA 1M5UA 1AB6A 2JBAB 4EYQA 1E6MA 4Z4FA 4F3TA 3Q41A 4LZLA 1JYEA 2W42A 5JNWA 1DJMA 2ID7A 4OLAA 3H5TA 3F6PA 1JL3A 3NNNA 4QYMA 1XWWA 1SXGA 3EQZA 3I09A 1JLKA 1VLZA 3C3KA 4YLEA 2FEKA 1UDRA 4MS4A 4RXUA 5BRAA 3RVPA 5KQMA 3T38A 2JVKA 3HVRA 3EDCA 3HUTA 5IEJA 5TQ2B 3NNSA 1ZVVA 3W9SA 1A2OA 1JFVA 2RJOA 1PEYA 3MQ4A 4RK5A 2B4AA 2QU7A 4MR9B 4UHJA 3T8YA 4E7PA 1NXSA 3OQOA 3N0RA 3O1JC 1NXXA 8ABPA 3OLYA 3LMKA 1C4WA 3OMXA 5TQ2A 2FXIA 5F64A 1AB5A 1Z15A 4EYGA 2PUCA 3QELB 3Q7RA 1QP0A 4MRMB 2ZWMA 3BRSA 4MPTA 5BQ3A 4YO7A 1TMYA 4N47A 3OLZA 4NCAA 4N03A 1B00A 1A04A 4MRMA 5T3YA 1KGSA 4XFKA 3D8UA 3MIZA 5DLEA 1M2FA 1TVMA 4G0OA 4RK7A 4JB0A 2BGGA 3S99A 3EJWA 2QV0A 3FDFA 5EWJA 4Z0NA 3GV0A 1DBQA 1QQBA 2WJAA 2IPNA 1EWVA 3JVDA 4NCBA 3RVQA 3URMA 2PL9A 3HZHA 2PUDA 1DG9A 3P9YA 3H6GA 4KK4A 1E2BA 4EGSA 1W25A 2YHBA 4YR7A 4EVQA 1LJUA 4RK1A 4WZZA 4MYRA 2PJUA 1Z26A 1LK0A 2FEWB 3C97A 3DZDA 3JPWA 5C5EA 1I3CA 4F06A 3E61A 2WY2D 1JFSA 1MB0A 2E4YA 5EWLA 1YIOA 4F8JA 3HEBA 1DCKA 1RNLA 1Z13A 2FN9A 2ID9A 1QMPA 3QELA 3QLVA 3N6VA 1ZH4A 3CG0A 1MVOA 3C3WA 3F6CA 2I6FA 3OQMA 4LE0A 3H5WA 1Z2DA 3A10A 4MR7B 3QEKA 3TD9A 3LKBA 4W5TA 4LDAA 1CHNA 2FMIA 1QO0D 4ML3A 4MQFB 5TQJA 3SM9A 3UKJA 2E4XA 1XHEA 2IDMA 4Z4CA 2P4UA 2IPAB 2NZUG 2Q5CA 3KG2A 2FLKA 4IMJB 4RXTA 5TE9A 3GRCA 2NT4A 4MR8B 2VK2A 3RVRA 5TPZA 3GBPA 4MQFA 3IP5A 3A0UA 4YCSA 4RY8A 2WJWA 1ISRA 2R47A 2HQOA 4RKRA 2PKXA 1CYEA 4JP1A 4N0QA 3TB6A 2J48A 3GT7A 4MS4B 2MYUA 1W9HA 4RK4A 2PE5A 3ROFA 1GCGA 3BBLA 5EWLB 3O1IC 4RY9A 3CU5A 5IUKC 3KYJB 1EAYA 4LE1A 1SXHA 2HJ9A 2JVIA 4G0MA 5FWYB 4EUKA 1D1PA 2IPMA 4MGEA 5JS2A 4MQEA 4F12A 4YS6A 2M1ZA 2OENG 3M6MD 3OO1A 2JRLA 1QP4A 3QLTA 4Z9BA 1Z16A 2FW0A 3HCWA 5IUNC 5PNTA 2A9OA 1NXTA 1P6UA 5IBQA 2IYNA 1ZDMA 1D4ZA 1NTRA 3N53A 3SQNA 3LUHA 3C3MA 4WUTA 1JDNA 3DGEC 3JPYA 3DLBA 4RY0A 5HKOA 3KS9A 4Q6BA 4FB4A 1D2AA 4N76A 4LE2A 3O2QB 1YMUA 5CNMA 3D02A 4RU1A 4G0QA 3EQ2A 4XASA 2FN8A 3RVMA 4KPYA 2HPHA 4Z9AA 4S05A 4ZMSA 1APBA 3O2JA 2R48A 2O20A 5FWYA 3IPAA 1RZRD 1L5YA 1Z12A 2L19A 5CNJA 2KYRA 1DRJA 2MSWA 5FWXB 4YV7A 3IP7A 2GX6A 4MAAA 4LDZA 3FMVA 2L17A 4ETIA 2P9HA 4G0PA 3CLKA 3QLVC 1YS7A 5C5CA 1YTUA 4PEVA 1M5TA 1GUBA 2QSJA 1IIBA 2WB4A 3B2NA 1NXOA 3RQIA 3LOPA 1U0SY 2CD7A 3RVOA 3KHTA 4JA2A 2IPLA 3NBMA 4MS3B 2PMCA 3OLVA 2DRIA 3IP9A 2JK1A 4MLCA 5JNRA 2FSPA 4EVSA 4MQEB 3OLWA 5B3JA 4EYKA 3EAFA 4S04A 1WETA 1Z17A 5I4CA 1PNTA 4WWHA 4O1IA 4OBBA 1Z18A 7ABPA 3TX6A 4W5RA 3I42A 1QNLA 4GPAA 3CTPA 4RZSA 5HM6A 1K66A 2GKGA 2FQYA 3RVKA 4HNSA 1YVUA 4D74A 4ZYLA 3HUUA 6ABPA 1YK0A 5EWMA 1JDPA 1PUXA 3RH0A 4PICA 5IX8A 3HM9A 3SG0A 1ZGZA 2AYZA 3A3KA 3H1EA 4W5OA 3L6UA 3NNDA 4XXHA 3LUDA 3OM0A 5B3JC 1SXIA 5EWMB 3H1FA 3ROTA 3GBVA 2FVYA 2FMHA 2TMYA 2LBPA 2A9QA 3CS3A 3I45A 4G0YA 1RPJA 4XARA 5CNIA 3N0WA 3VNAA 4YRZA 1VPWA 1EWTA
chains in the Genus database with same CATH superfamily
3IV7A 4G9GA 1PSWA 2XCSB 1QH0A 4DDVA 2RJNA 3FOAA 3ZNPA 3E15A 1FP7A 4RTRA 3T9BA 2ATEA 4H7FA 4C4SA 3MQ2A 3MJHA 3BD9A 5ALMA 3D6VA 5LXTA 2ZUFA 2JKVA 3HA5A 3PFGA 3SAJA 4BP9A 2XZOA 3EQ8A 3U60B 2ZXFA 4PZ0A 4ZJUA 7GPBA 3TGLA 4NV0A 3UNXA 2Q6LA 3V5NA 2CWWA 4NYIQ 2JIOA 3AEKB 1UBSB 5DTEA 4Y6RA 2HMTA 2H4FA 3BERA 3TZEA 3S2ZA 2C5SA 1JXQA 2Y3IA 5T67A 1KH1A 4H59A 3JQ9C 3EVGA 1G7CA 2AR7A 1G4AE 4M21A 3PJGA 1XZLA 4QREA 5AHKA 3IOCA 3CZRA 3Q3HA 1YC5A 5EIWA 4DANA 4ODIA 5FQOA 4YRGA 3EX7C 3COPA 1PJQA 4LDRA 1TZ2A 3M3HA 2NN3C 1N1MA 2ZJOA 3A1FA 2Z4RA 3B78A 4KMOA 4NAHA 4UEQA 4I9GA 4YYZA 4B8WA 2XYVA 1DUVG 1IQPA 2FWPA 1QO0A 4NICA 5D3QA 4DQXA 5LZ8A 5JWOA 4WTOA 4XEUA 2PX6A 4R5HA 2H1HA 1YT5A 4X1IA 1SCUA 1N6HA 1GARA 1T29A 2NVWA 3INGA 5ALTA 3RFUA 3ZQKA 1FMFA 1MIOA 1GKUB 2EW2A 3SBOA 1OVGA 1Y3IA 4GG1A 1O5TA 4OLJA 1HLDA 1MJNA 3ERCA 4DLRA 3IE0A 2P2DA 1Z62A 3P9IA 1YKFA 5DK4A 5FI0B 3NUGA 5F78A 3PIRA 5F3RA 3TNJA 1Z9BA 3HA2A 3IIKA 1U3FA 1VIYA 4MUYA 1M5RA 4BMYA 4P4GA 1NURA 2GOYA 2GT1A 3QNMA 4Q21A 1HF3A 1CJKC 4CL3A 5ERYA 4PU0A 3QMWA 3D4PA 4BWYA 5BUSA 3BULA 5IKOA 1WXFA 5JI3E 1H3NA 2Q2NA 3GGOA 4P5PA 1OYVA 1WSBA 2C9CA 4ESEA 3QEMB 1YDGA 2CF6A 4J6FA 2QLTA 4P4TA 5J4VA 1WAMA 2ZBPA 3LLMA 3R3HA 4Q24A 4URYR 4ZT4A 4ZA2A 1EK2A 1SUWA 1NPTO 4PWYA 4OGLA 4MW5A 5IC5A 3G1TA 4BQPA 4UAVA 1EXMA 4JNCA 4CF7A 1F20A 1V26A 5JV5A 2HD4A 4RVNA 2ABWA 3WLEA 1HV8A 1DAGA 1UUFA 1H2XA 2MMGA 1MDFA 2DTXA 3F2VA 3HRKA 1QKJA 2JANA 3ZGYA 3K0SA 2LNDA 4GMKA 1P3Y1 1NLYA 2DUMA 2WVGA 2LXNA 3KYCA 3H7AA 4Q1VA 4QX6A 1CZKA 2B9EA 2CXNA 4GU5A 1E3MA 2HHJA 3M6AA 1GNPA 5JQGF 1PZXA 1RJ9A 3JVUA 4Z2YA 3IBTA 3WJAA 3KJZA 3QTBA 3CZCA 4IWNA 4X1IB 4UATA 5B2EA 3GJTA 1FE8A 2MT9A 3DHNA 1EQUA 2R5WA 3MAAC 3NHRA 4O63O 5EQFA 1U4NA 5TPWA 1W5BA 4BPRA 5FNVB 3VV2A 5DRYA 2V7EA 4ZGGA 3BEOA 2BM8A 3K5WA 3FYTA 4MUAA 1AGNA 1RR6A 3OE1A 4LHXA 5A4MS 4AY3A 2R96A 2B4RO 4Q7KA 4A2WA 2Q4DA 1UXKA 1VPVA 2JJ2A 2JHPA 2P9ZA 4UFPA 5FTKA 3ZHUA 5JG7A 3GMTA 3AKCA 4GP9A 1YRAA 4ICIA 4BU1A 3C7CB 3AVUA 1I33A 1YMQA 3OECA 3H18A 1K5HA 4HSGA 4K3UA 1MLDA 1WCWA 2DUJA 1E4EB 2PNFA 4P53A 3GEGA 1GZ5A 3OCCA 3G59A 3WJ7A 4LNHA 2P11A 3UUEA 4DA8A 4M7WA 5E3JA 1XAJA 3ZG6A 1X74A 2WE8A 4MP3A 1O94A 1Z3CA 3A3YA 5TT1A 4BB0A 5MN4A 3OE5A 4OJQA 2DFDA 3TSCA 1CW2B 1KVTA 2WICA 5CT6A 1VRVA 2ZPUA 2YQ4A 3QHQA 5KKNB 1P3JA 3WYEA 1XL1A 1MAAA 2XNDA 5T64A 1KXJA 4S0ZA 4XQCA 4B35A 2ONJA 4BP3A 4HDMB 4AUNA 3K70B 1H4SA 4NVRA 1Z6QA 2DWPA 5IZCA 1WXQA 2JGNA 1H8EA 1DC8A 3FCAA 1FFSA 3I5MA 5BYKA 1AGYA 4TN1A 5CFQA 1KOJA 2C61A 5EJ7A 2O8BA 3CNHA 4J76A 1EHCA 2XSZA 1V7QA 2YNMA 2B92A 1DJLA 1E2MA 2JGJA 3G8AA 2F4NA 2H29A 1EGMB 3DF7A 2PWBA 4M87A 3MWGA 1M2EA 1WP4A 3QK7A 2VHWA 4GF5A 2V03A 3SEZA 1KQ3A 1MCZA 2BCJQ 2NU6A 2PMKA 4IWXA 3DBIA 1CVIA 1NF9A 3UV3A 3NC4A 2OZVA 4L5AA 2J32A 2F3PA 3FOCA 3LECA 3HB0A 3SC6A 4TWAA 1JJBA 3W2EA 4BO7A 1Y9EA 2Z04A 3E2MA 5DXFA 3EZLA 2DGDA 5C8YF 1ODIA 3MB5A 3U16A 2B83A 3T9DA 2PY6A 3AR5A 2R7MA 1FY2A 1E2IA 3JYLA 1EFKA 1E9VA 3FA2A 2B4YA 4G9EA 4NKRA 5KNBD 3OSZA 3PXBA 4JT4A 2B6NA 2A1TR 3KM0A 2UYQA 2ERYA 3GR6A 4L4XA 3URKA 4JEUA 3AB7A 4M1TA 4Y98A 4M7RA 5KOYA 1FYVA 2DBYA 3F3MA 1PZHA 2PQMA 3PVCA 4H6PA 4LJLA 5EIBC 1QP7A 1LJ8A 5EZ6B 3REGA 3KKNA 4WCDA 4ALKA 5IDWA 1MO4A 3LFUA 1U9JA 2WFLB 1W96A 3CQ9A 3ZGLA 4D0LB 4CBVA 3GAAA 5A5EA 3DH0A 1E6WA 4LI3X 5CK4A 1C9KA 1AK2A 3K0BA 5I9SA 4M98A 4EA9A 4FKBA 4NXMB 1FRZA 3MFQA 2CVZA 4J7XA 3SVZA 3JY6A 2FPIB 2ZBQA 3C8DA 3GLKA 2B5WA 2C2WA 3T52A 5TR9A 2B2CA 5ALKA 3RUHA 2QTVB 2ISSD 4LOHA 4Y6QA 1RBQA 2CK3D 3ZJ4A 5KYGA 4DLBA 2A88A 3FVVA 3TTVA 4G4JA 3I0MA 1OFIA 2YFHA 4GQAA 3DLTA 3GIDA 4C29A 3TDNA 2IKQA 4OL9A 1LLQA 2J07A 3E9QA 1DO0A 4TZKA 5LP6F 3LUKA 2CDCA 4TKZA 1KRXA 3STYA 1CQIA 1V1JA 2FEPA 3QITA 5BQPA 4NBWA 2WMNB 1M76A 3A1TA 5HOQA 4JBGA 5GOZA 3DFFA 4WESA 1JH9A 1BS9A 3F7OA 3WB0A 4BC0A 4F4CA 3H9JA 3U13A 3RVLA 1U8ZA 4G81A 1BDHA 1KK1A 2BZGA 1JEJA 1D0VA 3OAAD 4R2JA 4WE3A 1FX0B 3AM1A 4MGHA 2YIJA 2C4VA 1XALA 4P1ZA 2IA5A 1JLLB 2HK7A 2VUTA 5E6SA 5J3JA 4J3FA 2XXJA 3I1IA 3DO8A 1Z8FA 2I29A 3G2LA 2FPXA 1JL3A 2I4MA 4GKBA 1Z4LA 1Z38A 2GN4A 5C1BA 2GKSA 3DAYA 1VE1A 3C3KA 2YC2C 2ODPA 1LQTA 4FDTA 4EVIA 2YDYA 5A04A 1QDEA 1NOKA 2RARA 2F1RA 2QMEA 2R84A 1FNMA 2XVZA 1RKQA 4XX0B 3RDPA 1SEVA 3PLNA 2XIJA 2OR3A 3CA8A 3QYJA 4ND8A 3O03A 4D46A 1AOXA 5DNWA 2C2ZA 3UMSA 4E2FA 1EG7A 3LPCA 3H2BA 1ZVVA 1EFVB 4N7JA 2XRMA 3BE6A 1XNHA 5AKYA 1IDOA 3OQOA 2CXOA 2C3PA 3JVVA 3PHBE 4QXMA 4DY6A 1BGXT 3OLYA 4GZ5A 1N9GB 1AXEA 1JA0A 1EP3B 2YZNA 2D8MA 1SJ9A 4AO7A 4YMTA 2W98A 3I2KA 3KYDB 2W22A 3D8BA 1BCRA 3UH0A 5ITZA 1AX9A 5EERA 2PTGA 3NHAA 1JKJB 2FFRA 3DC7A 2XCTB 4LF4B 3P4XA 4MYTA 5IH7A 1HG0A 4MPDA 4TLEA 4AKGA 3IQHX 2C9MA 5AXAA 2JAUA 3LQ2A 1B00A 3I34X 2HFKA 2MIIA 1GPH1 4HI0E 1KGSA 3RSHA 2Q8NA 3KAKA 2XD4A 1RLMA 4RF4A 3RAFC 2B2XA 2CVFA 2AOTA 2PKQP 4IIXA 1W49A 3WBBA 1X14A 4QZVA 1F0NA 1LKZA 5U4XA 1HE3A 4D9CA 4IPTA 3T3OA 1H5UA 1MGPA 2GCEA 3LC7O 1JEQB 4IDDA 4M22A 3HUEA 4MVJA 4XIFA 3RNOA 3CR7A 1TKRA 1PR9A 2J0EA 4GBJA 2JLCA 3N2YA 3TZBA 4QT4A 3G9XA 3HKBB 1UPUA 1XZQA 2Q9CA 3ITEA 5JMPA 1S4MA 3W6ZA 3FIJA 1J21A 2E3JA 3UWPA 4TS1A 5DISB 4EPTA 3H4VA 1TA0A 4J0CA 4PS0A 4QWWA 5E1BA 1J8VA 1FPMA 2WHEA 1J2YA 1DTWB 2ECQA 1RM4A 1TCVA 3NHLA 2YXEA 2PNJA 1FNSA 1DKPA 2I67A 2PJUA 3HI4A 1E4OA 1LK0A 1U8CB 3B60A 3PEEA 4L8FA 4Y9UA 3NCTA 2N47A 2QTWB 4L7QA 1I1OA 2IODA 3KC2A 2QN2A 5EVJA 3WJ2A 1HRKA 4ED9A 1GVNB 3WOVA 5C0OE 4F8JA 3QELA 5F1KA 4N12A 1ZM9A 1GAQA 1XU9A 2QXTA 2Z0MA 3P7MA 3AI2A 2W2LD 3TSZA 4AJLA 4XWYA 3GH1A 3M9LA 4CLEA 4GGMX 2OV2A 4MR7B 3QEKA 4CMIA 4W5TA 3GA0A 2GN0A 1P1JA 1RWVA 4PZZA 2COKA 3NG1A 3IALA 1IUKA 1Z2OX 1TADA 3MGGA 1IOZA 1XGKA 2IBMA 3VKHA 4NPAA 5HIJA 4FUQA 2FP4B 2D7CA 3BHMA 5F33A 3EIHA 4HRVA 1N2XA 2NT4A 4G01B 4RFSA 4ATNA 4MQFA 1XX6A 3IEIA 3DVAB 2R8XA 3GCXA 2RGNA 5ALEA 4JN6B 3OPYI 2ODEA 1KQFA 2J31A 4D4LA 4B7UA 4BY9E 2GRAA 3TB6A 2WQ6A 5DHSA 1PFVA 2Y6UA 3E22A 1V8OA 3QBEA 5DHPA 3PYLA 2SKEA 3CX6A 4Z9FA 3ROFA 1L7NA 1YI0A 3S4YA 1SBNE 5DSZA 1SQSA 1ZXXA 4FFVA 5IUKC 2I2WA 1NW7A 2HO5A 4GC9A 4YFYA 4JU9A 3RE1A 5C2JB 5LQJA 3AW9A 4B7CA 1E2HA 3GLIA 1N9ZA 1G1AA 3NKFA 3PGXA 1UKZA 2PH7A 2EKPA 4WXRA 2OGWA 1MGOA 3PUWA 2JGMA 3WLLA 4H3VA 4QNMA 3OJ0A 3JD2A 3ZR4B 2GHTA 3DEYX 2WQZA 4KN5A 3N53A 2QENA 4TYMA 1O9GA 5JTTA 1KZ4A 4UW9A 3PV0A 1RTKA 1HC7A 3TW6A 3C39A 4BASA 1PFQA 4WDRA 3NKVA 4B9EA 2ODNA 4JITA 1DSSG 1E7YA 2Z6VA 4TRMA 4BMVA 3TDKA 2CXHA 1W5TA 4HBGA 1ZEJA 1A4RA 2WVJA 1POXA 3V2GA 3VC2A 3IP8A 4NCKA 1GR1A 1XLUA 1SQ5A 1NVEA 2PD6A 3EEYA 4JUBA 2HBZA 1XL0A 2C57A 1CDZA 2ZUTA 1PZEA 2BVNA 4BP8A 1VDMA 3BIXA 4KLRA 4MI6A 1SCKA 2CBZA 2HDWA 3JARA 3KR2A 5UKDA 5KNCH 3HU5A 1MX1A 2WUGA 4MWOA 5WRFA 4A8JB 4FOOA 2XMCA 4ROTA 1RZUA 5EIFA 3VC7A 3ZKWA 1XCPA 1H2YA 2IELA 3NTXA 3FPHA 3PFFA 4W5JA 4KPFC 3DUWA 2ZIZA 4FJ0A 4PGMA 4QT0A 1XJWA 4INJA 3A4MA 2DUNA 2A86A 2AOVA 2XMRA 3FUVA 2OMEA 2JI6A 1KYZA 2IHUA 2YJ3A 3QX3A 4WADA 4KUGA 4BS9A 3BL5A 2VDMB 4JI7B 5T5QA 2CKMA 3K0CA 4X63A 4UCQA 1UFQA 4NOKA 1LRKA 1GPAA 4ZCIA 2G88A 1T2AA 1FVHA 2PVPA 2IXGA 1M3SA 2H2FA 4PNZA 1Y89A 3DS8A 3TIGA 5THXA 4AY4A 3F8TA 2GXAA 2I2DA 2XE7A 3GVCA 4L72A 1Q20A 1JIIA 1DCTA 2JIDA 1QV9A 2XDQA 3GG2A 1LQ2A 2FDRA 3NB0A 1DL5A 3WWPA 2B8JA 3W9UA 2GF0A 1XWFA 1ULZA 3Q7QA 2XB9A 3L41A 1GN9A 3QHAA 4DT1B 5F7OA 2GKGA 2VC2B 1D6MA 3UWKA 3H6KA 1B76A 3ZCSA 4ZIRB 1QM5A 1CF4A 4HAIA 2EV9A 2V4ZA 5F5LA 3CVJA 4D74A 5LIPA 1MHTA 1YK0A 3C8ZA 3QE9Y 1E1CB 2I6SA 4K28A 2JIQA 1SN7A 2Z83A 4F5DA 3WA7A 3C4JA 5AKLA 1F06A 4OQZA 2HYDA 3DEIA 1ZW6A 1WSAA 2IX3A 3D0RA 2Y0DA 3GRRA 4BO3A 10MHA 4IYJA 5L95A 3NFRA 4QQ8A 4DBVO 2I6QA 3CH6A 4X54A 5JO9A 5E2BA 2M6RA 2YXPX 2EQ5A 4NZMA 3QH4A 1V96A 1CRLA 4FFBA 4S24A 4UM8B 5JH7F 1YHNA 2RGNC 4HB2A 5CNIA 3C5HA 2BYTA 1EWTA 1J9ZA 1DEOA 1N2CE 2HXGA 4ENRA 3BGIA 2C4TA 4INAA 1G66A 3K1JA 1VHLA 1ZUNA 2ZQZA 1IU9A 1EFLA 2RGDA 2NSYA 4EAAA 2H8KA 1FL9A 1RADA 1AKNA 3CLTC 1AHPA 2CXTA 5K6AA 4PZDA 4B2LA 5HA5A 2C1EA 1WZEA 1DJQA 2GYWA 3RU3A 1CX9B 4DS3A 1X0XA 3M49A 2X3YA 5TGZA 1GQOA 4CWAA 2R1VA 1DVRA 5ERXA 1VCMA 4UREA 2RK4A 3KBOA 1FS6A 3PYMA 4NJMB 4JLUA 4Q3EA 5AVVA 2DOKA 2FAXA 2YJNA 1ESMA 5AM5A 2R751 3AGQA 4YCAA 3EMBA 1DX4A 1JDBC 2NO7A 4JX8A 3QQPA 3TPFA 2IYQA 1HFEL 2WIBA 1OTYA 3DCYA 1JEYB 1E5DA 2JHFA 3FX2A 2JNWA 4HT3B 1Y48E 1M2OB 3NVDA 2H54A 3QTLA 5BNIA 3VKFA 3FFWA 4DNXA 1AZTA 3O7WA 3EYWA 3BJIC 1DAPA 5DPMA 5IDQA 1UFRA 1S8FA 1NJFA 1MAHA 1E1DA 2A1UB 1JMYA 2OC4A 3PR2B 1DJPA 4YACA 3N2NA 4L4YA 5HZHA 4C5BA 1BX0A 1VI6A 4RKEA 3VR3A 3HDHA 4WAUA 5FTMA 1KF0A 2BZSA 3L7DA 4YVFA 2VHYA 5EHIA 3M5CA 2EZ9A 4PAGA 2G77B 2J9YB 2QW8A 2R1TB 2PSFA 5EZ5A 4RTQA 3WWZA 2PSDA 1J70A 4NV1A 1T1SA 4LX8A 4X7MA 1TJYA 1NATA 3BSWA 3QKRA 1R16A 1EVYA 4DR5B 2NXJA 5KU7A 2VYNA 3LCRA 4OOEA 2DHRA 3DO6A 4MVJF 2VRCD 5G0UA 1FVFA 2BFCA 3MYYA 2RHGB 3A06A 2COUA 3OSUA 2GF2A 4L8LA 4TRRA 4F6LA 5LQAA 2J3EA 5ES3A 2XUDA 4DLTA 5L7TA 3SBDA 5DCYA 3BRQA 3L43A 4XRRA 4DCMA 1NUTA 3BFJA 2Q0SA 1ZD1A 5BV7A 2HQSA 3CPJB 4JMPA 5GM1A 4XVHA 3ZXSA 1QWSA 3MSCA 3OUTA 3Q3GE 4DXHA 5IN4A 2MSCB 1DWUA 4IGAA 1FB5A 4Y0VA 5H3CA 5K2OA 5CX4A 3L04A 4KXUA 1E62A 3NQ41 1NZFA 2BF4A 4CKXA 2HU2A 1JGTA 3DKKA 3FY4A 3V7UA 3ZWWA 4F4UA 2VF4X 5KOJB 2G9RA 2J4FA 1U8XX 2BZ0A 3HY6A 3FAZA 1H2RS 3DDWA 4FYWA 3N58A 4DC9A 2R85A 5GQSA 1OLSB 4RX1A 3GRFA 5CUQA 3UMGA 1WPRA 5JC8A 5LM3A 1D03A 4J0IA 3AKZA 2GJ4A 2GM5A 4MLDA 4CUZA 4XVCA 3PDIA 5CA0B 1T5TA 2P75A 4UTRA 3ICVA 1JJIA 3TRJA 3VQTA 1QE5A 3OO0A 3FNBA 4F21A 4F3KA 3R7WB 4GYKA 4RGQA 2O2DA 2YHIA 3GRZA 4HTFA 2W2OA 1WMSA 3B8EA 3ZDFA 3STWA 3MBIA 3CCFA 3ITNA 3PFIA 5EL0A 2R25B 2PKQO 3HPRA 2DU8A 4OJTA 3K16A 1M2VB 1G6OA 2G83A 4KX3A 1ODCA 3SQOA 5JT1A 1M2WA 4X85A 3WDKA 3OX2A 4QBTA 2P90A 1E1QA 5DF1A 1TIBA 2NYVA 2AR0A 2AMLA 1Q1BA 3ZW8A 1O0SA 3IJRA 1TU4A 4LJ7A 4UPVA 3V4SA 2NP7A 4PRZA 1XF1A 1J0BA 1QHIA 2R8PA 3A11A 3U7HB 1P8AA 1UZNA 4O4LF 3SYRA 1VKHA 1JV2B 3KXIA 4RD6A 1R4MB 3LWZA 1IVNA 2VQDA 1S3IA 3CRQA 3EY4A 1V11B 3FNFA 4DYVA 1QGAA 3CRRA 4X8MA 2AVDA 5TQ0B 3UTDA 1UADA 5DGCA 2MCFA 3TR0A 4AG5A 2R6CA 3DEFA 1WTCA 4KQ2A 4UBOA 4X41A 4G4IA 3ADCA 3CKMA 1WX1A 5EWJB 4HNVA 1SKBA 2PVSA 1V11A 2JB9A 3DEAA 4DJEC 4PX2A 5J47A 4KOAA 3U4QB 2AIRA 3HFSA 4HLCA 2PSHA 3W9BA 1NYTA 4RHXA 1U2EA 4NYMQ 4B6OA 3M1IA 4KNWA 1XZMA 4LSMA 3UKOA 1QWOA 1NVKA 2DETA 1NW8A 4MX8A 5FI3A 2IHNA 2PKEA 2O4UX 4ZEXA 2HLNA 2UZ0A 3S7ZA 1CY2A 3JQBA 1LX6A 2FMTA 4FIDA 3I72A 3VNVA 2ANBA 5CHYA 3QJ5A 4AQ7A 3UJ9A 2QP4A 2YW2A 5FPTA 3TX2A 2R6JA 1U0JA 4J3JA 1K68A 3H2HA 2IY9A 4WMLA 1NP7A 5JNVA 3W8RA 1PFUA 2FSSA 1W1WA 2HJGA 2X9VA 4KG7A 3DNPA 3JTMA 4UHHA 4TWRA 2SKDA 1T2NA 3Q3EA 4CIDA 2HLDD 4NU5A 5AOVA 1XXHB 3ENZA 1LK7A 4C6TB 1CUBA 1GQRA 2C3MA 4B79A 2PL5A 3IXLA 2O1SA 3ISVA 4NU0A 1QONA 3UMJA 4EZIA 1A5AB 2PYZA 1NGSA 1X7YA 1CY1A 1GZ3A 3IP1A 4MGKR 3M6LA 4P3XA 2N9UA 2QYOA 1QIMA 1DDOA 2H2DA 1VOTA 4MUFA 1VFNA 3KELA 5AKHA 1KZHA 2H9IA 1P0CA 2FX2A 4B6QA 5GTDA 1Z5ZA 4PV7A 1UBMS 5T4EA 2WUFA 1M74A 2NAFA 3OPYA 1E99A 2O8FB 1MW8X 3ITDA 3OIUA 2PKYX 3EARA 2OMKA 4JSRA 3MTDA 1JIXA 4RNCA 4XQEA 5C3MA 3DZGA 2DQ4A 4A8PA 4LN1A 2VDLB 5IJ0B 2VWPA 2CZCA 3K1AA 3ZDDA 3I9V6 1MO5A 4G97A 3KKZA 4OQ4A 13PKA 5E9JA 4BLOA 3NDPA 1PT8A 3AETB 4HN9A 4MCIA 1U0HC 2EGGA 1V1MB 1WJGA 4RCVA 1QIKA 2ZETA 721PA 1O6GA 3PB3A 3KNZA 4V03A 3U1VA 3DD1A 1KJQA 4KKVA 2LKDA 5K03A 5LLDA 1RP7A 2J3HA 4TVBA 1RPNA 1R15A 2QM0A 3LCMA 3UWOA 4AG3A 1P39A 4HVLA 5LKRA 4QICA 3O8OB 1ZA1A 2QTAA 1OUMA 4X60A 3R0IA 1XVTA 1YZKA 2NZYA 2I6UA 2ZT5A 2ZUWA 1OGJA 3H7IA 1I4OA 1K8RA 3KQVA 3LP8A 4O02B 5EQTA 3ROEA 3TCXB 4C4AA 4JHLA 4DLWA 1US8B 4OQNA 1X80A 2HC9A 2YOHA 3LL4A 3EXEB 4GVPA 3H0EA 3AWDA 3H5AA 3UC5A 2Q6IA 1JHZA 1QF9A 3S1SA 3N9IA 3ZVRA 4JSTA 2PS9A 3MRXA 1X1TA 4QHTA 4GX2A 1LBQA 3CLSD 3EFEA 3UBTA 2PLFA 5JMWA 4BC1A 4C6TA 3ZWPA 4GGOA 3BKXA 3CC8A 4ZU6X 4HQOA 4MIEA 2C84A 2UUBB 3K6SA 1U2PA 4X45A 1BFDA 2JGDB 2XB6A 2AMFA 4DBLC 4EKDA 1Y1SA 3PHGA 2A5LA 1SA0A 2NTYC 3RS7A 1X3SA 1TEZA 5TQ0A 4OQLA 1QYWA 5EKUA 8OHMA 3DE2X 4FHFA 3OTHA 3KR9A 1PR5A 1II8A 3GYGA 3PRJA 1FNCA 2H2WA 4TV8B 1B42A 2NXNA 2XE8A 2V74B 2ST1A 1Y5MA 2CNDA 3L0OA 2ID7A 1XRPA 2XTAA 3I9JA 3IJPA 4PLZA 1Y42X 5FRDA 2WUEA 1ETUA 3KOYA 2DUUA 4H18A 4Q39A 5TF4A 3Q8KA 1FW6A 1YL5A 2FR1A 3V2IA 4HK4A 5I45A 2WKRA 1NSFA 1SUCA 3ZBUA 1DJNA 3HVRA 3NO4A 5HGXA 2GK3A 2IXDA 5JSKA 2R65A 4A6DA 3W9SA 5A9SB 2PIAA 2RJOA 2Y1WA 2CNWA 3NONA 3OJFA 4LDNA 3T8YA 5JISA 4WPGA 4RIEA 1OREA 3CKLA 4XJVA 1DXHA 2FP3A 3FNGA 1Y8QB 3ZHTA 3HN6A 9MHTA 3M1YA 4BNDB 1YRHA 2CJXA 3RHZA 1RXWA 2BTQB 1ZVJA 3T5DA 3PSHA 4F3RA 1RVDA 3H9GA 3L06A 1CUVA 3C2QA 2XADA 4RORA 4BIIA 5EHZA 1QS0A 2EWWA 1HA3A 1UM9B 4ILEA 1XEAA 4AJOA 4EYGA 2HIMA 3N86A 4F5YA 4F56A 2QUKA 3BRSA 4I1PA 3KKKA 4D02A 3ZJTA 4MPTA 3KHKA 5AICA 5EUMA 1OLOA 3V33A 1NHWA 3O4RA 3IH5A 5GPBA 5DHRA 2IDJA 3IKMB 2VNJA 3QFRA 4TVSA 1GFIA 1HTTA 4RJKA 1PG0A 1FYWA 3VFDA 4PQRA 4ZAFA 4MW1A 5DLEA 4EQ6B 2IP2A 2P6RA 3QWIA 5JQWA 3VI4B 4G0NA 4G0OA 4Q5IA 4XPIA 2VDKB 4AUEA 4L4SA 2Z3ZA 3LUPA 1GPWB 2FF7A 4X61A 3S99A 4R6WA 4C0XA 3R23A 4AECA 4RTNA 5C9ZA 3M5PA 4NCBA 4H15A 3ROKA 4X1OA 5KDDA 2PL9A 1BS2A 5ILQA 4BZZA 1PJAA 1JG6A 3P9YA 2FSIA 3H6GA 2W4QA 3K09A 4WZBE 3AIKA 1IY9A 5G2OA 1UKCA 1P9WA 3FR7A 2HFJA 5KWJA 1YR6A 3RYCB 5JSZA 3ZK7A 5IZ4A 1CUWA 2B2NA 2A0XA 5K20A 1OFUX 1QQTA 4UDOA 3K53A 5CCEA 5BUZA 3TWOA 3GEIA 4CM7A 1JQBA 3VBCA 2VQSA 4LHEA 2PH1A 3N70A 4ZVKA 3ZC3A 2Y1DA 3WGYA 3AG5A 5FUQA 1M83A 2XTZA 1OFTA 2BM0A 2JC3A 1Q57A 3FSRA 3MT7A 2IC5A 1NRJB 4O4JF 1VJ1A 4P22A 1GQFA 3ESAA 2ZRKA 3CG0A 3F6CA 3OWHA 5A4FS 1YFLA 1UWVA 2ZANA 1UFVA 4RO0A 4EBFA 1C14A 4OMCA 4MQFB 2AZDA 4JX9A 4BRWA 1YZLA 2XT6A 4LRTB 4E5KA 1Z2CA 3SC4A 1YJBA 1DFGA 2Q5CA 3C3PA 4JGBA 4FLFA 4D9EA 2VATA 1XTPA 1T6NA 3WWYA 1GQSA 1D4AA 3OOYA 1CK4A 1MRNA 1G2QA 4QOGA 1HETA 4Q1EA 4MEBA 2OZLB 2F62A 4QGAA 4ZYZA 2J09A 3B1XA 3TGWA 5HX7A 1ISRA 2R47A 4RTJA 5LA6A 1ZNYA 1C2TA 1JKIA 2PKXA 2XTJA 3PE4A 3LPDA 4HLDA 3GHHA 1OLXB 3RM3A 1NJ6A 2YWBA 1LI7A 3CZMA 5TEWA 3IOBA 1Q0QA 4L9AA 2YS6A 4WA8A 2QRNA 2CL7X 2QRHA 1GZHB 2DFLA 2R8RA 3A6LA 4O4IA 2KHZA 1K7YA 4LE1A 4E11A 4Q12A 2CSXA 1EFDN 3MXOA 5HBGA 1TQDA 2P4SA 4TWJA 2ONYA 3ZY5A 4D7AA 3QLTA 1QP4A 3ZDRA 1DQYA 1SBHA 2VAPA 1Z16A 1WQ4A 4LHYA 1I0IA 2HB6A 2JF0A 2PWYA 4LJYA 2MSEB 3QYFA 1YS1X 2IZ7A 4EENA 3N3AC 4JC8A 2YWRA 4YP1A 1UIMA 3DDSA 3LUHA 4I4TA 3SBXA 4L5YA 2V1UA 1JAYA 1FSFA 2WJYA 2BDUA 3JPYA 2A14A 4NBVA 4KLAA 4DRZA 2VQ6A 3KS9A 4ZHSA 3I5YA 5CNMA 1XQ9A 1FNDA 3EXIB 5A2GA 3IQEA 4I3GA 1Z34A 1RQGA 1UJCA 2PFKA 3PFNA 4KO8A 4BEJA 4E1BA 3HFGA 3VAZA 1YZHA 5JRZA 3LQ1A 5EE5B 1SUIA 4JSYA 4JIGA 4LVCA 2JGRA 2XVXA 1BGWA 1PYDA 3T1QA 1H2FA 4D4GA 1GPYA 4LGMA 2X8JA 4Z3KA 3MCVA 3COZA 2FQ1A 2EKBA 3WFZA 2OCPA 4FGUA 3AVOA 3OOJA 2D4HA 1FXUA 3WO1A 4G2TA 5AVWA 1E8DA 1DI0A 4RMIA 2P9HA 2B8WA 1Y4UA 4OGGA 3JQGA 3RYTC 3T7IA 2PTHA 3HKDA 3QLVC 4MJXA 3UAYA 1NLUA 3UA3A 3DDNA 4OXIA 3JW8A 1IIBA 2BONA 1MORA 4A23A 4BBAA 1NBIA 1TZKA 2VP0A 1ZICA 4Q7MB 2CLSA 1VLJA 1G42A 4MMZB 1Z6PA 3ZY3A 4I3FA 2BFDB 2IPOA 5B3LA 2V6FA 1XCGB 2B3TA 3IO3A 3ZIUA 1XRQA 4F84A 3DVSX 3KJEA 4Q7QA 4WXHA 5KTSA 3W3AD 4LSZA 4B6PA 4G25A 2ZS7A 4MUXA 4B6FA 5JRDS 1XA4A 3OFSA 3HCFA 5D86A 1XYYA 2JFZA 4JXJA 1WQ3A 5ULLA 2PXXA 2VHVA 4OREX 2ZXEA 3FJ1A 5CIYA 1PL0A 4FFNA 3VYTB 2GXUA 3NIBA 1RHUA 1UPTA 4KXWA 1DEXA 1TM5E 2VSFA 4V24A 1ADYA 3R9IA 3H8JA 1L7EA 1U3DA 2DFNA 4OHMA 2Q3JA 5F5NA 3SFVA 1GTVA 2YMLA 3QWFA 3RSSA 2XXAA 2XR1A 3NOOA 1ZRMA 2VT2A 3HBJA 4OHCA 3RF7A 1JB1A 2PSSA 1XR3A 1TM7E 5T6MA 1W1UA 1WL8A 2GLTA 3HRHA 3NOQA 2W37A 5FTNA 4Z0HO 2PDAA 3RFCA 3AVXA 3L6UA 1ZWLA 3D59A 2ZBVA 1AKVA 4PYNA 3RJ9A 1X8KA 4NTZA 1CP2A 2IUFA 4NLLA 1H8ED 4JJAA 4TQAA 4TWIA 1IPHA 1IUOA 2ID8A 3D4LA 5IJAA 1CUCA 3K0AB 4R31A 3W5HA 4XARA 4EQ6A 1D2MA 4L8WB 5E6RA 1GG5A 4M6WB 4NEGA 4P7JA 1YB5A 2AW3A 1VA5A 4OLHA 5EJEA 4A6EA 2HBYA 2WA1A 4KMSA 4A0HA 4Z8YA 1RAFA 2ZTUA 1DKNA 1K2VN 2UUOA 3ZE8A 1KFKB 2PEZA 3H19A 4E5DA 3M4NA 1D04A 4YMVA 2XOKA 3FYCA 3ED5A 3I73A 2PEYA 1MABA 3UH1A 4B45A 1DPGA 3E9RA 4M1QA 1RZ3A 4M8IA 3AY0A 3LIPA 3CW9A 3O94A 1D9XA 2QW1A 3F9RA 3G5TA 3KTDA 1MJ5A 1WDTA 4OIFA 4AX8A 3L1KA 4L15A 4B71A 1H6AA 3L0PA 4ZOLF 2GFHA 2Z2JA 5DTQA 4F1JA 2ZJ0A 4YRJA 3ZCQA 8ADHA 3L7NA 5HE8A 2GBIA 1TA9A 3GLHB 2NSHA 1KIMA 1SG0A 3DE7X 5AW9A 5IT5A 1YUBA 3TLAA 1R8SA 3ZNQA 3RB8A 1OBVA 5AI6A 1FX1A 1IEXA 1MBZA 1N92A 3VPGA 4HWSA 4JI5B 1QZXA 3IOMA 5IZCC 3WXMA 2CF5A 4KRFA 1U8EA 4ZKDA 4NP6A 1IAVA 1ZCBA 2J4DA 4YRNA 2ARKA 5DGHA 5KC8A 3QA9A 2BWJA 4MQBA 1C9YA 3GFFA 1IBMB 3ZCXA 4LQDA 1A9ZA 1RRGA 2X22A 2MHCA 4RFLA 4IFIA 1Q15A 1X1DA 4K9SA 4TTTS 4D80A 2XHZA 1DTWA 1OE0A 1K0FA 3HBFA 3OEED 1EUZA 3PIDA 3NJ4A 2G9UA 5HF9A 1T6XA 2WHPB 4K6MA 2GEUA 1NT2A 3EGVA 4IHAA 2WWVD 1N2EA 4AJ4A 5F1OA 4XTCS 4KIGA 4BFSA 4LYFA 1AC5A 2WKPA 1ZRSA 2VPXA 4MDHA 1GNTA 3GLRA 2DPGA 3ODGA 4M1ZA 3BGVA 2FX5A 1AK1A 4PRLA 4HLNA 3OQNA 3FB1A 3WS7A 3AXTA 2H7VA 3R7BA 1FSGA 1YE8A 1P9LA 4MHOA 4CQMB 3P4UA 1I80A 2F67A 2C3UA 4W6QA 4D9BA 1U0OC 4FCCA 2C07A 3K4HA 1OXUA 1TECE 5KNDH 2XUHA 1LNSA 1TVCA 5DM2A 4A1OA 1O1YA 1G4UR 1Q7RA 1UCFA 3HN2A 4YHBA 2V4MA 3IAM6 1A5TA 4WXEA 3RSCA 8LDHA 5KTTA 1XJQA 2YRWA 3AHJA 3CF4A 2LIVA 1DARA 2O2CA 1QR6A 2E18A 1TTHA 2VA8A 3REQB 3ZU4A 3S8EA 4AI6A 1Z88A 2OORA 1ABFA 4YRSA 4POOA 3CEMA 1DC7A 1G3RA 1KO4A 2QIOA 4MTCA 1K27A 3RADC 4CU5A 3R4VA 2XLCA 1IZYA 4AP5A 5HUJA 2ZTLA 5EXDA 3A1UA 3T6KA 3O3OB 2OFOA 1OW3B 5I7SA 3IQXA 3K30A 4IDOA 5B1DA 5A03A 3WFJA 2UDPA 4Z4EA 3MCZA 1A9QA 1YRLA 2KE5A 2PZEA 1GNLA 3HEAA 1KE2A 1C5KA 4PSVA 2G1PA 1I2DA 3FPBA 4GO1A 4C0KA 2PHZA 4WEQA 2VQFB 4M1WA 5DHAA 2JH8A 4DB4A 2FHPA 1T8SA 4XLZA 3KQHA 4YJKA 4IQ0A 4YAKA 1OI2A 4IAOA 2BR5A 1WULS 1DX6A 4NBSA 4X24A 1EPUA 2FZWA 1HDRA 5EJ9A 4W9NA 4M0FA 1E9FA 5GV8A 2QTHA 1RPZA 5K7SA 5HKBA 4ARZA 1OI4A 1VMEA 2HNBA 2HRRA 3TKYA 1PTKA 4NNJA 2PQ0A 1U90A 3CBQA 3QBJA 3HSKA 4MRAA 4TVOA 4BMXA 2MYNA 2QVGA 3SHWA 4TLBA 3KVRA 1B8UA 2QPLA 5EE3A 4DQ0A 1L9KA 2KPOA 2B82A 2F59A 2WZBA 3BXPA 3K6RA 2Q7OE 1KU6A 2OAP1 4B2IA 3KJXA 2QYSA 4EEXA 4ZZIA 1LQUA 1IH8A 2AYXA 5B7QA 3UPTA 3BGWA 1KQPA 2QPOA 2ZYWX 4A3SA 2WD7B 2GN1A 2YRFA 4KITB 1QQ6A 4CM4B 2LDBA 2RHBA 1OD6A 1MKYA 1EWYA 1XDUA 3VDMA 2JH3A 3GVPA 4DMGA 1P5JA 3NIWA 3BJEA 4YMLA 2CV1A 5LR6A 1XAHA 2HIHA 2XNCA 4RGBA 5JVDA 4ER7A 3UJ6A 3W1WA 2XAAA 1OPRA 3HGTA 3DLIA 1XTSA 4H7EA 3OIVA 1GGNA 1U0NA 2VP5A 5KNBH 5LL6P 1MXHA 2BMWA 2IYRA 3G2IA 3KU1A 3RK4A 4FGJA 3UMVA 1ZCFA 5LUAA 5IULC 2O3TA 3O2NA 4TQUS 5DEOA 4E88A 3EAQA 1XMOB 1IVYA 4YX9A 3CUEF 3MJEA 2X5JO 1LZLA 4FFMA 4O4LB 1GRRA 5DDIP 1U2RA 5HDQA 4JC0A 4K2HA 3FE2A 5JDIA 4BMPB 3O0DA 4H1TA 3EULA 4OL0A 1Z7EA 4A26A 2QZZA 5H81A 2GD0A 2FF5A 4E32A 4CIWA 1P2DA 4KSCA 5EEGA 2EATA 4RD4A 1V9LA 2BF7A 2C9OA 2FETA 1POWA 3BAZA 1K08A 2P1RA 1LPNA 1QKKA 3E1SA 2DPXA 4WK6A 4IDFA 2V0NA 2DF8A 3M6XA 4GSYA 3UG6A 1DWOA 3I9MA 1VCOA 2AC4A 3P9NA 4RFVA 1GXSB 2OBFA 3RVSA 3SZMA 1IOLA 3NWOA 5CTAA 5A7FA 2HM7A 4YWJA 1CY0A 1XTJA 3NP9A 4N7BA 4AQDA 4BJ5A 2ID4A 1GPJA 2QN7A 5LB4A 4ZYVA 1URPA 3G89A 3SP1A 3TE6A 1OWPA 2IE0A 3OFJA 2GEBA 1OLSA 4YJGB 5CGZA 1HO3A 4BPBA 2ONCA 3FYSA 1KMMA 3KX2A 3OQVA 1N6KA 4OX9B 4MV8A 4KN9S 2V0CA 4KXLA 2XNJA 4JMLA 4L3OA 4OHVA 3GEHA 4QAQA 1KEKA 4M36A 4ARSA 3VA7A 3ND7A 2GPTA 2H57A 3RUCA 1QIDA 4EJ2A 1SUBA 4UBIA 1G5PA 2J9FA 1O6ZA 3T54A 5KVCA 4HSEA 4F2PA 2JG3A 2EEPA 1FMTA 2Z43A 4R51A 4RVCA 4TL6A 4DUPA 2GPYA 4YAUA 2I54A 4NE2A 3HDVA 1R7RA 2CW5A 1T4CB 1FFWA 4YAJA 1R0BA 1UBNA 1T3GA 1KTVA 1ODFA 1Z4KA 4GM1A 1TO2E 1E63A 1U7HA 2IHZA 3OBIA 3DHYA 4H1HA 4TM8A 4L02A 2FZEA 1Y3CE 4UM5A 1YBHA 1SVKA 4BQFA 5IFKA 3I9NA 1GZSA 1HQDA 1GUZA 3U48A 1AUQA 5BVGA 1DKOA 1T3HA 4G0XA 5TARA 2SICE 1GYRA 3M7IA 3GFQA 3G49A 3OLXA 2DVMA 1M5UA 1AB6A 1JPJA 4DYDA 4RSRA 5EYPB 2OORC 3AHFA 3Q41A 2JBWA 2OXRA 3DOHA 3EQ7A 2BRUA 4MWZA 2PRZA 4V38A 5HIMA 1VHJA 3L3BA 4CIVA 5E4JA 4BX0A 2JGKA 4UZSA 5D3MB 1XJ5A 2NPOA 4IS2A 4MAMA 1ECCA 1DO8A 3JD4A 3Q85A 1XN1A 1RRVA 1MC1A 4Q3BA 4GD3Q 4OXQA 4QFCA 4MB0A 4H31A 3NRCA 2H1IA 4L27A 3T38A 3DDZX 4RHTA 3PEWA 3DTVB 1NV9A 2O3UA 2YXBA 1WLYA 5HMLA 4NH0A 6Q21A 4DR7B 3AY3A 2QG9A 4GM4A 4RK5A 3JYPA 3V3KA 1NI4A 1JSZA 2EERA 3BFXA 4ESOA 1NXSA 2C77A 3NM5A 2HSEA 3PWSA 4WFJA 4WASA 3SJ7A 3N0RA 1NUQA 1AIPA 3AL2A 4B7AA 4CMGA 1T4CA 3THXB 3FSGD 2QK4A 3JR7A 4UCWA 3N76A 1YZVA 2QTGA 5A02A 1QOZA 2Q6OA 1HDOA 2XRFA 3PPXA 5JATA 2ZR8A 3DHEA 1TJ5A 4B9AA 4L0QA 4RLSA 4M0EA 3PGA1 4PZEA 2Q2VA 3AR2A 1T9GS 5F7JA 1BHQ1 2VHXA 4JL8A 5TRTA 3STXA 3ORFA 3WWOA 1Q6ZA 1ML4A 4L0CA 2RFLA 3S81A 3C3DA 5KBYA 4J0KA 2C9BA 3FI0A 3M5WA 4UHDA 2OZKA 4F3NA 4IIYA 4OI4A 4R0NA 1JU3A 2BGGA 1IZ9A 1BJKA 5CLJA 5EWJA 4PTLA 3BMNB 4CQNA 3IVXA 1IXRC 1DE0A 2QQGA 1K8XB 2Q5IA 1X7ZA 3FSJX 3D5TA 3CX4A 3IPLA 3QUCA 4I1UA 1AKWA 1P5ZB 5DX1A 3M4YA 1W25A 2Y0EA 3CF0A 3N6RA 3BZBA 3VYSB 3WGOA 2PZKA 1KAHA 3G68A 1ISJA 1EP2B 1JHRA 3FH0A 4WZZA 2ZTSA 4IV0A 1NL3A 1PDWA 4MKFA 3HRIA 5JPDA 1U2GC 5IPFA 1CYDA 2OM2A 4YJHB 2AQKA 5EHNA 1NXQA 4V0RA 4LBYA 1BDMA 2YXNA 3TZHA 4M9CA 4QVIA 2UVPA 3KT6A 3CB2A 3ICCA 9GPBA 1UBTS 3OQMA 3VC1A 4LBZA 5EINA 1Q7TA 1NJ5A 3LKBA 2AUNA 4LC1A 3V8NA 1BOFA 4D9KA 1L4GA 3RFFA 4J0JA 2F64A 1CJCA 2DH5A 2H9AA 4ZOLA 3DMTA 3PNBA 2WSBA 4RXTA 5DEIA 1VG8A 1JKFA 1T5DX 3RRYA 3AESB 2QAGA 2C0PA 3SBEA 1NF2A 2VK2A 3PT9A 1ZL0A 4NE7A 1KDZA 5BN5A 1IK6A 2VDRB 3F9IA 2HSWA 4DLPA 1FJ2A 1QFYA 4G89A 4KSBA 3EG5A 1OH5A 3VKGA 4QXPA 4EG6A 2QGNA 1Z6YA 3A1DA 3FJOA 2Z8ZA 3FM9A 2J45A 3E9ZA 1B43A 3MRVA 4JVSB 1H1DA 2JIBA 5DJ5A 2VRCA 3R0ZA 2H85A 4FXOA 3TG2A 4M9UA 3UTCA 4C0SA 2BH9A 3MPUA 3VR5D 3L01A 3WRVA 1OZHA 5HVNA 1D1PA 2XBUA 3FFAA 2GTPA 5AHOA 1K3TA 1Q1GA 1QCCA 1JDJA 2NNLD 3D0KA 2EL9A 3KEOA 2OLEA 4FFPA 3FDZB 3LO5A 3R3WA 4G5RA 4GUAA 1PI3A 2R79A 4NONA 3WI7A 3A6ZA 5IG2A 4I50F 2PUVA 1VE6A 4XW2A 2C1ZA 3GZNA 4DMMA 5EXEA 2XYHA 3E9DA 3R8XA 4MRRA 4CIXA 4N48A 4KJZA 2W2PA 4QO8A 4WUTA 4ZDJA 2PGJA 1G8AA 1YS2X 2J7PA 4V2IA 2A59A 1WCYA 2P41A 1E2QA 3BRWA 4F4JA 4MYHA 2VJQA 1I10A 3LD9A 4FB4A 3CCCA 5HKOA 4UU8A 4DR4B 1XD2B 1L8OA 1BEEA 2NUPB 1GWNA 2HPHA 3H87A 3OEHA 4Z9AA 3WLTA 4ALJA 4BX9A 1LF5A 4DDTA 3BD8A 3ZV6A 2UZ4A 2WIJA 1A8UA 1MB4A 5GGYA 1C8LA 4TL7A 3USZA 2VJCA 4BVLA 3IA2A 3MG9A 3JALB 2P8JA 2CLIB 2OAGA 5C4MA 1M67A 3L7OA 3CE6A 3E03A 3EVEA 4JJEA 2GLXA 4KSYA 4Y1RB 1PKXA 5B58C 2CLMB 2OM6A 3GLGE 5JWHA 3MPOA 5JCXA 3VKVA 5EPEA 3CR8A 3L5KA 3GFTA 2F9MA 1CXZA 5DMHA 4NDNE 3WGKA 3PUKA 3LOPA 4Q1CA 1IQRA 1N0VC 2FUCA 1HT1E 4IW3B 4BYMA 1I2ZA 3DNMA 3ZVLA 1AF4A 1W9MA 2VF8A 2DRIA 4M7PA 5ED0A 3RKRA 1U7TA 3PNVA 5B4TA 5HJ2A 2FSPA 1J0AA 1U1CA 1OIVA 3TQHA 2MU1A 2YINC 1NQAO 1RAHA 4XM2A 4EEZA 1U0EA 2J9RA 2FDXA 2ZJFA 4O1IA 5FOXA 4YUYA 3GDWA 4D81A 2OC9A 1KEVA 1L4NA 2CLLB 2K2WA 2Y68A 4BLVA 1VCNA 3AV3A 1CY8A 1S7CA 3BMQA 3QKSB 1UKAA 3CLUD 4LMRA 4JEHA 3CH7A 4RZIA 3ZWQA 4GECA 5AVXA 1JLMA 3ODPA 1FLVA 4FYKA 4HUQA 2XZDA 5KCZA 1JQLB 1N78A 4L4ZA 4N5HX 3PXEA 3T1NA 1HM5A 3ND5A 4CETA 4J3NA 4JV5B 1A8PA 4IH9A 2YMPA 4AJEA 4EGJA 1Z37A 4M8LA 2UV8A 1L7RA 2UAGA 2WTEA 4L07A 3F5MA 4JK3A 5EJ2A 4QU9A 4ZO4A 4NMLA 4F4FA 4FINA 3QVUA 4YRZA 1GYPA 1VI5A 3LUAA 2ZR9A 2DERA 1PK9A 1IN5A 3ZOZA 3M33A 4BMSA 4YUAA 4WGGA 2IIQA 4DJ5X 3U1BA 3R5FA 4EY4A 4XGQA 4HWTA 1GNVA 1T36A 2JK0A 4K9QA 4W5HA 4NHOA 1GPDG 1GY8A 5LU9A 4H0FA 4MLZA 1OZGA 2X1VA 4B4OA 2NWQA 4S1VA 4XWAA 4BO8A 4GOXA 4N9WA 3DUFA 4OBEA 2HA2A 3ANXA 5FHQA 1N2CA 2HEGA 3KQYA 3R6GA 5LXTF 1B0UA 1LB1B 3H1PA 3ZHSA 4YUWA 2GM4A 1YBMA 3U19A 3LHIA 4KQJA 3G79A 2FQWA 4ZVRA 2OV6A 1HSOA 3SICE 2AXNA 4HVAA 4HNAB 3JALA 4JELA 1XHFA 4OB8A 1UOOA 2J9ZB 3CH5A 2GESA 3IOYA 1B74A 3P20A 4ITVA 3BVPA 1K6XA 1QBGA 3LBNA 1EFRD 2SCUA 3VR5H 5KTMA 2GWRA 3Q8WA 2O8CA 1L5GB 2GAOA 1GU1A 1U0FA 1IWBB 2VH2A 2XAUA 3ND6A 3NM4A 4MO2A 3EHEA 4H2DA 5CGQB 4M1OA 1KBOA 3T5GA 4B44A 4BQOA 2OCBA 4TMFA 1OXMA 1CNFA 3L8ZA 5REQB 4U1RA 1JIJA 3RK0A 2RGXA 4FT2A 5DIFA 4F60A 1M6VA 2XOEA 1AA6A 2YZKA 2Y76A 4LY0A 3IAS6 3BA1A 5GP1A 2I3AA 3UJ8A 2B5VA 4B82A 5I01A 5I9IA 7AT1A 1SELA 3KLBA 1DKQA 3DW3X 3JZMA 3LCUA 5TJ9A 1JJVA 4BCDA 2XLBA 1UK8A 3HH8A 4OAOA 5GINE 2YN4A 3JWPA 3K05A 2DPLA 4O2AB 2C7VA 1YJXA 1N2CB 5EHQA 1F6WA 4RDHA 4EG8A 1AKQA 2WV7A 5T4HA 4FHDA 1MW9X 4R41A 2Y1XA 1WXGA 3U37A 4J0EA 2NO9A 1P4SA 3FDZA 3ROZA 3LWBA 4V0MA 1Z33A 2B1QA 2G1AA 3H9BA 1T43A 5IT4A 4X65B 4LPKA 4TLCA 2V7QD 4AULA 2QD4A 4JB8A 5AW1A 2BW0A 1P1BA 1K9SA 2AD1A 2HHCA 1E66A 1VMAA 1JECA 1COZA 2J59A 3O8QB 2EZ8A 2IV3A 1V5WA 2X9QA 3LW8A 4FNOA 5LMUB 3IR7A 1I7LA 4R1TA 5BXQC 3TZLA 3FXAA 1TM2A 1U0BB 2BAGA 1SVIA 3UPUA 1Y6FA 5IC6A 2W4MA 5ANRB 1L6IA 2XZPA 3DLHA 4LMBA 2GXQA 2WPNA 5F77A 2PU7A 2VTVA 3NTOA 4OYRA 1Q17A 3ZZNA 3PD0A 3UT6A 3OFNA 3VHQA 4FD3A 1V4NA 1WUTA 2IUEA 2Q3FA 3GGGA 1L3CA 2JVJA 2NUBA 5IAOA 4UAGA 4UUNA 5DKFA 2IXEA 5JBQA 2PUEA 3FRIA 2WLTA 3WGIA 3VSCA 1IHUA 1YOBA 3DOUA 1PHPA 3VR4H 4IJMA 3PU6A 1QFMA 5TJHA 1QZ3A 4LFCB 2ZAIA 4U2GA 1FFEA 1TK3A 4G67A 1C1HA 3T7KA 1A4IA 1EBBA 3GHYA 1ISMA 3GA7A 2X8WA 2FZCA 4LKRA 2IU0A 2QPTA 4B0OA 3LIIA 4XYGA 4YQEA 4DMKA 3NRJA 4AO8A 1X7WA 1Y9JA 5GM2A 4OB7A 1QGDA 1ZVQA 3R7NA 3W06A 4B43A 3GGJA 4PWZA 3S5JA 3O75A 1V7CA 3QPCA 4EUNA 4YTEA 4WJZA 4N5DA 3R6DA 4O0MA 4A27A 1TO6A 3S2SA 4BE4A 4MRVA 5LD2C 4LRQA 2O2GA 2PUGA 3VH2A 2AG0A 4TZ6A 5EVCA 4EA6A 2OCGA 4B6EA 1EUDA 3BA6A 1T9AA 2G09A 2HPVA 4JP5A 2R2GA 2DR0A 3JQEA 5CW2A 1T8UA 3DUFB 4KQCA 4YB8A 4TVKA 4Z9YA 2D0PB 4JT9A 4ZD6A 3IB3A 3UUFA 1VE7A 2VJYA 5L4LA 2ORVA 2JEZA 4KO4S 4OIMA 1WU8A 2X0EA 3GFPA 3RAGA 1L4UA 4UE3S 3ZNNA 1ZMRA 4OATA 4Q03A 2AE2A 2QD5A 2W0MA 4Q1AA 4QDXA 3EPLA 1WEHA 2ALJA 3HK2A 4K9DA 2GZ2A 1E3DA 2H4HA 2ZIFA 3CN7A 4L8GA 4P7BA 2MTBA 3HABA 5E1OA 3SSNA 4KOEC 1L1FA 2SHKA 4G4SP 1V16A 2HWYA 2H1SA 1RFLA 4PAQA 4AYXA 1UOEA 1JTEA 3RREA 4CLXA 1Q21A 2DFVA 3D3EA 1QPGA 1IN7A 3DOEA 5AJWA 3S68A 2D7DA 4MROA 3VC3A 3EXFA 3GL9A 4DCNA 3ADBA 2UUCB 2Q45A 4W9RA 1SXJE 3EMKA 2OZLA 2YIVX 4NFHA 4PO1A 1D8AA 1G5FA 4XUDA 1RXSA 1IZ7A 4KDCA 4BQRA 1TZCA 1SG6A 4BJ3A 1W0JA 5CFRA 1KMHB 1KI2A 4I9HA 3P9ZA 1TQHA 2JGDA 1GLGA 3MJSA 4WXPA 3MTEA 3R4CA 4NF2A 3GJQA 1U2ZA 1KZ1A 1J1ZA 5K0BA 3VU9B 1E2DA 3PCTA 4F6RB 3ZDCA 1U1IA 4PPYA 2ACEA 4RA6B 1BAPA 4ASUD 4Z49A 3VNRA 4YI5A 1L4YA 1ZZEA 2RKOA 4MWSA 4CM3A 1EGAA 3GVXA 3T1YB 3FLMA 2C00A 4JHXA 4JOCA 3S1AA 2ZULA 2O8FA 1O0BA 4NV3A 4R4JA 1MT0A 3MT0A 2P40A 3ZIAA 3HB7A 4I8IA 5B3KA 2BY4A 4GWLA 4K40A 4ANFA 1Y5IA 2ECOA 5TPWB 1ZMXA 5EKTA 4NJOA 1OBCA 4L9WA 1HZZA 2ERXA 1FFDA 221PA 3JAMA 1RQLA 3U3DA 1B7GO 2G0AA 3CNBA 4C0LA 2C7QA 1G7SA 4DADA 3UT5A 3EEOA 1DXQA 3F73A 3LY9A 4FDAA 3N0TA 2Q6VA 1X70A 1RKBA 2MSDB 3RC1A 3PKJA 3T1HB 1BX1A 3HXKA 4NU8X 1ZA2A 2QAGB 2PA0A 4TPKA 4UTXA 1UFOA 3QFTA 1LW6E 3FFTA 1OT5A 3HJGA 2I62A 4MUJA 4IQ4A 2OOKA 4MS1B 3UCFA 3Q5GA 4RD0A 3UC9A 2OCLA 1PJ8A 1JMVA 2CDBA 1X9IA 4BEWA 4PN3A 3MINB 4X95A 4BVBA 2JAXA 5ALFA 1X1RA 2TYSB 1J99A 2EXXA 2QHXA 4Y6LA 3SZOA 3ZEIA 3ZTYA 3DHWC 4IG9A 2HCRA 2BR4A 4PIVA 3BCHA 2F17A 3HFJA 3I9LA 4O25A 5E4FA 2AB0A 1PJZA 5COAA 3AHDA 3DBRA 4O4IF 4M7OA 5FUMA 3GLFE 4UDYX 2XMGA 1AMUA 2CY0A 4QJ4A 1U3GA 1X7YB 1JIQA 2IS1A 2PUHA 5FBHA 1MB3A 5BPHA 3K8YA 2DT8A 3EJ6A 3IVMA 3TAHA 3E82A 5FWAA 3M82A 5BVGB 1B0AA 2CUKA 3VDQA 4ND5A 1JG3A 4JLOA 2FW9A 5C35A 3RUEA 2FPLA 2JJQA 2A7QA 3H5VA 1WXIA 2QTLA 2KB0A 4IJ5A 2Z5FA 1XEXB 4HMQA 5DO9A 3QKWA 3U9TA 2JJ2D 2R7AA 3KL4A 4W9NC 2XMBA 5K6RA 4GI5A 4QQKA 3K9CA 3GLFA 1DHTA 3AUYA 3EE6A 1VHWA 1ZGBA 1FP2A 2O4CA 4NCJA 4F3TA 2WLSA 3UICA 1ESDA 1MB9A 3KBBA 4RLFA 3T1VA 2FN4A 1ZUD1 1DJMA 3TL6A 1GDDA 2A3NA 1QC5B 2H18A 3F6PA 3HCPA 4M9ZA 3R7FA 3ZLTA 4X8OA 1XTUA 2G5PA 4B34A 1RYEA 3OT1A 4RNDB 2PG3A 3EQZA 1WNTA 4PFSA 2ERCA 3BL6A 5FNZA 5LDDC 3PPVA 3W3AA 1CR4A 5KQMA 4TS3A 1O94D 1W0CA 2Y93A 1JNYA 2ASVA 4NJEA 1O96B 3TBFA 1D0SA 1V45E 3DFKA 3T4UA 2LIPA 1HI9A 4X84A 2LR0A 1SCBA 3EZ2A 3N2KB 3QIAA 2YHIB 4R1QA 4AZ3B 3D64A 4PZAA 1FXSA 3H1TA 4RKWA 4A15A 3A6EA 3IT3A 4F2WA 5FOQA 4ZMBA 4Z0PA 1WZIA 1RI5A 3GRVA 2GPJA 3GEPA 4II3A 4TWZA 3V2HA 5FA5A 2C78A 1OTHA 4ZVMA 4QUIA 3W6UA 1RWKA 3GT3A 3MEQA 4ZODA 2ZI3A 3RHTA 4EO4A 2YS7A 3QOWA 3UT5B 2PVCA 2H17A 1LNZA 2FUG1 5BV1A 1IBSA 2HMAA 4LRSB 3KQNA 1LPPA 3EWSA 5LXTB 1I01A 1RJWA 4ARAA 2QBYA 3MLBA 4BATA 2G1UA 4IHKA 5FJIA 5AKIA 1G8KA 2P9QA 3WMRA 3CRVA 2JLRA 2ZRBA 4J29A 2B25A 4D0SA 4IJWA 2I1QA 3T5CA 5FUYA 4N3GA 2IW1A 1IPEA 3L40A 4QECA 4MV7A 4YBZA 3SF8A 2NU6B 4F1WA 3TDMA 4PQEA 1XEXA 2FFBA 2ONKA 4O4JA 1JALA 2QV0A 3D4NA 4AS2A 3FB4A 2XRYA 2J5KA 3CB4A 4JVLA 1F8YA 1NUAA 3OJEA 3OOSA 4LY3A 3C4VA 1TMGE 3NHSA 1NI4B 2XOKD 3D2LA 1QVAA 1W1IA 4ER6A 2Q5JA 3JQ8A 3H3FA 3KO8A 1NT4A 5KYXB 4H6VA 5JEDA 1ZJ5A 3BS4A 2Q9AA 3PHLA 2O2SA 2EC5A 1GSIA 3EUFA 2DX7A 4NFYA 2NU9B 4EVQA 2NTNA 5HXAA 3I62A 5LNK6 2WWRA 3WMGA 2FEWB 1SKAA 2YOGA 5J2TB 3SSAA 1OYOA 4K87A 4CHTA 4L75A 1SOAA 2Z9BA 3C43A 5GONF 3OUZA 4B5KA 3VO8A 3AILA 4TKVB 4DNPA 1J2JA 4NG4A 3N5KA 3NUZA 2OXEA 2MR5A 1ZP6A 2V6JA 4M1YA 1XCMA 2BZ1A 2E9SA 2JFVA 3PDJA 4X6LA 2ZBGA 3T1OA 3OPMA 1V6CA 2IHKA 3H5WA 4W7HA 1CTQA 4TTQA 2DHCA 4QXOA 1E2UA 3E27A 3WTBA 3WNQA 2CLDX 2K6GA 2NZUG 1NN1A 1RXYA 2QN3A 1E1LA 1JSRA 3ZYZA 1UK9A 1HWYA 4BNVA 4ES6A 1J6UA 2YMQA 3C6BA 3JU3A 3K1TA 3QG1A 3CGGA 4IY1A 1TM4E 1YQWA 2AXQA 3GJ8A 1JB9A 4Q15A 3ROGA 4Z53A 1OZFA 2R1TA 1A50B 2O3SA 3N2IA 5CW1A 4YCSA 5JFOA 2EIXA 2HQOA 4XJSA 1CYEA 2H11A 3ZD6A 3LKZA 3OPYB 1NW6A 2X5NA 4TXJA 4HH1A 4DLXA 4RK4A 1B14A 2QLLA 1GAEO 3WL8A 1HY3A 4U3JB 1UP6A 1G5HA 5DNYB 4LXIA 4GQIA 4C87A 1IHXA 2ACWA 5JS2A 2W2KB 4HAWA 1KEEB 2M1ZA 4YS6A 3P97A 2Z9DA 5ALDA 4OXKA 3RF6A 4IIUA 1I6WA 3Q6IA 2C97A 2V58A 2W8BA 2PKCA 1SRQA 1ZNWA 4B80A 2OO5A 3B2EA 3F97A 4HAYA 3KYCB 2PFGA 1TAQA 3R5XA 3V1TC 5IFLA 1PT7A 4QYSA 1LPAB 3SIXA 3R9WA 3GAZA 3SQNA 1AV6A 2YIDA 4PLYA 3W4IA 1DWQA 3ZVMA 3ZY4A 4M0LA 2Z5VA 4EFDA 3MCTA 1OHHD 1J8DA 2RHMA 5L3SA 1ZM3A 1D09A 2VUSA 3M34A 3NV9A 3GB9A 4GZMA 4JJ4A 4RC9A 1U7DA 3H9QA 3T61A 3L1UA 1PFKA 4EUFA 1W7AA 1AHNA 1XLWA 2O3QA 5EP3A 2VZ9A 3ZTWA 4RF3A 3OOWA 5E7MA 3OTIA 3AWIA 5I7HA 2FN8A 4LZZA 4KPYA 3IQZA 2WA2A 3U2QA 1E7RA 5A1TA 3OT1B 3EVZA 3G17A 4EHLA 1FYEA 5C18A 2GN6A 3JD1A 5DI3A 1QRAA 3KDPA 5LKAA 1FU4A 5K0JA 5BSUA 1TYCA 2PWAA 4TKUB 5FWXB 1QH9A 4DCTA 2XIQA 3SZ3A 3IP7A 4DCUA 1JFFB 5E9AA 3X43A 1CLUA 4ZZ2A 5IW8A 1Y6QA 2XGMA 3OZFA 1AF7A 2F55A 4CLRB 3CW8X 4RPHA 2BGJA 4PHGA 5DTIA 3LE8A 5D5QA 2FGJA 4AJKA 4HUJA 4WKOA 1VLLA 2JS7A 1ZN7A 2P9GA 3ZU3A 4CV1A 3L8FA 3ZDYB 2WT9A 5KTRA 5TQVA 3AHCA 2V6MA 3OQPA 5D85A 3NBMA 3WA6A 1A5SB 3I9KA 4R71A 4WX2B 4DLLA 4IIHA 4Q4JA 1H0RA 2K7ZA 3GCZA 4LRYA 4B74A 1KO5A 1G64A 3UAWA 3EA4A 2XWSA 5HG0A 4FMPA 2XY4A 2XYRA 3W05A 3HGQA 4B4WA 1IM2A 1JJFA 2BI7A 2WTXA 3L8MA 3L84A 3ASYA 1IMOA 3KB8A 2OXCA 4A0FA 2EIHA 3HVHA 2BFFB 1IK4A 3PI6A 4BLTA 5L3QA 3LBHA 5K01A 1W76A 2DFPA 2AD5A 2H2HA 2OUIA 3HDJA 1NQOA 2BGIA 3UK2A 1I30A 1U5BB 2IHTA 3O82A 2RONA 3MLEA 5HYVA 1E2JA 1T0UA 2HQ1A 4EFMA 2C9YA 1PJCA 2P5UA 1GD1O 3HGMA 1N3IA 4UEOA 2PXCA 5K6TA 3EFOB 1X7HA 3K2BA 3OZCA 4ISBA 3ZDEA 1JHXA 2X6RA 3T3EA 3DG9A 1O54A 1WHTB 1G8HA 1CP3A 3WIVA 2CVOA 2O2EA 5JHHB 4GOMD 1J00A 3VNAA 1PJTA 3NBXX 1YQXA 4Q66C 1T36B 2C5HA 2JI8A 4RADA 4UD2A 4KEAA 2HDNB 1E5VA 5ALIA 1RPAA 2M2IA 4YH1A 3TQOA 1M6NA 2ZVQX 1ZGHA 1ZAKA 3AR6A 5F3WB 3ZHQA 1FTSA 1R74A 1W30A 3HCNA 2IYZA 4KGVA 4PC1A 1C0EA 2X7XA 3L49A 3MWEA 4EI8A 3AEZA 1FP6A 1SPXA 5HUQA 1X1QA 1LF0A 1ZCJA 1GR0A 1G9XA 4LBWA 5FI5A 2CHEA 2ZWAA 1GT6A 3PPYA 3RAJA 1T10A 4EQZA 3F7MA 1YQQA 5HM8A 3AVVA 2I3ZA 3THSA 3PBKA 4AIRA 1HX7A 2QJWA 4YAIA 3GRYA 1X1EA 1B6TA 2PS0A 5FCDA 4G41A 2PV0A 4L76A 3L6BA 4K0RA 1PK8A 1QYXA 3TOXA 1L1EA 3WLHA 1Y9DA 4IEEA 5I9TA 1UJBA 1CUZA 2KQUA 4FI3C 4Q7LA 3TIVA 1C3VA 4OV6B 2DPYA 3U7EB 1JYFA 2XMPA 4UMDA 3EPKA 5CVJA 3PD1A 1RI4A 3E1GA 3D1VA 3A1SA 2IKSA 2GETA 2HKIA 2VPTA 1KDPA 1V6SA 3FF1A 2VT6A 3HVJA 4F3YA 1J97A 5LJLA 1ENYA 5C8VA 2RBGA 4DKJA 2YVAA 3GJRA 1VKJA 3O2SB 2W6MA 5H3HA 1EDOA 1JG4A 1S9HA 5CFOA 3GQVA 3AI7A 4TMZA 2AVNA 2UYOA 3IT2A 2HBQA 3TNLA 3HY4A 2CCKA 1HYGA 1G55A 2GAAA 1EDZA 3E3AA 4DPLA 4HUTA 2H06A 1WUYA 5LBTA 3D7RA 3GDGA 2O2IA 1YNOA 1W88B 2B69A 2HTEA 1A4UA 3FPGA 4XQGA 1G5RA 3VPAA 4FC6A 3LRTA 1R64A 2JFPA 2WNSA 2WW8A 3HR4A 3IEKA 1ZD9A 2ZIXA 3PL5A 1U9ZA 5HP4A 4REQA 1VHDA 4OYYA 4GKVA 2WSSA 3WHKA 2AK2A 3IIMA 4HXYA 5CYFA 4YMHA 2QZ4A 4V0KA 5F2NA 3OHMA 2ES4A 3ZD7A 4U00A 5A06A 2HI0A 2XUFA 1H85A 4QPJC 4K7JA 1CUJA 1IB0A 1DBIA 1VC2A 1Z0IA 3R1IA 2WFMA 1B3BA 1RHMA 1T25A 4KIFA 1O5IA 3JVEA 4GT1A 4IIJB 1KYYA 4REMA 3WBKA 4UU1A 2WPDA 3THRA 3GUVA 4WSOA 4EKIA 4Q6WA 1FTYA 2DKNA 3NWBA 3QNWA 4O2LA 4U7FA 2PGXA 4YUXA 1YC2A 5KX5B 1Q1AA 3LH5A 3SHQA 1A95A 2V6GA 2ZYSA 4E5YA 3EEFA 1ONPA 3D6MA 1M1UA 1FFAA 3LXMA 3PC6A 4PC7A 5JAQA 1Y1KE 3B52X 4UUBA 1FSPA 1UQUA 3RRBA 1XZAA 3BK2A 4K8OA 2E5FA 4OOFA 5IJZA 4I1IA 3G8BA 5L51A 1BXGA 2OPHA 4Q3KA 1N6NA 3UYLA 1CUYA 3ILYA 4JR1A 4ILKA 4RH1A 5A6SA 4GQBA 4UUMA 4QJBA 3IJ5A 1DC5A 5FOWA 3QYPA 2AFHE 1Q3TA 1ZS9A 2OFPA 2H7CA 5A4DA 5KQRA 2IH4A 3X1YA 3FOWA 2VSXA 1I9CA 3ZE2B 1BOOA 1Q1NA 3V55A 1M54A 1PV4A 4JAVC 3H8SA 2F8SA 1J49A 1ZXLA 1HRDA 3D2AA 2NMVA 2A9PA 4HDSB 2C3OA 1F51E 5J43A 3MWDB 4G37A 1MH1A 3GGSA 4J8PA 2A0FA 1N0IA 2H2IA 3INNA 4FYHA 4WEOA 4CL8A 4RULA 3EZ7A 1FDVA 3N74A 1PQPA 1QH8B 1XZBA 1SOUA 3W7BA 2JJYA 1X1CA 3EVFA 5ECGC 3CWCA 4AF8A 2WWIA 1ZISA 2EJWA 1WF6A 4BFLA 1KDOA 3DV2A 1UWCA 3HNPA 1R66A 4UVEA 2AV6A 4AUKA 1SUEA 2VDNB 5HK8A 2ZOSA 1FJGB 4CG0A 4RL6A 4BV2A 4ENTA 1J09A 2QS9A 5IBCA 1BE8A 2NTJA 1YE5A 1JHUA 2X8AA 3QF4B 1XTZA 5DBIA 2BFBB 4X3CA 9ABPA 1XAGA 3UVEA 3ZWDA 1MO2A 2X2FA 1IIRA 3PLRA 1LBHA 1NSYA 2YR0A 3VHXB 4CV2A 4QELA 4BE7B 5KJ6A 3G5MA 3K5PA 1Y7IA 4RKFA 5LP6C 4J0HA 3ZWKA 4CDGA 1BWSA 1QE0A 3D7KA 3HP4A 4WLOA 5JOQA 2V0GA 1NXVA 1Q95A 2R8EA 4MI9A 3AHHA 4LKOA 4PYOA 4CZ2A 4UHEA 2YBEA 3LBFA 2DHQA 1V1RA 4KFRA 3OA0A 1N25A 4D99A 1LPOA 2QX9A 1XDWA 4M88A 4LHWA 4KFCA 1K4YA 3WFIA 4XWWA 3S8YA 1WHSA 1L5NA 3U4GA 4FT4A 1Q0RA 2JRCA 3OD1A 3OY2A 1ZH6A 1L4EA 1DAKA 5LIRA 4OLFA 1ADGA 4YRFA 5KQPA 2HJSA 4NMMA 3OTOB 4Q3CA 4EMBA 3T4EA 1F6DA 1XZKA 3Q11A 5CBPB 2IYUA 2KWIA 3ZWNA 4C7BA 1KZGB 4S2UA 2IEYA 3QKTA 1KO1A 5KTNA 2GA8A 1S2LA 1BMTA 1AQYA 1MRSA 1UMDB 3IAUA 1GZUA 2C95A 4K05A 5DP1A 2O8BB 3L7YA 3GUYA 5CG2A 3P27A 4HAZA 2C1XA 3RYHA 3VMMA 3ORYA 1XEFA 5THQA 5IANA 1SUFA 4RWEA 2N42A 3RV4A 2Q4EA 1H4QA 2ZT7A 1BKYA 4X8HA 1WPQA 3I6QA 3PZBA 5FBKA 2L2QA 1R9JA 1WRBA 3WYGA 1AZWA 2DWOA 1FSZA 4O3FA 2CYCA 3VVCA 4E4RA 1S2MA 2OL4A 2CLKB 3WOHA 4E14A 3H6HA 4JLSA 1XQ6A 3AY7A 3T4PA 1VXRA 2DH6A 2NZ2A 2WF7A 4D0NA 3I5UA 4DW8A 5H16A 5EHGA 2PO5A 1BU8A 1C1XA 3OICA 4Y6PA 3D43A 1I3KA 3OEHD 3ZJ5A 1OU4A 4JLNA 5L6LB 3Q1KA 3P19A 1Z08A 4L5IA 4AP9A 5FBVB 2X13A 4EYOA 2JLBA 4N9QA 5E6UA 1SRRA 2C03A 3KVVA 4JY7A 4OLBA 1AKUA 1L1QA 4MKIA 3B3GA 5DU2A 5AOAA 2IOQA 2VRWA 3IQIX 3PDHA 4KBFA 4CKCA 1WPGA 4IKEA 5K0SA 4DR1B 1B1AA 1Y81A 3NH6A 5G4LA 1SVMA 1TLFA 5IBPA 4O1HA 4K9OA 4X00A 1GTSA 4BMCA 4NDAA 4EMUA 5JO0A 3WKCA 3HWSA 3DONA 4HRAA 3HG7A 4WH0A 2HV9A 1YR9A 2A3RA 2VH5R 3K70C