2IYUA

Shikimate kinase from mycobacterium tuberculosis in complex with adp, open lid (conf. a)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
167
structure length
167
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords SHIKIMATE KINASE
total genus 65
structure length 167
sequence length 167
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iyuA00
3TR0A 5KPDA 3WNCA 2IYUA 1N0UA 2GHIA 2WSSD 3UMSA 2IHYA 4JLJA 5JCZA 2JJ2D 2QENA 2GXUA 1NLYA 2BJWA 5LBIA 5KSYA 4PPQA 2BMJA 3BFXA 3E1SA 1Z6TA 3FFAA 1VYUA 1MO4A 3D8BA 1M34E 2QRNA 4CT4B 1J90A 3TAHA 1IXRC 3RWMB 3NBYC 3K70B 3D3QA 1W7AA 3B5JA 5FPTA 2GNOA 1R5BA 3B85A 3FE2A 5JBQA 3BJIC 3A6PC 1E1QA 5DHFA 3U6KA 1N5IA 3GLIB 5JHHB 3IBYA 3GCGA 3N70A 5AJWA 5CJPA 2JCSA 2IUUA 4F92B 3U3MA 3KQKA 4IRUB 3TQFA 2A5DA 1XXHA 1QVAA 1T0HB 3B8HA 3CX8A 2WJVA 1CULC 2R2AA 3JZMA 3RS0A 1DO0A 1UBEA 3T06B 1J8YF 2D3WA 3GLIA 4N0EA 3QQ5A 4B6FA 4NPHA 4V03A 2ZI9A 4HDOB 3RRNA 1ZM7A 4PC1A 3EC1A 4HLUC 2IXEA 821PA 3KFVA 1XBTA 4LJ6A 1SKYE 2ZS7A 3SR0A 3D6TB 2GRJA 1RJ9A 1NMXA 1W0KD 3Q7PA 2V9PA 4XVUA 2W6JD 3CUEF 3PVSA 4V02A 4QM7A 2ZYWX 1QHYA 1NI3A 3IHWA 4ASUA 3KQNA 1OIVA 4RD6A 3HDTA 3RNLA 4DLXA 1N5LA 3SBDA 1VECA 2XNDD 4PX9A 3X1XA 4MKIA 3Q5DA 1WCV1 1GNQA 3B60A 3U7HB 4CW7A 1NSTA 3DOEA 2L0XA 3GFTA 3IIJA 3FYHA 3GD7A 3GJ7A 4RD0A 4ZPXA 5KSZA 1R0XA 2PCLA 2VO1A 2JATA 4ZCLA 3F3YA 4Q4JA 3MUFA 1TF5A 3SJZA 3IQWA 2BMEA 2GJ9A 1SZPA 1TNDA 4XSGA 2QORA 1U2RA 3B2EA 1YR6A 5G53C 1FMJA 4IOKA 1OXXK 1JALA 2CCJA 3NKVA 1SXJE 1U8ZA 1DVRA 3L8ZA 3MGCA 3RC3A 3U7EB 2PJRA 4OQFA 1U0JA 1WXQA 4C3ZA 4YMUA 3UG6A 1MH1A 1IBRA 4PHTA 1SQ5A 3NH6A 4X8LA 2ZSBA 2A5JA 3GPLA 4HZUB 1WB9A 4YONB 2O8FB 3OHMA 1J7KA 2QL6A 2HJVA 4DDUA 1E9BA 2YJTD 1MOZA 2ZITA 3QSYA 1K5GA 1PLLA 4MRPA 5GVSA 4TYNA 1T4GA 3A1WA 1JQJC 3GEIA 2A30A 4WBSA 3BS4A 5KYKA 4C7OB 3P32A 2V8OA 1D2EA 3PXGA 3B9QA 2HF8A 2QRZA 1ZM2A 2N42A 3MWYW 5EP1A 1VIAA 2ZRFA 1N6RA 3UWKA 3CONA 1GVNB 2X2EA 1JNYA 3LX5A 3K70C 2WBLC 1UEJA 4L9WA 4UXJA 3VKGA 3K09C 1RRPA 3KTAB 1J99A 4P31A 2FFHA 2GEUA 4MA4A 5EE9A 2BHRA 1CJKC 1DE0A 2F3RA 1KAGA 5GVRA 1SVMA 1W4AA 1OXUA 5DH9A 2LKDA 3W8NA 1CIPA 4ZO4A 2XOKD 1YVDA 3TBKA 1Q1ZA 2D7CA 3K53A 3R9XA 2OT3B 1NP6A 3CRMA 4RCYA 3IHLA 3I5XA 1VMAA 4EUNA 3NDBB 2OZEA 4Q19A 4E03A 1E1RD 4XVRA 2WTUA 2QPAA 2F1HA 4IHQA 5FBWB 3ZS8A 121PA 3KKPA 1G7SA 1H8ED 2J0VA 1XU4A 5FUXA 1ESNA 5AK0A 1XMVA 1CP2A 1FFHA 2DY1A 1G5TA 4IOMA 4MRRA 4JLKA 4WZAE 1VCIA 1UDXA 3K0EA 4EDHA 1NNEA 1W5SA 1XCPA 1U0HC 3AVPA 1Y3AA 1OFHA 2CJWA 4R7ZA 1DS6A 1UKYA 2WICA 3B7GA 1XCMA 2QP4A 1VYTA 2JJ1A 1F2TA 3OEEA 1ZC3A 2FJUA 1KDOA 8OHMA 2O8DB 4KVGA 2JDIA 2RGBA 2F7SA 5FTJA 4Z8XA 4UNRA 1E2MA 2Z4RA 4FIDA 4DC9A 2J5XA 2PX0A 3EZ7A 2GEVA 3LH5A 2EFHB 2WOOA 1U90A 4V0KA 3DPUA 1TAGA 2W6JA 1JR3E 3E70C 1Z2AA 2HYIC 4FCVA 1RYHA 2V6IA 4HB4A 5FI1B 4PC7A 2VL7A 1IN6A 2FZLA 1FNNA 2LKCA 3SHFA 2A9KA 3TW8B 4RZXA 4JIMA 5D3MA 4AYWA 4RY2A 2DHRA 4M1TA 1MT0A 1EFTA 1JJVA 1DO2A 4A2QA 5IRCD 1FP7A 4PTLA 4Q21A 4PC2A 4BFYA 1BMFD 5FR1A 1OYWA 2CHQA 5DSZA 4A0RA 3G5UA 3EPJA 2YWFA 1BKDR 2QAGA 4TYYA 2GK7A 2CDNA 1W48A 2YHSA 3W3AA 3GEHA 4PO9A 3SS8A 2F55A 2D7DA 4R2HA 2GCOB 4TMXA 3A1SA 3GJ5A 1KSFX 2VTKA 1G8YA 5H70A 4URXR 1F48A 2FWRA 3S1AA 1VG0B 5F2EA 2Z4SA 5CDFE 1OFTA 4D0NA 2VSXA 2RKOA 2ZU6A 2IYXA 4JLMA 5GADl 4C0LA 5C46F 2JGNA 2VP5A 1QBKC 3WYFA 1KMQA 3OIWA 4EFLA 2GZAA 1KSHA 2EFGA 4U5XA 4OI0A 3LXXA 2G3YA 4RKFA 5HKKA 1NIJA 4DLWA 3V4FA 4OK3A 1CJTC 5A4JA 4Q1BA 2XXAA 2ZI7A 4ITRC 1TTTA 4WXRA 1OKKA 3KQHA 3TUJC 5KDLA 3LVRE 5DISB 1U9IC 2EWWA 2WJYA 3H86A 3EWAA 4JVLA 2ZUDA 1KK2A 1DAFA 5JMTA 4LJ8A 4KYUA 4G5QA 1G8GA 4RZ3A 4C0BA 5JJIA 4C0JA 1ZUIA 3R8FA 3PV0A 3T1QA 1PLKA 2F9LA 4G5GA 2OFOA 1Q21A 3TIFA 2GCNA 3MMPA 1KZ7B 2YKGA 3IEVA 4US0R 4BPBA 4FMDB 5FOXA 4MRSA 4KAXA 1GRRA 4JVNA 4II7A 2BM0A 3V00A 1DELA 3NH9A 3AH8A 2GZHA 1KIMA 3EZ2A 2QBYA 1BYIA 4F38A 1ZNYA 2WJHA 2VYFA 4B71A 3QKSB 1MABB 2IYYA 1T91A 1L4YA 3BWDD 1TMKA 4C2UA 4HATA 2AXNA 5IDVA 3PR1A 5JS7A 2DWQA 3ZVLA 2RMKA 1ZD8A 1II8A 4IW3B 2V3CC 4BFXA 1KO1A 2ZVPX 3LNCA 3PITA 3QKTA 1HQYE 5IF9A 3GLFE 1TU3A 2YWGA 4UNQA 1KI2A 3ECCA 5B64A 2VP0A 1Z3IX 1DADA 2DWPA 4MDFA 4IDPA 1XEXA 3WMGA 5KNBA 1CR1A 4C9BA 3CB4A 4LJ7A 4C0AC 2Q0HA 4NYIR 4Q4AA 4B75A 3Q85A 4NBSA 621PA 2QAGC 4F91B 4EFNA 2PX3A 3U60B 4I1UA 4Q48A 2ZJAA 2ZR9A 2OBMA 1Z83A 3MG9A 2JAQA 1ANKA 2RGNA 4LOAA 4Q7MB 5TXGA 3D31A 1E9AA 1HUQA 2RGNC 5H68A 3AVVA 1AKYA 4UKDA 1EFRD 3HP1A 4WIAA 3ZVMA 3QKRA 1ZNWA 3TVTA 1XEXB 3RLFA 3O8CA 1JPJA 1E0KA 1EXMA 4TLBA 1BH2A 3QJYA 4TTRA 3L8YA 3U3KA 3GLGB 2ZE6A 4AC9A 2CNWD 5EXPA 1GNRA 4WZ6A 3IO5A 3W5IA 4X8HA 2K5UA 1JQLB 1L4UA 2C04A 1OHHA 2UZ3A 4BFWA 3U7FB 1Q3HA 4ABYA 2OLKA 2NO1A 1ZIOA 2G88A 1ZBDA 1NY5A 4IXMA 4LI0A 2JIZA 1T5LA 3KKMA 4A1FA 1K6MA 2RGXA 2ZJ5A 4PC6A 3GP8A 3KKOA 3EIQA 1KK1A 5DI9A 1GAJA 2BWJA 2P5SA 4B74A 2YOHA 1E9CA 4OK6A 2A7QA 3ADKA 3OFND 1KSGA 2FH5B 3TLXA 1S9HA 4K46A 1KI9A 2KE5A 2RGEA 4R71A 4AK9A 4AG6A 2C9CA 2ZRAA 3CPJB 5B30A 4TL8A 4DHEA 3MFYA 2FFQA 4HLDA 2PL3A 2QMUA 1IQPA 4LJYA 6Q21A 4RZUA 2J59A 3B82A 1KNXA 1P9WA 3PFIA 2R8RA 4MUBA 5AR1A 3S1AB 1X1SA 5C18A 2J7KA 2NZ8A 4LJ9A 5H1YA 1Z47A 4Q9IA 3SEAA 4DIDA 4ESVA 3LBHA 1E2GA 1IY1A 4GOJA 4DDWA 2W58A 3GLFB 1Z6YA 1G19A 1E9DA 1KI6A 2ZTSA 3LLMA 3RS3A 5JHGB 5KUTA 1R2QA 3I1FA 3T1VA 1QVRA 4DRZA 2RAPA 1NVVQ 4RZ2A 1KI3A 4OHVA 1OIXA 1PUIA 2GWHA 2QP3A 3C14C 1J8MF 3FMOB 4TMKA 3V4RA 3LDAA 1S1CA 3R7WA 3QXHA 4KFSA 5L3SA 2J7PA 2ZYUX 2JLVA 4DLVA 3CF2A 4PSVA 1E4VA 4URUR 3G0HA 3BB4A 3RYTC 4IVRA 2YZ2A 2ZRMA 3BBPA 2O8FA 3GJ8A 2BCGY 4A6XA 1BIFA 1KK0A 3GLIE 2GJSA 2OCAA 2YINC 4EFMA 5C2JB 4EPXA 2JIZD 2CEAA 1KJZA 1ZJ6A 221PA 5BXQC 4JLBA 5JWOA 3LA6A 5AJZA 1XD2A 2C5LA 2IYVA 4PHHA 1IJEA 2WAYA 1FL9A 2P5TB 1H65A 3ZVRA 4PR0A 1JR6A 3QE0A 4LHXA 4KBFA 4V0ME 5B58C 1R0ZA 3EZ6A 3TSWA 4EJSA 4I81A 2W2XA 3A1TA 3CIOA 2GBLC 2B21A 4O3MA 4KITB 1Z07A 3BRWD 1CRPA 2NPIA 4F4JA 2RCNA 1ZNXA 3LXRA 2WWFA 5H8WA 2GXSA 3DM9B 2BVNA 4PQFA 4R2IA 2WJGA 1B23P 5HPYB 1ZCBA 1G4UR 3RS2A 1R5NA 1XNJA 4CDGA 2H8KA 1ONBA 3MLEA 3EIHA 4HAZA 1CS4C 1QDEA 4PSKA 3OEED 3CH5A 3ZZUA 1OH6A 3KXLA 1GFIA 4B32A 4DLTA 2XXAB 4RCZA 2JLUA 4BUJA 1T9HA 2J0SA 2OSBA 4TYPA 1JR3D 2ZETA 2GXAA 1MO6A 4NCNA 721PA 4U02A 4HUQA 5K8IA 1KO7A 4QBIA 4KXFB 4E07A 4B6EA 1Z28A 3PUVA 2UZIR 3C5CA 1E69A 4NH0A 5GJCA 3M4YA 4KJZA 5FUYA 3R8CA 4C2TA 1I2MA 4FD2A 3OIVA 4FMCF 2QNRA 4IDQA 1JB1A 4PZYA 4WA7A 4DDVA 1JXMA 5JRJA 1KO5A 1ZRHA 2FU5C 3KKNA 3MJRA 4NYMQ 4G01B 1T5IA 4NKRA 4D4JA 3EPHA 1LW7A 1EK0A 4QFMA 2G9NA 4JLNA 1I4DD 4B2PA 4F93B 1II9A 2Z0MA 3VR5A 5CK4A 4M1YA 4E09A 4TQAA 3DZ8A 1ZD9A 4BLQA 1L2TA 2IYZA 1NRJB 1E2LA 3WP1B 5IHPA 1SVKA 3PCRB 1TF2A 3GFPA 4P0TA 2JLZA 4NYMR 1M7HA 4TLEA 4UJ5A 4C7OA 1GNPA 1SVIA 4IVQA 4CVNA 3I62A 2CBZA 2O52A 3FHCB 3QF7A 3KJEA 4B3XA 4V0MA 2CVHA 4NZYA 3WYAA 3U44B 2DYKA 4A8JC 3J81k 1ZMXA 4PQRA 4D82A 2QEQA 4QNRA 4TZ0A 1E2QA 2AD1A 3VR1A 3IDQA 4QM6A 2RGAA 4MYHA 1E9FA 1M2OB 4YDHB 4HAVA 4BFZA 1WRBA 1D2MA 4ZDJA 1VKJA 1LF0A 4YLGA 5SZHB 1G64A 2HLDD 1YZUA 5FTNA 3OAAD 1G6OA 3W6OA 1EX6A 1XD9A 1P75A 5L3QB 3F0TA 4PZZA 1W4CA 2BV3A 4OQLA 1GRQA 1UAAA 1X3SA 2MMCA 4PAOA 1G8HA 1R8SA 4QGFA 3CRQA 1ELOA 2O5VA 4DKXA 5HE9A 4D0LB 1NF3A 5HR5A 1NVUQ 3EZFA 3I72A 5FBLB 2O0KA 4Q1CA 1GILA 4Q7KA 3PEYA 1N25A 2R65A 5EUQB 1G3UA 2WWYA 1A4RA 4GOKA 1BYUA 3ZQJA 3I61A 2B6HA 1IN7A 1UDWA 1KKMA 5CLLA 5KPJA 1XPRA 4W5JA 3BXZA 3RHFA 1A1VA 1S96A 4GBMA 2KBFA 5E7IA 4LCBA 2WSMA 1Z0DA 1KO4A 5KHOC 1NKTA 4F4CA 3UPUA 2SHKA 2DBYA 3RRZA 3ADDA 1CKEA 2AXPA 3I73A 2AK2A 2XNDA 2GVDC 2V54A 3AB3A 5EUMA 4QJ5A 1MKYA 3NBXX 4IFBA 5KTYA 1HURA 2HXSA 4FWIB 5F9HA 4Q4HB 4DLRA 1W2HA 1O87A 4N1AA 1OH8A 4MDEA 2ZIAA 4EQ6A 1HV8A 4UXHA 3L0OA 2VIIA 2UKDA 2XTNA 3K0AA 1QHHA 2H16A 2WIBA 1A2KC 3A1VA 2ZJ2A 4WW0A 5EE0A 1ZU4A 1JBKA 3FB4A 3GJXC 2XSZD 4GP6A 1QHSA 2QE7D 3EXAA 2IW3A 4URWR 4ILEA 5DYGA 3WY9A 1A7JA 1P73A 2P6NA 5CM8B 4RD3A 3SU8A 3AF0A 3SNHA 4ZI2A 2VLIA 1IN8A 5BYJA 2AR7A 1M7BA 3T35A 1YQTA 2VP2A 3REFA 3A4LA 1E2NA 1WQ1R 2HT1A 2I1VB 3W6NA 1KI6B 1P72A 5LPNA 1OT3A 1S8FA 2ZS8A 2R6GA 2GBLA 4DWJA 3AGPA 2QM7A 3FPAA 1P2TA 2GJ8A 3W8RA 4PO1A 2B92A 1UBGA 5K8LA 1W1WA 4URVR 1Q0UA 2MMGA 3MJHA 4G1UC 1E79A 3MWJA 1HA3A 4L5BA 1N6IA 4NMMA 4MYTA 3JVVA 3EW9A 3W90A 2WWXA 4RD4A 4WVFA 3U6BA 1GTVA 4OI2A 1ZUHA 3IIMA 3QVUA 1GIAA 1JPNA 1OB2A 5GJBA 1XEWY 2Q21A 4B76A 2IF0A 2ZJYA 4XOIA 1CTQA 4AYXA 5E3HA 4P4UA 2P65A 4YMVA 2J7PD 3WXMA 4I4LA 3PIRA 4A0GA 4F4IA 1F2UA 2ZRDA 5DN6D 4KHZA 4YC7A 3KJHA 5FL3A 4DCVA 3EWSA 4GMDA 4HLQB 2NO9A 4IEIA 3ICEA 4Q4JB 4JBXA 1M7GA 3I8SA 1TL7C 4JT2A 4M9SA 4JJKA 4GFDA 4LHVA 4JLDA 1AM4D 3DVLA 5FBRB 3DOFA 3LQQA 2ODEA 4C30A 2NMVA 5AWFC 3OE7A 2G1KA 4X8OA 1YKSA 3BGWA 5DHAA 4LJAA 3AP1A 5CYOA 4B2LA 2NIPA 1M6NA 4D2IA 3K0SA 5F9FA 2AFIE 4B3BA 4HDQB 1P2SA 1ZD1A 3HPQA 1E1QD 4HZUA 2WPDD 3RSOA 4WOPA 2XX3A 2XITA 4KLNA 2YNMA 4DSOA 1E2FA 1ZM4A 2XZPA 3FWYA 1DG3A 1VPLA 2ZRLA 4A0FA 1XXHE 4ZDIA 3P20A 2JLRA 3EIEA 4OQNA 1JJ7A 3QPVA 2QT1A 4DIEA 5J4HA 2ERYA 1AS3A 1RE0A 3CZQA 4TTQA 1PV4A 3T61A 5EE1A 3QENA 1IM2A 3VR4A 2KBEA 3BH7A 1AKEA 4EKDA 2P67A 1IJFA 1G3QA 1HY3A 4LYJA 3A4NA 1U94A 5DNYB 2O8EA 4URYR 4RSGA 1HEIA 3QI2A 3FDIA 1OHHD 2CVFA 3GFOA 4TTPA 5B57C 2WZQA 1ZCAA 5D3MB 1L7VC 4MKGA 3VAAA 5HZKA 3CR7A 3RWOA 1W0KA 3U4QA 2CLDX 5CYPA 3SYKA 3C7KA 3EPLA 3K8YA 2AL7A 1F2TB 1VG8A 5K8TA 3NXSA 3KL4A 4CRWB 5ANRB 2QA5A 3WNBA 2ZU0C 1WMSA 3IO3A 4QRHA 1Z06A 1E9SA 2ZSDA 2I3BA 2RGGA 2CK3D 1M74A 2DFTA 2QTFA 5FUWA 1OE0A 3M1IA 1KI8A 1OKKD 1XJQA 1NJGA 4RKEA 5FTLA 1Q3TA 3MRSA 4U00A 5E95A 4GRAA 2IEYA 2WWGA 3L0IB 4MYCA 4MGKR 3BE4A 1GUAA 2VHTA 5EE3A 4XSHA 2C98A 3SI7A 1OIWA 1CR4A 2I4IA 2CL0X 2QTVB 4NTZA 1V43A 521PA 4D4MA 3SJAA 3VKHA 1E94E 1OFIA 3B1VA 3OFNA 5EZ6B 3WYGA 2OESA 5FL7A 1Q1EA 2JASA 4M4SA 2J41A 1HT2E 2ZUCA 2Z6VA 3CNNA 3QG5A 4NCKA 5AJYA 4ZKEA 1EGAA 3TRFA 2G83A 2PZFA 1JECA 2CCKA 4GZMA 2C03A 2ZRPA 3NWJA 4LSGA 3GLGE 3ZLJA 3VU9B 1TPZA 2G1JA 5DE3A 1OH5A 3CKLA 2VHUA 3L43A 3O8BA 1FPMA 2D06A 2JA1A 1ZVQA 3AGQA 4FCWA 4XWKA 3EG5A 1JXOA 1X8KA 2W6ID 3TK1A 1AJEA 2WPDA 3LV8A 3FMFA 3VX4A 2DPXA 1P9RA 2CNWA 4KODA 3AF3A 2V7QD 3AP2A 5DGXA 1AZTA 3TAUA 4BLOA 2OEPA 1A2BA 4EAQA 2GCPA 1XP8A 3WNDA 2MSCB 2ZYVX 3QKSA 1D5CA 1Z5ZA 2WKQA 2HLDA 1UEIA 1UBFA 3HR7A 1EFHA 3BB3A 4P33A 4Q4AB 4XJXA 1GG2A 4DSUA 3DKPA 5KSOA 1R0WA 1KZGB 1EFRA 2W2TA 2IWHA 1XMJA 3HJNA 2WKRA 3A58B 2RH5A 4JBYA 2FSFA 4JLPA 3U3JA 3NVAA 1X8LA 2FV8A 1CEEA 1RRCA 2BBTA 3IPYA 1KI7A 2HYDA 1D9XA 5FBVB 3RANA 3IIKA 2ORIA 3HWSA 1EG7A 2OXCA 1G7CA 1QF9A 1E2HA 3EX7C 4DSNA 3M0EA 4PPGA 5TARA 4MGIR 4BFUA 1C1YA 1TADA 4GPTA 1L8QA 1LV7A 3P27A 5IK2D 1KNQA 2FFAA 4Q1EA 3X1WA 2ZI6A 1C9KA 2A78A 1GL7A 2OFXA 1D8TA 1EESA 3GJ3A 4ZDKA 5J4LA 1E0AA 1IY0A 4PAQA 5DO9A 4BLRA 4KO8A 5FOUA 1XCGB 4DVGA 4EPTA 5LD2B 1SULA 1GRNA 3AF1A 4LYHA 3T1OA 4DUGA 3OIYA 3B78A 4AIIA 4DJTA 2ZR0A 2OXRA 1N5JA 4LHYA 4M1MA 2P3SA 4JVMA 4C0QC 1CF4A 4W9MC 2O8EB 4AG5A 3BORA 2ZRIA 2W83A 4YQFA 4JSYA 4FN5A 2OCBA 3SHWA 1SXJA 2IA5A 2VF8A 2ZRJA 4LV5B 3WMEA 1XTIA 2O0HA 5HZHA 2NZJA 3VNVA 1JR3A 2QPTA 4JBWA 4QJ3A 3IPXA 4E5UA 4PZLA 5EP4A 2V1XA 3AP3A 1ZNZA 4FINA 3O8DA 4ZIRB 1W5TA 1ZM3A 1US8B 4FW9A 3OAAA 3RDPA 2QQ0A 2C9OA 3P26A 1BO6A 2PLRA 3KKQA 3HPRA 4UJ3A 3SYNA 4ZCIA 1FOEB 1AS0A 1AS2A 2QSZA 4JVSB 5FOSA 3K0FA 3T12A 4TLDA 4KLZA 3QIAA 4P3YA 3CR8A 1F5NA 3DMNA 3CX7A 4CZ2A 4LBZA 2WAXA 4LJ5A 1UBCA 2IK8A 3CF0A 1U99A 4CGZA 4B3GA 1Q44A 1SXJB 3LFUA 5JEEA 2V6JA 4HLCA 3GLFA 3QBTA 4TMWA 5BYKA 3WHLA 1UJ2A 2C8VA 1RW4A 1MRSA 4YXWA 3X1YA 4CEIA 1CRQA 2QN6A 2PEZA 1EWQA 2OUKA 2QTHA 1UKEA 3KQLA 3X2SA 2FG5A 2W6IA 4GOXA 4IXNA 2XEXA 1Q12A 1OYYA 2JLSA 3RC8A 1KI4A 4KFTA 4PHGA 2W00A 1IN5A 1GL9B 3FGNA 2DCUA 2ZEJA 2D4HA 2HT6A 1U98A 3FVQA 2BEKA 4QOSA 3LW7A 1YR7A 1YZTA 2CJWB 1OB5A 4Y0AA 4XD7D 1FUUA 2PMDA 4L15A 4TL7A 4D80A 2E1RA 3PJRA 4AWXA 2QG6A 4O0MA 4R9UC 3MD0A 1KKLA 3SOPA 3QXCA 1Z0FA 1IAQA 3C8UA 1V5WA 3P1JA 1CU1A 4EPRA 1S1MA 3RAPR 1N3BA 1XF9A 2YWEA 3DO6A 3KZ1E 3OESA 5SZJA 2E9SA 1T8TA 1YZQA 3I92A 5IT5A 1ZM9A 4DCUA 1E2IA 3TSZA 4US1R 1XTJA 2EQBA 3ICQB 1XEFA 3GQBA 2AK3A 1QHNA 2NO6A 1QG2A 1KMHB 3LVQE 1U81A 2P6RA 2BIFA 1KTVA 4FMCB 4K81B 1SVOA 2DWOA 4HB3A 1MR3F 2NGRA 3BAFA 2CE2X 4AKEA 2HUPA 4IFEA 2PLFA 421PA 1TQ4A 2O8BB 4URZR 4GL2A 3CRVA 4DCSA 2W0SA 1KY2A 3AM1A 1NVVR 2OLJA 3PENA 2GJAA 2GCOA 3R20A 2C96A 2JLWA 1KMHA 3DL0A 2XGJA 1FP6A 5L8VA 3KFXA 1OH7A 1YZGA 3ZVNA 4LHZA 1I4TD 3BFKA 2YOGA 3N5CA 4C0HA 1ZYUA 2OCPA 2IUTA 1NVXQ 2VF7A 4YMWA 4Q1DA 1ZU5A 2CLCX 2FEOA 2R6CA 2ZJBA 4TZ6A 1OSNA 3N2IA 4B34A 1Z22A 5DLQC 4TMZA 4S2EA 1UF9A 1RC8A 4ZV4A 4E22A 1R4AA 1NMZA 5AUNB 4Q7LA 4V0OA 3TUZC 4Q1AA 3EZ9A 4V0NA 4AY2A 4DT1B 2HV8A 2ZROA 3LX8A 3IQXA 1KK3A 1TF7A 5AUOB 2O8CA 3OE7D 2QU8A 2REOA 4I1OA 1MRNA 2NO0A 4BASA 1R10A 5GJWC 3LBNA 4EJSB 1E2DA 2ZQ5A 2ZREA 1RKBA 1MABA 1N6NA 2H7VA 5TB5A 4DLUA 2F1JA 4MGYR 2ZJZA 2OO7A 1RFLA 4W7SA 2QGNA 5AJXA 4ARZA 4Q66C 2ZRHA 2XJ9A 4QHTA 1OLOA 3HYTA 4W5WA 2ZVQX 2CE7A 1XTSA 2ORWA 3MCAA 5C1BA 1S4QA 4KBGA 1A5TA 2V7QA 1X86B 1LS6A 3L82B 3QPWA 3Q9LA 1DBSA 2Q9AA 2IS6A 1N6LA 5CM9C 3RVBA 2QT0A 4QNMA 2OFWA 5JECA 2IC5A 3T1TA 1M8PA 4DEXA 2PH1A 3PUXA 4AD8A 3EA5A 1SHZA 2AN9A 1G3IA 4D81A 3CWQA 3X1DA 1R5OA 3NIBA 1IXZA 1KDTA 2GF9A 3AVOA 4MH0R 4Q5IA 2AKAB 3GJ6A 1WF3A 3VR2A 5BWMA 4ZDWA 2B7CA 1Q1QA 4IOLA 3I4LA 3P4YA 3QY0A 1CJMA 4ACAA 4GSYA 4TSFA 1SVWA 1KI1A 4Y0VA 3WBJA 2F1IA 3AVQA 4MUAA 1COWA 2AHOA 4ACBA 2REBA 4TMTA 2VEDA 2Y8EA 4JLOA 5J40A 3QKRB 4B43A 3U5ZB 1E2PA 2MSEB 3CO5A 1IHUA 4TMVA 2LCFA 1GZSA 1E99A 3ZZ0A 2FGJA 4OJKA 4BLSA 2IUSA 4PO8A 1E6CA 3GJ0A 3UK6A 3KX2A 1D2NA 2GVZC 2PCJA 2AWNA 3KTAA 2FMXA 4L16A 2IS1A 2GZDA 3L0SA 4PANA 1H8HD 4U7DA 3IGFA 4Z51A 2Q3FA 4HSEA 2ZI4A 3H4MA 1P5ZB 3QXSA 5FI0B 4PHFA 4OBEA 4XTCS 3K0CA 3ZJYA 4OI4A 1FX0A 1AGPA 4UNNA 2VA8A 2DFLA 2C78A 3KJIA 1CXZA 3CBQA 3RSLA 3W3ZB 2OHFA 4D0GA 4JL5A 3U7GA 3AVYA 1FZQA 4A36A 4P32A 1R6BX 4ON9A 2KI5A 3C5HA 3VMFA 1UM8A 2B8WA 2YV5A 2CCGA 4KVAA 2ZR7A 1G7RA 3TSOA 1WDTA 1R8QA 1XJCA 1LFDB 2BBWA 2ZI3A 5C4GB 3VTKA 1NL3A 4QBGB 2WHXA 4OYHA 5FOWA 4RFSA 3OIUA 1YZKA 3FOZA 4XWAA 4B3DA 2BKUA 2NQ2C 2VP4A 1KOFA 2C2HA 5LD2C 2QI9C 3T34A 3AV0B 4XVQA 1OF1A 4EJSC 3VNUA 2CL7X 5JI3E 4B3CA 1EFCA 3THYB 5JSZB 3A1UA 1G291 2BJVA 1KO8A 1T8UA 4BZPA 4CEHB 4PQYA 2EYUA 2VRWA 1Z0KA 2Z5FA 4LZZA 3WBKA 2VHQA 4XTRA 4P4TA 2RHDA 2VH5R 1VCMA 4AURA 4D26A 2BCJQ 4HAYA 1E2KA 2KB0A 4MRNA 2OG2A 5J4VA 3VFDA 4R98A 2GILA 1YR8A 2FPLA 2P6UA 2V55B 1E2JA 5JZVA 3MAAC 3IKJA 3BFVA 1HYQA 1UADA 2JLQA 3CZPA 2ZE8A 1XX6A 3CLVA 2ONKA 2O8BA 3KQUA 1OJLA 3NBZC 2XSZA 4KYIB 3ADCA 2OM2A 4B2IA 2J0UB 3W9YA 4L8GA 4Q4HA 4HUQB 3DKVA 3CPHA 1QHHB 2ATXA 4RFSB 3ZDQA 5FUVA 2A5YB 4YMSA 1UKZA 2QAJA 3Q72A 4BLTA 1W36C 1DAHA 4XWOA 1AIPA 4P4SA 3QG1A 3K70D 1E0JA 4JKIA 2N1BA 5DYIA 3THXB 4KV9A 2GESA 2IS4A 2O8DA 3ZZTA 2ERXA 1OPXA 3MSXA 3E2IA 4M8NE 2ONJA 2PJZA 3LW8A 4V0LA 1VG1A 4C4PA 5HCNA 4FMBB 1N2CE 4H1UA 2VSFA 3ETLA 1NVWQ 3ASYA 1YU9A 3TH5A 4LY6A 4QGGA 5AJVB 1P2UA 1W0JA 3DZDA 3AQ4A 1XD2B 4HAWA 2IBMA 1KSJA 1LNZA 3B1YA 4A9AA 2AD5A 1CJVC 4I1VA 4PFSA 3U2QA 3I8XA 2HXYA 3IEUA 5ELXA 2FOLA 2IF2A 5TDHA 2ZRCA 1T3HA 2ZRGA 4CEIB 1T0JB 4OHYA 3Q3JB 4B44A 2NG1A 3F8TA 5E7JA 1TQ6A 3VQTA 5FFMA 3NHBA 1RJ9B 5JCPA 3FKSD 1DTSA 3QXXA 1AGRA 1OFUX 1TU4A 3PEUA 1T3SA 1TQDA 2QE7A 3TE6A 4Q00A 4GNKA 1MO5A 1WP9A 5FTMA 1TEVA 2BBSA 3ONWA 2ATVA 2IWRA 3FTQA 2VQSA 2Q6TA 2ZAMA 1N6PA 4AYTA 5A5GA 4RD2A 1KHTA 3CX6A 5HE8A 1PLJA 1C4OA 2BM1A 2EW1A 2O0JA 4B73A 1IOZA 1NSFA 1RRFA 3FMPB 2TMKA 4G5SA 1E1RA 2RB4A 2VHCA 3TVDA 1US8A 5JFGA 4HDCA 1Z2CA 5BQ5A 1QG4A 3UKDA 4MGZR 4DLZA 1XTKA 1E9RA 4LC0A 1KY3A 1P6XA 1XD8A 2XJ4A 1DAMA 4O25A 2EWVA 1G8PA 2HCJB 3LWNA 4FWTA 3W5JA 4DUGD 3K0AB 4UQOA 4UXIA 3VHLB 5C4MA 1YZNA 3I3SR 1OV4A 1T6NA 5KDDA 3K1JA 1G9XA 1G6HA 4MKFA 5DIFA 4AKHA 2H18A 1MO3A 3HU2A 2OBLA 5G41A 4HUTA 4D25A 5JJLA 1GDDA 4WZBE 4A4DA 1CR0A 2Z43A 3KJGA 2F43B 2PZGA 3U4QB 2YYZA 3C16C 2F3TA 2QSYA 1EX7A 5CDFA 4M21A 4FCTA 5UKDA 1FQKA 1NBME 4LYFA 4OK5A 5SZIA 2IYRA 2BBOA 1SXJC 4Q02A 1Q1BA 2ZRKA 1W36D 1NIPA 5AUPB 5EP3A 1F60A 4DBLC 3QOFA 5EZ5A 1K8RA 2JDID 3LLUA 1I2DA 3I32A 2ZS9A 2B7BA 1D9ZA 1Z6AA 2CMKA 2WVJA 1GSIA 1TX4B 4A0HA 2HEIA 4O2LA 1W44A 4M1OA 3VHXA 1U0LA 2CL6X 3R9WA 2ZI5A 2EFCB 3GEEA 4QGHA 2C77A 5J5CA 4JMPA 3SFVA 5M04A 4B47A 4DXAA 1G8FA 1GL6A 2H92A 1VCOA 4HLUA 1WBDA 4M53A 4RD1A 2OBNA 3SQXA 1LTQA 1FTSA 3BIFA 1YE8A 4DT1A 1U9IA 1TEXA 3TR5A 2CHVA 2EVWX 4ERNA 1RYFA 5EJEA 3RRYA 4FI3C 4JYBA 3AVXA 3FFBA 2WKPA 3MWKA 4PPFA 2D2EA 4KCGA 4A82A 3OZXA 3PUWA 2OAQ1 3DDCA 1G4AE 1XXHB 3LQRA 4LK2A 1EWRA 4LGMA 3CRRA 3W6PA 2AWOA 1KAOA 1G18A 4BFTA 4Z1MD 1FUKA 3O8RA 5F3WB 2C9YA 3CH4B 1IY2A 4JZKA 3SQWA 2GDJA 3BB1A 4QXAA 1GWNA 1OXTA 1NJFA 2HDNB 1O3YA 1ZUNB 2EFEB 4KFUA 5FL7D 2YVUA 4L4UA 3GJ4A 2ZXUA 1XZPA 3NC0C 4FMDF 3SN6A 5EQTA 2IYLD 2J45A 1NG9A 2IT1A 2ZYTX 1N6HA 4N0DA 1X1RA 2UVQA 3THWB 2WWWA 5AUQA 3THOA 1SXJD 2J3EA 3BH0A 3ZS9A 3UWOA 2VP9A 2ASEA 2BEJA 1QRAA 1XTQA 4NYJQ 5CJ2A 3H1TA 4IDOA 4CEHA 3UANA 1AQYA 3NBFA 4RVCA 1UFQA 3QNUA 2NPFA 2ECKA 2FE4A 2D74A 1GKUB 1Z0JA 1LS1A 2ZPTX 4BFVA 3NC1C 2BOVA 2G0NA 5A0FA 3F5FA 1NN3A 5DI3B 1R7RA 2GAAA 3VR3A 1J2JA 1TUIA 2GKSA 2WIAA 3GMTA 3M6AA 4OL0A 4AI6A 2IYSA 4HEJA 1DPFA 2QM8A 3PG5A 1DAKA 4M0LA 3T5DA 5IK2A 1X6VA 1PZNA 1DAEA 1DEKA 1JEEA 4Q18A 1S0UA 4G5OA 1Q22A 2BKEA 3TQCA 3EAQA 1VYVA 3AKEA 1QZXA 5L3QA 1HTWA 2WJJA 3CF6R 2DB3A 1GOTA 5HTKA 3ZIAD 1KJYA 5G3YA 4LX0A 2PBRA 3THWA 5FBQB 3Q7QA 4HZIA 3E5HA 1CJUC 3KDSE 4PXAA 4LDJA 5DI3A 1PVOA 3IUYA 4BECA 1E0SA 2JJ2A 1NBMA 3BH6A 1QHGA 2YC2C 4S35A 3ASZA 3H84A 4B3FX 3NG1A 1U8YA 4QHSA 3EPKA 5TMPA 2Z83A 1NLFA 2FF7A 4TWZA 1P4SA 4ZCMA 3SE0A 3CNOA 4JJZA 4IJMA 3DM5A 2ZUBA 5JI2E 2H5EA 1P2VA 4M9XA 4Q03A 5EP2A 1G20E 3ND9A 4I99A 1G17A 4JL6A 1NKSA 1ZC4A 4HB2A 1FW6A 1WBBA 1G1MA 4LPKA 3TUIC 4QKQA 4ZIRA 4OQXA 1HE1C 4Q9KA 2AKYA 5KDOA 4LJ4A 1E96A 3U61B 3BOSA 1WA5A 4BEBA 4TN1A 1NBMD 4DDTA 3C15C 4NE2A 1HT1E 4N3NA 3T15A 2PZEA 2ORVA 3KUDA 2YC4C 5HKKD 2J0QA 1Q57A 4GI7A 2PT7A 4RJLA 2FA9A 2XTMA 5HCIA 3ZIAA 3NDPA 4H1VA 1LB1B 4CYMA 1P9NA 2QY9A 5DN6A 5JSZA 4BLPA 5G40A 4H9GA 2GETA 1P62B 4LBVA 2FPKA 1HQCA 2Q3MA 1GITA 2W2VA 2BMDA 4JSTA 2H1LA 4TL6A 1K5DA 4QG7A 5SZKB 4IEEA 3T5GA 4ESHA 4LWZA 4NYJR 1FMLA 4QJ4A 4DEYA 1XPOA 1SVLA 3LD9A 1P60A 1XEWX 4DB4A 2ANBA 3Q8XB 1E32A 3FKQA 3GLHE 1BMFA 2XAUA 3DHWC 2QP9X 1Y63A 1P7CA 2FSIA 2WSSA 4X8MA 2J46A 1VCNA 2WMOB 3TNFA 3EARA 1XPUA 3O47A 1E79D 1W47A 5FPKA 2ODBA 2OILA 2D2FA 4NL4H 4G5RA 3B6EA 1XB2A 2ZSFA 2H17A 4QHYA 4Q1FA 1ZIPA 1GM5A 3AEZA 3EC2A 3REGA 3G82C 2NOAA 2HF9A 2JLXA 4CIDA 2ZAOA 1ETUA 5BW8A 3WHKA 2JJ8A 1F6BA 3P4XA 2F9MA 4GDFA 4Q9HA 3B1XA 3OF5A 3THXA 1RZ3A 4YMTA 2XB2A 3ZH9B 2WM9B 1Z6XA 3UG7A 5LB4A 1GP2A 1YR9A 1COWD 4LV6A 4J0QA 1E9EA 4LV8B 4Q9LA 4POAA 4A8JA 3U3RA 2R62A 1OXVA 2JJ1D 3BD9A 4Q9JA 4BZQA 1VG9B 4YDSA 3OEHD 1RPZA 4Q47A 4L9SA 3THYA 3TW4A 4HAXA 3IILA 1Z29A 2FFBA 4BRWA 2GA8A 2IHBA 1IN4A 2ZE7A 3SZRA 2J9RA 4M9ZA 2J1LA 4OHZA 5KNCA 2P2LA 5CB8A 1GKYA 2HCBA 4G3XA 4MQBA 2FSHA 5BN4A 1IONA 1JEDA 1H8EA 1XDBA 4A6PA 2FSGA 2VPPA 2W0MA 4OJQA 4QGAA 4PSAA 3ZGXA 5P21A 3L2OB 4QC2A 4TLCA 2R6FA 2P0EA 4PPNA 4B35A 1NN5A 1SGWA 5FPYA 1CR2A 1WE2A 3QEJA 3CWZA 3X1ZA 1TQ2A 4LC1A 5FOVA 2ZSAA 2E87A 1DAIA 1U8AA 4IDHA 2ZRNA 1R0YA 5LB2A 3QBVA 4TQ9A 3N2EA 4LYAA 2PEYA 3AVTA 3ZQ6A 2OCYC 4GZLA 2I1QA 1D6JA 1SVSA 4D6PA 1YHNA 2N46A 1MV5A 2G6BA 3ADBA 2IYTA 2IL1A 4Z8YA 3AKCA 3PUYA 1LF5A 4M2LA 3ND8A 1P3JA 2Q3HA 3K9LA 1G3RA 1I4LD 1F2UB 1OXSC 1CLUA 2B8TA 2ZE5A 2H57A 1E3MA 4K8OA 1NY6A 1HH4A 4QL3A 4Z1MA 4Z54A 5LDDC 4XD7A 3WRYC 2QBYB 3AF4A 3AVWA 2FDCA 2KJQA 3RABA 4DCNA 1ZP6A 4D4KA 4FXPA 5TV2A 4EPVA 3FHOA 1YRBA 2FGKA 2ODNA 4LBWA 3U3OA 1A82A 4TL9A 4F7WA 2EYQA 3K9GA 2BDTA 5JWHA 2ZRBA 5BN3A 1XTRA 1XWIA 4NYIQ 2QZ4A 5CLQA 3QF4A 1NLZA 2ZM5A 2G77B 3HR8A 4NHOA 1G21E 1VTKA 1KDRA 1XZQA 4QBFA 5J4YA 3QXJA 3H2YA 3QEOA 4EPYA 5E7MA 1UKVY 2QAGB 3AF2A 2IXGA 2IEZA 2RHMA 1NG1A 1XJ0A 1E4YA 1RIFA 1F3OA 1BOFA 2QMOA 3U44A 3W34A 1S3SA 1J70A 1JAIA 1Q20A 4B48A 2XOKA 3UATA 2J87A 1M1YE 3K09A 2XZLA 4A92A 2ZJ8A 4OHWA 3KXKA 4LHWA 4UNPA 5CIWA 2AX4A 3LO5A 4BZXA 1AA9A 1DARA 4NU0A 4JL8A 1IXSB 1VHLA 5J4KA 1II8B 4OHXA 1SKQA 1KGDA 1Z08A 4KSCA 1XRJA 3RS7A 3GLHA 4RFVA 2VBCA 1Z0IA 1YZLA 4M1SA 1Z8FA 3ZD7A 3C41J 3FMIA 1GKIA 2LWIA 3SC3A 1S3GA 2Q9CA 2YWHA 4IVPA 1SHKA 5FOTA 4HB0A 2QMEA 3CRW1 3WRXC 1FQJA 4JS0A 3EA0A 4IOJA 4ZI3A 4MKHA 2REXB 2X1VA 3KB2A 4TYQA 3MWLA 1KDPA 3AKYA 4NCIA 4NCHA 2BC9A 2OE2A 3UXMA 3AVUA 3HU3A 3GLGA 4TLAA 5FPHA 2KWIA 1QHIA 3K9NA 1AK2A 2GTPA 2F6RA 3H0KA 3TGPA 5TVKA 2CHGA 1QHXA 3SBEA 5EXXA 2GAOA 1W2GA 4DZZA 2ZJOA 3R9IA 3RS5A 1T3LA 1P61B 3TJZA 1YRAA 2NO7A 4US2R 3PUZA 2G0TA 4TYWA 2WV9A 3I5YA 1Z63A 1JI0A 1FTNA 4TT3D 2KSQA 3Q5EA 2OAP1 1N6OA 4M1KA 1W49A 2D62A 3LY5A 4GMXA 4ARZB 2DFNA 1N6KA 4D4LA 4YXWD 4TT3A 1ZAKA 5JLJA 4P4SB 4QBHA 2F43A 2XNSA 1DOAA 2ODWA 1FX0B 3NHAA 4LPSA 3NEYA 1KJWA 2IXFA 4JYCA 3AKDA 2PMKA 5JEDA 4CEJA 2EU8A 4NDZA 1EFUA 2J0UA 3PEVA 2C95A 4IDNA 3A37A 4BGDA 4LRWA 4BE7B 2XTZA 3WP0A 3DMDA 3V9PA 2V1UA 3FKSA 3SFZA 2NTYC 2A5FA 2XB4A 3BC1A 3RRMA 3QKUA 3VU9A 4ZKDA 4ASUD 1BS1A 2OV2A 1OW3B 4EQ6B 3PQCA 4BQSA 3ZD6A 1G7TA 5CB6A 2X2FA 4BEJA 4XH9B 1W46A 4BRUA 2JEOA 3UMRA 1G3MA 2GF0A 2FZ4A 1DAGA 3AUXA 1PUJA 2ZANA 3R7WB 1XFAA 2RGDA 4GP7A 5EE5B 1ZW6A 1W0JD 4AKIA 3B13B 3VX3A 5CIQA 1G5RA 2IS2A 3SJBA 3D7MA 5F98A 1XMIA 3AUYA 4TQUS 3QPUA 4NCJA 1RVDA 3UMFA 5L3VA 2QMHA 2QGZA 3B9PA 3TKLA 4Q7JB 1W4RA 2XZOA 3JVUA 3KXIA 2QPOA 2CLSA 4EIWA 4DLSA 5FH9A 2A5GA 3K9HA 2C99A 3KB1A 5B2ZA 4NONA 1FNMA 4C0KA 3A36A 4BWYA 2A2ZA 2X19A 4Q01A 3SJCA 2JLYA 2GJKA 1AZSC 2WOJA 4Q4LA 4WXPA 4KU4A 4CF7A 5CITA 2WMNB 2WJIA 1Z6GA 5CK5A 4I1SA 5KO2A 1N0WA 3SDZA 3PEWA 5FR2A 2O8CB 1HE8B 5EXSA 3LBIA 2IYWA 5FPSA 1ESMA 4OI1A 3SYLA 2R9VA 2R44A 4KFRA 4JLVA 5JWRA 2ANCA 4JKYA 4MITA 2QQEA 2QUZA 3LAWA 1SKYB 3OEHA 2GEDA 5KOYA 1W36B 1S9DA 2EFDB 1B0UA 2CK3A 2VHJA 1RRGA 2CXXA 1E98A 3CM0A 4DCTA 2MSDB 3BK7A 3GLHB 1H8HA 1LY1A 2V4ZA 5G3ZA 3WMFA 1N5KA 4JLAA 3JZAA 3RS4A 4HI0E 4B33A 4BFSA 1PJRA 1E2EA 5L3SB 3L0PA 1DG1G 2BMFA 4KI0A 3A8TA 3DEFA 4AKGA 4A15A 5BN5A 3K0CC 3NTUA 1G5PA 4DSTA 2R6AA 3QUSA 4OQMA 1NN1A 1TUEA 4HAUA 1Z0AA 4O2RA 1VIYA 2FN4A 3IBGA 5K8UA 3VKWA 1N0VC 1XMSA 3LRPA 4W5HA 1G16A 2FNAA 4CT5A 2YOFA 5L3RA 4TSFD 3VR6A 2GK6A 1KYIA 3K0FB 1ODFA 4LUCA 4LBYA 4MYUA 1II0A 1VDZA 3QVVA 5GJVC 2DFKB 5J47A 4M22A 2F1RA 2R6DA 2DR3A 1X8JA 4GT1A 4NP6A 2PT5A 3C4JA 5EXTA 5D3QA 2HJGA 2RGCA 3ZYCA 5JRZA 2IX3A 3TMKA 5TY0A 2AFHE 4DLYA 1W4BA 1NN0A 5JJKA 2WWHA 2QROA 4WAUA 4UNSA 3KUCA 1YJ5A 4A2PA 4DB2A 3QF4B 4G0NA 2GXQA 2X77A 1VHTA 5KNDA 3EASA 3HU1A 2FPMA 1UPTA 5E4FA 4OKSA 2VP6A 2FX3A 4A8JB 3FHTA 3A4MA 1G41A 5JS8A 5FTKA 5KSPA 4PAMA 3B1ZA 3CNLA 2VSOA 2ZSEA 3NEJA 1JAHA 4IKEA 5KU1A 4CEJB 2FEMA 2WWIA 4M1WA 4A2WA 1AQUA 4HYYA 2IYQA 1AN0A 4XIGS 4MRVA 2A3RA 1LVGA 3CW2A 4JT4A 4KSBA 1S2MA 1NMYA 3B1WA 4EPWA 3CPEA 4PC3A 3UIEA 2Q9BA 2X8AA 3BERA 4M9QA 1CBUA 1ZINA 3HYRA 4C0SA
chains in the Genus database with same CATH superfamily
3DD5A 3OCUA 1EP9A 3QWHA 1I6KA 1ZJ4A 1R4NA 2GHIA 3N9IA 4QUGA 1DC8A 1D03A 1K3FA 4JLJA 4M7RA 5DNWA 2Y3IA 4DNPA 1QOZA 1ULZA 5FIUA 4F56A 2HUNA 2XMPA 5KSYA 5FO0A 3H2ZA 1Y8CA 3E1SA 1GDHA 1JDBB 4IIBA 3TDNA 1U2QA 2XUHA 1B3BA 2P1RA 1VYUA 1J90A 1RBMA 1Z9BA 4JUFA 3RU3A 5BWLA 3QKWA 3HVJA 3K70B 2YCBA 4CG0A 1W7AA 3JATB 3RGWS 3VPSA 1R5BA 1RLUA 2YBEA 1FDTA 4W9NC 3A6PC 1E1QA 5JPCA 3ZV5A 3U6KA 2W6PA 3NDIA 3T52A 2HCTA 3ANLA 1FU8A 5AJWA 3HDYA 3HXKA 3KQKA 5F64A 1IZYA 3HBMA 1ZJ5A 1N9KA 3IP5A 4OAOA 4NFYA 3RUAA 1QTQA 1XXHA 1D2CA 1NVDA 2VXBA 1OA0A 2SNIE 2ZCUA 3B8HA 1O96A 4JOSA 3PCTA 3P19A 2IVZA 2ZDQA 3B2NA 2GWRA 4N3CA 5JVDF 3BSWA 4IWYA 1UKCA 5FFNA 2JANA 3B3JA 5J63A 3OKFA 3KG2A 3N8IA 2GEJA 3QQ5A 2WNSA 4TLLB 3ICWA 1ZM7A 1VBMA 1AMNA 3MWEA 3EC1A 4HLUC 3DE1X 2IXEA 3L1KA 5EGNA 4CMAA 3HVIA 4XUDA 5A1TA 3L9XA 5I48A 1SKYE 2JI4A 1M6WA 1O96B 2ZIGA 3PGMA 4IO0A 1Q6ZA 1TTQB 5L7TA 3MCTA 1XAIA 3UHAA 3K2EA 4J0JA 2W6JD 3PCXA 1MC1A 4XVUA 2JGAA 1V7ZA 3PVSA 3VAYA 4CF6A 5DHPA 1QHYA 2I6GA 4IS2A 3HWX1 2ID4A 1RM4A 1UZLA 4PICA 3IHWA 4R7GA 4Y2RA 4JDPA 4DOMA 1N5LA 1VECA 4RM3A 4MKIA 3W5AA 3U7HB 4G4SO 3CFYA 3OVMA 4YV1A 1EIWA 4Z0PA 8ABPA 3IBFA 4QXPA 3ZHUA 2NU6B 4KXMA 3P2EA 3IERA 4DA0A 1GRVA 2P2CA 4UUPA 4DQDA 2PCLA 5J5VA 1MW9X 3WNVA 5EMMA 2JJQA 4EWLA 3IQWA 1YS7A 4HMPA 1YC5A 4FU0A 1SZPA 1QUFA 5G53C 4QOHA 3V1MA 1ISHA 4P7KA 2EKPA 2EX0A 2Q3EA 1PD0A 4H7JA 5EZYB 2FPOA 4M76B 2CCJA 3H19A 5TGDA 1TM5E 4KWCA 2WSIA 3HSKA 4UUAA 3U7EB 1DVRA 3D0QA 2I71A 1KP9A 3PQ8A 4S0ZA 5C34B 3QWFA 1EHCA 1ZI9A 2ZRQA 9LDTA 1QP7A 1QOQB 3O26A 3DF7A 4OQFA 1WXQA 2PJRA 2Q41A 1W19A 4PHTA 1SQ5A 2C84A 4X8LA 4DG5A 1WB9A 4YONB 5JVDA 4LXXA 2HJVA 4UM5A 4DDUA 1IZZA 2XQJA 2YJTD 2ZITA 2V58A 3B1JA 4HDMB 4TTVA 4F6RB 4MRPA 4CFZA 4HT3B 1T4GA 3A1WA 2CFSA 2FLKA 1JQJC 1RBQA 1YC2A 5GVSA 4WBSA 4CT0A 1FDWA 2Y05A 1JXAA 3CW8X 3LWDA 5BMVA 4DKJA 4C7OB 2Q7XA 4REMA 4C87A 2AF3C 1GNLA 1VJDA 5F2KA 1KEWA 3GZJA 2DZDA 2PWBA 2VR1A 1BH6A 1RJEA 1WHSA 3HI4A 4NAVA 4PXSA 4AX8A 2RHHA 1UBMS 2VNIA 3BICA 4CE6A 1J2EA 4HTFB 2Q7OE 3PA8A 2WBLC 2OM6A 4L3VA 5K3FA 2FY8A 3K09C 4KMSA 5EPUA 1SC4A 4Q3OA 4KXVA 4RL6A 1AT1A 3HYCA 4QXQA 2F3RA 1KAGA 2WF8A 5GVRA 3DG9A 2IH2A 1TQHA 2LKDA 3W8NA 1LVHA 4N49A 1BHQ1 2QWXA 4ZGWA 2M9MA 1VL0A 3IPLA 1OBOA 2AB0A 3WKAA 4BJHB 1QH1A 4J6EA 4BJ6A 4EJ6A 3WQBA 4ER7A 3R9XA 2OT3B 2VWGA 1E89A 2V7XA 5D00A 2XF8A 4CQNA 2C5SA 5C9ZA 1QAMA 4MMZB 3RF7A 3VU0A 3ZJVA 3CLTC 3N2KA 4MLDA 4RCYA 5J2UB 1NNLA 1TTPB 3OFVA 4EUNA 2J3JA 3E03A 4KUGA 1E1RD 1XQ1A 2LV8A 4JWTA 3G2OA 121PA 3ZS8A 1NSYA 1PEAA 1WEHA 1I1QB 2OO3A 3I3OA 3DQQA 3KKPA 2QLLA 4G5HA 4MWBA 3DDZX 3VOSA 3VYRB 1XU4A 1B1CA 1JKJB 2JFXA 4C0XA 5FUXA 1ESNA 4ZVKA 1GQOA 5DWQA 4K28A 1EBFA 1MAAA 1CDDA 3L5KA 4LG1A 1BD4A 4NG5A 3L02A 3RYHA 1C9YA 5IJWA 4KHPB 2PLWA 1VCIA 4PLCA 3A6EA 3K0EA 5G4LA 1IM8A 1DTWA 4RPJA 5F1KA 4PBRA 3QHAA 2WYOA 1OFHA 3OFSA 2CJWA 4R7ZA 3OEEA 2EGUA 3ZWMA 3IX7A 2O8DB 2V6FA 3UMCA 2XVXA 1YHZA 4BVFA 2F7SA 5FTJA 2HSDA 3KOOA 5TEWA 4HPJB 4WCVA 4D9KA 5LUAA 4R1NA 3HZOA 1GYRA 3Q1KA 4BUCA 1B16A 4CFYA 1ADCA 2QD2A 3EZ7A 2O7NA 3LH5A 2QV0A 2JHAA 1DC3A 2IOYA 3EMVA 2N1MA 1FB5A 3ANTA 3SHVA 3WLRA 3SKVA 3B1KA 4M9CA 4E70A 1Z2AA 2V6IA 4HEA6 3FZGA 4B4VA 4JOQA 3ORYA 3WLOA 3DFUA 1QM5A 4YP0A 1FNNA 3G8CA 3K7EA 4BV8A 2A9KA 4AYWA 1VL5A 2GT1A 4O4LB 1ORIA 1GG5A 1JZQA 1JBQA 5MGBA 4FYKA 1PWHA 4YASA 4XQEA 5BUSA 2Q7DA 1PVVA 3H3FA 5B7PA 4PTLA 2CB9A 4EB3A 4BFYA 1FIUA 4LSZA 1OGJA 2MSKA 2HK8A 4PZCA 5IARA 3R76A 2CHQA 5DSZA 1XVTA 1DEHA 4A0RA 3G5UA 4NV0A 2YWFA 1BKDR 3H1PA 2J6IA 2J9XB 3KSDO 4HDRB 2YHSA 3GEHA 4NR0A 4RPCA 2XMQA 4EZIA 5B4TA 4TMXA 3TQQA 4OGKA 3WYEA 3GJ5A 1KSFX 1XXLA 4MW2A 3RV3A 4ROTA 4KIFA 3USCS 4F3CA 2Z2XA 4O4HA 4EW2A 1KMMA 1WXIA 1KPGA 1ZNQO 5CDFE 2VSXA 3VH2A 3LDGA 4DEVA 2B35A 1YBHA 5KNCH 1EUQA 1DOZA 3K96A 3EAFA 3GH1A 3D81A 4J94A 1QWSA 1YASA 1AXGA 2C42A 2OD7A 3KKEA 4J3NA 4BTVA 1SOMA 5HKKA 2PYIA 2RAVA 1Z12A 3GGSA 1CJTC 3EULA 3KTDA 4PWZA 1O0SA 5A4DA 1ICIA 3GVXA 5JS6A 4WXRA 1OKKA 3TG8A 1N8TA 3ZJTA 2OBYA 2C7VA 2WJYA 1COZA 3EWAA 1NBWB 1OI7A 3GX1A 5K3AA 2ZUDA 1IQ0A 4IV8A 4G41A 1BDJA 4ZRMA 2B83A 2QMZA 2YRFA 1G8GA 1KEVA 3CLRD 4FEYA 4KP7A 2NM0A 4TWBA 1TZKA 4GEKA 4MIEA 4AS2A 5JJIA 4C0JA 1ISIA 1GADO 1WQ3A 2WTXA 4RMNA 4G5GA 4U7JA 1R0SA 1K3TA 4ZT7A 4N0MA 4UU7A 3TX6A 4YP6A 1W9HA 1M54A 5L7YA 4BNHA 5FUBA 2BI7A 2R97A 2XNCA 1KE1A 5FOXA 2Q8PA 1HTTA 1GRRA 4JVNA 3UK1A 4ECAA 3HNPA 2BM0A 3KR0A 4II7A 1W59A 4L57A 4ZP1A 3V00A 1DELA 4BJ3A 1CY7A 5IBRA 4IGFA 4Q82A 1HLFA 4TRRA 2WJHA 3GLVA 4DMGA 4B71A 2IUFA 3B6KA 3B51X 2NVBA 4G5XA 1ZLXA 4N8EA 3KCQA 2VT3A 4TN5A 4C2UA 3DPIA 1EK6A 1VHQA 4KDEA 1H0KA 2F2TA 1GPKA 1JKXA 2BISA 4UMVA 1ST3A 4EUFA 3Q8MA 1RFGE 4PGMA 3O4RA 4OMFG 1ZN8A 2EW2A 2V3CC 1EAMA 2BMWA 2DT5A 1XF1A 2JGDB 4BFXA 3BBLA 3GUCA 1HQYE 5E4JA 3S1LA 2YR0A 4G0XA 4RSRA 4UNQA 1KI2A 1CUVA 3E22A 3SSAA 1EK2A 2DWPA 5DT2A 4E14A 2XAAA 5IYZF 3PRHA 2EIXA 1NUUA 2HFJA 4TKUA 5KNBA 5CVDA 5E0KB 4C0AC 1RQXA 3TGWA 2Q0HA 3EWIA 3KNZA 4I2VA 3X43A 3EF0A 1T13A 3LHFA 4NBSA 4NQZA 3TRHA 2WU4A 3GAAA 5K8VA 2PZKA 2WJ6A 3V33A 3Q5GA 5DX1A 4UPEA 1M1NA 1U1CA 3U60B 3Q3EA 4Q48A 1C8BA 3CEAA 4F04A 3ZE1B 2ZR9A 4H2DA 5D86A 3DWGA 3QLUA 4YQZA 4LOJA 2PZLA 5TVGA 3PX2A 1QP4A 1I1NA 3D31A 1VXOA 5H68A 4P92A 4GC5A 4UKDA 4G89A 3HP1A 3RWBA 1S2LA 4CI0B 2O3UA 3FI9A 3LU1A 2TSYB 4E5KA 4BRZA 3QSYA 2C2BA 1BA3A 1E0KA 1T1SA 4R2XA 2VNAA 2C5EA 5GP1A 4JBGA 2H59A 3QJYA 3RLIA 5A5EA 3U3KA 1WHTB 1XRLA 2A92A 3OIFA 4AC9A 2YFYA 1MTZA 4TXMA 1U65A 2AMVA 1ESDA 1QIFA 5EXPA 2ZQZA 4KN5A 1G4HA 4B5KA 4X8HA 1RABA 5A6SB 1JQLB 2O2SA 3NYQA 4RF2A 3KETA 4EG4A 4XYEA 2CLOB 3T94A 3K6RA 4G1EB 4BFWA 5A5VA 3U7FB 1AKMA 4IG4A 2HF2A 1KA9H 2FPXA 1RWNA 4FX2A 4HVCA 1Y6JA 2WFAA 2IX9A 2BFWA 2PKCA 1A76A 2WHQA 3JQEA 4JR2A 3TFQA 3WB2A 1YZ3A 4A1FA 1A96A 2FEPA 2PRKA 2FPUA 3BN3A 4MS1A 4XLLA 4UOEA 4PC6A 2CJYA 3LYLA 4MI1A 3GXBA 3GP8A 2J85A 4FGSA 3JRXA 3KKOA 3ACCA 5LKAA 4R2LA 1TJ4A 3FH0A 4IAOA 4JQSA 4MA0A 3TOXA 4PLGA 5G0VA 5HZMA 3EWNA 1U8UA 1Z4PX 4BU1A 3ADKA 3QYAA 3P9QA 4BE4A 4DM3A 3OOJA 4H3HB 4MW0A 1OQAA 4AK9A 7YASA 4K0RA 3FCUB 4L73A 5GPBA 3TW0A 3V4SA 5CGZA 4AG6A 1L5FA 4YFVA 4L8YA 4ZYZA 1W25A 4IZIA 5B30A 2WE8A 3CZ4A 2R1TB 3HY3A 1PL6A 4V39A 1NDHA 5L4LA 2FFQA 2ZR8A 3LQ1A 1SK8A 4TV8B 3GRFA 4LJYA 4RZUA 3NPMA 2AUTA 4TM8A 5FBKA 5ERYA 2R8RA 1PBNA 2YYAA 4MAMA 4NENB 3TX2A 4LJ9A 3KR9A 4W99A 3WGZA 4K0KB 5H1YA 2BTQB 4RUKA 4Q9IA 3SEAA 2DRIA 5C5IA 4WNIA 5JDCA 4HN4B 3JARA 2Q6IA 1Z4KA 2EF0A 4AS3A 5AP9A 4D74A 1IY1A 1ZMRA 1X1QA 3GH3A 1U2SA 4IS3A 3LLMA 1L9KA 1E9DA 1DWUA 3AONB 3H1AA 5JHGB 5KUTA 1EMDA 1Z8NA 1SCBA 2VUIB 1T0UA 5LOVB 3MQFA 3W1EA 3IEKA 3FOBA 1C7ZA 2C4UA 3KYJB 5JXIA 2HWUA 1UT5A 1YVUA 4GBED 2V0NA 2PSHA 4JY7A 2QRKA 3Q9NA 5DFAA 3RVDA 3R7WA 1U7OA 3B6MA 3QXHA 1PFVA 4AJHA 4JP3A 2P6MA 4IRXA 4UCWA 3FYUC 4F4HA 1JF8A 1T2CA 3STXA 4BV9A 3RAEC 3EPPA 4R8RA 1E4VA 4EMUA 2YHIA 5GIPE 3TIIA 4FXOA 2ZRMA 3BBPA 4F3NA 2O8FA 4BP9A 4YJ3F 3EC7A 2PL1A 3ESXA 3N05A 4DHWA 4EY4A 3F9RA 3IKLA 3KYDA 3GLIE 2GNPA 2OCAA 4XI9A 4EFMA 5C2JB 4BMOB 3EFOA 4Z0TA 3QIVA 5DCLA 1JDUA 1HYHA 221PA 4WSOA 3PUIA 3VR2D 5BXQC 1P45A 3TGLA 1N4AA 3LA6A 5AJZA 2C5LA 2NV6A 1ZEJA 1IJEA 2YNMD 1K8YB 1OVGA 4X7RA 3ZVRA 4DBLE 1JHPA 4QTXA 1EE2A 2JB9A 3QE0A 4KIWA 2O19A 5GY7A 1WXGA 4EJSA 5EHNA 2QL9A 2G71A 4R4JA 3L7JA 3QTTA 3SZMA 3E3AA 3TTWA 3AETB 4YTEA 4FFWA 3BRWD 1CUZA 4KX5A 1W96A 1WDMA 4F4JA 4JGGA 2IHNA 1HDGO 1UDAA 2RCNA 1ZNXA 4W9RA 4XM1A 4BNNA 4F2PA 1XROA 2XB6A 3EQ9A 4BVBA 3B89A 1E61A 2GXSA 1ZGZA 1GUBA 2BVNA 3HKCA 4PQFA 2HRZA 3OBBA 2WLTA 4MQ4A 5CGQB 1SRQA 4Z9XA 1B23P 5HPYB 5DHSA 1G4UR 1T0BA 1VB5A 4CDGA 1G8KA 4WOBA 5CD9A 5LXTB 3MLEA 1GPJA 5FD8A 2BFBA 1BNCA 5ULLA 5DCYA 1OTHA 2UUCB 2H54A 1DKOA 4R6XA 2OHJA 1GPLA 3TLCA 4V0QA 3CH5A 4M46A 2FZEA 2C92A 4YRKA 5I3ZA 2WI8A 4RCZA 1T9HA 1Z7GA 2J0SA 3EEOA 2IJGX 1CUUA 1QLHA 3HY6A 2GXAA 4IIGA 4RHYA 2DUUA 3AUKA 1VJ5A 3TDMA 3VJRA 3FTDA 1P80A 4E07A 1G59A 1VI2A 3KQTA 4B6EA 4B84A 2IODA 4MS3A 1TK3A 3F97A 3DR3A 4I9UA 1D4AA 4NH0A 1IVYA 2RE8A 1GV0A 2BZSA 2SKCA 3D6HA 4KJZA 2VDPB 1DAPA 2OQVA 1ZRMA 1IVSA 1ONSA 3IESA 1IUOA 1Q50A 2UZ0A 3IT2A 3PF8A 5C7YA 3NETA 2QNRA 1QX4A 5ALDA 3ENQA 1XV5A 1PUXA 3M2PA 1YUNA 4XKJA 1PQPA 3S2IA 5IKEA 1ORRA 2TRSB 2HIAA 3KKNA 3PRYA 2JCYA 5E4YA 5IU6A 4G01B 1T5IA 4GXNA 1QDLB 1HDIA 3FFTA 5JJCA 1R66A 3EVGA 2HRDA 4JLNA 4MWZA 5AW0A 3VKVA 3UT5A 4FCCA 3VR5A 3ZWCA 4DJDC 1P29A 4GYWA 3PWZA 3DZ8A 5FRDA 3SIPA 4CDRA 4ZMBA 1K7SN 3OP1A 1E2LA 2AOTA 3CR3C 3QMVA 2J4DA 3MT7A 1DX6A 5H3LA 1H4VB 5K0FA 1MB4A 4XRRA 1K7FB 5EAIA 1M7HA 3V1NA 5LP6C 4UJ5A 4Y9UA 1VPEA 2O0MA 4MMYB 3UZUA 4C7OA 3UV3A 3ETDA 2XVYA 3MT9A 4L50A 4HH1A 4O02B 2JBAA 3LZCA 4Q3NA 5G0SA 4JGBA 1OYVA 5C37A 4BNKA 4IIHA 4KXXA 4GXQA 4MW5A 4D9NA 5F1YA 1E3WB 2DYKA 2QUJA 5A4FS 3VYTB 3U44B 4YQYA 1CDEA 5CDHA 4LJRA 1BQ3A 1YI0A 2QEQA 2XGGA 3MGGA 4P4GA 4D4GA 5HM6A 2L69A 5AOAA 2IYEA 3AV3A 4GAEA 4KRXA 3RVSA 2OZLA 4XDHA 3QK7A 1U8CB 1F5SA 3K0BA 4HAVA 4KRGA 1B8PA 1DXYA 1WRBA 4MLPA 1KMNA 5FHQA 5A7HA 2D1SA 4YLGA 2EV9A 4B6PA 4FFRA 1TMOA 3U48A 4DREA 4QDXA 4JQYA 4YECA 4DLBA 2D1RA 3QEBZ 4DR7B 2NUTB 3E4CA 2ZUVA 3ENVA 4QGFA 3WGNA 1HZZA 3P2YA 4DKXA 4CR6A 5I9LA 3HB0A 1CW2B 1JXQA 1Y1KE 5HR5A 5J2UA 2J31A 3W5CA 3EZFA 3BX1A 2FR1A 5FBLB 1GILA 3DBHB 1LRLA 3WL4A 5A02A 3PEYA 2ZBFA 3R7BA 3R41A 4OEHA 1Q74A 4R0NA 3JYNA 3NKFA 3AM4A 3UFXB 3ZQJA 4CTMA 2QRPA 1TA0A 1IN7A 2XQGA 1Z7YA 2MCFA 4W5JA 3RODA 4H60A 4ZWNA 3SICE 3WK5A 1LCIA 4JP1A 2GSWA 5LLDA 1DL5A 5EMJA 2FX2A 2VFAA 4LCBA 1YGYA 2OXTA 1GGEA 2WSMA 3U31A 4EKEA 5IJ0B 3O92A 3O90A 3U3DA 1XTPA 3DD1A 1IBKB 2XNDA 2GVDC 3AB3A 3F4LA 1PDVA 4FUTA 4MDHA 1FRQA 3OY7A 1HURA 2HXSA 4B0OA 1KOJA 5F9HA 1ICEA 1W2HA 1GAEO 4NBWA 1QC5B 3OZBA 2P9EA 1OX5A 3B6ZA 1OH8A 4X63A 4DTIA 1WBJB 3ENKA 3PPYA 4UXHA 1UBSB 2D5AA 2VIIA 3NM5A 2XTNA 4ID9A 5CBKA 2IPAB 3AL3A 3WDMA 3TQRA 1XTBA 2WIBA 2QUKA 1A2KC 1N7HA 3A1VA 3IMEA 2ZJ2A 4DMHA 3OKCA 2VT6A 1NMEA 3COYA 1GZ4A 1HC7A 1QHSA 5H82A 2JIOA 2VDLB 1M5UA 1IWBB 2BGRA 2P6NA 2YV1A 2BF7A 3SU8A 2P9FA 1Y4ZA 2A0XA 2VNKA 1VLHA 1M7BA 2F3SA 4D7AA 3T35A 4CIWA 1YQTA 2FWMX 5L53A 3JSXA 1NRWA 1GPYA 1K1EA 2H6EA 3A4LA 1ZHFA 1F9AA 3OI7A 4C21A 2IH5A 2I1VB 2ZAYA 1P72A 3DZHA 2ZXEA 3ASUA 5GONF 2ILVA 1S8FA 4Q24A 3C87A 3G6WA 2IPOA 3QYPA 2I62A 4P3NA 4Z7JA 3VNSA 3PI7A 3ES9A 1UBGA 3FPCA 2BGLA 1KS9A 1N2OA 1QV6A 1W1WA 2CHUA 3GDHA 1BS2A 4G1UC 4ZV9A 5LZ7A 2YFHA 3MWJA 4OP2A 1N6IA 4PYRA 4UD6A 4RTRA 3EVCA 2X6TA 3FF1A 4YI5A 5EHQA 3HXMA 2WVHA 2R8EA 1PBTA 3W90A 4ZYXA 4A6EA 3UMBA 1O94D 1EK1A 1ZUHA 3FPLA 3IIMA 4JOBA 2W43A 4NBLA 1GIAA 1JPNA 3G2MA 4R05A 4B7XA 1OB2A 4QUEA 5GJBA 1I5OA 3I2YX 1BCRB 1P19A 2DT8A 2Q21A 2VYVA 4B6OA 4B76A 4XOIA 3W06A 5JNUA 1DEXA 3L7YA 1OLXB 1UXJA 3DULA 2RBEA 1BEEA 1N57A 4MVJG 2OXFA 4U0KA 4P4UA 3B7PA 4Y2GA 3NO4A 2J7PD 1DOHA 3WXMA 3OJCA 4F4IA 1YJXA 4WPGA 1GEEA 1QGAA 4G0OA 5FCDA 2ZG6A 4BNZA 4HRAA 1JKIA 3HWRA 4FDUA 4Z49A 4KHZA 3KJHA 3C3EA 2V5AA 4W82A 5GWXA 4LHSA 2BGUA 4WESB 1JI3A 3GLTA 3EWSA 3WL6A 3ICEA 3NQ41 1WY5A 1KTIA 4UTZA 1NP3A 3DEKA 4JT2A 4PF1A 1JSLA 4UBOA 4C78A 4EEKA 1QONA 4JJKA 5KOJB 1JMKC 4BEWA 4KPYA 4IIJF 4FONA 3DOFA 3SEFA 4B46A 3OOSA 2HF7A 1EA5A 3OE7A 3L7OA 4U63A 2G1KA 4MW4A 5HWSA 4G5YA 3VPFA 5DHAA 4B2LA 2J3HA 2NIPA 1FNCA 1M6NA 2NQTA 1GQFA 2AFIE 4WL0A 4HDQB 2IU0A 4AP5A 1ZD1A 3HPQA 4LMPA 1WHSB 4B3BA 4REOA 3AUTA 1CQIB 1DQSA 2EZUA 1O0CA 2WPDD 3VYWA 4AJ9A 1EK5A 4BO5A 1SVNA 2OENG 5JXWA 1NI4A 3BRCA 3LT0A 1DFIA 1QBGA 1SBHA 4KLNA 1E2FA 1ZM4A 4XJTA 1NR5A 1LA2A 2XZPA 3QPBA 4YVFA 3IJEB 2LRHA 3MJVA 1NPTO 4YWHA 4F3KA 4A0FA 5BRNA 3CUWA 2YQZA 2WWRA 1OZFA 3TRJA 3EVDA 2WSYB 3QPVA 4OQNA 1U3UA 2QT1A 3NHWA 3WGUA 1XSEA 1RE0A 1TM2A 4CIVA 1PQYA 3QENA 3NPAA 2PGIA 2Y93A 3IT3A 1EAYA 3VR4A 1HF3A 2AI3A 1TB4A 3H9JA 1AKEA 3REQB 1WY7A 2P67A 1IJFA 2J3DA 3D2BA 4LYJA 4PW0A 1U94A 5DNYB 1OHHD 4K1XA 1ODCA 3ESCA 4Q15A 2QLBA 2O48X 3MD9A 3ECSA 3R6DA 1IUPA 4MX8A 4ZOBA 1L7VC 1XR3A 5IWAB 1Z2PX 2PQMA 1EX1A 3RWOA 2AR9A 3QE2A 3U4QA 1HRDA 1T0PA 3H1GA 4IQ4A 3C7KA 5IAJA 3K8YA 5G1PA 5IVIA 4DANA 5LQUA 4XD2A 1KH2A 1GTL1 1QR6A 5ANRB 4DCMA 3U4DA 2ZU0C 3IO3A 2WJ4A 2HEGA 1E9SA 5AVUA 1J8FA 1Q17A 5FUWA 1M74A 4KX3A 4A26A 3K3PA 4MZXA 3E0XA 1KI8A 1XJQA 2ACWA 3ACBA 5THXA 2I4RA 2GM9A 5CDUA 1Q3TA 2XD4A 4MQEA 3S44A 2DXIA 1LRKA 1VMEA 3G8BA 4CM9A 4C43A 3O3NB 3W8FA 1KWGA 4H7IA 5CFMA 3LECA 3DP7A 3BE4A 2JLAA 2NXWA 4FDLA 2J3QA 1NYRA 3NAQA 3QA9A 4XSHA 4CM8A 5JNSA 1QCCA 2C98A 1OIWA 5CTJA 1GAXA 1H2YA 2CL0X 2QTVB 4J4TA 4ZT4A 4WKBA 3L6EA 3PLRA 1V43A 4C7XA 1PR3A 3C8MA 4X24A 1D04A 2QTWB 4XQ0A 4IKPA 1NONA 3ZGYA 2FMFA 1M6EX 5AHKA 2GPSA 3MFQA 1FTQA 2Z6VA 3ME5A 3QG5A 1PNQA 3Q7EA 4M1ZA 1SU6A 4NCKA 5T6MA 3UW1A 3W3AD 2VWPA 1D4ZA 3ZLJA 4JC4A 4P3PA 3VJKA 3DAPA 4U6NA 3RTCA 4C6SA 1MAVA 4F8JA 4F11A 2A0KA 2XMSA 1IC6A 2VHUA 5KQSA 4INOA 2PKQO 3O8BA 1Z25A 1H4QA 2D06A 4NY1A 1ZVQA 2BEUB 4N5MA 5D5HA 3SHQA 2I67A 3RT7A 4HP8A 4BNMA 1JXOA 4N40A 1X8KA 4PG5A 1SIBE 2W6ID 3AEQB 4RM2A 1QQ5A 4XYLA 4CLRA 4JX8A 1P9RA 2CNWA 1UH5A 3V80A 1OWPA 3WJ2A 2PRJA 3I5MA 1AUVA 5KYYB 2OEPA 3W05A 5LOVA 2GCPA 1T5SA 4S2UA 4AZ0B 2MJLA 1RCUA 1SUSA 5KVAA 1WTAA 4HTFA 2PFGA 4DAEA 1K8QA 3DEHA 2AEFA 2YY7A 4PG4A 1UBFA 2ZDGA 1EFHA 1N0HA 1PS9A 3BB3A 5GOZA 3SSOA 3WGJA 4UE3S 3UN1A 4DSUA 1KZGB 1EFRA 4PG6A 5ICSA 2C1XA 1YL7A 3HJNA 2NO4A 3GRCA 3HO8A 2V7PA 4J0DA 4INAA 4JLPA 1XG5A 1KVQA 2DBVO 3NVAA 5IJAA 3VC2A 1X8LA 2FMTA 1YZFA 1LNSA 4FDMA 5B3LA 3AK4A 4RXUA 2D8AA 1WIWA 1BXGA 2IEDA 2Q4EA 3DEJA 3A6DA 3QOXA 3ZNQA 3RANA 1QR2A 1JBEA 1TVKA 3C7CB 4R8MA 5TPZD 4A0QA 1S2OA 2PT6A 1QF9A 2X5OA 2AFRA 2BN4A 1HFEL 2C0QA 3K8ZA 3M0EA 5EZSA 4BL5A 4DSNA 3H2BA 4PPGA 2I76A 1C1YA 4O1MA 2AOUB 4YDRA 1H2BA 2PX8A 2XHZA 3HVKA 1LV7A 3P27A 4YPFA 3ZK8A 5IK2D 2FW6A 4Q1EA 3CH6A 4WZZA 1XZAA 3FCAA 1IHPA 3FNGA 4HJXA 1EVQA 1VE3A 3WWYA 4EB0A 4DV6B 1V95A 2DUMA 3ZE8A 3WLAA 1T24A 4FLMA 4HDNA 4UHDA 4EARA 2CEKA 3KQOA 1IY0A 3OO1A 2CJPA 1PR5A 2Z58A 1Y7LA 3D8RA 2B30A 4RESA 4DVGA 1XCGB 3R2JA 1Z5GA 4EPTA 1FYXA 5LD2B 2LD4A 2XY4A 1MCZA 5EY5B 5EWMA 4XW2A 1RRCA 3GYBA 5TSDA 1EEHA 3KSMA 3OIYA 2CLMB 4ESEA 1YR1A 1NT2A 3IQHX 3ICOA 1S2DA 4L0CA 2OXRA 3R44A 4LHYA 4M1MA 1KFJB 3K94A 4R69A 1QO9A 2HPHA 4AG5A 2WVGA 3BORA 3WV4A 4CTJA 1JA0A 3EGIA 2PKQP 1SXJA 2VF8A 1ZZGA 2ZRJA 1E8DA 2A4MA 2HB6A 2NZJA 1HYGA 2O0HA 1JR3A 1OAKA 4UUQA 3VR5H 5K20A 3ZD7A 1SUWA 5KYUB 3VNVA 1ZI6A 5D3KA 4LSMA 1JTFA 1JT2A 5BOSB 1HDCA 1WVMA 3THSA 1Q16A 2IIVA 3HBJA 3NTXA 4KIJA 1UDRA 3DB2A 3FZNA 3LOPA 2PLRA 4RL4A 2X23A 5AI8A 1QO7A 3KKQA 1IWOA 3HPRA 4UJ3A 5AW6A 1FOEB 2BGJA 2J5QA 2QSZA 4C1BA 1SBTA 4QX6A 3WTBA 3EZYA 3HJFA 5DGHA 2O9JA 3IHTA 4AXBA 4R7TA 2YHAA 1SM4A 5LMUB 4WOJA 4LBZA 5JXHA 1EFPA 4G0ZA 1O03A 3R6GA 1XNGA 2ADOA 1B1AA 3TO5A 2QRVB 3BILA 3QBTA 3WHLA 1UJ2A 3OM0A 5BYKA 1BEZA 5MN4A 3C70A 3VDXA 2X3FA 1AQLA 4YRMA 3C3WA 3O0TA 4G5FA 5E6RA 1LV8A 2PEZA 5GAJA 1JDPA 4E33A 1DRKA 3TCNA 3X0DA 3ZQ4A 2WZBA 4DLKA 4GOXA 4KMOA 4IXNA 1RR6A 1HDZA 2RK4A 3DUWA 3RC8A 3IT0A 3LGAA 4KFTA 4WH0A 2MYUA 1F12A 3EB9A 2SCUB 4PHGA 1GL9B 3DKRA 3NYWA 3PXBA 3KXPA 3U4CA 4LVNA 3EUWA 3DBOB 1OC2A 4CKXA 4ZEMA 1YDWA 2D4HA 2FSVA 4QOSA 5JNRA 3LW7A 1BJTA 2EAUA 1EUYA 4M98A 4G8BA 3T8YA 2DPHA 1K9SA 1AO0A 1J09A 1SD2A 4XD7D 4MHSA 5FQNA 3RSFA 4X91A 2HSZA 4D80A 2E1RA 1H1DA 2GASA 1KKLA 4U7FA 3QXCA 1Z0FA 4D6XA 1IAQA 2C8KA 3MBOA 3P1JA 1CU1A 1JX6A 4PLVA 3WICA 1S1MA 1TK2A 1KYYA 3KHUA 5KAPA 4QULA 4AMUA 1TT5B 1J9EA 1DQYA 4LFCB 1RI5A 1TUBB 1SKMA 1FFWA 1ZM9A 4G56A 3FLBA 4GBGA 4DCUA 2EQBA 4PYJA 1XEFA 3RVKA 3GQBA 2A94A 2QVXX 3BIXA 2PA3A 5T57A 1GFWA 3R77A 1U81A 1XCBA 4YP7A 2PPVA 4FW8A 3OTOB 4NFSA 2IP4A 3F5SA 3RVMA 4FMCB 4K81B 3OOYA 3IVCA 3JTEA 3GELA 4HB3A 4A1OA 2BKAA 4P81A 4XWWA 1PCXA 4GM4A 3JYHA 4P53A 2PLFA 3TIVA 3WOHA 1S2NA 2ATCA 5CLGA 1AZLA 1NVFA 1O1YA 4IKOA 4MUGA 2VHEA 5AM3A 2JBHA 1H2FA 3CRVA 3FNBA 4MJ7A 2GJAA 5LNK6 4OUDA 1OWLA 4LZJA 1L1FA 5A6VA 1JQBA 2PG3A 2BFFB 3L7BA 2C96A 4JASB 4MCJA 2JLWA 1KMHA 4QYXA 1B8VA 1UT8A 4G84A 3RKRA 5L8VA 2FQQA 3Q98A 3QEKA 2IV7A 3OKAA 3BFKA 2YOGA 2ONYA 4S3MA 4C0HA 2H1CA 1CUGA 1IPFA 1X19A 1XDDA 4WCFB 4HGZA 4CMEA 4Q1DA 2CYBA 1I4WA 1ZU5A 1QCDA 1AN9A 2FFJA 1S3IA 2HBZA 3DH0A 1GGJA 4NU6A 4TZ6A 1UM9B 1Z22A 1EZZA 1SKAA 2LNDA 4TMZA 3BWMA 5K4HA 3LE8A 4Q3BA 4ZV4A 4E22A 4YUYA 4MW7A 3TXYA 3H8SA 4FSDA 1ORDA 3MMXA 3UGKA 1U0NA 1QYCA 2HI0A 1ZA2A 5CNMA 4TOIA 3MTIA 2QNBA 4MJXA 4WX2B 5FWAA 3SCZA 1R0CA 1Q77A 3K15A 2HIHA 2VPTA 1JJBA 3LX8A 3LF2A 4FYWA 4C4ZA 3TZHA 3AYZB 1TM1E 3I6YA 5DGCA 5AUOB 5AI4A 1ONOA 4QT4A 1X7YB 4I1OA 3UOAB 3QXGA 2QUAA 3OLVA 4R8VA 2NO0A 3KPJA 4BASA 4EJSB 2YW9A 3K31A 4YDQA 1NQUA 2DUWA 1E2DA 3T7RA 1RKBA 1MABA 4B2YA 2H7VA 5TB5A 3MWDA 3GLQA 3WWOA 4CKYA 4G9BA 4LFAB 2ZJZA 1K9VF 5SYNA 5SV2A 1RFLA 1UBOS 4GE0A 4JIGA 2QGNA 4ARZA 1R0RE 2CD9A 3ZU2A 3P9ZA 3V8NA 1CUBA 5IH7A 3AW9A 1OLOA 3F8SA 4YY3B 5J1SB 1AMUA 2GMWA 2ZVQX 4PS1A 1A97A 2ORWA 4XIYA 1MC5A 3HGMA 2C2XA 2YJ6A 1Z0SA 3QLTA 4ZT5A 2P4UA 2HAEA 4C2AA 5JMPA 4EO9A 4NK4A 5DZSA 5JXJA 2HQSA 2Q2OA 5FKJA 5BNIA 1UM9A 3NEPX 3DLBA 3SF8A 4Q0MA 5JECA 1M8PA 1L5GB 4FHFA 2W4MA 1AUQA 4ED9A 4ZAYA 4BNVA 1SHZA 2X8JB 3DOIA 2QLNA 4REQA 4N5LA 5EWLB 3NIBA 1DWQA 1IXZA 1Q0SA 2GF9A 2VRBA 2XA1A 3CINA 1OR8A 2C00A 2OP1A 1GHTA 1L8OA 1REQA 3GJ6A 1ZK4A 3IAEA 3KV3O 3NHUA 4IOLA 4QUHA 4CHGA 3OETA 2I6UA 3DAHA 3P4YA 4GKAA 4K7JA 2I1LA 3GOQA 3QY0A 1L5HA 4ID3A 4UHHA 3BWXA 1KY5A 2UV8A 3RRBA 2VF2A 2ZVJA 1KI1A 4Y0VA 2JLCA 3FSJX 3IP9A 1RTTA 2REBA 4XGNA 2VEDA 2Y8EA 4HBGA 1E2PA 2MSEB 4UASA 1PR1A 1SBNE 3C3CA 3T3MB 2VAXA 4C5CA 5BNZA 2FMKA 1RC1A 4HN9A 3JRNA 3BK1A 1E7QA 3I37X 3JS5A 4K2AA 4BLSA 4L76A 1E6CA 1KAMA 3UK6A 4DCOA 1YA6A 3AIIA 3QBJA 3VDMA 5JAHA 2A0FA 1JLLA 3KTAA 4WGFA 1JR4A 1QYWA 1H6DA 3AFMA 1CEEA 2H2AA 2CUKA 3E8XA 5BVGB 3GEGA 1TIKA 3VC7A 2R2GA 4N76A 4H7HA 2W4QA 3D4PA 4KLAA 1K7EB 1Y6QA 3OWXA 1MGPA 1P5ZB 5FI0B 1JG6A 5E1BA 4YS6A 4EBFA 2I2DA 1Y1QA 4OI4A 5JY6A 2QG4A 2Q50A 2QW1A 4H1TA 1X7ZA 4IIUA 4CLXA 3UAWA 1ZGBA 3CBQA 1OZ0A 4RPLA 3HDVA 4EGAA 5H9WA 1D0IA 4JNCA 5K0GA 5KCZA 2OV8A 3BMOA 3AVYA 1NQOA 2KI5A 2DETA 1KJ9A