2IYUA

Shikimate kinase from mycobacterium tuberculosis in complex with adp, open lid (conf. a)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
167
structure length
167
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHIKIMATE KINASE
publication title Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 65
structure length 167
sequence length 167
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iyuA00
2QZ4A 1DPFA 2W6JD 1G8HA 3U44B 2KJQA 3NTUA 4LSGA 4D82A 1XJQA 1XXHA 2B21A 4KLZA 3SJCA 1NVWQ 1XZQA 3DPUA 2VEDA 4PZYA 3DL0A 5EUQB 2WV9A 2VLIA 5F3WB 4B35A 3Q3JB 4R7ZA 1VPLA 4JT4A 4G5SA 4DT1B 2F1HA 4IW3B 5A5GA 4L9WA 4PSAA 2VP4A 1VDZA 1Q3HA 5DI3B 3ZVRA 4UKDA 4QOSA 4A8JC 2BIFA 3MLEA 2XOKD 2NZJA 3WNDA 4W9MC 1E98A 1KJWA 5FPKA 1PLLA 3ZD6A 5J4VA 3G5UA 5FTKA 1FZQA 1G5RA 1EWQA 4Q02A 3VAAA 3PJRA 5FFMA 1CR1A 2XSZD 1WB9A 1SXJA 1KZGB 2ZU0C 3QXSA 5DN6A 3TUZC 5FBRB 4W5JA 1Q1EA 1ETUA 2ZROA 1KNXA 2C77A 3OFNA 3U3JA 1E2NA 1VECA 3IHWA 3IO3A 3WYFA 1CEEA 2EW1A 4EPVA 4LJAA 1NSTA 1GAJA 5GJCA 1KSFX 2CXXA 4D6PA 1VCIA 4IOJA 2CJWB 4KLNA 3T34A 3CX6A 3A6PC 1RZ3A 3MJHA 3GEIA 4MKFA 4AG5A 1RIFA 2H7VA 4XVRA 4AC9A 3HPQA 3OAAA 2F1RA 4EFMA 2OG2A 3EWSA 1ZRHA 1ESNA 3TK1A 2QAGA 4BGDA 3WMEA 3OEED 2ZU6A 1EWRA 3LWNA 2UZ3A 3KKNA 2D74A 5L8VA 4WXPA 4DBLC 5SZJA 3HU2A 3W3ZB 5KOYA 4RCYA 3VU9A 1G8FA 4XJXA 2QT1A 3IIMA 3OEHA 1BH2A 5E7IA 4D2IA 4XD7D 1MO4A 2HLDA 1E1QA 3R8FA 3UANA 4JSTA 1OSNA 2IEZA 3IQWA 4DXAA 2O5VA 4HYYA 4HDCA 1E9RA 1I4TD 2RGNA 4R9UC 5C4GB 1L4YA 1NMZA 4Z1MD 1DAMA 3C5CA 5HKKD 2GXUA 3OE7D 1GWNA 3ND9A 2DR3A 2GZHA 4HB2A 1WP9A 1SXJE 4EJSA 1E1RA 4BLTA 1XPRA 3BFXA 1T9HA 4GRAA 1CF4A 1MKYA 4P4SA 1DOAA 4PC3A 5DHAA 5UKDA 1ZD1A 4NYMQ 3ZVMA 1QBKC 1FQKA 3CRMA 4PHHA 1GSIA 5L3SB 1M7GA 3X1XA 3PEUA 1ZYUA 2GRJA 2GVDC 3WMFA 3U4QB 2GXAA 4A9AA 1OFHA 1ELOA 4JYCA 4P4TA 1XP8A 1ZJ6A 1DVRA 3U7EB 1J90A 2FSIA 1II9A 3E5HA 4PR0A 3T5GA 4AD8A 1EK0A 4X8OA 1NSFA 4WA7A 4DSOA 5ELXA 1OH6A 3I61A 4LJ4A 1XU4A 1ZM3A 3SYLA 2I1VB 4BFSA 1JB1A 1Q21A 1R5BA 1NL3A 4B32A 2ZRIA 1GFIA 1UKZA 3AF1A 2ZXUA 4DEXA 3TAUA 4B74A 2PCLA 3ZH9B 3FMPB 1GKUB 3E2IA 1T5LA 1NBMA 5IRCD 3QJYA 3S1AB 4C2TA 1E2DA 1Z3IX 3LA6A 4WZAE 4D81A 4PX9A 3NIBA 2Z83A 2FSHA 2BCGY 2WZQA 1R8SA 5BN5A 1QDEA 1Z0DA 5JRZA 2ZE5A 2ZRJA 2WBLC 1O3YA 2F43A 4BFUA 2CBZA 5K8UA 3P32A 5KSZA 2QSYA 2CHVA 4XH9B 2VHTA 3TKLA 3SC3A 4BRUA 5D3MA 4AYXA 2OT3B 3THYA 1RPZA 1AIPA 2EFCB 3UWKA 4ZIRB 1ZBDA 4F4IA 2ZSAA 4RD4A 4DVGA 1XJCA 3LW8A 621PA 3SFVA 4PO1A 1ZIPA 5E95A 1NRJB 1QHIA 5K8LA 1T91A 1XD8A 1UPTA 2IX3A 3JVUA 2V55B 4TMTA 1W36B 4CDGA 1EESA 5C2JB 1PJRA 2P6NA 3PUYA 4F4CA 2FDCA 2ZSBA 4F92B 2HCBA 2CJWA 1OW3B 1EX7A 4MH0R 4DCUA 3SDZA 4DLSA 3IKJA 2ZITA 3CNOA 4ACBA 3VMFA 3KQLA 4M1SA 4PQFA 2WTUA 1CBUA 3NEJA 1D2EA 2A5JA 4Y0VA 4CEHA 3AUXA 2OBNA 1X1RA 3RS5A 1G3UA 4BFYA 5KNDA 3GLHE 1XCPA 2XXAB 3UMRA 2OUKA 3KTAA 1S96A 5DISB 3RANA 5IHPA 3RRNA 3QKSB 3EPJA 1SXJD 2ZJ8A 3AM1A 2FG5A 5DN6D 1AGRA 5DIFA 3KJIA 2OFOA 5KNCA 5JI2E 1NBME 4DRZA 2KB0A 4PQYA 2GZAA 2Q9CA 2O8FA 4EPXA 3PUZA 4TYYA 5TARA 2QMUA 4OI0A 3AVTA 1UEJA 2OBLA 4AY2A 1G20E 1KK2A 4A8JB 1NF3A 4JIMA 4KODA 3LBIA 4S2EA 3THWA 4IVQA 1CLUA 1NNEA 1CJKC 4ZDIA 2F1IA 2VF8A 3GFOA 4Z8YA 3RVBA 2FSGA 3EIHA 2J46A 2GK7A 1IJFA 2OESA 3CRVA 4UXIA 4JLMA 5JJLA 2DFTA 1DE0A 4URXR 2G0TA 4IDHA 5C46F 2LKDA 2OLJA 2OCPA 3OIWA 3GQBA 2YC2C 4V0OA 3KQUA 1ZW6A 1LS6A 4UNPA 3PR1A 1OXUA 2OCAA 4V0ME 4AYTA 1G3IA 1KY3A 3VR3A 3OEHD 1P5ZB 4A0HA 3HR7A 3B9PA 5TMPA 3NHBA 1E1QD 4L9SA 4OJQA 3D7MA 3NVAA 3AVUA 1IOZA 2P5TB 2O0KA 2HT6A 5KTYA 1BKDR 4BZPA 4MRNA 3ZQ6A 2Z0MA 1UBFA 5EP2A 3T1VA 1KOFA 4QC2A 1WQ1R 3TSOA 1Z6TA 2ZETA 4KBGA 1GP2A 3HJNA 3Q5EA 4Z54A 2IYYA 2J3EA 4YC7A 1LF0A 2C9YA 4JSYA 5EE0A 2FFHA 4FINA 3WMGA 1D2MA 1E1RD 3QE0A 4IVPA 1L4UA 1Z5ZA 3LV8A 2RHMA 3ZQJA 5FR1A 4PANA 1VCOA 2PH1A 4Q4JB 3B1YA 5BW8A 4D4KA 4JLKA 3O8CA 3AVQA 4YMTA 1U8ZA 3A1VA 3AVOA 4LWZA 1TX4B 5FBLB 3S1AA 3NG1A 1US8B 1LS1A 1GKIA 1P2VA 3BRWD 3VKHA 2RH5A 2ODNA 3A1TA 2RKOA 4GBMA 4NONA 4G5QA 1G8GA 3LH5A 3QF7A 3X1YA 4FMCB 4Y0AA 1SKYB 3R9IA 4DHEA 3CRW1 3W5JA 121PA 1ZUNB 5B2ZA 1HA3A 5GJWC 1QHXA 3O8BA 3ZJYA 2GEUA 2ZUBA 1QVAA 3BH6A 4G0NA 1KKMA 4KHZA 2JLZA 5SZKB 1G16A 1JI0A 2NPIA 5J4KA 2EU8A 3Q5DA 1DAHA 2VP5A 4HUQB 1PZNA 1KDPA 5AJYA 1GUAA 1NBMD 4DCSA 2N42A 1VMAA 2V8OA 3SS8A 5HZKA 3K0CC 1XFAA 1HV8A 4OHWA 1KK3A 2O8EB 4LYFA 4XVQA 5BN3A 2G3YA 1OXXK 4MGIR 1WE2A 2GBLA 1GL6A 1H8HD 3ZZ0A 2NG1A 1WBBA 1C4OA 4URWR 1F60A 4BFTA 3CO5A 5FL7A 1P2UA 3ZGXA 2JATA 3GCGA 3ZIAA 1G5PA 3K0AB 4D80A 1YRAA 4LHZA 3WP0A 4PAOA 3ND8A 4FN5A 4V0LA 4UJ3A 1SXJC 3PG5A 4Q1CA 4RD0A 4PHFA 2XXAA 3UXMA 4XTCS 2XZLA 1XRJA 5HE8A 2V1UA 4DLXA 3TNFA 1BO6A 3QKSA 1VIYA 4TQ9A 1P62B 3THXB 1AN0A 2IYLD 3DMDA 4MGZR 5CLLA 5AJXA 3P27A 2O0JA 4ESHA 4QHTA 2BMJA 1AZSC 1RC8A 1W0KA 3LBHA 2N46A 3DKPA 4LPSA 2FWRA 4TWZA 3GLGB 2WWXA 3QKRA 2EFGA 1BOFA 4DSTA 2JCSA 3AB3A 1J70A 4YDSA 4NYIR 1XB2A 2Z4SA 4N3NA 5J47A 2IHBA 5JSZB 1K6MA 2ZJ5A 4EKDA 5LB4A 3L2OB 4LC0A 5JRJA 2BOVA 2FGJA 4RZ3A 2PLRA 2NO6A 2MMCA 1E4YA 3EG5A 2JLSA 2W83A 4ESVA 4BLOA 3UKDA 4A36A 1L7VC 5TV2A 5C4MA 1W0JA 3GEEA 1TEXA 3ETLA 1X8KA 4Q4AB 1W1WA 3NEYA 4CW7A 2FOLA 3HPRA 4HAZA 4CVNA 3BGWA 4HB3A 1HH4A 2XNSA 4M4SA 4BWYA 1W46A 3CH5A 1R10A 4IXMA 4HDQB 3RYTC 3FFBA 1IAQA 2VBCA 3QBTA 2VPPA 4OK3A 1XWIA 4WIAA 4YDHB 2R65A 4EJSC 2ZSDA 1UKYA 4X8LA 1ZM7A 2B8WA 2JLXA 1D8TA 1JR6A 3PVSA 3UG7A 3PCRB 4RFSA 1KI8A 2KSQA 5KPJA 2P65A 1OV4A 2ZJOA 3K9GA 1F2TB 4M1YA 4X8MA 2AK2A 3GJXC 3GMTA 2VYFA 3CKLA 2GCPA 2QTVB 4Q01A 5TDHA 4Q1FA 2WHXA 2XNDA 4Q9HA 1GM5A 4AKHA 4GI7A 2RGAA 2V4ZA 3DMNA 3EX7C 2IF2A 3AVXA 1RRCA 4HI0E 1R6BX 1A2BA 4YMWA 2IYUA 2IBMA 3T1OA 4M22A 1ZNYA 4RKEA 3C14C 4C0JA 4FI3C 5FOTA 1X8JA 1PUIA 3TRFA 2F3TA 3DOFA 2YVUA 4JZKA 1KIMA 2GZDA 4QBHA 3RSLA 5FTLA 2DFKB 5AUOB 4URYR 1V43A 4F93B 1E2LA 1XCMA 1G1MA 2FU5C 3OIVA 2DWOA 4TLDA 3N2EA 3G0HA 1FNNA 4HLUA 1COWA 1Q12A 2HXSA 2ZAMA 1YZUA 3F0TA 3CF6R 4TQAA 4D25A 4OJKA 4V0KA 2ZJAA 2QGNA 3FPAA 5CDFA 2GF0A 2J7KA 2WWIA 3NBYC 3P4XA 4I99A 4QGFA 1SQ5A 5DE3A 2FE4A 1KI2A 3KXKA 4M1MA 4OQFA 4QGHA 3SZRA 5L3QA 2O8EA 3AVVA 3PUWA 1JEEA 1VHTA 4CZ2A 1XEXB 3P1JA 3SJZA 4F91B 1B23P 1X86B 3B7GA 3LO5A 2IYTA 2C03A 3WXMA 2JLVA 1W4RA 5AUQA 3IQXA 2ZS9A 1P75A 2GTPA 3X2SA 2NO7A 3QXCA 1TF2A 1D2NA 4FD2A 4F38A 1AS3A 4D26A 2BV3A 4MDEA 2FX3A 4US2R 1IN7A 3L0IB 1KI6B 3NC1C 4LY6A 8OHMA 2GJ9A 2WPDA 4IOKA 3B1VA 1R0XA 4IDOA 2ONJA 5F2EA 1QZXA 4Q9IA 3DZ8A 3B1ZA 1RKBA 2Q3HA 1IXSB 1KDTA 3NC0C 521PA 1SHKA 2W0SA 3SI7A 3BB1A 1ZNZA 2CVHA 4KFTA 2Q9BA 1UBEA 1KK1A 5KDOA 5FL7D 2FH5B 5HTKA 1N6IA 3H86A 3ZIAD 4P32A 1RRFA 3TUJC 4MKGA 1FUKA 5JSZA 2O0HA 4B6FA 4PSVA 1TQ2A 2J87A 1K5DA 2BBTA 2JGNA 4Q48A 3K1JA 1E9DA 3QBVA 4CEJB 3ZS8A 1Z47A 3LRPA 4S35A 3L0OA 4YONB 4CT4B 4NCKA 3BFVA 2F1JA 4OI1A 3H2YA 1U90A 1XNJA 2PJZA 2WVJA 1OH7A 2ZRHA 4PQRA 4GZMA 2V7QA 4DKXA 1NY6A 3VQTA 3K70D 3I92A 4HZUB 4L15A 4NYIQ 2A3RA 1W0KD 1TUEA 1XTIA 2D2FA 4JL5A 1G6HA 1NN0A 2PLFA 2LKCA 2IA5A 3QENA 1DO2A 3A4LA 1DO0A 1PLKA 2QG6A 4IRUB 1P60A 1OB2A 4RCZA 1R2QA 1DAFA 3EA0A 2CDNA 4MUBA 2QU8A 2W2XA 3R7WA 2OILA 4GP7A 2XITA 3QXHA 3AV0B 4JL6A 4TT3A 5K8IA 1E32A 3CF0A 4M0LA 1ZIOA 4QFMA 1ODFA 1R5OA 4LYHA 2CL7X 2JLWA 1W0JD 5J40A 4JVSB 1LNZA 3A1SA 2HJVA 4Q1AA 2IYVA 2BHRA 4D4MA 2QRZA 1EX6A 4BASA 4ILEA 1UFQA 2AXNA 4HDOB 1YKSA 4KFRA 4Q7JB 3SFZA 4OQMA 5HZHA 4NYMR 1WRBA 4BLRA 5IK2A 2EWVA 2AWNA 3IEUA 4MQBA 3MFYA 2JDIA 2V6IA 3ZZTA 221PA 1NG1A 4CRWB 4H9GA 1GG2A 2PL3A 1T3HA 4IFBA 4TLEA 2OXRA 4P4UA 3FB4A 2C96A 1KJYA 3AGPA 2YZ2A 3L0SA 3LY5A 1RFLA 3R20A 3DM5A 1S9HA 2YOGA 5CIQA 1TUIA 2WJHA 4TYPA 2IYRA 3BH0A 2G9NA 1U0LA 4QL3A 1YZTA 2GEDA 1A1VA 2AR7A 4QBIA 3R8CA 4B2LA 3EARA 4TSFA 5SZIA 3ICQB 5CIWA 1JXMA 5LBIA 3U61B 1W7AA 4UNQA 2H1LA 3SYNA 3H0KA 3QPUA 4POAA 4Z51A 1SVOA 1XEXA 4FMBB 5FBQB 3F5FA 2VRWA 2GK6A 4MRSA 3F3YA 4N1AA 3GJ6A 3ZS9A 4TL7A 3QG1A 1W4BA 1Q3TA 3FKSA 3PV0A 4IDNA 5BXQC 3EPLA 1COWD 2O8BA 3CF2A 1S1CA 2GKSA 3C5HA 2VTKA 5E4FA 2VSFA 3L8ZA 3GLFB 2ZE6A 2VHQA 2ZRPA 3ASYA 5BWMA 2FJUA 4MYCA 2CCKA 2IC5A 2V6JA 3CR7A 2OE2A 1KO5A 4HZIA 4R98A 4TQUS 4MA4A 3AVYA 3TIFA 1FP7A 1QHHA 2P67A 1KZ7B 1HY3A 1E0JA 4O2RA 4BEBA 1G41A 4U02A 721PA 4RD1A 1NMYA 3QSYA 3EC2A 1A7JA 1BYUA 1XF9A 3K0EA 2QTFA 1G8YA 4JLOA 5TB5A 1X1SA 3VR2A 1S0UA 3BFKA 2HEIA 5CK5A 5JEDA 3RC3A 1G5TA 4DCNA 5GVRA 4AYWA 2WPDD 3SOPA 4C7OA 4CEJA 2D3WA 1ZCBA 1OIXA 2WM9B 2XEXA 3K70C 1NLYA 1XMIA 2ZVQX 3ADKA 3KZ1E 4TN1A 5FOUA 2R6CA 3PENA 1MT0A 5GADl 2QT0A 2YOFA 2AX4A 4EQ6A 1G7RA 2PT5A 2JLQA 4NBSA 4QJ3A 3AF3A 1CRPA 4ZKDA 3H4MA 3LQRA 2G0NA 2D7DA 4FXPA 3VR1A 1G17A 1W4AA 2YJTD 3FTQA 4OL0A 2LWIA 3CX8A 4I1UA 2QPAA 3DZDA 2XGJA 2C5LA 1XEWY 1F48A 2PX3A 2MSEB 1XTRA 1NJGA 2CL6X 1KHTA 1XXHE 3A1WA 3CNNA 4KU4A 2PT7A 4RSGA 3GJ5A 1UKVY 3WP1B 2JJ2A 2R62A 4ZO4A 3CZQA 4GOKA 2KE5A 4G3XA 2V7QD 4W5WA 3MWJA 4AIIA 3REFA 2GDJA 1AS0A 4PO9A 4EPTA 1TEVA 2J7PA 3K0SA 1XCGB 4Q4LA 1F2UA 2HT1A 4PC7A 2DB3A 2XJ9A 2NGRA 4TMKA 2W58A 3FYHA 3EC1A 2ANCA 2ZI3A 2ZR0A 4M53A 1OFUX 4B75A 3FGNA 4EUNA 2ORWA 4QBGB 4B3XA 2ZYUX 3ZVNA 3PXGA 2H8KA 2WJVA 5GVSA 4P3YA 2QTHA 3K0FA 1L8QA 4OQNA 1BIFA 1N6KA 2Z5FA 4KFUA 1NN1A 4TT3D 4RZUA 3KFXA 4DDUA 1MV5A 4Q19A 2IWHA 3UIEA 2P6RA 3TAHA 1G6OA 3NKVA 1FMJA 4LJ6A 3B2EA 3SJAA 3FMOB 1JEDA 4BEJA 1HT2E 2J45A 1K8RA 4LJ7A 4NTZA 2EQBA 3ADCA 4ITRC 5KO2A 2CE7A 3FDIA 1E3MA 3T61A 3TJZA 1VG9B 4Q03A 2P0EA 3ADBA 1MRNA 1Q44A 1RJ9A 5IK2D 5B58C 1YZQA 2JDID 2GCOB 3EPHA 2EYUA 5FPTA 2L0XA 4MKIA 1Q22A 5G3ZA 3Q72A 4WOPA 1U9IA 3X1DA 4DB4A 1HUQA 3U44A 2IT1A 4PFSA 1AS2A 1CTQA 5AK0A 1WDTA 2MSCB 3B13B 3B6EA 3OIYA 1NY5A 4W7SA 1HEIA 3U3RA 2GXSA 1OHHD 2DBYA 4YMSA 4OHVA 3G82C 1ZP6A 3BB4A 1VYUA 1JPNA 4URZR 4I1VA 4DLUA 1JAHA 3RS2A 4B48A 4Q4HB 4DT1A 1NP6A 1KO4A 5H70A 4NMMA 5CJPA 5HPYB 4F7WA 4DLTA 1KMHB 3BBPA 5DI3A 4BE7B 1ZUIA 3WHLA 4BUJA 1R4AA 4PXAA 4OQLA 4B3DA 5ANRB 1N6RA 2IYXA 5DO9A 3AP2A 3LAWA 4US1R 2RB4A 3TMKA 1M7HA 4URVR 4M9SA 1KO7A 4QBFA 1KO8A 3T12A 4G5RA 4B76A 1WMSA 2I1QA 5JBQA 4IEIA 2IYQA 4DIEA 2WSMA 1IXRC 3EZ9A 2FV8A 2FSFA 2F7SA 1OT3A 2NZ8A 2OO7A 2ODEA 3N2IA 3V4RA 2H57A 4MUAA 3U5ZB 5LPNA 3AEZA 5FOWA 1SVWA 3MWKA 4JL8A 2NOAA 4ZKEA 4PC1A 4TMVA 4DC9A 3KL4A 1P9RA 4FIDA 4FW9A 1TAGA 4AK9A 3IUYA 1GDDA 4DB2A 2AWOA 1KAGA 1M2OB 4V02A 1VCNA 3VHLB 4YMVA 1VYTA 4EPRA 1C1YA 1HQCA 1T3LA 2JIZA 4WW0A 5EZ6B 2DPXA 3TH5A 2PZGA 1DEKA 3MGCA 5CM8B 4B3FX 3O8RA 4PPGA 1KYIA 2R6AA 1OFTA 1NKTA 4M1OA 1FMLA 3QOFA 1VKJA 3UG6A 2W2TA 2BBWA 2ZI4A 1D9XA 4GPTA 2X19A 3OFND 4HLQB 4MYHA 5H68A 3U3KA 4B73A 1GILA 2AHOA 1TTTA 3WYAA 3NHAA 3U6KA 4TZ0A 2QORA 3AF2A 4JJZA 1BMFA 1ZMXA 5H8WA 3CONA 3D8BA 4NDZA 4EDHA 3AKEA 2RCNA 5FOSA 1FTSA 1E9FA 3VTKA 1E2GA 4M1KA 1N3BA 2RGEA 4ZDJA 1QHNA 3VKGA 3IGFA 4MRRA 3OAAD 4FMCF 1YR8A 5EXPA 2BMDA 2BBOA 2ZEJA 4L8GA 1TU4A 3RLFA 1OKKA 2AKYA 2X2EA 4C0LA 3VHXA 3LNCA 2QGZA 4RD3A 1KDOA 2I4IA 1M1YE 1E69A 3QKTA 5JJIA 2ZYTX 2GILA 2D62A 2J59A 3FHCB 1CJTC 2BM1A 4Z8XA 2E9SA 3KKMA 5JCPA 1YHNA 5L3SA 1AQUA 2HLDD 1S3SA 2C99A 1UDXA 3LQQA 2GJKA 4Q9JA 4A4DA 2H92A 1EG7A 4BQSA 3QXXA 3N5CA 1A2KC 3BORA 3LD9A 4I4LA 3EPKA 3U4QA 3ADDA 4RKFA 1NIJA 3LXRA 1TU3A 1V5WA 2WWFA 1PUJA 4LC1A 3NXSA 4QHSA 4BLPA 3I62A 3GFTA 1GVNB 3QKUA 1P61B 4M1TA 2VF7A 4A0GA 1R5NA 1N6PA 3EAQA 2QQ0A 2IS6A 1TPZA 4QJ5A 1JQLB 4GP6A 2PEZA 1KY2A 4JLDA 4M9XA 1MR3F 3RS7A 3QNUA 4Q5IA 4A1FA 3DOEA 3U7FB 1PVOA 1U81A 2E1RA 3L0PA 1AKYA 1SVLA 4K8OA 2V54A 4UXJA 4A6PA 4LDJA 2AKAB 4L4UA 2ZTSA 5G3YA 4DLWA 4BECA 3PEYA 4MDFA 5FH9A 4OK6A 1IN6A 5KSYA 3SHWA 2J5XA 2WKPA 1NVUQ 4Q4HA 4LHVA 3DO6A 3SE0A 1W49A 3JZMA 1U2RA 4GMXA 1G3QA 1G9XA 3FHTA 1NLFA 1WF3A 2J0UB 1M74A 5FOXA 1E99A 1H65A 1NKSA 1U0JA 5FBWB 2DYKA 4HUTA 1LTQA 2P2LA 2Q3FA 5EE3A 1HE8B 1BS1A 3L82B 3WY9A 1MH1A 2GWHA 3TQFA 1EFUA 5KSPA 1G7CA 1OF1A 2CCJA 3CRRA 4ZIRA 3MMPA 4KVGA 1N5LA 3RHFA 1AZTA 4K81B 4O25A 1Z29A 2WAXA 3B85A 2R2AA 4Q18A 4XWOA 4JBXA 4B6EA 2HF9A 4FCWA 3HU3A 3SBDA 1LV7A 3BWDD 3VNVA 4G01B 1GKYA 4KJZA 5EE9A 2SHKA 4DCVA 3B1XA 1G3RA 1Q1QA 3CPEA 4NE2A 5JHHB 1G18A 4G5GA 4DDVA 2XTNA 4AWXA 1E2HA 2IUTA 1D9ZA 2IYSA 4XWKA 2BKEA 4GT1A 1ZNWA 4B3BA 4EAQA 2FFQA 3L43A 4DSNA 5L3VA 3AGQA 1AM4D 4YMUA 2YNMA 4ZI3A 2QPTA 3T15A 1KSHA 1Q20A 2FA9A 5FR2A 1ZD9A 3CRQA 2ZREA 2IK8A 3QPVA 4BZXA 1TF7A 3N70A 4OI4A 1E9CA 3AUYA 1Y3AA 2WJJA 3PITA 4EPWA 5E7MA 5H1YA 4A8JA 4DIDA 1C9KA 2QAGC 3RWMB 2JIZD 2CMKA 2FPLA 2CVFA 3TGPA 2QE7A 5FPSA 2JA1A 4C0SA 2A30A 1P6XA 1JAIA 2VHCA 1XBTA 3K9LA 3MAAC 3KUDA 1PV4A 1RW4A 1G19A 1EFRA 1E2EA 1ZUHA 3CH4B 2LCFA 3ZDQA 5AUNB 2AFIE 4C0BA 5JS7A 4ERNA 5B64A 4OHZA 1VG1A 1XTSA 4ASUA 4A2QA 1BMFD 5EZ5A 3QVVA 2OFXA 2W2VA 2WMNB 3GLIB 5AJZA 2RGNC 3GD7A 1X8LA 3IBYA 5FUVA 1XPOA 4LBWA 3EIQA 1P9NA 4HAUA 2A78A 3HDTA 2J0VA 3MG9A 1IY2A 1NI3A 4MYUA 3IIKA 5IDVA 3LFUA 1SGWA 4ZPXA 2QBYB 2ZS8A 2QL6A 4DLVA 2OCYC 1OKKD 2H18A 3MJRA 4JS0A 4Q00A 3I1FA 2ZRCA 4URUR 5FTJA 1XMSA 5AJWA 5JS8A 1DS6A 1M8PA 2ECKA 4PO8A 1T8UA 2V9PA 3K9NA 1T5IA 2ZVPX 4KFSA 4Q4JA 1Z83A 4QM7A 2XB2A 2IS1A 1DAKA 4AKIA 3AP1A 2RGCA 5JHGB 1NVXQ 4WZBE 1JALA 4RZ2A 1SZPA 1YR9A 3I5XA 1F6BA 2CHQA 4GZLA 4Q7MB 5EE5B 3IILA 3T06B 3KKOA 3KJEA 3C8UA 1XEWX 4HEJA 4OYHA 1US8A 3J81k 4TYNA 4IDPA 5FUXA 4CF7A 1DADA 1NN5A 1YU9A 3BOSA 4HATA 2A7QA 3QF4B 4JT2A 4Q1DA 4ZV4A 1E6CA 1NVVR 3ZYCA 3P4YA 4LV8B 2RGXA 2GCNA 2X1VA 4FWIB 2HXYA 2BEKA 1LY1A 1J7KA 2R44A 3WNCA 3I8SA 3AVPA 3I8XA 1ZC3A 3RRMA 2WKRA 4HUQA 4PZZA 4MYTA 5JMTA 3QY0A 1KI3A 5HE9A 1MABB 2A5DA 3U6BA 1WXQA 3B82A 5GJVC 1EFTA 4FMDB 4LOAA 1QHYA 3DM9B 5JCZA 3U7HB 4LBVA 1ZVQA 1T0HB 1BYIA 4HAVA 2X2FA 3C41J 2VSOA 3K0AA 4C30A 4Q21A 3KQHA 4F4JA 4KVAA 4IEEA 4TLBA 3ZLJA 3LDAA 4N0DA 2ZR9A 3OZXA 2JJ8A 4TL8A 3X1ZA 1KKLA 3FFAA 1JBKA 5IT5A 4C0KA 1VTKA 1G21E 4UJ5A 1PLJA 3THXA 5DSZA 2QN6A 1GRRA 3KUCA 3QEOA 2EFHB 3BAFA 2XZPA 1YE8A 3T35A 3NDPA 4M21A 1CRQA 2GETA 2XOKA 3THOA 1W36D 2REBA 4HAWA 4LI0A 1SULA 3UATA 4D4JA 4DDTA 1QF9A 1M6NA 3VNUA 4GOJA 4ACAA 5EJEA 1CULC 2FMXA 3GLGA 4NCHA 3W5IA 1GOTA 4JBWA 2DFNA 2VHJA 4TYQA 5F9FA 1SKYE 2NMVA 3PFIA 2HCJB 4B47A 1HQYE 4RVCA 2OAQ1 4DLRA 2AD1A 2ZRKA 2QENA 4KSBA 3DHWC 1Z6YA 2GF9A 1VG0B 2IEYA 2WMOB 1ZC4A 3IHLA 2D4HA 3KXLA 1SHZA 5CDFE 3E1SA 2IF0A 1KNQA 3KX2A 3MRSA 1IONA 1FUUA 4JVMA 4Q4AA 4NCIA 4TL6A 1DAGA 1P3JA 3ICEA 1JJ7A 3GJ7A 4A15A 4KYIB 4QHYA 3CW2A 1I2DA 3LXXA 2R9VA 4MGKR 3ASZA 3SQWA 4RY2A 3GPLA 4XSGA 1SXJB 5KYKA 1S8FA 2QE7D 5CYPA 1S1MA 4DDWA 1IBRA 2QBYA 1AJEA 5L3RA 2BJVA 4B71A 1Z8FA 4JLPA 4KV9A 2IYZA 1NMXA 2ZRAA 5E3HA 1FFHA 2RHDA 3L8YA 1YVDA 3UWOA 2OAP1 4BZQA 2QM8A 3PQCA 4C4PA 1F2TA 4AKEA 1TF5A 1VHLA 3IPYA 4PSKA 2QA5A 1IHUA 4U7DA 4ASUD 1EFCA 1T0JB 1P73A 4MGYR 5CYOA 2ZM5A 1YQTA 2OSBA 4NP6A 1G7SA 3Q9LA 2XB4A 2QAGB 5JEEA 4Z1MA 2C9OA 3GLGE 4PHTA 1XMVA 4PAQA 2FPMA 3CB4A 3B60A 3AQ4A 4CEIB 3D6TB 2ZI9A 3DEFA 4V0NA 1CU1A 5KHOC 1D6JA 5GJBA 2P5SA 3SHFA 1IY1A 2V1XA 1L2TA 4KO8A 1P7CA 1KSJA 2ERXA 4X8HA 2P3SA 3KKPA 2AXPA 1B0UA 3HYTA 1E79A 1KAOA 1Z08A 2Z43A 4LBZA 5EXSA 1XX6A 1W44A 4JVNA 4BFVA 3B5JA 1XTJA 2QMOA 4KAXA 4QNMA 1GRQA 1TL7C 2BVNA 4BLSA 3DVLA 2IXEA 1CJUC 2XNDD 1NN3A 2JEOA 3RS3A 3VR5A 4CGZA 2EWWA 3BS4A 3OF5A 5BQ5A 4L5BA 1N5JA 1YR7A 2K5UA 1HT1E 4GL2A 1N0UA 2HV8A 2YV5A 1Z2AA 1GNQA 1NVVQ 2BJWA 821PA 2GA8A 1Z6XA 3BH7A 4EJSB 3F8TA 1E4VA 5M04A 3FOZA 4JVLA 1FOEB 2VA8A 4MRVA 2ZRLA 3M0EA 3CM0A 3SJBA 3IEVA 2CL0X 2B7CA 1S2MA 3K8YA 1KI6A 1G64A 5JFGA 2VHUA 2ZIAA 4JYBA 3ZVLA 3SEAA 1Z6AA 1Z0AA 5DYIA 2GBLC 4RZXA 2YYZA 2C2HA 5BYKA 4WZ6A 3IBGA 5JJKA 2YOHA 1Z6GA 4R71A 1Z07A 3O47A 4FWTA 3RC8A 2REXB 3HR8A 2CNWA 4GFDA 1DAEA 1R0YA 2Y8EA 2UZIR 3GLHB 3HYRA 2FFBA 3WYGA 2WJYA 1M7BA 5FBVB 2WSSA 3AF4A 3IPXA 3QEJA 1U99A 2ERYA 1OE0A 4OKSA 3K53A 4Q1EA 2IWRA 4Q1BA 5A0FA 2PX0A 4O2LA 1SVSA 3GJ4A 5EQTA 2QPOA 2ZJZA 4P33A 3NBZC 2ZRMA 4E09A 3BIFA 1UDWA 2ZPTX 1II8B 2YHSA 4MRPA 3SNHA 4NL4H 1E9BA 1ZM4A 2J0QA 1KMQA 1U98A 4I81A 3K0CA 1W2HA 2ZRNA 4P31A 3TW4A 2ZRGA 1W4CA 3K09A 1MO6A 4NYJR 4R2HA 1KSGA 4U5XA 3KFVA 4HZUA 2F43B 3RWOA 1RRPA 5BN4A 2OBMA 1DG1G 2NTYC 1ONBA 5D3MB 3SU8A 3THYB 1I4DD 4CT5A 4QJ4A 3CBQA 4OQXA 4C0QC 1GIAA 4PPQA 5HR5A 5A4JA 5KDLA 3EXAA 3TBKA 1JECA 4ZI2A 4DLZA 3CIOA 4H1VA 4XSHA 5JWOA 1VG8A 1TNDA 4UXHA 2CLDX 3GJ3A 1VYVA 3Q7PA 3OESA 4GSYA 5FPHA 1G8PA 1WBDA 3RDPA 3JZAA 2A5FA 4Q9KA 2JASA 5CLQA 1J8YF 1GNPA 3AKYA 4HB0A 2ATVA 1ZM2A 4N0EA 4Q9LA 4BRWA 4CEHB 1SVMA 1CS4C 1G7TA 4IOMA 2ONKA 2H16A 4TMXA 5CB6A 1XEFA 3KTAB 3PUXA 4IJMA 3PEVA 1FTNA 4Q47A 4WVFA 2O8DB 1MOZA 2ZSFA 2VQSA 3A8TA 4CEIA 3IDQA 5LB2A 2OV2A 1IXZA 3HWSA 3SN6A 4AI6A 2FFAA 3VKWA 3CZPA 3VX3A 2VSXA 2WKQA 1JJVA 1E2PA 2O8FB 3AF0A 1XZPA 2FPKA 1OXSC 2VL7A 3KDSE 3BB3A 4NCJA 2BBSA 1S4QA 2Q9AA 1XMJA 3B9QA 1MRSA 4ON9A 1UM8A 3THWB 1Y63A 4ZCMA 1NJFA 2VP2A 2W6IA 1N6HA 2AL7A 3GJ0A 2ZJ2A 4XTRA 4FCVA 2WJGA 5JI3E 1XPUA 2H17A 4HLCA 2B8TA 1DARA 1E0SA 4A6XA 2QSZA 4U00A 1XD2B 4TLAA 4EFNA 2B7BA 2DCUA 2G1KA 5C18A 3SQXA 4HAYA 3CNLA 1IJEA 4HLUC 1N0VC 3W8NA 2CK3A 3NBFA 4EFLA 5TXGA 2BDTA 1E79D 4B2PA 4DUGA 3QUSA 4HLDA 1OB5A 1JR3A 1T8TA 4HAXA 3UK6A 1CKEA 2VIIA 3GLFA 3Q85A 3I5YA 1NG9A 2OFWA 4M1WA 1E2IA 4KSCA 2IUUA 5EP3A 2QMHA 2OXCA 4HB4A 1IN4A 4UQOA 2F3RA 2XAUA 3TUIC 3LX8A 4TSFD 4A0RA 2GAOA 2FF7A 3E70C 3O8DA 4LYAA 2QNRA 2HYIC 3M6AA 3LW7A 3GLHA 3T1TA 2FEOA 4JKYA 4PC2A 2X77A 4D4LA 2Z6VA 1Z06A 1ZNXA 2ZS7A 1E94E 3I72A 4A82A 1RYHA 1X3SA 2B92A 4US0R 5FUWA 1Q1BA 2Q6TA 3FKSD 4JLNA 3ZZUA 1MO5A 2AD5A 3W34A 3REGA 2XJ4A 2IUSA 3EIEA 4LX0A 4LJ9A 1E2FA 3C7KA 4II7A 1OJLA 2J0SA 2YINC 2QP9X 1II8A 2VP6A 3BD9A 1H8HA 2WOOA 2C9CA 4OI2A 3KJHA 3TSWA 3W3AA 1E0AA 1YRBA 1QG2A 2KI5A 3VFDA 2GESA 3FHOA 1A5TA 3VR4A 1KI7A 5B57C 4LYJA 2D2EA 3TR5A 2CNWD 1GL7A 3K9HA 3TE6A 1ANKA 2PZFA 3I3SR 4R2IA 4JLVA 4TTRA 2WSSD 2GXQA 1A82A 3MWLA 1HE1C 2R8RA 2EYQA 4LV6A 3RABA 2JJ1A 1FNMA 2FZLA 3TQCA 1JR3E 1K5GA 2WWWA 1GRNA 4MKHA 5IF9A 2C04A 4V0MA 1DELA 4A2WA 4NYJQ 4TMWA 3W9YA 5B30A 5BYJA 4DWJA 3GLFE 3D31A 1E0KA 3AH8A 1OFIA 4NU0A 1GL9B 1LF5A 1MO3A 5G41A 2WOJA 4RFVA 5DHFA 4IVRA 5JECA 5CITA 1JPJA 5EXXA 1U8AA 5FPYA 1KTVA 1RE0A 1YZNA 4FCTA 2FEMA 5HCIA 1N2CE 2IS2A 4YQFA 2ZJYA 3BK7A 1U8YA 2J1LA 2MMGA 3MSXA 4A0FA 1J2JA 2BM0A 4ARZB 2IS4A 5J5CA 4KBFA 3W6PA 2FGKA 2O8DA 2F55A 4G5OA 4HSEA 1DAIA 1W5TA 1F5NA 1UEIA 1VCMA 5KDDA 3K70B 2G88A 2QP3A 4KXFB 1AQYA 3NH6A 1ZD8A 4XOIA 2JJ2D 2C98A 3IIJA 5CJ2A 4IKEA 4NZYA 2C95A 1LW7A 2BWJA 3QKRB 3EASA 3VX4A 2Q21A 2J7PD 2GJSA 2YWEA 3FVQA 4WAUA 1E2JA 2CE2X 2RGBA 5P21A 1CJVC 3WRXC 3UMSA 4WBSA 3EZ2A 2BC9A 5FOVA 3PIRA 1SVKA 1J8MF 1XDBA 2R6DA 3MWYW 5AUPB 1Z63A 3C4JA 1GITA 1XD2A 1KI1A 3AKDA 1Z22A 2GCOA 2YWFA 3B8HA 1DG3A 2FNAA 4W5HA 4B44A 2PBRA 3CPJB 4IDQA 3RSOA 3TVDA 2A9KA 1P72A 4JBYA 2DY1A 3RS4A 3QXJA 1Q57A 3RRZA 3OIUA 4QXAA 5EE1A 2ZUDA 3BERA 3M1IA 1II0A 2D06A 4LGMA 1H8EA 1UBCA 1N25A 1FP6A 1TQ6A 2W6ID 5F9HA 1R7RA 5J4HA 5E7JA 1E96A 2AN9A 4NKRA 2HDNB 5DYGA 5HCNA 5CK4A 2WIAA 3VR6A 2NIPA 1QG4A 2QP4A 1KK0A 1KMHA 1OPXA 1CJMA 3PUVA 1YJ5A 3SBEA 4AKGA 4J0QA 4RFSB 1UF9A 3LX5A 2MSDB 4D0NA 2CK3D 5J4LA 3AVWA 3EZ6A 2IW3A 4ZDWA 5G40A 3W6NA 4TZ6A 1RYFA 3GFPA 4DUGD 1FX0B 2ZI5A 1YR6A 3KXIA 1FQJA 1JR3D 2DFLA 3P26A 4CIDA 1YZGA 1KJZA 1TQ4A 2C78A 1DBSA 3B1WA 3KKQA 5J4YA 3EZFA 2F6RA 1XJ0A 1G291 1KO1A 4DZZA 2DWPA 4DCTA 4LUCA 1XD9A 4UNNA 1FL9A 2GEVA 2QROA 2Z4RA 2QRNA 2ZYVX 4KYUA 1IN8A 4JKIA 2ODWA 5DH9A 4LRWA 5FTMA 3AP3A 2Q0HA 4OHXA 4LCBA 2ORIA 2WIBA 1IN5A 4YXWA 1QVRA 2A5YB 1WCV1 3Q7QA 3ECCA 3GP8A 4ZDKA 1G4AE 1P2TA 3R9XA 1E2QA 1Q0UA 1T4GA 4C0HA 1JXOA 1G3MA 2G83A 3U7GA 3BC1A 2GVZC 5L3QB 1Z2CA 2EFDB 3QPWA 3K09C 3UPUA 1CR0A 2IHYA 2QAJA 1R0WA 1E9EA 4Q7LA 3R9WA 4OHYA 2YWHA 3TW8B 3NWJA 4JMPA 1KDRA 2IL1A 4PPFA 4PTLA 3P20A 1IQPA 3GEHA 1NLZA 1CR4A 4NPHA 3SR0A 2UVQA 2JLYA 3CPHA 5KU1A 5EUMA 3LLUA 1OYYA 3CUEF 4ARZA 2WAYA 1ZAKA 4LJYA 3KB2A 1X6VA 2OLKA 2JJ1D 2J41A 3ONWA 5KPDA 1I4LD 2X8AA 2R6GA 2FZ4A 2W00A 4B43A 1OYWA 5LD2C 3RAPR 1VIAA 5C1BA 4H1UA 2REOA 3UMFA 3NBXX 3LVQE 3A36A 4A92A 3RS0A 5DGXA 2OZEA 5EXTA 4M8NE 3X1WA 3NH9A 3W8RA 1M34E 2ZI7A 1W2GA 5FTNA 5KNBA 3TSZA 4O3MA 2O8CB 2PMDA 4IXNA 4DEYA 4XVUA 4FMDF 5JWRA 1TQDA 2HUPA 2ZJBA 2CEAA 3GJ8A 4RD6A 5K8TA 5DI9A 2ORVA 2G1JA 421PA 1Z0KA 4P0TA 1T3SA 4E07A 2I3BA 5DNYB 4G1UC 4UNSA 3W6OA 4BPBA 3QI2A 2GJAA 4I1OA 2YKGA 2ATXA 3M4YA 3DDCA 2ZUCA 3A58B 1Z28A 1UADA 2AFHE 5CM9C 3FMIA 3RNLA 3TVTA 5JZVA 4WXRA 5KSOA 4XIGS 4BFZA 2G77B 4C9BA 4JLJA 1HURA 1OIWA 5KUTA 1AA9A 3A37A 4TMZA 1Q1ZA 4Q66C 1ESMA 1LFDB 4GOXA 2GHIA 2ZANA 2CLCX 2FN4A 2IYWA 3MUFA 3R7WB 1QHSA 4GMDA 1ZM9A 4V03A 2TMKA 1AKEA 1KI4A 1U9IC 2PCJA 4M9ZA 5TVKA 2A5GA 2XZOA 1E2KA 4OBEA 2J0UA 4TTQA 4ABYA 2ZRBA 5JWHA 4PC6A 4LBYA 2A2ZA 2JLRA 5TY0A 4AURA 3B78A 2PZEA 4JLBA 2N1BA 4DJTA 3PEWA 1FX0A 2BCJQ 2J9RA 3FMFA 4C0AC 4DLYA 1XTKA 4LV5B 2V3CC 1IY0A 4B3CA 1SVIA 3WRYC 1H8ED 1N5KA 1DTSA 4M2LA 2ZAOA 1YZLA 4B33A 3EA5A 4XWAA 1N6NA 2IXFA 4BFXA 2BMEA 2EFEB 2RGGA 3FKQA 2W6JA 2WWGA 2ZE8A 3U60B 4CYMA 3FE2A 2OCBA 2VP9A 2OEPA 4LK2A 3WHKA 3A4MA 5D3QA 1N6OA 2G6BA 1GTVA 1OLOA 3QG5A 1O87A 5EP1A 5FUYA 2HF8A 3BXZA 3EWAA 1N0WA 3HP1A 3LBNA 3BE4A 5SZHB 4QNRA 2ZRFA 5CB8A 2WICA 3V9PA 2OHFA 4RD2A 1J99A 3KB1A 2XTZA 2R6FA 3U3OA 2RAPA 1LVGA 1I2MA 3RRYA 4E22A 1ZCAA 1QHGA 1NIPA 1WA5A 1E9AA 2HYDA 5G53C 1HTWA 3TR0A 3MCAA 4IFEA 2BMFA 4MITA 2NQ2C 3MD0A 1N5IA 2VO1A 1YZKA 4QM6A 2GJ8A 1OXTA 2WJIA 6Q21A 3IO5A 1Z0FA 2ZQ5A 2F9MA 1E9SA 2XX3A 1F3OA 1U94A 4KI0A 4ZCLA 2W0MA 1RRGA 3V00A 3V4FA 2O8BB 1SKQA 1XXHB 3D3QA 3H84A 4NCNA 2EVWX 2QQEA 2BKUA 2QY9A 4Q7KA 4RJLA 2XSZA 2ZYWX 4EPYA 4YXWD 4AG6A 1S9DA 1RVDA 3LLMA 1UJ2A 1IM2A 1XTQA 3I32A 4PAMA 3U3MA 4IHQA 3QQ5A 1QHHB 2CHGA 3EZ7A 1OH8A 4QRHA 2IXGA 3WNBA 2OM2A 4JJKA 1OXVA 3DKVA 2PMKA 1JQJC 2ANBA 2QM7A 3A4NA 3CR8A 3QVUA 2YWGA 4JLAA 3KQKA 1P2SA 2VP0A 2YC4C 3QIAA 2WWYA 4PHGA 4GDFA 1EFHA 2UKDA 2GNOA 1A4RA 1EXMA 2O8CA 1P4SA 4LJ5A 3C16C 4NH0A 1U0HC 3GLIA 1Z0IA 4A2PA 2NO0A 3OEEA 2KBFA 5FI1B 2RGDA 4DSUA 1R0ZA 3SYKA 4OK5A 4C7OB 4M9QA 3I73A 4B3GA 1KI9A 3WBJA 4TYWA 2ODBA 4NHOA 4TL9A 2ZSEA 4LJ8A 4D0LB 1CXZA 1UBGA 1T6NA 3CLVA 3I4LA 4LPKA 4YLGA 4LHWA 1W5SA 4O0MA 5AJVB 4EQ6B 1GZSA 2ASEA 1D5CA 4LHYA 1EFRD 2QEQA 3C15C 4KCGA 4XD7A 1OH5A 3W90A 1GNRA 4EIWA 2VH5R 2JAQA 2DHRA 3HU1A 2B6HA 4K46A 2WWHA 2ZRDA 4GNKA 4LZZA 4QGGA 3H1TA 4B34A 3KQNA 1TMKA 2E87A 5DLQC 5HKKA 2NPFA 2RMKA 3OE7A 1CP2A 3OHMA 3Q8XB 2QMEA 3JVVA 2CLSA 5AWFC 1AGPA 4L16A 3T1QA 2GAAA 4D0GA 2D7CA 5FL3A 1JNYA 3CX7A 4UNRA 1R8QA 3QF4A 2Q3MA 3VU9B 5LD2B 1P9WA 1UAAA 2XTMA 5FI0B 3TLXA 3T5DA 2ZI6A 1E2MA 1N6LA 2DWQA 4PZLA 2JLUA 3CWZA 1UKEA 1F2UB 4B2IA 1CR2A 3EW9A 4ZCIA 2KBEA 5EP4A 5F98A 4TLCA 2F9LA 1TADA 2PJRA 1W48A 4E03A 2AK3A 3WBKA 4BLQA 2BEJA 1CIPA 2QUZA 4KITB 3GLIE 5LDDC 2NO9A 1MABA 3K0FB 1QRAA 1LB1B 2HJGA 1Z0JA 1AK2A 2CCGA 3KJGA 4PPNA 2KWIA 3U2QA 4E5UA 2ZR7A 3CWQA 1OIVA 2ZE7A 1ZU5A 3FWYA 1FPMA 3ZD7A 2C8VA 4QG7A 3BJIC 3NDBB 4P4SB 1KGDA 1OHHA 2NO1A 2O52A 1HYQA 5AR1A 1FW6A 3A1UA 4TTPA 4I1SA 1ZU4A 1W47A 3AKCA 5JLJA 1S3GA 4BFWA 1ZINA 4QGAA 1W36C 1RJ9B 4QKQA 2P6UA 1EGAA 2H5EA 3LVRE 4C3ZA 4IOLA 2QI9C 1G4UR 4C2UA 2PEYA 4LHXA
chains in the Genus database with same CATH superfamily
1VFPA 2QTTA 2PZAA 1DPFA 4ZYUA 5C1DA 4J94A 2XZTA 5D5HA 3PDJA 2KJQA 2REQB 1GL3A 4DXHA 1VB5A 1ZGJA 4YRJA 4AJPA 3HB5X 3DHEA 3GC6A 4R9RA 4LK3A 1XXHA 3WICA 1FYFA 3MT7A 2OQVA 3FYSA 1WNFA 3DPUA 1PJSA 1KA9H 2YNMC 1XZFA 2WV9A 2RHRA 3K4PA 3O31A 4RSMA 5TJ9A 3TX2A 5L53A 1G5FA 2CY0A 2FRDA 3ZHTA 4NEHB 3UENA 4R7ZA 1VPLA 4HX5A 4JT4A 2AOUA 4KL8S 4PYKA 2AE2A 2Y1OA 3G9TA 4OOEA 5EQFA 2F1HA 3EEYA 3HB4X 1EAYA 2XCQA 1EU1A 2R4QA 2X8JA 1LJLA 1VDZA 3CQ9A 2E4YA 4IPTA 4JP8A 3A6EA 3OOJA 3BKWA 5FV7A 1Y4ZA 2QT9A 4ALMA 5HTOA 4C1NA 2WUDA 3ET4A 4QOSA 1Q0TA 3VJRA 2GZ2A 3PR3A 2WP8J 3QEMB 4L28A 4E51A 5BXYA 3PUIA 1KR2A 1RD4A 3RHZA 5A0VA 4C20A 3FPGA 2YZ7A 1PLLA 3ZD6A 3SQDA 1JBQA 3WK6A 1D4AA 2WA1A 4AUNA 1JA0A 3GRPA 2RK4A 5DNUA 1ZR2A 1LBTA 3NM6B 1CR1A 1SXJA 1KZGB 4TV8F 1EJBA 1JBEA 2PJUA 2ZSJA 3OJWA 3W1WA 4DAEA 3TUZC 1M1YB 1ETUA 2ZROA 2C77A 3G5MA 3O1IC 4AMGA 1VECA 3IO3A 3C48A 1PKEA 1JHVA 3SLGA 4MQMA 4RPGA 3OZCA 1NSTA 5H9VA 4E11A 4FP9A 2COUA 5JYCA 1ZVKA 3BL8A 4F5DA 2CXXA 4HXGA 2FPPA 4GNRA 5B37A 4IOJA 1LBEA 1GLVA 3T34A 4WASA 2VCYA 2JKYA 3OM0A 3QGMA 4DCOA 3MJHA 1Y5RA 2H7CA 1M0WA 1K4MA 2H7VA 2I5PO 5AOBA 4AC9A 3HPQA 3OAAA 2F1RA 3TEMA 2OG2A 4C78A 3FPKA 1ZRHA 3TK1A 2A9FA 1JVBA 1PT8A 1L7DA 2HU2A 2QAGA 4HDKA 4RHXA 3GPDG 4YBZA 2ZU6A 4KRYA 3WMEA 1GG5A 1GPLA 3ICWA 1P4HA 4A6EA 4ZN6A 3ORQA 1CUYA 1ENPA 1G9SA 3MINB 4WXPA 2R5NA 4IR7A 4X1KA 3E7PA 1NWCA 2WYOA 3H1AA 5SZJA 1USVA 1N2ZA 4Y9UA 2DT5A 4EUSA 4U1RA 4RXMA 3ED5A 3P45A 3W3ZB 4WXYB 3PU6A 3P2JA 4C05A 5KOYA 5KB3A 1IEXA 1YB2A 2QT1A 2X15A 2YQ4A 3G13A 1FFCA 3MS7A 1Z38A 3OT4A 1RLOA 2TSYB 5L3ZA 3FZQA 3UANA 4IUDS 3VDXA 4X6YA 8ADHA 5DYTA 1IQUA 3L05A 5F2KA 3IALA 4FQ8A 4QJIA 4PYLA 1I3OA 2RGNA 4R9UC 5C4GB 5BT9A 5DTIA 3A9WA 5KYWA 3RU3A 5B2FA 2WIGA 5HKKD 3RAFC 2H2FA 2W6OA 2ZJ3A 4NE7A 4EAAA 1NUUA 5I47A 1HF3A 2JKVA 1U2SA 3L5KA 3R8XA 6LDHA 2C7GA 2E4UA 2PV7A 5KVQA 4BNIA 1XPRA 3BFXA 2HHHB 3AUJB 3C74A 3HKDB 3EG9B 4ZAVA 1TRHA 4O08A 2GK4A 4X45A 2VT3A 5E1DA 1GSIA 5LOVF 2DHCA 3ENWA 1XAIA 3C7TA 1IH8A 3QI7A 2P9FA 4YREA 3UBTA 1O0CA 2YY7A 1YL5A 1ZYUA 5D87A 3DDOA 5L6LB 2GVDC 3K9FC 3RREA 5JO9A 4DSZA 2IU4A 5CCXA 2I3AA 5EOVA 3JVIA 2ZIWB 3H4IA 4CF3A 5CFMA 4UTOA 3O4JA 5IDWA 2XE7A 3GG9A 1FY2A 2FLVA 3LY7A 4PR0A 4AD8A 5ELXA 4PXYA 1F5SA 1NSFA 2EL9A 1WDKA 2FPOA 2I71A 4WA7A 4LJ4A 1XU4A 4ZRMA 3I61A 1JH9A 3JQ6A 2ZBDA 3KJZA 3L0YA 4GDMA 4LZPA 4D46A 4W7HA 1O2DA 2NSDA 1LPAB 1NL3A 4N5HX 1XZAA 2ZRIA 4B32A 1UKZA 2YICA 3L8MA 2ZXUA 2FG7C 1QANA 1SO8A 2BR3A 2VKQA 3HVUA 4RYDA 4B74A 5AI9A 5CXXA 5I4IA 1X39A 2MSWA 3T9AA 4RTNA 3U1TA 2WUFA 2FUNB 4OOFA 1DFGA 2VOEA 3CIFA 3H05A 3HRKA 1U7WA 5FQNA 4QLOA 4WZAE 5F1PA 2VWPA 4ZAGA 2RK3A 4PX9A 2FW8A 5AKGA 2HRZA 3SSNA 1G20A 2QB5A 1WEHA 4JI0B 3JVEA 4YI3A 1EP2B 3WGYA 3QEMA 1YK1A 2NUPB 2PWBA 2ZRJA 1O3YA 1Z0SA 2F43A 4QELA 3IA7A 1PEYA 5KSZA 5IKOA 2VHTA 3TKLA 4H0FA 5JY1A 2QL5A 4ND5A 1L9XA 1AUPA 4B2YA 2OT3B 2JD2A 1C3XA 4N6OA 4UUBA 3D4BA 2VUTA 4XYBA 5AW5A 4G0VA 2ZSAA 1QV6A 1TA0A 3NWBA 4RD4A 5IVDA 1CRZA 4CPDA 4XYLA 2X14A 1DO8A 5K09A 1LNSA 4PO1A 4RKQA 3GT3A 1T91A 2GTIA 4C4OA 2AEMA 3VPCA 4MB2A 4E5VA 1W36B 1QLHA 1ST3A 2V65A 4TMTA 5FA8A 1IMOA 2J9GA 1YQ9A 4JOSA 4NBTA 3SX0A 3X1KA 2YRWA 1YVUA 4XIIA 5FX2A 4HYQA 2QRLA 4ZQHA 2F8TA 2FP4B 5J43A 4DCUA 3SDZA 4DLSA 4IX1A 3IKJA 1Y81A 5AFSA 2WTUA 4OQDA 1A76A 1D2EA 4CEHA 1PWHA 5A9SB 4G0QA 1MJGM 2OBNA 1X1RA 3AUXA 4P92A 4PU0A 2B34A 3GXOA 2NNLD 3NYIA 3GLHE 4BFYA 4FDVA 5KNDA 2XXAB 3V8NA 3KTAA 1HE4A 4BB6A 3RANA 3WC4A 5C8DA 3GEPA 4L08A 4L07A 4JU8A 3OT5A 4M89A 2NU8A 3O1LA 4FGKA 1BU5A 3HXQA 2ZJ8A 4G65A 3AEUB 2FG5A 3LHSA 2PA3A 1H2XA 3ZIUA 4D43A 2GH1A 3LXUX 5KNCA 4WLEA 3MJDA 2WINI 1EIZA 1XCBA 5CT5A 3BXPA 3L0DA 4DYHA 2Q9CA 5BY2A 1F20A 1FFBA 1YK0A 2A0KA 3ID6C 3PUZA 2HSWA 5K0NA 4LSMA 4EPXA 1PK8A 1E7RA 2OV8A 1FUEA 3DAFA 3VVMA 5IXYA 3HFJA 5BSHA 1A8PA 5BMVA 1CLUA 2HQRA 2IDZA 2FWMX 2K4MA 4LA4A 4WCDA 1CJKC 2B4KA 4KQWA 4Y2GA 4F2PA 4NNJA 2F1IA 1NNEA 3ZDBA 3EIHA 4RE6A 1IB6A 1CR6A 1QYCA 4K9OA 5KYUB 3RFCA 1DJPA 4YWJA 2BSXA 3NNSA 4UXIA 2MSNA 5JJLA 1CIVA 1VSVA 1SWVA 3PFCA 1FA9A 4IDHA 4RLFA 2QRUA 3S2GA 4YRBA 2OLJA 2B4YA 6PFKA 1BXRB 4CIYA 1WXHA 2P40A 3CJQA 3HKDA 3EG9A 5CR9A 2Z9BA 4UNPA 3G2LA 4D8UA 1XC7A 5LCXA 1MB3A 4P93A 5CNMA 1A7KA 1G3IA 1KY3A 3D0RA 3OEHD 5C1IA 4RTRA 4AJHA 4OFWA 3BWMA 3NHBA 4XEUA 3MJTA 5IJXA 2Y68A 3T94A 5SV2A 3WGTA 4BNNA 5B2EA 3NVAA 4UC0A 4GPIB 1ZD4A 4Z53A 3NJ8A 1SWWA 2FN8A 2XYQA 4GI5A 2JAWA 2CFTA 1JYEA 1SQGA 4GVLA 4BZPA 5KTYA 5BSUA 1JEYB 3P9SA 5EP2A 3A3PA 3K35A 3OQHA 5HUHA 5EVCA 4M98A 4QC2A 2H08A 4BQEA 3ACCA 2Z2JA 1TFUA 3HXOA 4WSOA 4Z54A 3GN1A 2IYYA 2J3EA 5E2IA 3HUUA 1BE1A 1T9GS 2CUTA 4HEA1 3USZA 1H9CA 4JSYA 3WMGA 1E1RD 1Z5ZA 1MGPA 5B1HA 5FR1A 2A67A 3X2EA 4F5ZA 1RMTA 2ZT5A 4Q4JB 2HOQA 5MFPA 1JFFB 3B1YA 2XYVA 3KTOA 3BUSA 4Y9RA 4TVKA 5HGXA 4BIMA 2I55A 4EI7A 3O8CA 3VSAA 1PFQA 4EGQA 4LF8B 3NG1A 4X97A 1WW2A 1CUZA 5KNDH 3W04A 2YIDA 4WUVA 2ODNA 4K86A 2PKXA 1PW7A 1ZZEA 3L6DA 3X1YA 1IL0A 4YVFA 2D1TA 3NKFA 3W5JA 1HA3A 3GUHA 2NUPA 3MQ4A 4J7XA 4W9RA 3GK3A 1DC8A 5KNCH 5JLAA 3RAEC 3RIXA 3V55A 1O8BA 2ZUBA 4TYMA 1YRWA 3LVBA 3BH6A 2VDOB 3DT8A 5AJUA 2X8WA 3MM4A 3BMNB 4G1FA 4I5DA 5FFNA 4BJ1A 4BLWA 1MHTA 3FDZB 4EHHA 1I3CA 3I9MA 4FFVA 4QTZA 1OBOA 3RU9A 4M9RA 4DCSA 1VMAA 5HZKA 4X00A 3K0CC 1XFAA 1KP9A 4OHWA 3AZQA 4LNAA 4XSVA 4XVQA 1TCAA 1OI2A 2EIHA 2Z57A 1NFFA 4DLNA 1YVPA 1YNOA 2UYOA 5F12A 4IINA 2FP4A 3CO5A 3OUUA 1SURA 4QOHA 5KQSA 1UANA 4KNWA 3WWYA 5EXEA 4ND4A 3GCGA 1MT3A 4Y0NA 3DLBA 3ZIAA 4S04A 1LWNA 1DKLA 4DS3A 1SXJC 4Q1CA 3L1UA 1UK7A 4G2NA 1U2EA 1UP6A 2I3DA 2XXAA 2XZLA 1HGXA 3CKMA 2GPTA 4OM7A 3EQ8A 4DLXA 3ZGVA 2OKCA 4K6OA 4OU4A 2BDEA 1YDWA 5E8JA 4TQ9A 1VIYA 3THXB 1U3DA 2J4FA 3AEUA 1AN0A 1GFZA 2IYLD 4X93A 1G2IA 3F6EX 2GA9A 1RHRA 2AGVA 2WNIA 5AJXA 1DC7A 3P27A 5CFRA 4QUDA 2VRNA 3JSXA 1MIOA 3NOOA 4WUTA 1L1FA 1RC8A 1W0KA 3I5AA 4LPSA 1WF6A 3L6BA 1E1CB 4JGIA 5GM1A 3GLGB 2WWXA 3OQMA 4Y30A 3MTQA 2PUCA 1BOFA 5D51S 4B9EA 2B4QA 3PE6A 4MVJI 4NYIR 5TGDA 5T8KA 2IHBA 1C9JA 2OPBA 1QQ5A 2Y71A 3TRIA 4EKDA 3TF5A 4HGNA 5KYUA 1PT5A 3THRA 2DWCA 3L04A 1ML3A 2P1RA 2XMZA 2I62A 3K5WA 2LDBA 3N2GB 2BOVA 1JSXA 4HFMA 2PLRA 4INJA 4KXNA 3H9GA 5JSHA 3EG5A 3PQ8A 2FW1A 4JC8A 4JUFA 1V8OA 4JHXA 4A36A 4ARAA 5TVGA 4MLDA 1M73E 1EQ2A 2IITA 1LK7A 1P44A 3GYBA 4ZO6A 4MEAA 1FFGA 1QVZA 2FOLA 3HPRA 3JQRA 4MRAA 4ZK6A 1SCBA 4CVNA 2X2OA 2FHPA 4LDZA 4ZMBA 1DJOA 4WWHA 2FVXA 2IPOA 4N01A 3LS2A 1SHJA 4BE4A 1I7PA 2OCDA 2ZTUA 3FFBA 4RA6A 5DV9A 5HM6A 1Y5LA 1K4KA 1XWIA 2VHYA 4OK3A 4YDHB 3ZV6A 4BYGA 1P5JA 4JJ6A 4WECA 1L5MA 4JV5B 2WEKA 1C8LA 3HBAA 1GUFA 5CX1B 2XUPA 3C1AA 4I8IA 3RUAA 2OO3A 3EH1A 4J0EA 4Q39A 4P6VF 2UUBB 1G98A 1YKFA 4Q3EA 2NXJA 3L0ZA 4XI9A 3U17A 1OV4A 1P1BA 1RNLA 2ZJOA 3K9GA 4LRTB 4X8MA 5J5VA 2EARA 2VYFA 4X90A 5TDHA 3SOZA 3UMGA 1N8TA 3KG2A 4Z7JA 2WHXA 5BRAA 3ISTA 4AKHA 3VR3D 2JFHA 1ZX1A 5B7PA 2V03A 4DJ5X 2X22A 1A2BA 3HLTA 5I9IA 1YZ3A 4OHKA 3T1OA 5JYBA 4GP9A 4XFDA 3N8IA 3PFWO 5K0SA 3KAQA 4FI3C 3WK9A 1U4SA 3HVKA 1Q7EA 5K0FA 3HUDA 1Q5PA 1V6CA 2F3TA 3DOFA 4JZKA 1OVGA 4D9MA 3V8RA 4OXYA 3V8EA 4YLYA 3P7MA 3RIMA 2A0XA 3MRXA 2I80A 2IODA 2W6PA 2XE8A 4K6MA 4NBKA 4TROA 4F93B 3DAOA 3L7OA 4WN9B 4NQZA 3JTMA 1D0IA 1FNNA 1PJBA 1Z2OX 2BFAA 1NRWA 2FEWB 3A6ZA 3NHUA 4ND8A 3AFMA 3NC4A 3KD2A 3LX6A 3F0TA 4XB2A 1UPXA 2CUNA 3QH4A 1MFZA 3WKCA 4TGLA 4ZTUB 3BMNA 3CF6R 3P2YA 4TQAA 4C01A 5BNTA 4W99A 3OKCA 4L8YA 3SF0A 1UK6A 3D1JA 4U2EA 4YFVA 4JYZA 3S2EA 3F9CA 2QGNA 1K08A 3CUKA 1NWHA 5CDFA 3RAJA 3SMVA 4K9RA 4MIOA 4QGFA 4F5YA 1K0FA 4JQOA 4OQFA 4YUYA 3T9DA 5AP9A 1MBZA 1CNMA 3WLPA 1LSOA 1XEXB 3R5XA 5GPBA 2PXCA 3GVCA 4LZNA 1O0SA 3HZRA 3P1JA 4G84A 4IDEA 1X86B 1SUDA 2QLMA 3B7GA 3PQEA 3OPVA 1O6FA 1U7XA 3DWGA 1OY1A 1GQYA 4MULA 2QQFA 1IDN1 1W4RA 4B7UA 1VGQA 1BMTA 1J0AA 1RHKA 3PHJA 3X2SA 4EVQA 3WQRA 1NXVA 4G4SO 3C6XA 1IN7A 1RTKA 2C0CA 2Z2ZA 3EULA 4FIZA 2EAUA 4LY6A 7ABPA 3A2KA 2GJ9A 5AJHA 1HT3A 2YR0A 2CHEA 5I7VA 3BTVA 3D6MA 4L5AA 5IC6A 5KZMB 1YQUA 2ONJA 3T7TA 1C8KA 5F2EA 4WY8A 9MHTA 5ETJA 2NUAB 1Z39A 4DGSA 1UXGA 4Q3DA 2BI8A 2Q3HA 3NC0C 1KIFA 1Z3CA 4PLZA 3IQIX 1YTUA 3FTDA 3VTAA 3K0HA 3MWEA 4ZYYA 1ZNZA 2RSLA 5BVHA 4NX2A 1OTYA 1PN3A 2VF5X 2M6KA 1Z5GA 2UZ0A 4PIVA 1E1CA 3AJ8A 1X0XA 4AL4A 5AKKA 3G0CA 3R5JA 5B3LA 4CDGA 3H86A 4FFBB 4DAOA 5CFNA 2YQZA 4JXKA 4I9UA 4PS1A 3WTCA 4WACA 2QR3A 1MA3A 1CF9A 1GZHB 1YIDA 2O0HA 3A11A 3E1KA 4B6FA 2J87A 2JAHA 2BBTA 1JIXA 3O4FA 2Z6QA 1E9DA 1HKUA 2UVDA 3LRPA 3UAXA 4AZ3B 5BSFA 2P30A 3DEAA 4K7JA 5I7RA 5C7OO 1R64A 3DYVA 1XNJA 4LQLA 3RNOA 4IILA 4DVJA 5HIKA 5CFPA 1DBVO 4RE5A 4AECA 3TI9A 4GZMA 1RJWA 1UQTA 3FNIA 4FSHA 4ZVPA 2HBRA 2ODAA 2ZUWA 3F9RA 4U7PB 3K70D 2IH4A 1M6EX 4H1WA 2HW8A 2A3RA 5DMXA 1L4KA 1N2IA 3I4CA 4Q7EA 2WG1A 4JL5A 3EVBA 1RYBA 2RGUA 2CW5A 4EJMA 2PLFA 4YX9A 2LKCA 2I7CA 1F1BA 3A4LA 1MN6A 3EZLA 4ITUA 5TC4A 5JDIA 3O92A 2GN1A 2AC4A 4DW8A 1GQRA 1H2HA 1B6GA 2YFYA 3ZXUB 1OB2A 3EA0A 4MUBA 3WDSA 3H5OA 2HNAA 2QU8A 3RVRA 4GPBA 5TMDA 3GGDA 4REQB 3JQAA 2O4CA 5D6OA 3ZX4A 1JA1A 1XA3A 1C30B 2IHTA 4P36A 2O19A 4TT3A 1JJBA 4QFBA 4X3OA 3DUFA 1IBMB 3SDSA 3R3UA 3G5AA 1SOWA 1CUSA 2QM0A 1AURA 1WTAA 3GPBA 4M0LA 2O3UA 1R5OA 4QFMA 4DQXA 5JO0A 3C3MA 4PCUA 3HADA 2CL7X 2JLWA 3JAMA 2AQ8A 3IOCA 3E7WA 3R3YA 5J40A 2FAXA 4FKZA 4AKSA 3UH1A 1LNZA 3GAMA 1REQA 2HJVA 1EBUA 1OLUB 4CU2A 2BHRA 4D4MA 2W22A 1S6YA 2W6MA 3GOHA 3MTBA 4JY7A 4K9SA 4NE9A 4N82A 4NMXB 2NO5A 1YKSA 2A1TR 1DRKA 4BASA 2CHFA 3HB1A 3FVWA 2EWVA 4F06A 4MQBA 2XUJA 1BH6A 2JDIA 2BSQA 4HS4A 4WVLA 3WLTA 4CRWB 3U4GA 1RLMA 5LP1A 1GG2A 3V7FA 4TLEA 2D8MA 5DNAA 5GZ6A 4Z3DA 2OXRA 2IDKA 4X92A 3SM9A 4BBZA 1MUUA 4BE9A 5L4SA 4R6XA 2FSUA 1EPUA 3AGPA 3LP5A 2YZ2A 4WN9A 3KVYA 4ZEXA 3L0SA 3DLIA 2QDXA 3EAGA 2C97A 1S9HA 2QV7A 1F7VA 5TF4A 4CM7A 4ZGWA 3RFUA 5CIYA 3TTXA 4Z4CA 4TYPA 5HF8A 2PRSA 2VJMA 4OFXA 5LZ4A 3D3KA 2Q27A 3BH0A 2OQRA 4P3XA 4K40A 4RAQA 4MX8A 1A1VA 3O91A 1YQDA 3PLRA 5FXMA 3R8CA 4B2LA 5SZIA 1JXMA 5LBIA 1RJEA 3OZSA 1A9ZA 4RK7A 4Z51A 4POAA 4QQFA 5E8RA 1XEXA 4MGHA 3GA0A 3TLYA 4Z0HO 3QFTA 4CLRA 3L4SO 1FW8A 3GBSA 3PXCX 4QEZA 1T2VA 2JFUA 3NP9A 3QG1A 4G4JA 3VJLA 1W4BA 3TIGA 1Q3TA 3BKXA 1JIJA 3JTEA 1ZI9A 3OEYA 4F6CA 4ZYZA 2O8BA 1PX0A 2O1EA 3CF2A 3PB3A 4R3UC 1QDUA 3A10A 3CNEA 1CUCA 1WXXA 2VSFA 3O8OB 3L8ZA 4B83A 1W75A 3H75A 5TT0A 2ZRPA 1ATZA 3ASYA 1UDCA 4B45A 3ROQA 4F04A 2O4UX 4MYCA 4W9NA 3NAGA 5L7WA 2CCKA 5EGNA 4HBGA 1UDBA 2V6JA 2IV3A 3CR7A 4R98A 4B87A 4C21A 4C14A 2BH9A 4EHBA 1FP7A 1V4NA 2ZFUA 1HY3A 1LH0A 5E9AA 2CMGA 1H3NA 4U02A 3UA3A 1LQ2A 4JJGA 5DPMA 1A5SB 5JPIA 3QMWA 1XDDA 1G8YA 2DQKA 1XMQB 4DA6A 1DX4A 3FVTA 2ZK7A 4IHJA 3VR2A 5C5IA 5F51A 1BRMA 1S0UA 2J6CA 1VRWA 3BFKA 3DONA 1AE1A 5IXSA 3CCFA 4MB0A 4N8DA 1QQTA 4DCNA 1UBSB 4O6VA 2DTEA 1G5QA 1PDWA 2WPDD 3M6FA 4C7OA 4CLEA 1ZCBA 3P9KA 1NNSA 1OZHA 2IE8A 5E4YA 1NLYA 2HREA 1SCUB 4TN1A 1DIGA 1X7WB 4KR6A 2R6CA 3V97A 5JYDA 4CQMB 1MT0A 4D3XA 2QT0A 2AQKA 4K9NA 3I6MA 4HDSB 2AX4A 3NTXA 3CVJA 5SYNA 1M0TA 2C0QA 3FVRA 2GUWA 4NBSA 4QJ3A 2TRSB 2I6GA 1A88A 3AIKA 1QIFA 4ZKDA 1MB0A 1SRRA 5FTWA 1H2YA 4MVJE 2LCIA 3W78A 3VU1A 2V3WA 4ZPJA 3LWDA 2R1UA 1R15A 4A6DA 1GNLA 4E6EA 2P2NA 3LBYA 3TZLA 2XGJA 3DOIA 2B98A 4ZC1A 1J5EB 3V1KA 3OTQA 1F48A 4RVGA 1NJGA 4OMDA 5KREA 3PHLA 2NZXA 3H2KA 1C30A 2B2CA 2PT7A 1Z7WA 2HX1A 3HA3A 1EUCB 3DKIA 1BJRE 3ELWA 4M7RA 4P5EA 2JS7A 2CXPA 2R62A 4HEQA 3CZQA 4N6GA 1LBHA 4NU5A 4KO3S 3G6KA 5ALHA 4G3XA 2PWZA 3TVYA 4AIIA 1KJNA 1AXGA 2WR8A 2GDJA 2VRCD 3DAHA 1X80A 1PR1A 3FPHA 3GF4A 3O3MB 4AG3A 2QWXA 3K0SA 4YCBA 2IZ5A 2I2AA 4Z7NB 1Z63A 5ICCA 5HZGA 3OTIA 4OJNA 2IVZA 1J8QA 2OGUA 3EQ2A 1U8CB 1U1FA 3P5BA 4M53A 2ZI3A 2OP0A 1JTVA 1OFUX 3QPBA 4HRXA 2ONYA 3FGNA 3KOWA 1KZ1A 3KZNA 3ZWOA 2ORWA 3B20A 3BIJA 2WG2A 3NHPA 5FFFA 4P08A 5SY9A 3UB4A 4TPKA 4OSPA 5ICMA 3LFHA 2R00A 5HJ2A 2ILVA 4MUXA 2E0IA 3K0FA 1BIFA 4U8GA 3BSWA 3TE7A 3ESBA 4HNAB 5E9JA 3MCTA 4DDUA 1MV5A 3MJEA 5A7HA 2JLBA 3UIEA 2P6RA 2P5YA 3ZHQA 5KCMA 4LJ6A 3T4PA 3KP1A 3S1LA 1HT2E 3IELA 4TKVB 4B6OA 4PN3A 5A06A 4NTZA 4REOA 5DBFA 2YVQA 2XHZA 5CVTA 3ZUGA 4X1OA 4DM3A 5C5CA 1I24A 3ADCA 1FX1A 5KO2A 5AI4A 3MA0A 2D2XA 1ZVMA 3KK0A 2QUIA 3D4LA 3NRCA 1E3MA 1ONNA 1FMCA 3ACDA 5ESRA 2RJ3A 4CKBB 1CVRA 1QOZA 1T9CA 4H7JA 3TZCA 4IJKA 2Q2WA 2L0XA 3JSAA 5CDUA 4GLJA 1QO7A 3ZE8A 1OLXB 2J9FB 5KWJA 2AT1A 2PANA 1N7JA 1HUQA 3KQMA 4AY4A 4DR4B 1AGXA 4ARBA 2GSWA 4OPMA 5CBPB 1N8KA 1CTQA 3PDUA 3ROMA 5KMGB 1TYAE 2B0CA 3SC2A 4ETMA 2W4QA 1RBYA 2MSCB 3UGJA 3P97A 4KPGA 4MJ7A 3U3RA 1O96A 2DBYA 2GXSA 4MLZA 4BUCA 3IPLA 2V0GA 3O8OA 1ZP6A 1VYUA 3JAKA 2VJOA 3K31A 4TTJA 1KMMA 3TCKA 4DCPA 2ACKA 4C0WA 5LDHA 5DRYA 5BWBA 4RTMA 4HAOA 2HPHA 2HO5A 3ISVA 3LGSA 4X6UA 2WSBA 4HYEA 1KO4A 2X86A 1PGJA 3C98A 2NZUG 3M5DA 4NMMA 5CJPA 5HYVA 1QMPA 4ARIA 2HA5A 1T1IA 3Q3EA 3BBPA 4LQCA 4MVJD 5DI3A 1P9LA 1QVWA 3BF7A 4HWRA 4LF7B 3IPAA 1N2GA 5CFOA 5KBYA 2YXEA 5EVJA 5AVVA 3S2SA 1Q17A 2OR3A 4U7TB 3KT6A 2BHSA 1N6RA 3PWTA 3RFXA 2IYXA 4B4VA 4HY3A 4RH0A 4US1R 5DO9A 5FWNA 2LUOA 2RB4A 2XOEA 4EB8A 1DRWA 1KO7A 2I3GA 1KO8A 4QBFA 4U7GA 4G5RA 4WINA 3H04A 4EP1A 1Y9DA 4CL0A 4KWCA 2D0PB 3OX2A 2WSMA 2B8EA 1WY7A 2CUZA 1AQIA 4IEFB 3HBMA 3UJ8A 3W05A 4HJRA 1UPBA 1OT3A 1Y6ZA 3RYHB 1CZOA 2H1HA 3N2IA 3DTYA 4YTEA 5M5BA 3AXTA 3QMVA 4BP8A 3U5ZB 4PZ9A 1ZWKA 3OZGA 3R5HA 3CUWA 4KWIA 4RDIA 2Q5EA 1EGQA 4JL8A 2HM7A 4L8WB 4PG6A 1XAHA 4PGMA 4QECA 2EGHA 3USES 3GHHA 1LLDA 3U7QB 3O95A 4DC9A 3C6MA 4TS4A 4AK9A 5KYYB 4AJ9A 1GDDA 1Q1GA 1BWQA 2A9OA 3ONEA 4V02A 4EL0A 2ZUFA 1WCXA 5K4HA 1OC2A 8MHTA 1VYTA 3ZBPA 3ZD8A 1ISMA 3MQFA 3PD0A 2JIZA 4WW0A 3WWCA 5EZ6B 3ZHYA 2H06A 4E2YA 5HFAA 1LSJA 5IZCA 2CJPA 3TMYA 3HCWA 4PPGA 4AJNA 4PPYA 2W4IA 2C9ZA 1FMLA 4GC9A 1JLMA 2QJWA 3GRVA 1YA8A 2JB9A 4HPWA 1C0LA 3HBNA 1DBQA 1NYTA 3LFTA 4OQYA 5EWLA 1EUCA 3NPAA 4XIFA 3ZWYA 4N7JA 4HT3B 4GPTA 2WZCA 2X19A 4Z49A 3QVTA 1V48A 3T7CA 1TO2E 2P8JA 3OPXA 4B73A 1IUOA 3A1FA 1V11A 1PT6A 2PRZA 4L4RA 4YAFA 3WYAA 1T3TA 4Q3NA 1QM5A 1S7GA 4TV9B 3U6KA 1CYEA 3AF2A 1APBA 2VAXA 3LYUA 3FUXA 4B5LA 5H8WA 2YZGA 3ETCA 3DR3A 3ZKWB 2RCNA 1TO1E 1C7JA 3FIJA 3IV7A 4J0CA 1SUEA 1FTSA 3JQFC 1PQWA 1N3BA 3E5MA 3S40A 3IGFA 1JHUA 1EH5A 1ILEA 1YR8A 1NXQA 3HVIA 5U9CA 2B3TA 1E8NA 1M67A 2ZEJA 4WJKB 4JA0A 3E7XA 3E9NA 3QX7A 4LHEA 2H07A 1UT8A 3SQLA 1ZWLA 4IQFA 4ZAWA 3UJ6A 4DREA 1K8XB 3EGOA 2ONCA 3ST7A 4D3SA 4XM0A 2X2EA 2NU9B 3QA9A 5A6VA 2FEKA 4GPD1 1FXSA 1E3QA 4F11A 1TYZA 1KEEA 2RHGB 3NTVA 4QOJA 3H6KA 3QLJA 2I4IA 1TM4E 3OC6A 7YASA 2RHWA 4KQCA 4DR7B 4UTPA 4R01A 4IRXA 3Q0TA 1CJTC 2BM1A 3EQ7A 2E9SA 2G8NA 3IP8A 3KO8A 3SHVA 2DR2A 3LO8A 2O7QA 4IIJB 1K3UB 5H16A 1UOQA 1QO9A 2EWMA 5E3JA 4M99A 4LSZA 4FFOA 1XALA 4BQSA 3LD9A 4D97A 3U4QA 1E6LA 1HM5A 2V74B 4CKBA 3ITEA 4J90A 4ND2A 2FSSA 4BMVA 3S3TA 1UOEA 4H2DA 1J0EA 3GFTA 2NT4A 2BMAA 4M1TA 1UUFA 3U3ZA 1R5NA 1TJNA 1XZMA 2J9FA 3EY9A 4Y7CA 1UJBA 3ZZNA 4A27A 1TPZA 1U5AA 3HYNA 3O21A 4QJ5A 3VGPA 2IS6A 3JQEA 3NETA 3Q2IA 2QS9A 3W3AH 2WQZA 4QFDA 5ER6A 4NFSA 1K5HA 4RQBA 1MFPA 2O05A 4Y2TA 2HLHA 2UV8A 2WLSA 4Z0PA 1AKYA 2V54A 3KETA 2JBWA 4DLWA 4ZOCA 4JOQA 3C3XA 4DE5A 5CPBA 1ODCA 2IOYA 1C0IA 3IHTA 1EJ0A 3F2VA 4FE7A 1JUDA 1Q7CA 3KELA 4WOJA 3SE0A 3HO1A 3SSMA 5AHXA 1W49A 1U2RA 4GS5A 1G3QA 2H0QA 2VYND 3E18A 5F2OA 1A98A 3R7LA 5HZMA 5KC9A 1ND5A 1B43A 2J0UB 5DP2A 3TTWA 3IP9A 1H65A 3AR3A 1NKSA 1EQUA 1U0JA 2OHHA 3BHMA 4KP7A 4DNPA 4EKYA 5JH7B 1ISJA 1Z26A 2VBFA 4XGIA 5C81A 2Q3FA 5FLKA 3KU4A 3MYYA 5HCUA 1HE8B 3QVLA 1DAPA 4IZOA 3SZOA 4UMFA 3DAGA 1KZ4A 4XX0A 4Q3LA 5FI5A 1U3FA 3TQFA 4ZMRA 4HGOA 2X6TA 4ZT3A 3EODA 3OCZA 1D4ZA 2DFPA 2I4OA 2IPAB 1N9KA 4TOIA 1AZTA 1JDZA 3QYAA 1D09A 4GMKA 5JSYA 4JB8A 4TQGA 2WAXA 3B85A 3N0RA 3FX2A 3HXKA 4Z9YA 4BRZA 4J91A 4OQEA 4JBXA 2JARA 2C92A 2HF9A 1UBOS 4FW8A 4KAFA 4QD3A 5KAMA 3UUGA 4FCWA 5JQWA 1PJAA 4CFZA 3BWDD 5EUBA 3WJAA 5IUJC 4KJZA 4E2FA 2I2XB 2WZDA 3HN2A 3FLMA 5AVZA 2A1IA 1WZIA 4NE2A 1RXUA 4HV4A 5JHHB 3RYCA 1E20A 3GJZA 1I7LA 4AWXA 1R74A 5KYXB 1RYMA 4GT1A 4LWPA 1ZNWA 4X44A 4G4GA 4QUEA 5BR8B 4DSNA 3WAKA 1AM4D 1VKHA 3KYJB 2WG0A 2G8LA 4GGMX 4HMQA 3FOEC 2ZJ1A 4R8RA 3V7NA 2A84A 4CF4A 2Y1LA 3OCYA 4PBTA 4KX3A 3R0ZA 2QYSA 3JWPA 5MN4A 1Q20A 1OPRA 3HUTA 1Q16A 4KGXA 5FR2A 2PJDA 3FJ1A 3Q11A 1Y9ZA 1ZZGA 3Q7RA 4OAOA 4TV9A 3RVPA 1ETHA 1MXFA 2DQYA 2DMRA 2VDQB 1VMDA 1XRSB 3AUYA 1SNYA 3PITA 5H3LA 3U3XA 4EPWA 3PGLA 3ZKWA 5H1YA 4YRAA 4JI7B 1X1DA 3FWPA 1XDGA 2RI6A 3H3JA 3IR7A 3RWMB 2WUEA 4MW6A 3W5AA 1V37A 2PUJA 3GJYA 1X2BA 3E61A 3OPNA 2QN3A 1OD6A 3A1DA 3TO5A 3UZUA 2OWEA 3VVLA 3U16A 2CMKA 2F8LA 2FPLA 2V9ZA 2QE7A 4TTVA 1Q15A 4BMDA 4F3TA 2PGXA 3N1UA 8ABPA 1EBBA 4D9IA 1OREA 1W85B 2I8AA 2WAMA 1C14A 4R1PA 4ME6A 1RW4A 1PFYA 3DVAB 3AOGA 4NJOA 4TZTA 4N8SA 1ZUHA 2LCFA 2RH4A 5AUNB 1M1UA 3N2YA 4C0BA 3EVCA 4OB6A 5JS7A 1CS0B 2PBLA 1XZNA 1E7MA 4AO7A 4IM7A 3J80A 1L5OA 2MINB 4RMGA 4OHZA 1A27A 4UUQA 4YT5A 4QBTA 2O3QA 2N75A 4ENUA 4A2QA 2Q0XA 3D7LA 1P3Y1 1BMFD 3IQHX 5HUQA 2EP7A 3GLIB 1XPJA 4GPAA 5AJZA 4INZA 2IYNA 1X8LA 2HA7A 2R00C 4RF2A 4B7CA 3EJ6A 1E8MA 1JHXA 4JODA 4CKYA 1OTHA 5DT9A 1GSAA 1JIQA 1JILA 2J0VA 4MYUA 1BHSA 1NI3A 3RTGA 1M76A 2Z5LA 1KP3A 3ELBA 1YQGA 3IT2A 4DLVA 2QZSA 5F64A 2H18A 4JS0A 4RK4A 4N41A 2AYYA 5ENDA 1XMSA 3SY8A 1WD5A 4OA5A 1DUVG 2CLEB 4IQ8A 2X5OA 2G04A 3I76A 3OPMA 3E0XA 2FF5A 1T5IA 2ZVPX 4TTTS 1G21A 4KIWA 2XB2A 4FSDA 5FO0A 3UJHA 5AK5A 4LVUA 1JEQB 1WVIA 1WCWA 4WZBE 1H05A 3I5XA 3NXKA 2CHQA 2QTCA 3CRNA 3KJEA 2H1FA 3DC7A 1XEWX 4Y6SA 3J81k 4M6WA 1T9GR 3T1HB 3WDKA 5ALPA 3BJRA 2JCVA 3CGWA 3EDCA 5DASA 4GGPA 3BMXA 3S27A 6REQB 1MQAA 2ZPAA 3R3SA 4ZV4A 2ZT7A 5ED0A 2C5HA 1YOVA 1LKZA 3AHIA 4I3HA 4GSLA 4LV8B 3K2IA 5ALWA 1DX6A 4FWIB 4S05A 1HDZA 1O95A 1SB8A 2BUBA 2QL9A 5EMNA 5J9FA 3OETA 1LY1A 3DFIA 3S2YA 3WNCA 1S8OA 2EERA 4YHBA 3I8SA 2ETXA 1J42A 3RRMA 4PZZA 1FJGB 3PGA1 4WEQA 5JMTA 4A15A 1FQWA 2WU0A 1EFAA 5LYJB 3DDZX 1R00A 1XRMA 2WJZB 4BJ3A 4R2WA 2JAOA 3B82A 3E3MA 4LOAA 1QHYA 5EIXA 3W1VA 2Z04A 4I5EA 2ID4A 2WB2A 1FFAA 3GY0A 4YI5A 1T0HB 1BYIA 1V8DA 1LX7A 2EBWA 2X2FA 2ZT6A 2VSOA 3C41J 3KQTA 4G5XA 4GKBA