2IYUA

Shikimate kinase from mycobacterium tuberculosis in complex with adp, open lid (conf. a)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
167
structure length
167
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHIKIMATE KINASE
publication title Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 65
structure length 167
sequence length 167
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iyuA00
2P0EA 3GJ7A 5FL7A 1NL3A 2C2HA 1CULC 4KFTA 3FKSD 3DM5A 3CWQA 1SVSA 4QOSA 3ND9A 3MFYA 2DB3A 2O8FA 2ZI5A 1ZCAA 4BFYA 2ZREA 4OBEA 4FW9A 4Q4JA 2NPFA 3A36A 2FZLA 4F7WA 1E2LA 3KL4A 3K9LA 1A7JA 1DAHA 4JIMA 5GJWC 4DT1B 1AZTA 4DSUA 4LI0A 4JLDA 3WYFA 3I61A 3RS0A 1OFTA 4NYMR 3T1VA 2OLKA 5GJVC 2AKAB 1PJRA 1TX4B 2J0UB 1NY5A 5DI3B 3IQXA 2CBZA 2KBFA 5JWHA 1IBRA 4TTQA 1X1RA 3PUWA 1CR0A 1GL9B 2QP3A 3KTAA 1P2TA 4EPYA 2O8EB 4PZYA 4FXPA 1IXSB 4B6FA 3QVUA 2ZS7A 2ZRNA 3FGNA 1I4TD 4PHFA 1J70A 3HU1A 1E4YA 2EYUA 1NI3A 3H86A 1W0KA 1WRBA 4GOJA 1IJFA 1EG7A 1G3MA 1E9RA 4FCVA 4LYJA 1XTQA 2ZJAA 3QQ5A 1UADA 3B1XA 2W6IA 3GLHE 5C4MA 4KSCA 2PLRA 3WYAA 4PSAA 4G1UC 5JECA 2DWPA 1OXVA 1XJCA 5CJPA 1KSGA 1G8FA 3K70C 1YR6A 5E7IA 1S8FA 2G1JA 3KUDA 1P6XA 2Q21A 1VCOA 5KDOA 2GJ9A 1XPOA 4QGFA 4JLBA 4EPRA 2ZI9A 4A0GA 1BMFA 4EKDA 4MKGA 1E94E 1H8HD 1KY3A 2NIPA 5JSZA 2NOAA 2HT1A 4CEHB 3WMGA 2MSDB 2QMOA 2X77A 3GJ0A 2ODEA 3VHXA 1KI3A 2V54A 4PHTA 2QROA 4HLQB 3MG9A 3WRXC 2ONJA 1E0AA 1S9DA 3BD9A 2H1LA 4JL6A 1OH5A 1VECA 1W0JA 4B3GA 5H68A 4EFNA 2G77B 3BFXA 2ZI4A 4C0AC 1G7RA 4LHVA 2DCUA 4LPSA 2O8DA 4MKHA 4LDJA 1QHNA 2RAPA 4UXJA 4PC6A 1Z29A 3O8CA 1N5LA 2J0VA 3K8YA 2WZQA 3CPJB 4OYHA 5GJBA 4C0SA 2AD5A 4LBZA 1AGPA 1VCMA 1M74A 2GK7A 1DO2A 1T5LA 1OFUX 5CDFE 1Y63A 4BWYA 1II8A 3IIKA 3L2OB 4DLSA 4LJ8A 4W9MC 4W5HA 1LY1A 1RJ9A 2RGEA 2ZE6A 1A5TA 2CHQA 1RE0A 2HF8A 3A1TA 2CK3D 3HPRA 2ZRMA 2FGKA 1S1MA 4HDCA 4B3BA 1FPMA 2CDNA 1HYQA 3FFAA 1W1WA 5KSZA 4XVUA 2WAXA 1W4AA 1XCGB 3IGFA 3U3OA 4D4MA 1DS6A 5IK2A 1YZTA 1DAGA 2H57A 1Z0FA 1E1QA 5IF9A 4KFRA 1KDPA 5DLQC 2VP5A 4ZIRB 4V03A 1KK0A 1Z2AA 1CU1A 3K09A 4GOXA 2PX3A 4NYIR 4O2RA 3FKQA 1NN5A 5LBIA 3HR8A 1KO4A 1Z0DA 3CZPA 4TSFD 4IOLA 2A5DA 3UWKA 3QOFA 2R6AA 3RC3A 4YDSA 4AYXA 1E2GA 4G5SA 1JAIA 1UBCA 4PZZA 1TQ4A 4A82A 1R0WA 2PCJA 3GJ5A 4R7ZA 1GNPA 1O3YA 2G83A 2I1VB 5G40A 4YXWD 1G64A 2D74A 2GJAA 3FMOB 3OFNA 4A8JC 3MWLA 1G16A 3IHLA 3TW4A 3CKLA 4MGZR 4B71A 1ZNWA 4MA4A 5CM8B 5JCPA 1Z6GA 2QT1A 4NONA 1P2UA 2PMKA 2OBLA 2EW1A 2G9NA 2BJVA 4IDOA 3LBNA 1IN4A 3IBGA 5FL3A 2ECKA 1SVKA 1MO3A 2GZHA 3CPEA 1P5ZB 2QM8A 1TEVA 2ORIA 2GEUA 1RKBA 1KO1A 2ZS8A 1ZM9A 4AIIA 4AG5A 2QI9C 2QORA 2ZJYA 2D2EA 2GXQA 2IYWA 1Z2CA 4KFUA 2ZRJA 5EUQB 2O8CB 3O47A 3SS8A 3P20A 4BLOA 1N6NA 1UF9A 1YZGA 1E79D 2XB4A 4FMBB 2AHOA 2GILA 5EP2A 1X8JA 2QEQA 4DRZA 3KJGA 3ZVRA 2QPTA 3CRMA 4BUJA 1JALA 2IYLD 2F9LA 2ZJ8A 2UZ3A 1NVXQ 3TSWA 4YMTA 2C04A 1UKZA 1NSFA 1G291 1M34E 2QGZA 2XXAA 5SZIA 3O8BA 1E9FA 2QY9A 2ZRKA 1NRJB 2B8WA 2EFHB 2ZAOA 4N3NA 3PUVA 4TYNA 3ZDQA 5FUVA 1FL9A 1E2HA 4MYHA 121PA 1AN0A 4CVNA 1AGRA 3LFUA 1XEXA 3MAAC 4AK9A 3BIFA 1XZPA 1HT2E 3KJHA 3R7WA 2R6FA 3QPUA 4P4SA 3EZ7A 2BEKA 4Q66C 1XXHB 4LJYA 5K8LA 3QEOA 1Q22A 1J99A 4TZ0A 1VYUA 4NDZA 3AF0A 3U4QB 4LV5B 1COWD 3REGA 2GVDC 4Q1DA 4Q5IA 5FOTA 1JPJA 1U94A 3RWOA 4A9AA 1I2DA 4TQ9A 2EWVA 5FPHA 4ZI3A 5JHHB 1G7TA 4HDOB 1AZSC 1DTSA 2FEOA 2OLJA 3U3JA 4NCJA 2GRJA 1KMQA 2GKSA 2OT3B 2VTKA 3GMTA 3AKDA 2F43A 4CEIA 4EJSB 3TUZC 3GJXC 1LS1A 3AV0B 3BFKA 3EZ2A 1XMVA 3AF2A 4GRAA 3U44A 4GZLA 3EARA 4TL8A 2QMEA 1IN6A 4O3MA 4IFBA 2AXPA 1DG1G 4DLRA 4ASUD 2WPDD 4NMMA 4OK5A 2OXRA 2J0SA 3NEYA 3GJ6A 1NN1A 2R6DA 3QENA 1W7AA 1F2TA 3AVYA 5CM9C 2O0KA 2G1KA 4Q1FA 3EC1A 4PPNA 2VO1A 4A15A 1YKSA 3Q72A 4IJMA 4WXRA 3NDBB 3PXGA 3D31A 4BFSA 1TL7C 1XCPA 2GXUA 4QGAA 3DL0A 2XSZA 4RD0A 3IQWA 2JA1A 1R0XA 1SQ5A 1XD9A 4RD2A 3UG7A 1ZYUA 3ZQJA 4Q1CA 4A92A 4BE7B 5EZ6B 5TXGA 1YR9A 2X8AA 3FMPB 4ITRC 5E3HA 4H9GA 3AKYA 2OBMA 2NGRA 1PUIA 1UM8A 1MO5A 2GDJA 3BE4A 3ECCA 4LOAA 4OI1A 3SU8A 2JLWA 1T8TA 5BYJA 3WNDA 4IRUB 4LPKA 3PIRA 4R2HA 1KY2A 2VHJA 4M53A 3CUEF 1G7SA 1NF3A 1VTKA 2AK2A 1VG0B 3LLUA 3WHLA 5FPTA 1K5DA 4CF7A 2WWFA 3OEED 1M7BA 4TL7A 3W3AA 4LBWA 1R5OA 4F4IA 1OFIA 1Q44A 5HR5A 2XZPA 4M4SA 1NVVR 2RH5A 3KX2A 5CDFA 2OO7A 2BCJQ 1GKIA 3Q85A 1KZGB 1X3SA 2IXEA 1L8QA 4DDWA 2KB0A 2IX3A 2QGNA 4B32A 3IBYA 4LUCA 1P9NA 4FI3C 2QN6A 3HP1A 2ZU0C 1XTKA 1GTVA 5FOWA 4AC9A 3KJEA 5SZHB 4HATA 2C99A 1FNMA 3QI2A 2FSFA 3C4JA 5DE3A 4TL9A 3A1SA 1XX6A 3N5CA 3KQKA 3KQUA 3BB4A 4DIDA 1U0LA 2FFQA 3L0IB 4HAWA 2JCSA 4LGMA 1JB1A 3KKQA 1RPZA 1G5TA 3MRSA 4C7OA 3WMEA 3QF4B 1PLLA 3BWDD 1IAQA 5AJZA 4E03A 1ZD8A 4QKQA 1FP6A 3RYTC 1G3UA 3VR4A 4LY6A 2QG6A 1OFHA 3LD9A 2RGNC 5KU1A 2VP9A 4UJ3A 4Z8YA 1W49A 4Q02A 2P6NA 1N5JA 5DHAA 4ILEA 4CZ2A 2QRNA 3VQTA 1OYWA 5F98A 4AYTA 1UKEA 4OJQA 1HQCA 2VSOA 1P62B 4D0GA 3DDCA 1G19A 1D2MA 2ORWA 5FTLA 1UKYA 4Q03A 2RMKA 1R8SA 1T0HB 2OSBA 1BOFA 4Q1EA 4PO1A 4TL6A 5DN6A 3U60B 4MRSA 5JS8A 4TMWA 5BYKA 1FX0B 1UDXA 2AD1A 4U00A 1YU9A 2QAGB 2R8RA 3H84A 3ZYCA 5LDDC 3M0EA 3VMFA 3FKSA 1E32A 4S35A 2JASA 2JJ8A 3P32A 4RSGA 3KUCA 2NO1A 4XSGA 3IO5A 3MSXA 2VP2A 1FUKA 1FUUA 3AUXA 3KQLA 5KNCA 2ZI7A 1P4SA 3D8BA 3V9PA 4ZKEA 2GK6A 2I4IA 3GJ3A 4DCUA 2OESA 4KFSA 1Z22A 3BOSA 1ETUA 3I8SA 4QJ4A 2BVNA 1LF0A 4M1MA 3QKSA 4MUBA 2AK3A 2AX4A 1KSHA 5CB6A 1AA9A 3BH6A 4I1UA 3AKEA 4CT4B 2A9KA 4Q4HA 2OFOA 1KHTA 3CM0A 4NKRA 3TBKA 3IEVA 4AURA 5FTMA 4N0EA 3SHWA 1KGDA 1IQPA 1ZUHA 3PEYA 1E3MA 1R0YA 1KOFA 1QG2A 3QVVA 4YC7A 3RABA 4D81A 2CE2X 4CEJB 2A5JA 3R20A 1E2NA 1EFHA 2EYQA 1H8ED 1TUEA 4GNKA 4EAQA 2QE7D 2GETA 4V0KA 4M2LA 4AKGA 3W90A 5A4JA 4NTZA 3ONWA 1T3SA 4FMCF 2H92A 2IYUA 3U3MA 4WIAA 4DT1A 1VKJA 1E9SA 4JKIA 1ZNXA 1E99A 1WXQA 4NCNA 3TQFA 3WP0A 2BKEA 2NG1A 1XXHE 5G3ZA 2P2LA 3HR7A 1ZIPA 1XD2B 1NLZA 1TMKA 2ZYUX 2J0UA 1L7VC 5DI3A 2YVUA 3IILA 1WP9A 3B78A 3LVRE 4XOIA 3K9NA 4WZBE 1G21E 2WBLC 1D9ZA 3QXXA 3M4YA 4RCYA 2GAAA 3ZZTA 2B7BA 2O8EA 1JNYA 1YZKA 3EA5A 4X8HA 2PT5A 1H8HA 5HTKA 1II9A 4F91B 5IRCD 2V3CC 4IDHA 2QAJA 1XNJA 3K1JA 5TDHA 2RGAA 2JATA 2ORVA 4Q7LA 2PZGA 1E96A 2VF8A 5CK5A 3TKLA 3SFZA 2GZDA 5KTYA 3THYB 1W46A 2OE2A 2FGJA 1N6OA 1GP2A 2JGNA 3ASYA 4HSEA 4E09A 4EPXA 3B9QA 4NYJQ 5B57C 3J81k 4YDHB 3RNLA 2FPLA 3ADBA 3WXMA 1KAOA 3IUYA 5ANRB 1ELOA 2CL7X 5BN3A 2ZSAA 4Z1MD 4M0LA 3ASZA 4A2WA 2P5SA 2A2ZA 4PZLA 2GEVA 2JEOA 3QBTA 2YWHA 4DDUA 2IYXA 4S2EA 2PT7A 2HDNB 2J45A 1L4UA 3NBYC 1B23P 1KJYA 1HY3A 4DCTA 5TMPA 5TV2A 3KFXA 4TLEA 3LW8A 4HB3A 3CPHA 2FN4A 3DZ8A 2GJKA 1TTTA 2KWIA 1G8PA 3U2QA 3CH4B 3GQBA 1OIXA 2F1JA 2NO9A 2CK3A 4BFVA 1FOEB 1S0UA 3C41J 2HJVA 3G82C 4KBGA 3L0OA 2PCLA 2V55B 4ZPXA 3UATA 3EPKA 2V1XA 3CNNA 2ZR0A 3CRRA 2QENA 2GWHA 2GZAA 1KYIA 3G0HA 1AS0A 4NE2A 2F6RA 1JJVA 1F60A 1FQKA 2GJ8A 1VYVA 3I3SR 4ON9A 3ZS8A 5KYKA 4EPVA 4A0HA 1S1CA 2C9OA 2CLDX 2AN9A 4DEXA 3KKOA 1OPXA 3RS4A 5FBVB 4B6EA 2FDCA 4IHQA 1OYYA 3ZH9B 1U0HC 1ZJ6A 2V9PA 4PXAA 1U2RA 2AKYA 2BMEA 2JJ1D 1QHIA 4BRUA 1EWRA 721PA 4U7DA 3FYHA 5KNBA 1CR4A 4XD7D 4DWJA 3EA0A 1N6HA 2ZE7A 4M9SA 4WA7A 4LYAA 1UAAA 3D3QA 4MITA 1LF5A 4B33A 3IPXA 4FD2A 1CR1A 2CJWB 5HE8A 4HZUB 2RGNA 4KVGA 3WMFA 5JJKA 3P4YA 1DAMA 1ESNA 2RGXA 1Q21A 3A1WA 3HDTA 2WICA 4D2IA 5GVRA 4RKFA 2WJJA 5DYGA 1XZQA 4YXWA 4GI7A 2J59A 5C18A 4L15A 2P6UA 2CHGA 3PEWA 2HLDD 2YINC 4J0QA 5JRZA 4ZIRA 1KTVA 1G6OA 1NNEA 2EVWX 3CR7A 3QPWA 2BBWA 3OESA 4P4UA 4PPFA 1GNQA 4X8OA 4LHYA 2A5GA 3TR0A 4XTCS 4DLYA 4KODA 2VSXA 3W9YA 3ZVNA 1SVLA 1AJEA 5FOXA 4PC7A 3S1AB 1X6VA 2ZSDA 3GLGE 4IOJA 4TLCA 4TWZA 1OJLA 1GL6A 2Q3HA 3L8ZA 2O0HA 4RD1A 3T06B 2N46A 2WOJA 5C2JB 1Q1QA 5EP3A 4GZMA 1Z6XA 3T61A 5ELXA 1MO6A 3WBJA 2IC5A 3T12A 1E79A 1KJZA 2NZJA 2XNDD 5EUMA 4QBGB 1G5RA 3IIJA 3SEAA 1U90A 3F8TA 3RS3A 4NHOA 4OI0A 3RSLA 3I32A 4EQ6A 2HYIC 1NG1A 3OEHD 1JR3A 4HAZA 4V0ME 4C0QC 521PA 1XMSA 2PMDA 2VRWA 2WHXA 4TYWA 1ZC4A 1FFHA 4RD6A 4M1KA 4MYCA 3KQHA 1FMJA 2FV8A 3DEFA 2VL7A 3AKCA 2ZJBA 4DHEA 1RW4A 5HE9A 1FQJA 1SHKA 4BLQA 4R9UC 3WNCA 1OE0A 2WMNB 1EFUA 5FH9A 1RIFA 3NXSA 3L8YA 3PENA 1UPTA 3U3RA 1CLUA 1OH7A 4C0KA 1BH2A 3D7MA 4PSVA 4UKDA 1VYTA 2OUKA 2WWWA 3BXZA 3F3YA 4HLUA 4ERNA 3HYRA 3CWZA 2O8CA 1J2JA 2QAGC 4DDVA 3DOEA 3E1SA 5LD2C 3LBIA 5EE9A 2E9SA 1N2CE 3EX7C 4KXFB 3SJAA 4BRWA 1COWA 5IT5A 4KJZA 3UXMA 5E95A 2C77A 2EU8A 4OHYA 3GFTA 421PA 1P75A 1Z6TA 5AWFC 1R0ZA 3B5JA 3SJBA 2P65A 4CRWB 2IL1A 1US8A 3SOPA 4AG6A 4OI4A 5JWRA 3M1IA 1LNZA 3AVXA 3PUYA 5FFMA 4LBYA 2Q0HA 3NWJA 4M9XA 4ASUA 2DWQA 1M1YE 2WPDA 4Q9HA 2JLUA 3NHAA 3AF1A 4PO9A 2QQ0A 4RZ3A 3BERA 1B0UA 3N2EA 1GG2A 1QHHB 4PQRA 1NP6A 1WDTA 1E2MA 1LFDB 1JAHA 1OXSC 3GEIA 4RCZA 3U4QA 4D0NA 3C7KA 2YNMA 4IDQA 2C96A 1E2FA 1E2PA 1K6MA 4ZCMA 3V4RA 3OF5A 3QXSA 2QSYA 5J4YA 4B2LA 5AJXA 2FA9A 1SXJB 3BS4A 2WJGA 3FE2A 4QXAA 2QM7A 5L3QB 1RRCA 1CJUC 5JEDA 2IWRA 1W36B 3GJ4A 4OHWA 1N0UA 4MUAA 4KSBA 2OFWA 3TLXA 1G6HA 5B64A 2O8BA 4IXNA 4RY2A 3VR3A 3KKNA 1ZVQA 2XOKD 3EWSA 1A2KC 1SULA 1W4BA 4G0NA 5FPYA 1JEDA 5KNDA 2QUZA 1OW3B 1OV4A 3EIQA 2FSHA 3QG5A 1Q12A 1ZCBA 2RGBA 4MGYR 1VG1A 4Q01A 4A6PA 4A2QA 1HQYE 1SVOA 1NJGA 2ZTSA 3OEEA 4NPHA 4DVGA 2LCFA 2GCPA 2GF0A 1R2QA 1LW7A 1Z0KA 4TMVA 5FI0B 2BOVA 2ODWA 3C16C 2HF9A 4NL4H 1W36D 3UK6A 4XVQA 1GITA 1RVDA 2IXGA 1G8GA 3FTQA 4GP7A 5J4LA 3CNLA 4CW7A 3CO5A 1D2NA 3E2IA 4P32A 5SZKB 1WMSA 3NHBA 3BH0A 3CNOA 3GCGA 4GFDA 2ATXA 1KNXA 1MABA 4TMZA 3EC2A 2RGGA 1S3SA 3Q7QA 2I1QA 2NZ8A 4L8GA 1XFAA 3GLFE 3AVVA 1GKYA 2ANCA 4LJ7A 1QHGA 3PITA 2QQEA 3GEHA 4URVR 1DADA 3TW8B 3DMDA 4GMDA 4M21A 2RGCA 1ZM7A 5LPNA 1R6BX 3TMKA 1KI1A 2IK8A 5F9FA 4B44A 2FX3A 1KDTA 4DDTA 4JVSB 2J7PD 1XEFA 2OILA 2Q3MA 5D3MA 3A4LA 3ADKA 1EK0A 5CIQA 1P9RA 4URUR 1G9XA 2OEPA 3VFDA 4PC1A 4EPWA 3THXB 2OCAA 1Z06A 2ZI6A 3L82B 3TVTA 2P3SA 3B1ZA 2PZEA 4C30A 3DVLA 3Q8XB 2SHKA 3DM9B 4PAMA 1CIPA 1E2KA 1KAGA 1I4LD 1VDZA 2GBLA 3HPQA 4Q1BA 1C4OA 1KIMA 4QNMA 4R71A 1DE0A 4I81A 3VKWA 3DZDA 4BZPA 3QF4A 1CJTC 3FB4A 1KDRA 1NVWQ 2JIZA 3EZ9A 5EJEA 3K9GA 1KNQA 2GESA 3OZXA 1W5SA 2ZPTX 3X1YA 4GSYA 3P1JA 1Y3AA 3NBXX 4UXHA 4K46A 1D6JA 1W2HA 3UIEA 4EPTA 1NKSA 4TTRA 2D4HA 5A5GA 1Z08A 4PC2A 4MKIA 2ZU6A 3O8DA 2MMCA 1ZUNB 1Z5ZA 1KO5A 2QTHA 3GFPA 1JPNA 1XTJA 5CIWA 2HUPA 1FX0A 3WY9A 1TQ2A 3B9PA 3T1QA 4GBMA 2QAGA 1XD8A 1L4YA 1CTQA 4N1AA 2WWGA 1TUIA 4UJ5A 3W6PA 1JJ7A 2QT0A 5JI3E 3EPHA 2IXFA 1H8EA 4M8NE 1XF9A 2F1HA 3SBDA 2QE7A 3BAFA 1DOAA 1V43A 4ZDKA 3LH5A 3CR8A 2OCYC 2IT1A 1KI6A 3A1VA 2GHIA 2WKPA 4BEJA 1P9WA 1PZNA 3I73A 4F4CA 4FWIB 3VKGA 3LWNA 3SJCA 4BFUA 1NN0A 2F1RA 3B85A 1E2QA 1SVMA 2O8FB 2Z6VA 4DXAA 4ZDWA 1YZLA 1S3GA 4R98A 5DISB 3B13B 2QU8A 2C98A 1J90A 4JKYA 5BWMA 3K0SA 2VBCA 3UANA 2WSSA 4HAUA 4ABYA 2IA5A 3FHCB 4CEJA 3D6TB 2BM1A 3MJRA 4XIGS 2A5YB 2G88A 1J8MF 4L9WA 1DARA 1YQTA 2FU5C 4C4PA 1WBBA 2LKCA 3B6EA 2XEXA 3DO6A 2QP4A 1T9HA 4M22A 4WZ6A 5UKDA 2W6JD 2IS6A 2NPIA 4DB4A 2F9MA 5EZ5A 1EX7A 3CRVA 2OM2A 3E5HA 821PA 4KVAA 5JJIA 3TIFA 3LNCA 3P4XA 3ADDA 1BO6A 2VHTA 1G18A 5KHOC 4Q9LA 3RRMA 1GZSA 4BFZA 1N6KA 1Z83A 4LRWA 4DB2A 3DMNA 1JI0A 2XZLA 6Q21A 4Z1MA 5HCIA 1NSTA 3B1WA 2BCGY 3AGPA 1E9EA 3NBFA 2YWEA 1SXJE 3HJNA 5KPDA 4K8OA 1F48A 2X2FA 3GLHA 5BW8A 4JT2A 5AR1A 5B30A 3MGCA 1N5IA 1CJKC 1NN3A 4UNNA 2ZRHA 2REBA 3HU3A 1Q1ZA 4ARZB 1TNDA 4I1VA 3THYA 3P26A 1RRFA 2VEDA 4B3DA 4E5UA 4URYR 1VHTA 1IN7A 2MSCB 1KI4A 3WYGA 1E9AA 5CLQA 2WSMA 4NYMQ 2A30A 4PANA 4HB2A 2C95A 3R9IA 1XMIA 2W0SA 5FPKA 1CJMA 1G20E 1EX6A 1VG8A 4XTRA 2FJUA 2FOLA 1TU3A 3A4NA 3U5ZB 5JI2E 1FZQA 3VR5A 3ZD6A 1N6PA 4HUQA 3W5JA 5L8VA 4IOMA 4KCGA 3A58B 1SZPA 4Q4LA 1GNRA 3SJZA 2GNOA 2J1LA 1G7CA 2A5FA 3WNBA 2JJ1A 3QG1A 1Z3IX 1ZAKA 5E4FA 4XD7A 3CF2A 3KKPA 4LV8B 4OQFA 3ZZ0A 4LHXA 2HXSA 4DEYA 4HI0E 4V0NA 3SFVA 4V0OA 3UMRA 2O8DB 5DHFA 2PEYA 2D62A 4L9SA 3QY0A 5F9HA 2CNWD 1R7RA 2ZR9A 1Z0AA 5JBQA 4LYHA 1TQDA 5H70A 3U6KA 2BV3A 2NO7A 5KOYA 1EGAA 4URWR 5TY0A 3X1ZA 1FW6A 1GOTA 2CVFA 4QHYA 5FPSA 5FUWA 1RJ9B 3QKRB 1BS1A 3QJYA 4G5OA 1GRRA 2NTYC 2GVZC 3SQWA 2HLDA 3CRQA 4TQAA 1XTIA 3ZVLA 2YJTD 2CL6X 2PJZA 2OAQ1 1Z8FA 3K0AB 4I99A 4PSKA 2NMVA 2GXAA 1LB1B 4UNQA 4EFMA 2BBSA 3OAAD 2CCKA 2J0QA 4AWXA 4OHZA 2ATVA 2VHCA 4HZUA 2ODNA 4A0RA 1ZBDA 5BXQC 1QDEA 2QNRA 3H1TA 3IDQA 4PAQA 4A2PA 4FCTA 4Q19A 3K0EA 4LJAA 4D4JA 1F6BA 1U98A 2IYQA 5TARA 4LCBA 3CZQA 3UWOA 4Z8XA 1E69A 2QP9X 3CRW1 2GA8A 2QPOA 4M1SA 2XNDA 4Q4AB 4QHTA 2ZJ5A 3VR1A 1N25A 2W2VA 4QHSA 3LX5A 2V7QD 1IHUA 4Q21A 1G41A 1V5WA 1TADA 2UKDA 3FVQA 1Z0JA 1S9HA 3KZ1E 3OEHA 3TAHA 3ZIAD 3GLGB 4JYBA 2GCOB 2QMUA 1R4AA 1BKDR 5J40A 4BLPA 2FPMA 4KU4A 4MYUA 4QBHA 2CCGA 3S1AA 1PUJA 4ZCLA 3LV8A 3DPUA 2GAOA 3C14C 2UVQA 3WP1B 1LTQA 2IHBA 4FMDF 4FMCB 4JLVA 3KXLA 4DIEA 1QHXA 1JQJC 4LBVA 5FBRB 4OQLA 2Z4SA 1W2GA 2ZUBA 5BN4A 2HXYA 3UMSA 5HKKD 4RFSB 4HYYA 5TVKA 2CXXA 4G5RA 1PLJA 4PQFA 1TEXA 4TMXA 3KJIA 1EFRD 4F4JA 1U9IA 2YZ2A 1WA5A 1GL7A 2YYZA 1BYUA 1II0A 2HCBA 5FTNA 3TUIC 4XWOA 3A1UA 2W83A 2BBOA 5C1BA 1ZM3A 2REOA 3FPAA 2EFCB 2GXSA 4CYMA 2BIFA 3R9XA 3E70C 2HV8A 4M9QA 1OB5A 2AWNA 4C0JA 4HAVA 4AD8A 2RB4A 1Q3HA 1ESMA 1P7CA 1T3LA 3OFND 3Q7PA 2HYDA 4M1YA 5F3WB 1XMJA 2QBYB 1QBKC 1W4RA 1DAKA 2FNAA 3QNUA 5JRJA 5B58C 5L3SB 4DUGD 3B2EA 4C0HA 3JVUA 2J46A 1DEKA 3KFVA 1NLFA 1UFQA 2OAP1 1OXTA 4JVLA 3ICEA 4QRHA 1YVDA 2XXAB 3NEJA 3BFVA 3EZ6A 2WKQA 4LJ5A 4XH9B 1T5IA 1SGWA 2IWHA 2J5XA 1E2DA 3DKPA 5DIFA 4ACBA 4HLUC 1SVIA 1VPLA 3CBQA 2ZE8A 1QRAA 3KKMA 3DOFA 1A4RA 1DAFA 4WZAE 1XEXB 2R62A 2YHSA 5KO2A 3TNFA 1E1RD 3RAPR 3X2SA 4IFEA 2B6HA 5G41A 4Q47A 3PR1A 2N1BA 3TRFA 4F92B 3FHOA 4DC9A 3LRPA 4LYFA 3SHFA 2XOKA 5LB2A 1SKQA 3OE7D 4DKXA 4DCSA 4ZKDA 2ZAMA 3TSOA 3GP8A 1FP7A 5FUXA 5DSZA 1RYFA 4OL0A 2RCNA 2DR3A 3H4MA 1IN5A 5EE1A 4CEIB 2F43B 5DI9A 3V4FA 4G5GA 3RLFA 2XITA 2WWYA 2IF0A 2X1VA 3C15C 4JLPA 3AVOA 2ZQ5A 3BB3A 1DAIA 2PL3A 1QHYA 4JL5A 4IDPA 2R44A 5K8UA 2XNSA 3A6PC 2IYYA 4BLTA 5HZKA 5IHPA 1T4GA 1Z6AA 3NC1C 3SC3A 3MJHA 2R65A 3IPYA 2WM9B 4PR0A 3R8FA 1F2TB 1S2MA 1ZUIA 4CEHA 2C9YA 1SVWA 4LSGA 2Q9AA 3TH5A 3I4LA 4MH0R 4EJSC 2V4ZA 3CF0A 1VMAA 4DLUA 4TMKA 5CYPA 2BHRA 1G1MA 5J47A 1WF3A 4BLRA 1QVAA 1ZINA 4MKFA 3GFOA 3TR5A 1M6NA 1MR3F 2YV5A 3MD0A 3NBZC 3AUYA 4RZXA 2JLVA 4M9ZA 4OQXA 1PV4A 3GD7A 4QJ3A 5EP4A 5DNYB 2IW3A 1P2SA 1WB9A 4BZQA 4Q7KA 4IVPA 4DLXA 1RFLA 2BKUA 2QMHA 3EPLA 2HEIA 2J7PA 3K0CA 5FUYA 4ESHA 5L3VA 2QTVB 3GLFB 2WWIA 2IUSA 221PA 1OXXK 1ZP6A 4MDEA 5C4GB 4P31A 2IYVA 1GDDA 5FTKA 5KUTA 1XB2A 1KI7A 5EP1A 3U7FB 1MV5A 3VU9B 2ZVPX 4KI0A 1JR6A 1XU4A 3OIYA 4XVRA 5A0FA 1TF7A 1CR2A 2CLSA 2H17A 2WOOA 1EXMA 1KK3A 4RZUA 3RWMB 3QEJA 4TSFA 3JZAA 3ICQB 4LWZA 4JT4A 1BYIA 1D5CA 3B60A 1E2JA 1M8PA 1TF5A 3VAAA 4MQBA 1G8HA 2Q3FA 5AUOB 4AYWA 1KZ7B 1W44A 4DJTA 3PV0A 5KSOA 1GVNB 1ZIOA 4HZIA 3K9HA 2WAYA 4JLOA 1GIAA 1LS6A 2FMXA 2B92A 3F5FA 1T91A 5K8IA 3BJIC 3VHLB 3LY5A 1YRAA 4A8JB 1WBDA 2Q6TA 5FBLB 4C7OB 3I92A 1U8AA 1E4VA 3LXXA 4XSHA 4HAYA 4WXPA 4B74A 1Q3TA 1HTWA 2OCPA 2J41A 2ZSEA 1XRJA 4TYQA 1KK2A 4DCVA 2PLFA 2QPAA 4QJ5A 2X2EA 1QHSA 1F2UB 3AF3A 2PH1A 5FOVA 1CJVC 3DKVA 2ZSBA 4EDHA 1ZD9A 3ZLJA 2OG2A 1BIFA 4BLSA 2GBLC 4PQYA 2JDID 1N0WA 3Q9LA 1NVVQ 2UZIR 2V8OA 5JFGA 2BWJA 4AY2A 5AUQA 2G3YA 1OIWA 2Z5FA 5JJLA 3RRYA 1CEEA 2FPKA 1IM2A 4V02A 3BORA 2MMGA 2V1UA 621PA 3K53A 4MGIR 5C46F 1RYHA 4LJ4A 2ZIAA 3PUZA 3RVBA 1G4AE 3RSOA 4M1OA 1ZMXA 3GLIB 3PJRA 4GP6A 1OHHD 1NBMD 1P2VA 3C5HA 2Y8EA 4B3XA 3TAUA 1OKKD 5CJ2A 4OHXA 3SDZA 1OSNA 2D06A 4P33A 4XJXA 1Z6YA 1R8QA 2IS4A 1TU4A 1G3QA 4GMXA 4B34A 3IKJA 2J7KA 3QKSB 4BZXA 1JEEA 1Z0IA 5LB4A 3A4MA 3MCAA 1HT1E 5BN5A 4Q4HB 3H0KA 5H8WA 5DN6D 3OIUA 1GSIA 4NH0A 2PJRA 1OH8A 2W6JA 5J4HA 1NVUQ 2F3TA 4G5QA 3VNVA 3AVPA 1KKLA 1YE8A 2Z43A 4CT5A 4FN5A 3ZQ6A 1KJWA 3L0PA 4GPTA 2BBTA 2Q9BA 4IVQA 3Q5DA 4YMSA 3SZRA 3THOA 4I4LA 1MRSA 2BMDA 1KMHB 5JLJA 4ZO4A 2DPXA 4JJKA 3EXAA 2GTPA 2ANBA 3I5YA 3BRWD 1X8KA 1NG9A 3SI7A 3BC1A 1T3HA 1JXMA 3Q3JB 3X1DA 5AUNB 5KSYA 1P73A 3SN6A 2ZRAA 1XXHA 4NBSA 2TMKA 3SYNA 3QE0A 2G6BA 4JLMA 3F0TA 5AK0A 4PHHA 2D7DA 2EFGA 4QG7A 4TMTA 1UBGA 1K5GA 2ZRDA 2DFTA 1AKEA 4JMPA 3UKDA 1P60A 3WBKA 1AM4D 2QL6A 3EW9A 3ZJYA 5KSPA 4DCNA 2ZYVX 3W34A 2XB2A 1LVGA 2CE7A 2F55A 4JBWA 1NIPA 1MRNA 1E98A 2GEDA 3KB1A 2RGDA 2C5LA 3IEUA 4L16A 3I5XA 4EJSA 1FMLA 4JVNA 3LW7A 5CK4A 3FMFA 4O25A 5F2EA 4BFWA 2C8VA 1VG9B 2YC2C 2Z0MA 3QBVA 2FFBA 4ZDIA 3UG6A 4F93B 4QBIA 3PUXA 5DGXA 2J87A 1U81A 2EFEB 3UPUA 1I2MA 4ARZA 4B76A 1CRQA 4Z54A 4M1TA 2P6RA 4JSTA 1WCV1 4TT3D 2CNWA 4Q7JB 4Y0AA 3TK1A 2OXCA 2P5TB 1G3RA 1W47A 1NJFA 1DELA 1R5NA 2XAUA 2D7CA 3BK7A 1W48A 3VTKA 2G0TA 2AFHE 1SXJD 4CDGA 1E9BA 2EQBA 3NC0C 1EESA 1ZM4A 3MWJA 3QF7A 4ZDJA 4TTPA 2XJ9A 1IXRC 4WAUA 4C0LA 3I72A 3THWB 2HJGA 3JVVA 3AVTA 4QM6A 2XTNA 1EWQA 3FMIA 4CGZA 4ZV4A 2I3BA 3ZGXA 4LK2A 1NIJA 4UNPA 1GKUB 2VF7A 2ZYTX 3AVWA 2CLCX 4DBLC 4TLAA 1P72A 1G5PA 4IEEA 4Q18A 3OAAA 3VX4A 1XCMA 2XGJA 2JLSA 2JLZA 2D2FA 2FEMA 2JJ2D 2ZR7A 2ZRFA 2DYKA 3LA6A 3CX6A 1OIVA 1P61B 2DBYA 2O5VA 3AVUA 1U99A 5JHGB 3QKRA 3AQ4A 4B75A 4BEBA 1I4DD 4AKHA 1O87A 3W3ZB 2V7QA 3I1FA 3EG5A 3ZIAA 4B2PA 4E07A 2XZOA 2IUUA 4QC2A 3K0FB 2E1RA 5H1YA 4HLDA 1C1YA 4IVRA 3CIOA 3K0AA 5HZHA 4BPBA 5J5CA 1OXUA 2J9RA 2YC4C 1F5NA 3B82A 2H16A 1ZNYA 1KKMA 3TJZA 4NU0A 1XDBA 1MT0A 1NBME 2EFDB 5HKKA 5HPYB 4RJLA 3QUSA 3L43A 1XTSA 1DPFA 4L5BA 3U3KA 3MWYW 2B21A 2FE4A 4Q4AA 1EFRA 1AS3A 3MWKA 2GCNA 3U6BA 1MO4A 4YMWA 3U7GA 1DVRA 2JAQA 3GLGA 2GCOA 1HA3A 4IKEA 2KSQA 1U8YA 1G8YA 4E22A 1X1SA 2WVJA 1M7HA 3LVQE 4DLZA 3NTUA 5J4KA 2ODBA 1Z63A 1UKVY 2F3RA 4IXMA 1Q20A 1IOZA 2V6JA 1XEWY 1JBKA 4JJZA 3GLIE 4EQ6B 3KQNA 4B3FX 4A0FA 1E0KA 4WOPA 3AF4A 4RFSA 1OF1A 2R6CA 4DUGA 1OB2A 2Q9CA 3A8TA 2CL0X 4V0MA 3LX8A 5EQTA 3OIVA 4P0TA 4RD3A 2HCJB 2C03A 2DHRA 2FWRA 4OJKA 4TN1A 2QRZA 3AB3A 4LV6A 4PFSA 5K8TA 5EXXA 4LZZA 3LBHA 3C8UA 3LDAA 3LLMA 1DAEA 3RHFA 2R2AA 1K8RA 2RHDA 2CMKA 4Q48A 1P3JA 1U9IC 1CF4A 1R10A 2VA8A 4Q4JB 4PX9A 2LKDA 1E1RA 3H2YA 5FTJA 3FOZA 3TSZA 3ADCA 2H5EA 1VIAA 2KBEA 1M7GA 3PEVA 3VR6A 2QBYA 2IEYA 3EASA 5FOSA 5DH9A 1JR3D 5L3SA 3TVDA 1D2EA 2FF7A 2KI5A 4NYJR 4P4TA 4TLBA 1TQ6A 4YMVA 3W6NA 3OE7A 4B2IA 1TPZA 3MMPA 3SYLA 4BFTA 1XJ0A 4MDFA 1SKYB 2ZETA 2WV9A 4W5WA 3SE0A 1G4UR 2ZRCA 1VIYA 3KTAB 3VKHA 4NP6A 1XD2A 5FL7D 3QSYA 2A78A 1Q1BA 3CH5A 3U7HB 3ZD7A 1US8B 1UBEA 4JYCA 1N0VC 2IEZA 2JLYA 1HEIA 2DFLA 4TYPA 2ZRIA 2WJHA 2ZS9A 2PZFA 4L4UA 3EIHA 3ND8A 4KLNA 2VH5R 2IS2A 1ODFA 1DBSA 3CF6R 3KDSE 2PEZA 4WVFA 2W00A 1U0JA 4WW0A 1ONBA 1G17A 3GJ8A 4R2IA 1D8TA 3QXJA 2GJSA 1ZW6A 2PBRA 4O0MA 3RS7A 2WWHA 1TAGA 2VIIA 2FFAA 5AUPB 2IUTA 2BMFA 3FWYA 3RC8A 2IBMA 5L3RA 4HDQB 1GRNA 2QSZA 1IN8A 4ACAA 1QVRA 3R9WA 3RS5A 1CRPA 3T1TA 4KAXA 1PLKA 3EWAA 4US1R 1Q57A 1XTRA 2F7SA 5JSZB 1ZC3A 2RKOA 1ZU4A 4DSNA 3B8HA 2O8BB 4MGKR 4OHVA 1XPUA 1TF2A 3MLEA 1IY2A 4D26A 1ZU5A 1W0KD 2BC9A 4A6XA 4EFLA 4JVMA 2VHUA 1WE2A 2Z4RA 3W5IA 4D4KA 4JZKA 2E87A 2W6ID 4I1SA 4LC0A 1NKTA 4YONB 4DSTA 3PEUA 4PPQA 1SXJC 4N0DA 3IHWA 1N5KA 2JLXA 1CKEA 2ERXA 1T0JB 3X1XA 1XEWX 1HV8A 2ZROA 3SBEA 1W36C 3HYTA 4RD4A 3B7GA 4PPGA 2Z83A 2CVHA 3ZVMA 2JLQA 4JSYA 3WRYC 4A4DA 3RANA 5JMTA 1YR8A 2IYRA 3T35A 1BMFD 3SR0A 3N70A 2H8KA 4KV9A 2EWWA 1G3IA 4Y0VA 1L2TA 4OI2A 3AP2A 2A3RA 3QKUA 2W2TA 1II8B 1RRGA 3NKVA 5EXTA 1F3OA 2H18A 1MABB 2XTZA 3EIEA 5G3YA 4DLWA 4LHZA 2AWOA 4JLAA 3WHKA 4QM7A 4H1VA 2VSFA 2ZSFA 1QG4A 1W0JD 3GLFA 5P21A 2ERYA 1AKYA 3FDIA 3BH7A 1YZQA 4JBXA 1XPRA 4FMDB 4C0BA 3T15A 2FSIA 1X86B 2XTMA 4OK3A 2VP4A 3K0CC 3IIMA 3NDPA 1DG3A 4US2R 3VU9A 1GWNA 5EE0A 5DYIA 5JCZA 1YR7A 1N6IA 3NH9A 3QPVA 2CJWA 5CYOA 4QGGA 3OHMA 4EUNA 4B35A 3PVSA 1HURA 3U61B 2WIAA 5D3MB 1PVOA 3RDPA 3DHWC 1IONA 1HUQA 3TE6A 2WTUA 1GM5A 4A36A 2YWFA 2JDIA 1Z28A 2ZANA 1E0SA 2WJYA 5GADl 3BBPA 5G53C 5E7MA 4EIWA 4P3YA 4M1WA 1XBTA 3LQRA 4UQOA 1GRQA 1ANKA 2OV2A 1JECA 3AVQA 2KJQA 4K81B 5DO9A 2MSEB 2O52A 3I8XA 1XWIA 2QTFA 2REXB 4OKSA 3LAWA 4A8JA 4OQMA 5IDVA 2L0XA 4G01B 1NY6A 1MKYA 1QZXA 4IOKA 3M6AA 5IK2D 3IO3A 1HH4A 3HU2A 3X1WA 1AS2A 1OHHA 1NBMA 3RS2A 1ZM2A 2J3EA 1N6LA 1A82A 4IW3B 1T6NA 1E1QD 1F2UA 1UEIA 4QFMA 1OKKA 3Q5EA 4O2LA 4BECA 5JS7A 2ZRPA 4QNRA 2LWIA 1WQ1R 4BQSA 4UNSA 3T5GA 1YZUA 2ZJOA 4BFXA 1E6CA 3FFBA 2ZXUA 2P67A 3EPJA 3SYKA 4X8LA 1JR3E 2BJWA 2W0MA 4XWAA 1GUAA 2X19A 5LD2B 2YOGA 2BMJA 2IS1A 2YOHA 3VNUA 2JIZD 4JLJA 4Q00A 4NYIQ 4GL2A 4MRVA 1A2BA 4W7SA 3GLIA 1U8ZA 2ZRBA 1OH6A 4ESVA 4XWKA 5JZVA 2FSGA 1CXZA 4X8MA 5D3QA 2K5UA 4DLTA 3U7EB 1KO7A 1NMXA 1KI6B 1E9DA 4QBFA 2CEAA 4V0LA 4HUTA 2WJVA 3I62A 4D82A 1HE1C 4YQFA 1MH1A 2IHYA 2ZJZA 2WIBA 5AJWA 4TYYA 4AKIA 1EFCA 3CX8A 2IYZA 1KI2A 1S4QA 2ZRGA 2KE5A 1ZD1A 1JQLB 4C2TA 3B1VA 1XJQA 2R9VA 2ZE5A 1KSJA 2XJ4A 4QGHA 2OHFA 3V00A 4KITB 4H1UA 2CHVA 1R5BA 3PG5A 3VX3A 3NG1A 1GILA 1SKYE 3MUFA 3R7WB 3W8NA 4RKEA 4MRNA 5KDLA 4P4SB 3ZS9A 4W5JA 1KMHA 2R6GA 4JL8A 4MYTA 5KPJA 3K70B 4POAA 4G3XA 4C9BA 2BEJA 3P27A 4C3ZA 2VP6A 1C9KA 1AQYA 1D9XA 1UJ2A 1Z07A 4OK6A 2AXNA 4A1FA 1KDOA 2PX0A 4IDNA 3CONA 3QXHA 5FOUA 2C9CA 4PAOA 3LXRA 1QHHA 3FHTA 1RRPA 1YHNA 3NVAA 2WWXA 3T34A 5J4VA 1OT3A 2ZYWX 2YOFA 4LJ6A 4RFVA 1M2OB 4NCHA 5EE5B 4GOKA 4TT3A 4B3CA 4PO8A 5E7JA 3QIAA 2WSSD 1T8UA 4JLKA 2C78A 1KI9A 1Q0UA 4HB4A 2ASEA 2IF2A 1LV7A 3U44B 4FCWA 3AM1A 1SXJA 2VYFA 3GLHB 4PHGA 4D4LA 2F1IA 3EAQA 5L3QA 4FINA 1NMYA 3CW2A 3JZMA 4DSOA 3K70D 3OIWA 2OFXA 2NO6A 5CLLA 2ZUDA 4Q1AA 4UXIA 1EFTA 5SZJA 4B48A 2V6IA 1DO0A 3CB4A 5FBQB 5B2ZA 1KK1A 4JS0A 1A1VA 1YZNA 4GDFA 5FI1B 2AL7A 2VPPA 1RZ3A 1E9CA 4B47A 2WMOB 8OHMA 3EZFA 4LC1A 4KO8A 1ZRHA 2ZI3A 4U02A 3W8RA 5AJVB 4I1OA 1IXZA 1AK2A 4B43A 2ZUCA 1J8YF 3A37A 1UDWA 5GJCA 2JJ2A 4HUQB 4FWTA 1XP8A 3BGWA 4II7A 4US0R 1IY0A 4D6PA 2IYTA 2QA5A 1VHLA 4OQNA 3R8CA 3ETLA 1FNNA 5AJYA 4HB0A 3AP3A 3LO5A 4U5XA 1CBUA 1JXOA 3VR2A 2ZRLA 4JBYA 2DY1A 4MRPA 5EXSA 3THWA 4DLVA 4RZ2A 3KB2A 2VQSA 3AGQA 3RRNA 5KDDA 5FR1A 1KO8A 2ONKA 1W4CA 1H65A 2WKRA 5JWOA 4MRRA 3RRZA 1FTNA 4DZZA 2B8TA 4Q9IA 3PCRB 2XSZD 3REFA 4URXR 5GVSA 1NMZA 2IYSA 3G5UA 1CS4C 2VP0A 1KSFX 3NH6A 1HE8B 2B7CA 2QZ4A 4YMUA 2FZ4A 2W58A 1E0JA 2N42A 2DWOA 3NIBA 4RVCA 1W5TA 5FR2A 4D80A 3KXIA 2ZITA 1Z47A 4F38A 1AQUA 2D3WA 2ZEJA 3TUJC 2BDTA 2DFNA 4IEIA 2W2XA 4KHZA 4NZYA 4TLDA 3LQQA 2CCJA 1GAJA 3TQCA 1VCIA 3THXA 2FG5A 2AFIE 1GFIA 4GT1A 2AR7A 5EXPA 3O8RA 3K0FA 2BM0A 4KLZA 1YRBA 1E2EA 3AEZA 4KYUA 3UMFA 1Q1EA 4URZR 1YJ5A 4D0LB 1N3BA 1IY1A 1QF9A 2FH5B 3SNHA 1ZNZA 5EE3A 4Q7MB 4HLCA 1AIPA 4LHWA 4NCKA 4Q9KA 3T1OA 1S96A 1KI8A 1MOZA 1UBFA 2A7QA 4ZCIA 2JLRA 5TB5A 5JEEA 4BASA 2YKGA 4AKEA 3W6OA 3ZZUA 1VCNA 4Z51A 4TQUS 1NLYA 2VLIA 3CLVA 2O0JA 4KBFA 3GPLA 4PTLA 4YLGA 4D25A 2WJIA 2FFHA 4QL3A 1FTSA 2GF9A 3QXCA 4BGDA 3BB1A 3N2IA 3PFIA 2G0NA 3T5DA 4TZ6A 3K09C 2RHMA 3TGPA 4Q9JA 1RC8A 4FIDA 3AH8A 1CP2A 4PC3A 1SHZA 1IJEA 2OZEA 4LX0A 4B73A 1N6RA 1OLOA 3KXKA 4HEJA 2NQ2C 5HCNA 2ZVQX 4CIDA 2ZM5A 3SQXA 4LJ9A 5FBWB 2XX3A 5BQ5A 4UNRA 1J7KA 3HWSA 2DFKB 4NCIA 5CITA 5M04A 2NO0A 1E2IA 3B1YA 3CX7A 3PQCA 4AI6A 3AP1A 2YWGA 2OCBA 2HT6A 3L0SA 4ZI2A 4HAXA 3C5CA 3GEEA 3QKTA 2OBNA 4KYIB 5CB8A 1X8LA 4JLNA 1UEJA 4C2UA 2VHQA 4WBSA 2ZJ2A 2H7VA
chains in the Genus database with same CATH superfamily
4RGBA 3GJ7A 4MIYA 1ML3A 4NFSA 2BMWA 2XHEA 3FSEA 5FL7A 3FKSD 3OCVA 4JZYA 3WRWA 2ZTHA 3ND9A 1FC0A 3MFYA 2O8FA 1ZLYA 4KO1S 1TFUA 4IO0A 4OBEA 5L45A 3H6HA 3ETCA 4CGYA 1KMNA 5JZMA 3A36A 2OYSA 3R7BA 4F7WA 1XQWA 4OH1A 4RVGA 3FZYA 2MCFA 3G9XA 1A7JA 1DAHA 5GJWC 1ST3A 3CLUD 4MLCA 5B7NA 2DQZA 3LHFA 1BN6A 3UAXA 3AI1A 1OFTA 5IWCA 1JHUA 2OLKA 4KR0A 2W9XA 1PJRA 2ZIVB 2WK1A 5T7BA 3A3KA 3KZCA 4WXMA 5DWVA 2W42A 1NY5A 3DVAB 4IJQA 1LKZA 4L76A 4WZAA 2CBZA 4RHEA 3TIIA 2HSGA 3K1AA 1VOTA 4ANFA 4H0NA 2UVDA 2QLFA 4GX2A 2O8EB 1P2TA 4PLVA 1FFBA 4IIEA 1RYEA 3M6LA 1TW2A 4PZYA 5BQOA 3VZBA 4GOLD 5IYZF 4J90A 4RVFA 4BATA 1I4TD 4IILA 1Z7YA 4PHFA 5F1PA 4AY4A 2I99A 2B98A 4E5VA 4F4FA 1AVTA 1WRBA 4GOJA 1SUPA 1KEUA 1G3MA 2VK1A 5JD5A 1XTQA 1YAJA 1QZZA 2JKZA 1AQLA 1YL5A 3B1XA 3NVMB 3VYVA 4Y2JA 3HSSA 1X80B 3N0WA 2HO4A 3ZH2A 2A0FA 1IUPA 4FN4A 2DWPA 2YWDA 4KRFA 1SBZA 2XECA 3EUEA 1G8FA 2OGZA 3G0OA 2CY0A 5H80A 3TQRA 3K70C 3KUDA 3AK4A 2PSFA 2XEDA 1P6XA 5IXYA 1P0MA 2GJ9A 4TXJA 2OLEA 3U17A 4EPTA 1UBKS 2VR1A 5B5SA 2OQ2A 4LY9A 3SVZA 3L06A 1XZJA 3ZEIA 4EPRA 3F74A 4EKDA 1LK7A 2JFXA 5EZYF 1O4WA 5BWOA 5FO0A 4CKZA 1D07A 5JSZA 3GGDA 1RI3A 5KKCA 3GXBA 2HT1A 2GFIA 5EIEA 3T54A 5ICGA 2MSDB 1MC4A 4ZQEA 5TMBA 5MDHA 3LHSA 3L4EA 1KI3A 1LGYA 1ZXXA 2V54A 2HK6A 3N6RA 4PHTA 2QROA 4HLQB 1BHO1 4CQLA 4EUFA 3KPUA 3PCTA 4BY9E 5E1MA 2PGOA 3AJ9A 1S9DA 1SA0A 2H1LA 1MJHA 2VNSA 3BD9A 1VECA 1WD7A 1OTHA 3C98A 3LBFA 4R0MA 4B3GA 4LY0A 1Y4AE 5G02A 3BFXA 1CUAA 1UMKA 2PDAA 1BDJA 1G7RA 2IEGA 4U7TB 2ZSUA 1KOLA 1YQWA 4TXNA 4JJ6A 3UM9A 5I7SA 5K0JA 3ZHYA 4JUFA 3LY7A 4BJ3A 2RAPA 3ICCA 4PC6A 1Z29A 1JE1A 1HX7A 4Q3LA 1WJGA 4P4LA 4NMWA 2PGJA 3K8YA 3OOSA 1RRMA 4ZMSA 1LK5A 3CPJB 1Y1LA 2HMSA 3O8LA 3WLQA 1M74A 5HNKA 1DO2A 1J7JA 1T5LA 1OFUX 1XDZA 2OV1A 2PKXA 4WN9A 3NIGB 3DMRA 4JBNA 1FDTA 3UNXA 5B4TA 5KWIA 4MP3A 3LRTA 3ZGVA 2I78A 1E0DA 1EVQA 4LJ8A 4FOTA 4JJ4A 5JSKA 1DXYA 4W9MC 2BHNA 3ZWNA 4MQLA 1FYXA 1S6YA 1U04A 2DWUA 2EBFX 2PQ0A 4XB1A 4K0KB 3SHOA 1WD5A 4IIVA 4EHAA 3KEGA 5BW4A 4RTMA 1GSHA 1XTTA 1LLQA 3K72B 3ROQA 4P34A 1I6KA 3DLAA 4F5EA 1FSFA 2CDNA 1HYQA 3FFAA 1MPTA 3DDWA 1W1WA 1JQ3A 3BDVA 3NJRA 3NLLA 4L72A 4BVBA 5LP6C 1C7FA 1ORWA 1TK2A 2QTTA 4B31A 4CIVA 3PHBE 4IQ4A 3IUEA 3NAZA 1O6GA 2YY7A 3C70A 4B5KA 5IK2A 1YZTA 1DAGA 2H57A 3EH2A 1K8XB 4LJSA 3ZY3A 1JAZA 1KY4A 1SU8A 4MA0A 4N6NA 1PD1A 3GT3A 3HRKA 2BFDB 3OURA 1Z0FA 2CHUA 1Z12A 4Y2XA 1E1QA 4C1BA 5MN6A 1E1LA 1T5HX 1TAHA 1N7IA 2B1QA 2VP5A 5G0WA 2NSJA 3H19A 4GQBA 1THGA 5IJ9A 3KOXA 5EHZA 1Z2AA 1J8VA 3EYWA 5ELLA 4XVHA 1B6TA 4ZO6A 4ZOLA 2PX3A 3SSNA 4HVCA 3U26A 3HR8A 4K2AA 1U9ZA 5KJCA 2AEMA 4D9MA 5KX5F 2X6TA 3WIDA 4L73A 5LMNB 1FFSA 4ONEA 1SOMA 4TSFD 1IYZA 2P2GA 3ZX5A 4IOLA 1WUHS 4FJ1A 4OGLA 3UJHA 4BUZA 3QOFA 5DK4A 2WSBA 3RC3A 1LEHA 1J39A 2PCJA 3DF7A 3BIXA 4PWYA 1E58A 1MA3A 3I9MA 4MVWA 2DR2A 1OLUB 4RDIA 3DOCA 5BMVA 1G64A 1H2HA 2IIBA 3FMOB 4I4IA 4A8JC 3ZIDA 1DMRA 4QOJA 4KLRA 1XQ6A 2CGEA 4ISCA 3BZBA 4PZ9A 4CKCB 3M3PA 4I4NA 4B71A 4JJFA 4MA4A 4X65B 2RSLA 3O82A 2RHLA 4Y2PA 5CM8B 3SY8A 3TIVA 4Z4FA 5HKAA 3HYCA 1YB1A 4F21A 3LHKA 4ZQBA 2PMKA 2G9NA 1C1DB 2D0OB 3CO0S 1NBAA 2CWWA 2JAHA 4N18A 5REQB 1EA7A 1V4VA 1IN4A 4HX9A 4QFCA 2OGSA 3ZBPA 3HHEA 1Q50A 2PFGA 2ORIA 1S7GA 2FOIA 3N0TA 2GEUA 1PBNA 1KO1A 1RKBA 2H85A 2MIIA 4I9FA 4F5DA 1N75A 3QU5A 4A8TA 2D2EA 2GXQA 4IIXA 4EY5A 4JFRA 1SU4A 1XZFA 2ZRJA 3O47A 3EGDB 3C6XA 1CIJA 1UF9A 3L7NA 1E79D 4EB8A 2XB4A 1UMBB 4GDMA 4IINA 4GBJA 1CYDA 4EA8A 2X0FA 4YXFA 3TAXA 5HZMA 1NJ6A 2QPTA 3LPDA 4IH4A 1U0OC 2NXEA 1Y8AA 4MW0A 2COUA 1JALA 5CEFA 2IYLD 2F9LA 2PBLA 1S2DA 2UZ3A 2VI5A 2X0IA 2ZJ8A 3H8WA 1AXEA 5FLKA 1MQAA 4GSKA 1A8SA 1NSFA 3WLSA 2QGZA 1VP9A 3G2NA 5SZIA 4P3PA 2P2SA 3AINA 4UUBA 4EGQA 4BJ6A 2EFHB 3HHPA 3NHZA 1KFEB 1JX6A 2VQFB 2B20A 3K4QA 1FL9A 1JHQA 4CVNA 3QYPA 2QZJA 2X3FA 2C3MA 3LUDA 1AGRA 1XN1A 3LFUA 3MAAC 2JH3A 4JASB 1HLGA 3W8DA 4N48A 1L1EA 1SVUA 1UZLA 2YMPA 4UUQA 2QXUA 2O06A 2Q1UA 5BURA 1XXHB 4LJYA 5E1DA 1E2BA 2ZJ6A 4J4HA 1J99A 4OXRA 4E15A 4TZ0A 4KO4S 3QU9A 3AF0A 1URPA 1KEEB 3HB0A 1U0TA 2HNAA 3REGA 4RQBA 4F6CA 1Y8CA 5FRDA 4D1YA 1G21B 1JPJA 1U94A 2QQ5A 4MRAA 5A9TA 1JEYB 3HJFA 4TQ9A 2EWVA 3K15A 3N59A 3WX0A 3OZEA 2PU7A 1P6UA 4HDOB 1IB6A 1YE5A 1F1BA 4MB0A 4NCJA 4AO7A 2OT3B 2VTKA 3CLHA 3O0TA 2F43A 4GVXA 1V7QA 2EL7A 3GJXC 1L3BA 4OJMX 4EAAA 3EZ2A 5LYJA 4LECA 3VPCA 4AUNA 4EFKA 4EHKA 2SNIE 2Q4BA 1QLHA 1SCBA 3EARA 1AA6A 3C3JA 1IN6A 2BTOA 4IFBA 2GCGA 3KKLA 5HOQA 4ASUD 2WPDD 4K9PA 4OK5A 3SHQA 4KUEA 1DCTA 3PVZA 1PJBA 3IHKA 3FCEA 2FI1A 3O90A 3ITEA 2GARA 2J0SA 5K6AA 4RH0A 2BJHA 3N2GB 4KR7A 2O0KA 2WDZA 4ZYYA 3NBQA 4Q1FA 5K0LA 4V2IA 2PSDA 1C14A 2VH2A 3AR4A 1I2AA 1I33A 1UR5A 1UWLA 1VGVA 1NHWA 2PQMA 2XNHA 3Q41A 4A15A 5LVAA 4IJMA 4F3TA 5E2BA 3IXMA 2ATCA 1PJSA 5DU2A 1A9RA 2X5XA 2JA1A 3W7BA 1XU7A 5WRFA 3UG7A 2EKBA 2P2DA 1ZYUA 4L5CA 3W5BA 3VVLA 1H1TA 5EZ6B 3W06A 5ECYA 2X8AA 2AN1A 4JODA 4H9GA 4DMHA 1QH9A 2OBMA 3E7PA 3DKKA 3Q15C 4WBXC 3G0DA 3ECCA 1XVUA 2NYVA 2D5IA 2QHXA 1O8BA 3RVJA 4FYMA 3FI9A 3RT1A 4PYJA 4Z4QA 1J0AA 1TK9A 1S01A 4FX2A 2I9PA 3H4IA 1MF7A 2AK2A 1VG0B 2GRUA 2X5KO 4ZC1A 3N8IA 4CF7A 2RDMA 2WWFA 3KLBA 4ECEA 2J9FA 2QVBA 2K7FA 1CEYA 3E5NA 5HR5A 1NZFA 5BVHA 2XZPA 4M4SA 3TRIA 1JI3A 3V7YA 5CDFA 3M89A 4K6FA 4PNZA 1KZGB 2QRGA 2PJDA 3NM4A 1ZKMA 3NIFB 5GM2A 2AEEA 3FOEC 2IX3A 3IBYA 4LUCA 4WDRA 1P81A 1L4GA 1MJNA 1XTKA 2FKAA 4LYDA 4MOWA 4PSUA 5D85A 4FTWA 1E3WB 3AFNA 4D92A 3IL2A 1V1MA 1D1QA 2VCEA 2XD4A 4KN9S 2HD4A 4H4CA 1FNMA 2FSFA 1PL7A 4HPJB 3OZBA 3R7NA 3P2MA 3CYFA 5F3RA 3JD0A 5B55A 3BB4A 4A7PA 4E5KA 4E4TA 1U0LA 2AJTA 2FFQA 3DMGA 2JCSA 3DNMA 1JB1A 3M6FA 4LGMA 2NZYA 5IASA 3MRSA 2I29A 3WVNA 1PLLA 3FSGA 4RPGA 1L4HA 5AJZA 3AEQB 4IJUA 2W98A 1FP6A 4JB0A 4K0RA 2PFSA 3VR4A 4JWKA 3VNRA 1HYEA 1OX5A 1ZJWA 3VDMA 4GWGA 4QPCA 1I2CA 4XM2A 3JYQA 2XF8A 1RU3A 1VJ0A 4DE5A 4GR4A 1JHXA 2HRRA 4CCSA 1KJ9A 1N5JA 1T26A 4KQWA 4OQQA 1GZUA 3O1IC 2QRNA 2PLAA 3T9AA 1E92A 2IHTA 2R4UA 4RDHA 3RYHA 3SXUB 3T5AA 1P62B 5IH3A 3DDCA 1G19A 2ORWA 1U1GA 2VH1A 3TQIA 1IBCA 5L7YA 5FTLA 3JWHA 2OSBA 1BOFA 4TL6A 5IDQA 5DN6A 2Z6QA 2X22A 4TMWA 1I6MA 2L82A 1UDXA 5TSDA 2C7RA 2NVBA 2YHUA 4HGPA 1U8FO 2XT6A 3M0EA 4YYZA 3TB6A 1E32A 2OBFA 3R40A 4CMIB 5KBYA 2JJ8A 3PFBA 1MIHA 1KH3A 2NO1A 2B4RO 4KK4A 2QX6A 3RLIA 1FFWA 2VP2A 5LBTA 3AUXA 1EHIA 3NT5A 2FR1A 5IJZA 1FFGA 1P4SA 5F4BA 2RARA 3D8BA 3P5BA 2GK6A 4EHBA 2IZZA 4BDSA 5C8YF 3OP1A 1XZCA 1Z22A 3BOSA 3LBYA 5CXSA 1HC7A 4JP1A 4ZOBA 1W581 1QBGA 3PE4A 5IVIA 4FGLA 3NHFA 3KQTA 4CM3A 4BO5A 3O8NA 1KSHA 1AA9A 3NGXA 3VHQA 1A9XB 4Q4HA 3GPIA 4A0SA 1OI2A 5LWHA 2ONZA 1IAVA 3H83A 4NKRA 4MVJF 1DC6A 4LXTA 4H4DA 1BXKA 1YOVB 2EKLA 3QVMA 1ZUHA 2I2AA 2XPCA 3H97A 4UDNA 4D0SA 2H9IA 2Z8XA 9ABPA 1KOFA 3AZQA 5G0SA 2PXXA 3DEJA 1J22A 4HEQA 4C6HA 3E3LA 4CEJB 2XKAA 3R20A 3F96A 3E9ZA 1EFHA 1R3UA 1QCCA 2UZ1B 4JB3A 4EAQA 1C9DB 3EXFB 1CQIB 2NYAA 5EKUA 3ZU2A 4DLAA 2Z6UA 4HWGA 2TECE 4HDSA 2O3TA 3ONWA 4XI9A 3WKAA 4F3CA 4LCEA 3ZE9A 4D0GA 5CDYA 3DCJA 1Z2EA 4FMCF 3LUHA 4I3FA 4WLUA 3U3MA 3T7IA 4DT1A 4K26A 1E9SA 8MHTA 1ZNXA 2WM3A 1E99A 4HFRA 3MJVA 3T3HA 4YN3A 3HUDA 3KELA 1C2YA 1UKAA 1XXHE 4FD3A 5G3ZA 2K2QB 4N4AA 4ZZ2A 5EWJA 3WZLA 4AZ0A 4ZT3A 1NLZA 2JLCA 1ZNQO 3AEUB 4HNQA 5M3BA 2JGDB 2AYXA 3C8DA 3IAS1 4II3A 3NUQA 3VYWA 3CH7A 5HXAA 2H4ZA 3D6VA 2NSYA 2YVUA 4EB6A 2CLMB 4X20A 4D6YA 2O4UX 3LVRE 1R16A 3MT7A 4XOIA 3T7SA 5BSVA 1G21E 3ZZTA 2UXCB 3O94A 4O4LA 4CMEC 1JNYA 2PT5A 4NOJA 4E2XA 1CE8B 1Y3HA 2VPQA 4QZVA 1CIVA 1CQPA 1ZMOA 4G07A 4EM6A 5JSHA 1NMSA 4WLVA 1JF8A 3UJBA 2RGAA 1Z8DA 1K08A 2XYPA 5LQSA 1VFPA 2PZGA 1SCAA 2VF8A 3ILXA 5H59A 4J2HA 2Y27A 1UODA 4YALA 3ELWA 4TYMA 2GZDA 4BIIA 3JRXA 3Q0TA 2CLHB 1PK8A 2PKYX 2OE2A 5DFAA 4GMFA 2FGJA 3OM8A 3FMVA 2Q2WA 3UFBA 2JGNA 2JHFA 2O2EA 3D1VA 4XLZA 5DN9A 3STHA 3TOSA 1MW8X 1IMJA 5LA6B 5A7HA 4M0EA 3Q7RA 4ZJUA 2VDUE 2H0RA 4H17A 5K6RA 5F23A 4N8SA 4YDHB 3JQAD 5AI9A 4R83A 1LSUA 1EP2B 2IZ6A 3Q4GA 1KAOA 5HGJA 1QG6A 3U7QA 3UUFA 4BLVA 5JAQA 4OHUA 2WTBA 2GTIA 2O20A 1ELOA 2CL7X 5CX1B 4MCIA 5BW5A 2ZSAA 3ASVA 4DUPA 4M0LA 4E88A 1M6HA 1NFFA 2HU8A 2P5SA 4J8PA 3LHDA 3QBTA 4JELA 2YWHA 4MI1A 1QU3A 1ZH6A 3IV6A 4DDUA 2WG1A 3NBYC 1B42A 3F5MA 4L85A 3D2AA 3PFWO 4EG6A 5TMPA 1WPGA 8ADHA 2YZKA 2A67A 2Q5IA 3KFXA 3BIJA 4HB3A 3SLGA 3TTVA 4PM4A 3TRHA 4FDLA 2FN4A 1K3FA 4W8OA 3UA4A 1R6AA 4F12A 1N3LA 4MV5A 1U28C 2HFJA 2Z57A 3JATA 2DFVA 3U49A 2NU6B 2F1JA 2NO9A 3OG9A 5COBA 4ZALA 4M60A 1H85A 3IT0A 4JDPA 1PJTA 5BV2P 2HJVA 1XRSB 3HSYA 1YFJA 3ONNA 4ZU1X 2UZAA 1NPDA 3OM0A 5HA5A 3UATA 5EJ6A 5JJCA 1U8UA 3CNNA 2ZR0A 3CRRA 3HKDA 3SD7A 1M9NA 1IZYA 3PRHA 1ODLA 4NE2A 2I5PO 3DLTA 3BWXA 5FPQA 4YAFA 2FW0A 1VYVA 3I3SR 4BX0A 3ZS8A 5J2TA 5LA6F 3KM0A 3EZYA 4DR6B 2H9YA 1YBFA 2IY8A 3NUZA 3N05A 1A8QA 4PAGA 3VJLA 4B6EA 3O1HB 3C24A 3EY4A 2HBQA 2IYNA 3TZEA 3PC2A 3R3VA 3LNTA 1J23A 1QHIA 3AHJA 3WKBA 4M38A 4FB5A 721PA 3MWGA 1IZ9A 1P9LA 2Q2QA 4NF2A 1PT6A 1XTZA 2FXIA 2ZE7A 3HP7A 4J4BA 4WA7A 3VRHA 2P5YA 1P18A 2ONYA 2NYUA 1QVZA 2OORA 4E0BA 2OCKA 1KS9A 1O58A 3IPXA 2B7LA 4FD2A 4QATA 1CR1A 4UEWA 3ISTA 4YBRA 3WR5A 5JAUA 2RGNA 1JFFB 1GPH1 3ML1A 5H0IA 3P4YA 2HIGA 2V4MA 4FNMA 3H99A 4L6CA 4WCVA 2Y1CA 2RGXA 4N12A 2M2IA 3CBGA 2QUKA 2X14A 4OHBA 4ZAFA 2CHFA 1TMYA 4AJEA 4D2IA 5GVRA 1ZLXA 4DMCA 5DYGA 1XZQA 4WRRA 3SJUA 2LNDA 4DUYB 4L15A 3PDIA 1ODIA 2B9VA 5JRZA 3OY7A 2WI8A 2OVFA 4TWBA 4Y7CA 1NNEA 2D7JA 2BBWA 2QN3A 3DE5X 3NCHA 4I36A 2LW7A 4P4UA 4WACA 5KMGA 3CMMA 5KKNB 4DLPA 2CZCA 3O2NA 4C3VA 4X0EA 4PIPA 3UGKA 2XCRB 4KFCA 4MVJE 3W9YA 3JQDA 1SVLA 3M3HA 2ZLBA 2G7ZA 3S1AB 1AJEA 2JGMA 4ZJZA 4NPAA 4UHCA 1J8QA 1JNXX 4IZ6A 5EJ5A 2LVBA 3HI6A 4MS1A 3CSUA 1GL6A 3KYDA 4F5YA 1XVAA 2Q3HA 2O2CA 4MR8B 3JQ9A 4RD1A 2YRWA 2WEKA 3L3BA 3G68A 5DPMA 5C2JB 2W6MA 3TTYA 5EP3A 4C3UA 4GZMA 3ICWA 1U8EA 3T61A 3ZHOA 4CKEB 3OIFA 3T12A 1NXSA 2DQKA 4QBGB 2YYAA 1L6RA 2J6CA 3IIJA 4WKBA 3PTZA 2J85A 3F8TA 4DM7A 1UC5B 4KWTA 4NHOA 5BT9A 1O0BA 1Y6JA 5MN4A 3C3AA 3HKCB 4KIUA 4UDYX 3P9SA 4V0ME 521PA 1IWBB 1YGPA 1POXA 2VRWA 4MKXA 4HT3B 2WHXA 1GZ3A 5EC8A 2J3HA 1HNNA 3FPLA 5E9QA 1XCLA 4M1KA 4MYCA 2FV8A 4C89A 1RWNA 1IE3A 1FQJA 1Y33E 1NP3A 3H8VA 4KV7A 4BLQA 4YV1A 3HFSA 4JT8A 3A05A 4TT8A 1KMCA 3MQFA 5FH9A 2PV7A 3NATA 3PENA 4H7DA 4LKRA 1UPTA 5ADVA 3U3RA 3PLAE 1CNMA 3WLAA 4C0KA 4MIOA 4RPIA 1HZZC 2TS1A 5B3JA 1IWOA 3PDWA 1VYTA 3BXZA 3F3YA 2V5UA 1DX6A 2ZUVA 3HYRA 2QAGC 2CFSA 1DKPA 4K40A 5KREA 5LD2C 4ZYUA 1IY9A 4UQLA 2I4NA 2O14A 1ZK4A 5AVSA 4FDAA 3CV3A 5HRAA 4QO8A 3INNA 2XY4A 3TINA 5FWNA 4BRWA 1COWA 5IT5A 2W2KB 1B6GA 2C1ZA 3URMA 1XOIA 3STUA 4HNTA 1E2UA 2YXNA 2MR6A 2RHBA 4NBRA 3JALA 2BR4A 2GZMA 4N8EA 2C3PA 2IU3A 1E1NA 2X15A 4ZAYA 2WHEA 1ORRA 4BKUA 2PL1A 5M34A 2F3UA 1W5BA 3HDYA 4FSHA 1L8AA 5AVRA 4AUEA 2GKOA 1IQUA 5LFAA 4NV0A 2CLFB 3NNSA 3RU2A 4GF5A 2NW6A 5BNFA 1KBZA 1RZUA 4OI4A 3G5AA 5A6VA 2RONA 1XLTC 4WLFA 4ALMA 3M1IA 2APJA 5JWRA 1RXWA 2CFCA 3OLQA 4OLJA 5FFMA 4LBYA 3AVXA 2Q0HA 1S7CA 3OMXA 4QAQA 3QE4A 4MEJA 1QFSA 2PMBA 4Y2RA 2HHHB 1Y6GA 4RZ3A 4XEHA 1EK2A 4YCLA 4KOEC 1WDTA 1E2MA 1NA5A 2Y4OA 2DRIA 3DAPA 3W78A 5TLSA 3F2IA 3H7IA 2BTEA 2I76A 1LSJA 2GNPA 4L0CA 1ECFA 4JDUA 3ZWXA 4HWSA 2R8EA 4IDQA 2Q4RA 1CQXA 4Y9TA 4C5BA 3EIUA 1HSOA 1E2PA 2NSLA 3I9KA 4KMMA 2C9DA 4BN0A 2HSWA 3EEIA 4LE0A 2XDYA 4E21A 4ZCMA 4ZIRA 1K8YB 3S28A 2X9NA 3S2YA 1K8QA 4UBJA 1XO1A 3IE1A 1SCUA 1OTXA 3QLUC 4J1TA 4KE8A 3G1UA 5EMNA 4B82A 1CJUC 4RLHA 5JEDA 1RRCA 4OHWA 1I01A 5T3YA 3WA7A 1TC2A 1Y9DA 2PX4A 4KSBA 5KC8A 1GDHA 4G09A 5B64A 2O8BA 1XALA 3DC2A 2WT8A 3HB7A 4DA7A 1I0IA 2RB5A 1WWKA 3CTPA 3UB4A 1ZVQA 2XOKD 2I6TA 1A2KC 3DEKA 3EWSA 4MB6A 3UT0A 1R5JA 2HR1A 1GU1A 3A1CA 1JU9A 4LHEA 3MWDA 3VGJA 1F7UA 3WGTA 4BZWA 3H1PA 4G0OA 4PYOA 1OV4A 4F8EA 3S1SA 4DBLE 2ATEA 1YE3A 2R85A 3JXEA 3O9VA 1DOZA 3W5VA 1ZCBA 3GLKA 4J16A 4IIJA 1WPRA 1O9BA 2HAEA 3A31A 4MGYR 1VG1A 4MJLA 3R8XA 4DA8A 3RROA 2CJPA 1A50B 4IIGA 4DCCA 1A97A 5DZSA 2ZTSA 3R3JA 4NPHA 1VIDA 2WF9A 3IP9A 4G23A 1I0LA 2BGRA 4OMDA 5TPZA 4DVGA 1WCYA 6NULA 2O8EA 3G8AA 2GF0A 1R2QA 1LW7A 1ZIYA 1ZK0A 3WLOA 4AX8A 1JLHA 2E2WA 4DY4A 3C16C 2J6HA 3ME5A 2FRXA 3QHQA 4IDDA 1GHTA 3UWPA 3UK6A 4XVQA 3R0IA 1GITA 1RVDA 5E9JA 3FTQA 2EZ4A 4ZCTA 5AICA 2O1SA 2WNSA 2O7SA 3UKOA 3ZX4A 5AW0A 4QEKA 5CT6A 4FGSA 1S2OA 3BH0A 3NHBA 4Q3AA 3CNOA 4OY3A 3GCGA 5FEUA 2WVGA 1EPUA 2XNJA 3SC2B 1K1EA 2OC4A 1QTIA 4EF6A 2W2NA 2PUAA 3DFKA 4D9EA 1NOJA 1XFAA 2CXSA 2WFAA 2JD2A 4C4RA 1AMNA 3GLFE 2FN7A 3AVVA 4BVKA 1DWPA 4M7RA 3KSAC 2OECA 1UWCA 1NPTO 5DLDA 2YN4A 1U0NA 4M21A 1DWUA 1N92A 5C7YA 3PEEA 5EESA 1H93A 5A0TA 1R6BX 5F51A 3DZJA 4XM0A 1KI1A 3V3KA 1Z9BA 3OCYA 1HTTA 4UHJA 2ZJ0A 5ALWA 4DDTA 3L7OA 1HFWA 3AW9A 3BWBA 4I55B 4OXXA 1GEEA 3TW6A 1XEFA 5D3MA 1U8TA 3I0ZA 5CIQA 1EK0A 1GARA 2Z2ZA 2ODAA 3TDNA 1JIKA 1G9XA 5KVQA 1JP7A 1J1IA 3VFDA 4DQVA 1X0XA 3SIWA 2OCAA 3THXB 2OB1A 5CG1A 5E1OA 3TVTA 1JZQA 2NNLD 1YB7A 3RFUA 3KVOA 1FSZA 3KZVA 2WHPA 4DOMA 3CH6A 1C4XA 2E4VA 3IOYA 3BJRA 3M1AA 2RHTA 5B3LA 3O9MA 2YUIA 3HN6A 1E2KA 4CM8B 5KTTA 2GBLA 4Q1BA 3H1GA 1LCIA 2XADA 5FD8A 1KIMA 2QN7A 3SXJA 2AOVA 3I39X 4EVSA 4CUKA 1RZRD 5I7RA 3CEPB 4AWAA 1YA4A 1CJTC 2D0DA 3H4TA 1NVWQ 2JIZA 3HYNA 4LYYA 3TLGA 4JI2B 3V1YA 5FYDA 1BHQ1 5KX5B 1BS9A 3U37A 5JMOA 4DANA 4BMNA 4GIBA 3QLTA 5K4GA 2GHRA 3M5CA 4OXNA 5HSGA 5BQ3A 3NBXX 4UXHA 2QYOA 1QIMA 4TTRA 4LSWA 4UW9A 5K8VA 1AB6A 3AFHA 1H6DA 3EF1A 3QE2A 5CVCA 1Z08A 3ORFA 3R5FA 1H4QA 4YUAA 2FFJA 3O8OA 2RC5A 3CHYA 5TF0A 1Z5ZA 2QL7A 3GJQA 2V3WA 3PJFA 4I55F 1GU7A 2Q41A 3PQ2A 5HDBB 3E0QA 3GFPA 3F78A 5JDCA 1A1SA 3PQ8A 1VPEA 1BJRE 3TKYA 2JVKA 2ILVA 4PFKA 4J43A 2ORED 1MD9A 3P2OA 2XTAA 3S44A 1XD8A 1Z7BA 1CTQA 3OEWA 4V3BA 4OFZA 2XOEA 1Z36A 2W4IA 3FPKA 5GIOE 1ONNA 3TTXA 4HDNA 1HT0A 3EG9B 4M76B 1HFKA 2F1HA 2ZYSA 5IDWA 5K01A 2PSJA 2C2XA 3B9BA 4HEA1 5IG2A 3ZI4A 1U7OA 2IZ5A 4XR9A 1ZN2A 4ZDKA 3LH5A 4O4JF 3EJ6A 4HFMA 4C4YA 1JE0A 5TGZA 1KI6A 4A10A 2ODPA 3QQPA 1R66A 2CB9A 4BEJA 4M0UA 5AK4A 1SUWA 5E2AA 4ND7A 4R0VA 4D9HA 2WNIA 4F4CA 3VKGA 3L40A 3PYXA 3SJCA 2BEUA 5ERXA 5DHRA 4O2BF 5FWAA 5BUQA 1PX2A 2G76A 2O8FB 3GGOA 1IDOA 2A5LA 4PLWA 4UOZA 1CDDA 3D4BA 4G63A 3AB7A 1NT4A 1FDVA 4URHA 3AM3A 3ENWA 2J67A 3COSA 1HEYA 2XMRA 3UANA 1P2GA 3D6TB 3GLVA 4PV7A 1E5VA 1DARA 1FSGA 2FU5C 5CYFA 4C4PA 2LKCA 4EGFA 1WBBA 2PRSA 3RVSA 3K71B 2KM1A 4BTVA 2Z08A 4HCJA 2Z2YA 1KL7A 2B1GA 3KYIB 1PDOA 2HRCA 2QP4A 1T9HA 3M70A 3MXTA 3K1AB 4R3NA 1H2ZA 2NPIA 4GMHA 2F9MA 3CEMA 4PZCA 3STTA 3WJ2A 2OM2A 3EF0A 2JFOA 4WWHA 3P94A 3PFCA 5A71A 3AOEC 1G18A 2CXNA 4Q9LA 1VQ1A 1E7YA 1GZSA 3RRMA 2G1PA 3CSSA 3VOSA 1N6KA 2OHIA 1A8PA 5ALNA 4TZTA 4Z0PA 6Q21A 4DMMA 3FETA 3PDHA 1SOAA 4UBLA 5KTRA 2GX6A 2XCQA 4Z1MA 4JI1B 2C83A 1PGNA 3M81A 3VNSA 1E9EA 2YWEA 3IUMA 1A2QA 2X2FA 1N8SA 2NAFA 1DXQA 1PTKA 4RMIA 3VUFA 4BHTA 2JCYA 3ZDRA 5A4KA 2CF6A 1TZKA 3C4QA 4DV5B 1B0PA 3MGCA 5ER6A 4UNNA 1ZVVA 1Q1ZA 3U4IA 1A8UA 4ZQFA 3ULKA 1PZEA 2FPGA 2MSWA 5GP1A 2BP7B 2ECOA 3BHMA 4FWBA 1W88B 2VDNB 1KI4A 3WYGA 4FHFA 2J32A 2O8CB 1E9AA 5KVVA 3PGVA 2A30A 1C81A 1JJIA 1KYVA 3G2OA 2C95A 4PICA 3L18A 3RT7A 2CDAA 2W0SA 1TM3E 4BKPA 4OIMA 4BRZA 1VG8A 1V7PC 4JA2A 1TU3A 4QBTA 4YT8A 3A4NA 3U5ZB 5JI2E 4PLCA 2JFYA 3B51X 4H35A 3ZD6A 1N6PA 1NBWB 1GQRA 2Y1XA 1WU8A 4IOMA 5ESWA 1PYGA 1MG0A 3A58B 1SZPA 4UU8A 5H3HA 3SJZA 1DMSA 3QVWA 2DQSA 2VAXA 2DR0A 4P4NA 2A5FA 3A9VA 4UTXA 4PG8A 1SD5A 4UM9D 3WNBA 2ALJA 1LK0A 1H0HA 1ZAKA 1JKFA 1SUAA 1VBMA 3EGCA 3CF2A 3F6PA 1NNLA 4LV8B 3ZZ0A 4LHXA 4PPYA 4NR0A 1JLRA 1NNSA 1TVCA 2CLKB 3N6XA 4UBOA 2DERA 2X5JO 3LJKA 2VDLB 2CNWD 5IULC 1FBNA 2ZCVA 4LDPA 5JBQA 1IN1A 1M2EA 5ARCA 1XKQA 4LYHA 2B4QA 4K9SA 1NTRA 4HWOA 5FXMA 3E3NA 3CVJA 4M8IA 4RO0A 4FB4A 5ES4B 2P1ZA 4WN9B 5F76A 1QFYA 4TKMA 4URWR 5TY0A 3X1ZA 5KOYA 1FW6A 2IODA 4D4IA 2CVFA 1OBCA 2EKQA 4H1HA 2A0WA 1K63A 3PD1A 1Q2UA 4HNRA 4J7AA 3BA6A 4QHYA 2YICA 3QJYA 3GOQA 1M0TA 4G5OA 4L9RA 3VDXA 4HY3A 4J1NA 3SQWA 1T2FA 3VO1A 1BVRA 4AW9A 4DC0A 4B3FX 1ZRMA 1DZIA 4EP1A 3UENA 4CIWA 1DRVA 3WMRA 3AR9A 3NP7A 1UEXC 2PJZA 3KPJA 3WWCA 4LVOA 3A2LA 3K0AB 1Z8FA 4I99A 1GYRA 2VJDA 4PSKA 5ALUA 2C8KA 2AG0A 2NXNA 5DW0A 3MOSA 4HADA 4J0GA 2GXAA 4UNQA 3EVTA 3T7EA 1P4RA 2QYSA 1CY4A 4GRIA 4QOHA 2CCKA 3CY6A 4WDQA 2G5PA 2W2MA 4HKTA 4RFLA 3A3NA 3L0YA 4HZUA 4Q39A 2JFGA 2XRFA 5BXQC 5KYYA 3IDQA 1T15A 5F7JA 4A2PA 3I9V6 3WV4A 2PZMA 3A1NA 2OVBA 3K0EA 4D4JA 1JSRA 4XFJA 3UWOA 4DG5A 1N1EA 1ENPA 2OCXA 4V1CI 2XNDA 4Q4AB 3R9KA 1HR0B 1QYXA 1IVYA 4CM5A 3L7IA 5CVVA 4PZAA 4Y9RA 1TADA 4IGAA 2CXUA 1S9HA 3GLGB 2Q62A 3DZCA 1UBHS 5KOHA 2QVYX 4INAA 5D5HA 3DAFA 5JY1A 1Y6FA 4E7OA 3IIEA 4L5JA 1ENYA 1BRTA 2FPMA 5I8WA 1XMOB 1W34A 2XNCA 4QBHA 1HXHA 3F3KA 4ZCLA 1WB5A 4AMGA 4PTYA 1GADO 1WXHA 2UVQA 3GFFA 5AHXA 4RTPA 4QYIA 3AW8A 7REQA 2FUEA 2G9VA 5DM60 5BP7A 2QZ9A 4UEKA 2BSQA 3OPYI 3H04A 3U39A 1GGKA 1Z5WA 3UMSA 3B36A 4RFSB 3SOZA 4RTLA 1FDUA 1Y7PA 4A0QA 1TEXA 4TMXA 1A4UA 5ITVA 4DV7B 3I2IA 4GYJA 1PL0A 2JI9A 4B6JA 2AN4A 3H9JA 2HA2A 3QGMA 1JIVA 2GYWA 1R6UA 4DIBA 3FKJA 3GUYA 3ZYZA 2AN3A 2VHYA 4QA9A 2XDAA 3SZGA 5GIPE 3OOYA 5LN1A 4ZOLF 2JGFA 3O2JA 4CU2A 2VJYA 1ZM3A 2BYTA 2BFOA 5C3MA 2HBRA 5EZSA 2PWPA 2QGFA 3THRA 5KB3A 4AD8A 5K7SA 2AJCA 1Q3HA 2RB4A 1P7CA 2PUHA 1FLVA 3EWNA 2HYDA 2XQFA 3MYRA 4GS5A 4M1YA 5HG0A 1ID1A 3BPSA 5F3WB 1TAUA 1QBKC 3OZRA 1W4RA 3QX8A 3ESCA 4XCQA 3EPRA 2LGJA 2FNAA 4QUBA 5L3SB 5E3IA 4DUGD 4OMUA 1WZUA 3JVUA 4IUYA 6AT1A 3D3KA 2XKBA 3ICEA 4QRHA 4N6GA 1YVDA 4QJBA 3NBUA 1VB3A 2RI0A 2WKQA 3EZ6A 4LJ5A 2IWHA 1QCYA 1NVEA 8ABPA 1SVIA 4FYXA 1K89A 3CBQA 3QE3A 1QRAA 4M1QA 4PZUA 3KKMA 1TCBA 1LNQA 4WZAE 5J1TB 5KYUA 2AI1A 2R62A 2QR5A 2Y67A 3LT0A 1ZWLA 2C3UA 3KB6A 3KJQA 1EAYA 2V6GA 3N8GA 4FGJA 3BGIA 3I9JA 4ND5A 3TL2A 4IQGA 5CB4A 4JFAA 1XZLA 4EYOA 5LZ2A 2RFLA 2R8PA 3HJGA 4LDRA 1YJBA 5JE8A 1QP0A 3LECA 1W5AA 1T6ZA 2CUKA 3IUQA 3PR1A 4OB7A 1QZ3A 2J5QA 4Q47A 5IARA 2A14A 3DV0A 3RH0A 3LRPA 1IK6A 1OWOA 3HS3A 3VZRA 3UK7A 3WWDA 5FO1A 2Z98A 1RVV1 1NQVA 5LU8A 1SKQA 3MS2A 1Z4MA 5DM0A 3DKIA 5ECGC 1ZH4A 4ZKDA 5LMCA 4G0XA 1UT6A 3TSOA 4D57A 1W4LA