2IYVA

Shikimate kinase from mycobacterium tuberculosis in complex with adp, open lid (conf. b)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
179
structure length
179
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPSPSEAATLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords SHIKIMATE KINASE
total genus 66
structure length 179
sequence length 179
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iyvA00
1W0KD 2C77A 4YXWD 4R9UC 3B2EA 1XTSA 4B33A 4E07A 4Q7MB 2DFLA 5C1BA 1ZD1A 2YWHA 3P4YA 1TU3A 1MOZA 4LHXA 5CJ2A 2FE4A 1NVVQ 3T34A 4RD6A 1QBKC 3DKVA 2QT0A 4HAWA 2YKGA 3N5CA 4EIWA 4TL7A 2ASEA 3NXSA 2GBLC 3MWKA 1CP2A 1NJFA 1TAGA 2QAGB 3PIRA 2A5GA 2IYLD 1II0A 5JSZB 3EG5A 4P33A 1J99A 1BYIA 1NKTA 2QGZA 4JLMA 3GFOA 1G6OA 2XSZA 3KKNA 3OEEA 5LDDC 4EAQA 3OE7A 2QZ4A 5CITA 2WHXA 4IDOA 2QQEA 2BBWA 1JPJA 4OHZA 4LY6A 1GL9B 1OH8A 5AJZA 1N6LA 1YHNA 1DPFA 2CJWA 2AFIE 4BWYA 4II7A 4LHYA 4IEIA 4LV5B 2OCPA 3HYRA 5HCIA 4C0SA 1WB9A 4ITRC 3VFDA 4ZIRB 1XU4A 2G1KA 4OK6A 3BAFA 2ZI7A 1CU1A 3CX6A 4G5QA 4Z54A 2I1QA 1QHNA 5KDOA 4Q9JA 1JAIA 5B64A 3T1OA 1XMJA 1N6IA 3LDAA 1GITA 3FHCB 4DDUA 3KX2A 4UNSA 4Q4JA 3VKHA 2WVJA 4OHYA 1Z22A 2RMKA 3SHWA 3LW8A 4Z1MA 4M22A 1H8HA 2CEAA 2YJTD 5EUQB 2P3SA 1QHYA 1N0WA 1RJ9B 1ZCAA 5FBVB 1ONBA 3E5HA 3X1YA 5AJVB 3CF0A 3E1SA 1OXXK 4MDEA 4OL0A 2YZ2A 5G3ZA 2J0SA 1HT2E 1CBUA 3FE2A 1TUIA 3ONWA 3VU9B 4PC3A 2GCPA 4B75A 1AS2A 2SHKA 4QJ5A 2R62A 2ZI9A 4HUQA 3W5JA 4NYMR 1GM5A 2O8FA 4HUQB 4C30A 5AJYA 4DKXA 3BH7A 4BFVA 1G7TA 1HH4A 1ELOA 3PUXA 2KBFA 3AF1A 4HB3A 4DLUA 3BFXA 2ORVA 3DZDA 4MA4A 1OB5A 2ZU6A 2NQ2C 3WNDA 3ZZTA 3LO5A 4AKIA 3I8XA 2HF9A 4V0MA 1XD2A 3MMPA 4Q1FA 1AZSC 3FMFA 1RJ9A 1N6RA 3IILA 4PFSA 4TQ9A 5JRZA 1CRQA 3SFZA 3WXMA 4Q02A 1G41A 1DAMA 3QXHA 3A37A 4D4LA 4GZLA 1JQLB 4AY2A 1KY3A 3R9IA 1X8KA 4D25A 1UKEA 1Z2CA 2GK7A 4B47A 4RD3A 3GLHE 2OZEA 4MYHA 4PQRA 4DLZA 3HDTA 4BFWA 1E2PA 2RGAA 2BOVA 2OT3B 2QTFA 4GBMA 4GI7A 4Q4HA 3U7EB 3X1DA 3LA6A 3NVAA 3ZGXA 4KAXA 5HZHA 3U3KA 5E4FA 2F1IA 3W3ZB 1F2UA 1T5IA 3AUXA 2FV8A 4XJXA 3KQUA 2XOKA 4HB0A 3NEJA 1OHHD 1W4RA 2ZYUX 2FJUA 4NCKA 4NHOA 3TR5A 3AF4A 4FN5A 4A4DA 3AKEA 2CJWB 2B92A 4U5XA 1N6HA 4XVRA 1Z2AA 4HDQB 3KB2A 1YE8A 1YZTA 2YOGA 1P5ZB 2ZRIA 3VMFA 2CNWA 3ZVNA 2AHOA 4LC1A 1MO3A 4QRHA 4A6PA 4CW7A 3SE0A 4DCNA 1CR2A 2GA8A 3NBXX 2O8EB 3BORA 2FZ4A 3FKQA 3G5UA 5TY0A 1T91A 4DVGA 3ZD7A 4E5UA 4LJ4A 4B76A 3CF2A 3RAPR 2YHSA 2D3WA 4C0HA 4A6XA 3U3JA 3OFNA 1QDEA 3D3QA 2OFOA 5BN3A 5LBIA 3T5GA 5EXTA 5A0FA 1QHHB 5EJEA 1TF2A 1G16A 2O8BB 3IO3A 3RNLA 1KMHB 3TH5A 5FTMA 1S9HA 3T1VA 3RHFA 1SVWA 1OT3A 2VIIA 4B2IA 4US2R 5J4LA 3V9PA 2ZJZA 1VKJA 5KTYA 2IYYA 1SVKA 3L2OB 4IVRA 5CM9C 2EYUA 4ESHA 2H7VA 2C95A 2DBYA 1PJRA 2DWPA 3LRPA 3P32A 2F9MA 2AXNA 2WOOA 4BLQA 4CEJB 1IBRA 3BIFA 2P6NA 5EZ6B 3LQQA 5DI3A 4BRWA 1EWQA 2VF8A 4ZI2A 5K8TA 4DCTA 2EFGA 2BJWA 2ZRDA 3RLFA 1C9KA 3U3OA 1OIWA 4HB4A 1TEVA 4FW9A 3AM1A 4PQFA 3NBFA 1SXJC 3BBPA 2ZJAA 3MWYW 2WSMA 3KJEA 4IDQA 4UJ5A 2QM7A 3M4YA 1UKZA 2KB0A 1KDPA 2P2LA 2WKRA 4UKDA 3DM9B 5DIFA 2PT5A 2A3RA 4NZYA 3UG7A 1Z6GA 2GXAA 3FMIA 3K70B 4C0JA 4XTCS 4D0NA 5C46F 2MSCB 1CXZA 1IN4A 1KAGA 4PHGA 2GKSA 4X8HA 4AK9A 2CMKA 2V3CC 1WXQA 1MKYA 1YZNA 1KYIA 2F43B 1Z83A 4EDHA 2OHFA 1RFLA 2WMOB 2ZR0A 3BD9A 4FCTA 4I1OA 2VQSA 3LD9A 3EA0A 5C2JB 4MGYR 1GVNB 4V0KA 4L8GA 4MUBA 1ZW6A 3SBEA 3TQCA 4URVR 1ZM3A 3MG9A 3CNOA 2O8BA 2VHQA 2ZTSA 1OH7A 3IHLA 4GT1A 3MLEA 4LYJA 2ZUCA 2P6RA 2GNOA 1NSTA 5JRJA 2VBCA 1KSHA 3G82C 3LAWA 4HAZA 5JHHB 2Z5FA 4HI0E 4MGIR 4OI2A 5B30A 2IYWA 1PUIA 4RZ2A 2W0MA 3BC1A 4LZZA 5FTJA 2V1UA 2ATXA 5F9HA 2Q3MA 4HDCA 1TQ4A 2KI5A 1WCV1 2C78A 1Q12A 4G3XA 2IK8A 3HU1A 4HZUB 4URZR 1UADA 5KOYA 2JLXA 1H8EA 1F5NA 4NE2A 3FMPB 1RE0A 1NY6A 1XTRA 4JYCA 5GADl 1NKSA 4JLKA 3ZVMA 4O0MA 3UWOA 4ACBA 2BBSA 4NDZA 5BW8A 2E1RA 2WWFA 2ZSBA 4Q21A 3LV8A 4BRUA 5JECA 1LY1A 2J5XA 4RD1A 4L15A 2YVUA 4QNMA 1NN0A 2IEYA 2BEKA 4G1UC 1E2DA 2IYVA 1EFRA 4Q1DA 4LJ5A 3RRYA 4LBWA 2Q9CA 3JZAA 1MO4A 4LPSA 1ZIPA 5AJWA 3RABA 4BFSA 3C5HA 4MRVA 3AVVA 1YZKA 4I1SA 4ZKEA 3VKWA 2CK3A 4E22A 3R7WA 2C04A 4G0NA 1G8FA 3CX8A 1FQKA 2O52A 1M8PA 2FFQA 2IXFA 4BECA 1KI4A 4MITA 4C0AC 4L5BA 2Z43A 2GZDA 1Z47A 2IWHA 1KHTA 1CEEA 1Y63A 3NDBB 3IHWA 5BQ5A 2ZVPX 1AQUA 1AGRA 1FZQA 4W5HA 2W0SA 1W46A 2QGNA 3H4MA 1QF9A 1KJWA 1S2MA 1KI8A 2VF7A 5J4YA 3REFA 3CB4A 4G5GA 5KDDA 1S4QA 1E94E 1T9HA 2GILA 1ZINA 4TMXA 4V02A 4DJTA 3SN6A 4Z8XA 2O0JA 3VX3A 1A4RA 4ZDWA 1T3HA 2OXCA 3Q7PA 2IHYA 4LX0A 1ZRHA 1E99A 8OHMA 2GJ9A 1OPXA 3AGQA 5E7IA 3AF0A 3MCAA 1FW6A 3K8YA 1L4UA 1NG1A 2OUKA 3NH6A 2B7CA 2ATVA 2QSYA 4OQFA 4RZ3A 1ZVQA 1HUQA 4OI1A 1Z5ZA 2N1BA 1AKEA 2GXQA 2J0VA 2ZR7A 2P5SA 1KK2A 1P6XA 2PL3A 4PAOA 2ERXA 1B0UA 1GZSA 3ZD6A 2J0QA 3LFUA 3RRNA 1P4SA 1NRJB 4U00A 4OK3A 1F60A 5G40A 4A2QA 3BWDD 2OFWA 1CS4C 2EFDB 3U6BA 1IXZA 3U7FB 2ODBA 2H1LA 4JBWA 4XVQA 1XNJA 2W6ID 4QGHA 3W6PA 2QL6A 4LJ7A 5JMTA 1GNRA 4OQLA 2V6IA 4C2TA 1FQJA 1N5IA 3TSOA 2GZHA 3OAAD 4L9SA 2FDCA 2EW1A 4Q9KA 1ETUA 1FOEB 5IF9A 4QBFA 5CDFE 1KKMA 3ADBA 1E2JA 2E87A 2ZRPA 3BFVA 1E2HA 2R44A 1G1MA 2H92A 2H18A 1XMIA 4ZIRA 1P72A 1DVRA 4BLOA 1QHGA 4RCZA 3PUYA 3RRMA 5HKKA 2H57A 2ODEA 2RGBA 3GP8A 1W4BA 3NG1A 2WZQA 1OFIA 4QM7A 4Q1AA 3A1TA 3L8ZA 2NPIA 5JFGA 1P62B 2WSSA 2JLRA 4GRAA 4M9QA 4Y0AA 2IT1A 1FP6A 3GJXC 1DBSA 5DI3B 5E3HA 2PMDA 4GPTA 5IK2D 1D9XA 1TEXA 4W5WA 3TRFA 1L8QA 2ZRJA 4LGMA 3Q7QA 3ZYCA 2GCNA 3CW2A 4GZMA 4Q9LA 3ZIAD 1KI1A 2X19A 3B1VA 2ZS7A 4M1YA 1S9DA 4B2PA 4BFYA 5AJXA 2CXXA 1HYQA 1AKYA 2DPXA 3TQFA 5AUPB 3U60B 4JMPA 4LWZA 2ZJBA 1E1RD 1SVIA 4DLRA 1KMQA 1K8RA 1KMHA 3PUWA 4N0EA 4BGDA 1G8YA 4D26A 3EPJA 4C0KA 1Q44A 1VCIA 1R8QA 2JDIA 3SOPA 1G7RA 4WA7A 1BO6A 1SVSA 1T3LA 1YKSA 2VYFA 3TVDA 1H8HD 2CBZA 3GEEA 5FTNA 1XJQA 2BEJA 2RGDA 1NF3A 3KQHA 4OJKA 2WJYA 3AKYA 3U61B 4MUAA 4HZUA 2W2VA 3IQWA 4BLRA 4P0TA 1KO1A 1FNMA 2EQBA 5TMPA 2ZRNA 1KI9A 2J0UA 1NL3A 3WNBA 2H17A 1JR3E 4G5SA 2DFKB 2PEYA 1GWNA 3ZS8A 3V00A 1U0JA 2AX4A 3LWNA 2YWGA 2RGXA 1UF9A 3HJNA 3LX5A 3MJHA 5FUWA 4BFUA 4JVLA 2UZIR 3H86A 4IKEA 2V1XA 4UQOA 5FL3A 4BE7B 1NG9A 5ANRB 1I4DD 1XZPA 1SXJD 3N2EA 3EAQA 1TQ6A 1KSFX 2EFEB 3LVRE 2F7SA 4LJ8A 2RH5A 3HPQA 1NN3A 3B85A 1DE0A 2AN9A 4URUR 1XWIA 3LH5A 5KPJA 3Q8XB 1XDBA 1ZM9A 1E6CA 2EWWA 5TARA 1I2MA 1XTKA 2VSFA 4AYTA 4QJ3A 3F3YA 3RVBA 3TBKA 4D2IA 3NHBA 3WY9A 4TYWA 3TJZA 3B1ZA 1Q1QA 1U8ZA 2YOHA 4URWR 3QG5A 4QHYA 2YOFA 5CLQA 1UKVY 4QC2A 1W7AA 2VSOA 4PX9A 2RCNA 2NZJA 1ZNXA 1D9ZA 2V7QA 2J7PD 1DOAA 4FI3C 4A2PA 4HUTA 1Z6YA 1X8LA 4CVNA 3QJYA 1U8AA 1XTQA 3QPVA 4YDSA 3SI7A 2GBLA 1KSGA 3JVVA 3AP1A 2K5UA 2WAYA 4JLAA 4IXNA 3T12A 1U94A 3A58B 3V4RA 3CO5A 3T1TA 4FMCB 1GTVA 1EFHA 1BMFA 1EXMA 2PBRA 5DE3A 1E2EA 1R0XA 5SZHB 2C9CA 5K8IA 1X1SA 4TL9A 4R7ZA 2VEDA 2BKEA 2J59A 4H1VA 5CM8B 3KXKA 4TLAA 1PLJA 2OCAA 5A5GA 2GXSA 2XXAB 4DCVA 1EWRA 4TTPA 4TYPA 2R6AA 4D0GA 3UXMA 1Q1BA 4PAMA 4EPYA 2J9RA 3TLXA 2JJ2D 3PVSA 5B58C 5DN6A 4M9ZA 5DH9A 3K9HA 4KI0A 4A9AA 1JEEA 4N1AA 4WZ6A 2ECKA 2FSHA 2VHJA 4Q4AB 3QKSA 2AK3A 1Y3AA 5D3QA 4A8JA 2GJKA 4E09A 4W5JA 1OH5A 3CRMA 4AKEA 3UATA 4LRWA 4BZPA 1HTWA 2ODNA 2QSZA 3BJIC 3TSWA 3A1VA 3AUYA 1X1RA 2C96A 2IYQA 2CVFA 2D62A 2OCBA 1KI3A 5EP1A 1CLUA 4W9MC 3K53A 2OBLA 1P9WA 2GVZC 5AUQA 3PITA 2JLQA 2YWEA 4JLVA 5JWRA 3H2YA 1A2KC 5HPYB 3GEIA 3R8FA 1OLOA 3K0EA 5TB5A 3U7GA 1W36B 2IA5A 3QE0A 3A6PC 1M1YE 3N2IA 4AI6A 5KDLA 3SJCA 4DIEA 4F4JA 1CRPA 3T5DA 2OAP1 2HLDA 4NYMQ 1NLFA 1ANKA 2Z6VA 4YDHB 3WP0A 3CKLA 1ODFA 4PC6A 3NHAA 1G3UA 1O87A 5G53C 1E9RA 4FIDA 3QEJA 4OJQA 3GMTA 1R6BX 4DEXA 2X1VA 1Z6AA 2R9VA 4CZ2A 1JJ7A 3GJ3A 1JJVA 1T4GA 5AK0A 2QMOA 3UANA 4BFZA 3JZMA 4FCVA 2C8VA 4Q19A 4PZZA 1BIFA 1R8SA 1K5GA 4XSHA 2IS4A 2HF8A 4O2LA 1U90A 2QMEA 1JPNA 2JLUA 1FTNA 4EPVA 1PUJA 5SZKB 1NI3A 1C1YA 2C03A 2V6JA 3NDPA 3BOSA 2W58A 2CL0X 2BM0A 1NN5A 5DYIA 4B6EA 3AF3A 4FMDB 1LV7A 5DO9A 1Z07A 1WA5A 5KPDA 4ZI3A 3LQRA 3P4XA 3R9XA 3KFXA 5KSZA 1LB1B 1NSFA 2F1JA 2OO7A 3Q5DA 3GLGE 3D31A 1G3IA 1VYUA 2JLZA 2QY9A 4KLNA 1E0JA 4PZLA 3RANA 2IS2A 2BBTA 2ZIAA 3X1ZA 3GPLA 3LLUA 3AH8A 1WDTA 2B21A 1NMXA 3KZ1E 3RS0A 1PVOA 4ESVA 1R2QA 2EU8A 1F2TB 3GFPA 3U44A 2ZSFA 3C16C 1G7CA 3W90A 5F9FA 1E9FA 3NC0C 3ICEA 2V9PA 3MUFA 2WJIA 1HE1C 1S3GA 1P2SA 1W4AA 2ZSAA 1US8B 5CIWA 2ORWA 2VP4A 3I5XA 1XTJA 4FMCF 2BBOA 1GKIA 2R8RA 1IN5A 4H1UA 2ZRKA 1SKYB 3UMRA 2MSDB 3FGNA 3QVUA 3UWKA 2R6CA 1LVGA 1N5KA 1YZLA 2LCFA 1TQ2A 2F6RA 4IXMA 2GEVA 2IUTA 2VA8A 2ZI5A 5FBQB 2WTUA 4JVNA 4I4LA 1P7CA 1SXJE 2FA9A 2VP9A 2J87A 1D2MA 1OFHA 1TUEA 3AB3A 2ZI4A 2Z4SA 2NG1A 3RS4A 2C98A 2QP4A 1OE0A 2F3RA 4KVAA 2HYDA 4TSFA 2FPKA 5TXGA 2UKDA 2XTZA 1CTQA 1OHHA 3U2QA 2JLSA 4C4PA 2XGJA 4NCHA 4NCNA 2C5LA 2GJSA 1S96A 2RHDA 2QE7A 2VPPA 1UPTA 1KO4A 1E2MA 4CRWB 1T0JB 1J8MF 2BCJQ 2QAGA 3PV0A 4TTRA 2JIZA 2FGKA 2ZEJA 4DLSA 4QBHA 4DB4A 5FL7D 2QBYB 4FMDF 3SHFA 5JWHA 3IKJA 4D4KA 1S1MA 1YZUA 4B34A 2OAQ1 4Y0VA 2GF0A 3THXA 4OK5A 1NMZA 3FTQA 4BEJA 3O8RA 1N25A 4QGAA 1MV5A 3EZ6A 3GLFA 3UPUA 4C2UA 4Z51A 3PEUA 1COWD 1E2FA 4IVQA 1W44A 2N46A 4ZCMA 3UKDA 4B3XA 1XPRA 4LUCA 2BC9A 2FU5C 4TN1A 2QEQA 3WHKA 1DS6A 2PZFA 1TQDA 3VX4A 3BB4A 1UEJA 1KI6B 2ZJYA 2FEOA 3IEVA 3IIMA 4PZYA 3FDIA 1RVDA 1NLYA 4IFBA 4Q01A 4XD7A 1YQTA 3W8NA 3AGPA 3CRQA 5F3WB 4P4SA 3C41J 3CR7A 1ZUNB 3FKSD 4IEEA 2AXPA 1E32A 3QF4B 2GEUA 3FVQA 3WNCA 1WBBA 2QPTA 3O8DA 4DC9A 2HCBA 3W9YA 4ARZA 2QPOA 1KSJA 5L3SB 2IS1A 4Q5IA 2WJHA 2WMNB 3L0IB 3QXCA 1SGWA 2WKPA 1SHZA 3VR3A 5ELXA 3AVWA 4C7OA 5HKKD 2GCOA 5H68A 4QJ4A 2ZU0C 1T8TA 1GDDA 1AS3A 2QTHA 3WYGA 4DSTA 1SHKA 3KUCA 5JCPA 3CUEF 1DAHA 1XTIA 4P31A 2ZJ2A 3VR6A 2R65A 2P67A 1HQYE 1LW7A 2ZUDA 3GJ8A 2HT6A 3QNUA 4Q9HA 4B35A 1Z6XA 3EWAA 3K9LA 1T0HB 2GAOA 2CCJA 2DCUA 3HPRA 3B60A 5IK2A 4EQ6A 4ZO4A 2EYQA 5FR2A 1N3BA 5JLJA 1J8YF 2ZVQX 4R71A 4JZKA 2WKQA 3IEUA 3VTKA 3WHLA 3ICQB 2ZE8A 2JLYA 1TU4A 1FP7A 5FOTA 2GVDC 3WP1B 1RW4A 1KI7A 2I3BA 3O8BA 3VAAA 3WRYC 5JZVA 4ZCIA 3N70A 5DISB 4DSUA 1GOTA 3OZXA 4UNRA 2PX0A 1A1VA 2A30A 4C0LA 4LJ9A 3K9GA 1RPZA 2VP0A 4TLBA 3CPJB 4OYHA 4ABYA 1E79D 1ZM4A 3QQ5A 2JDID 1HEIA 1KO7A 3KTAB 3O47A 3AP3A 4KCGA 3RRZA 2ORIA 4R2IA 3L82B 3ZQ6A 4PC1A 5K8LA 3TR0A 1TNDA 2P0EA 4B2LA 4DDTA 3RS7A 3W34A 3FFAA 1JR3D 1OKKA 2HXYA 2ZJOA 2FN4A 2FNAA 3DVLA 4GP7A 1P3JA 4DLYA 4AYWA 2PH1A 1MR3F 3HU2A 4RFSB 5EP3A 3CNNA 1YRBA 1S3SA 3KL4A 4MRRA 1X3SA 4G5RA 4AIIA 1G6HA 1DAEA 4EKDA 2G77B 2D7CA 3D8BA 4JS0A 2CHQA 4LYFA 4K46A 2ZM5A 3PEWA 4Q03A 1JBKA 421PA 1RRFA 3QUSA 4BLSA 4Q9IA 2AWNA 2HV8A 1JAHA 1RC8A 5EE0A 1R0ZA 4KFRA 3WMGA 5JEEA 3T1QA 4B3DA 2J45A 4JYBA 1GSIA 3I32A 1ZMXA 1EFUA 3FB4A 4PPGA 3U3MA 1II8A 4NU0A 4A15A 1M7BA 2AFHE 3OEHA 4NYIR 3T61A 5FR1A 1OXSC 2WV9A 4AKHA 3FFBA 2OSBA 3WYAA 1MABA 3A1UA 2DFNA 1U0LA 4NP6A 2GESA 5EXSA 5SZJA 1LFDB 1G4AE 4RZXA 4EFNA 3C8UA 3GLHB 4OBEA 1Z3IX 2XZOA 3TW4A 4QKQA 2ZXUA 2HJGA 3IBYA 4TL8A 1G20E 1X8JA 2DWOA 4YMTA 4JKYA 4KU4A 5EQTA 4B32A 4MKFA 3ADDA 3KQLA 4ARZB 4CEIB 1KAOA 4B3BA 3GJ7A 2YINC 2LWIA 3QF4A 1ZC3A 4N3NA 1GKYA 3L43A 4M1TA 4G01B 3ZZUA 3RSLA 2MMCA 5CK4A 4RKFA 3QXSA 1N0UA 3V4FA 2WPDA 4PPQA 1OH6A 3EWSA 2CNWD 5CYOA 1N6OA 5FI0B 3QENA 5C4GB 3AVPA 3NKVA 3GJ6A 1P75A 4BZQA 3B13B 4QBGB 2JATA 2O8DA 2VL7A 2VHUA 3U3RA 4AURA 1MRNA 5EXXA 2IYTA 4EPXA 4IOLA 5DGXA 3U4QA 1IJFA 1M74A 1QVRA 4LBVA 4XWAA 2IYUA 2XZLA 1I4TD 1AN0A 2YWFA 4Q7JB 4JLDA 5E7MA 4RD0A 2BMEA 1YU9A 2Q3HA 4DZZA 1LF5A 4Q1CA 1EFTA 3ASYA 1E2LA 3GLGA 1J7KA 1E96A 1GRNA 3AVTA 1BS1A 3K09A 1OFTA 3GJ0A 1SZPA 4TMVA 1IN6A 3QPUA 1FFHA 4YXWA 4S2EA 4B74A 1VTKA 3CPEA 4IOJA 1KOFA 3LXRA 2Q3FA 1G7SA 3DHWC 2GXUA 1M7HA 2JAQA 4YMUA 2FFBA 1HURA 2BIFA 2FH5B 1LS6A 3B78A 1ZD9A 3ND8A 4DWJA 1CR4A 1JXMA 1KK3A 4DB2A 2ZS9A 2ODWA 1E2KA 1F48A 3A1WA 3P26A 2OLKA 3RSOA 1XEXB 3ECCA 3FKSA 4OKSA 3QSYA 2XZPA 3GLHA 1JEDA 2AD1A 3P27A 3OESA 1NVVR 4DDVA 4WIAA 4D4JA 3SFVA 2J46A 1R7RA 1G17A 1G291 5DSZA 4IVPA 1Q57A 4NBSA 4DRZA 5FOWA 2IBMA 4UNPA 1XCMA 1VECA 3SEAA 2DY1A 2WSSD 5H70A 1VPLA 2X2EA 1RIFA 1VYTA 5CB6A 4RCYA 3DMDA 2ZI3A 2QI9C 2NOAA 3TVTA 2FSFA 1HE8B 3I1FA 1P9RA 4LYAA 3PXGA 4TT3D 3REGA 5JCZA 1OXTA 1S0UA 5JJIA 1QG2A 2WIBA 3S1AA 1W0JD 2AK2A 3OIUA 1SVLA 2NO0A 1QHSA 4TZ6A 1N6KA 1ZBDA 2BCGY 2OCYC 1UM8A 3ZDQA 4BUJA 3GLFE 1XCGB 3QG1A 4CEHA 1KTVA 1IM2A 3CH5A 4NMMA 1DARA 1ZAKA 1AS0A 4BQSA 1CULC 121PA 2B8WA 4GNKA 1KIMA 4LC0A 4LYHA 4HAXA 3KQNA 2D7DA 2GHIA 3MFYA 4QFMA 3W8RA 2IUSA 2XNDA 3GJ4A 3ETLA 1NVWQ 2IW3A 3K09C 1NLZA 1Z0KA 3GLIB 4MRNA 3QEOA 1A7JA 3C5CA 2D4HA 3KTAA 1Q21A 1VCNA 4GP6A 4M4SA 5GJVC 2PLRA 4AG6A 2XJ4A 4D81A 2HYIC 4F38A 5FH9A 4CGZA 5EE9A 3KKMA 3TUIC 2B6HA 4M9XA 5FUYA 1NNEA 2QUZA 3GLGB 1T3SA 3SC3A 1FUKA 1DAKA 3SS8A 5G3YA 1YVDA 2XB4A 3B9QA 4DBLC 4RSGA 2O8CB 2ZAOA 3AP2A 2FPLA 1N2CE 2FG5A 5JJKA 2DHRA 1XPOA 2XSZD 3ZVLA 4AG5A 3QIAA 4M1KA 1D8TA 4HLCA 5BWMA 1ZM7A 3KQKA 5HZKA 5BYJA 4MKGA 2P6UA 5JS7A 2W2TA 4MGKR 2VO1A 2VP5A 3UMSA 2QM8A 3C15C 4MGZR 1XBTA 1IY0A 5J47A 1N6PA 4LI0A 4BLPA 2JEOA 2NO9A 2GETA 4P4TA 3KKQA 3QY0A 1NP6A 2XB2A 3T35A 4QL3A 1E3MA 1R0WA 1Q20A 4C9BA 3SQXA 1DO0A 4F7WA 4TLCA 2AR7A 2CLDX 2GCOB 1EFRD 3IBGA 4B44A 1GL7A 5FPHA 3SU8A 3A36A 2Q9AA 2A2ZA 5P21A 4BZXA 3ZLJA 1OJLA 1GNQA 3DO6A 1IY2A 4JT2A 1QHIA 4UNQA 4QHTA 5FBWB 1Z08A 5EXPA 1NVXQ 1UBEA 2IHBA 4F93B 4EUNA 1CJVC 5IHPA 1D5CA 4Z1MD 4FXPA 1W2GA 1N5JA 4CT4B 1AIPA 4C0QC 4JLJA 4RZUA 1E1RA 4ZDKA 4KYUA 4G5OA 1SKQA 4M1MA 2QP9X 3RS3A 2WJJA 4P4SB 4TLEA 2QAGC 3KJHA 4D4MA 4L4UA 4PTLA 821PA 3THYA 4V0NA 3ZVRA 5SZIA 2ZR9A 1SKYE 1Z06A 1ZU5A 4JJKA 1VG1A 3M1IA 4IJMA 1FL9A 2BMFA 2WWWA 3C14C 4PO1A 4CT5A 3X1XA 4HLUC 2CL7X 5JI3E 3B1YA 2WWHA 1LF0A 2DFTA 3LW7A 2OFXA 2REOA 5L3VA 1BYUA 3QKRB 3EIHA 4I81A 1VCMA 4LPKA 3TAUA 1SULA 4YMVA 1E69A 1C4OA 2J7KA 2OG2A 2ZE7A 1YR8A 4AD8A 2JJ8A 2JJ2A 3K1JA 4EFMA 2QBYA 3F0TA 4M1WA 4EPWA 4HDOB 1E2QA 1W0KA 1XB2A 1UJ2A 2RAPA 3MD0A 4UJ3A 1P2UA 1SXJA 4KBGA 1WBDA 5JBQA 3QI2A 4L9WA 3EZ7A 2OV2A 1ZUHA 3BH0A 1Q3TA 4Q7LA 3HR8A 3CNLA 4BFXA 4MYTA 3GJ5A 2OBMA 1G5RA 4BASA 4OQNA 5B57C 2HUPA 1R10A 3I8SA 5FOVA 1G21E 3H1TA 3BGWA 4KODA 2JJ1A 1MRSA 3RS5A 2QORA 3OEED 4OQXA 5FUVA 4JL5A 3OHMA 2GTPA 4AYXA 3LBHA 2NZ8A 1LTQA 4ACAA 1GIAA 1ESMA 2WOJA 4X8LA 2HCJB 4DSNA 3Q85A 2IXGA 2ZYVX 2RHMA 2QTVB 1JNYA 3QXJA 3VNVA 1US8A 3ND9A 1YRAA 3WBJA 3KKPA 1W47A 4KFTA 2EWVA 3IQXA 4A8JC 2GRJA 4MH0R 4CF7A 1F2TA 3U44B 1XF9A 4A0GA 1G3QA 2DB3A 4TYYA 1XXHE 3AV0B 3K0FB 5KSOA 1GRQA 2BM1A 3U6KA 3DEFA 1W5SA 3K0AA 4XWOA 4WZAE 3THWB 4DT1B 4TTQA 1M2OB 1E4VA 3QF7A 2XAUA 3CPHA 1EGAA 1RRCA 5LB2A 5IDVA 3B6EA 5KO2A 2ZRBA 5H8WA 1Q1EA 3X2SA 4M1OA 1U81A 2YYZA 2PJZA 2IYSA 1TF5A 3BE4A 2VSXA 4KLZA 1IQPA 1YR6A 1ZU4A 1V43A 3AKDA 2LKDA 3SQWA 3P20A 2ONKA 2RB4A 2XEXA 3K0AB 4NCIA 721PA 2GEDA 3KXIA 2NMVA 1R4AA 2ZYTX 1W5TA 1D2EA 4TQAA 5JI2E 2BV3A 2IF2A 3R20A 4KFSA 4YMWA 4A82A 4URXR 1OF1A 3NH9A 5J4KA 2J41A 5DNYB 3BS4A 1KI2A 2FFHA 2R2AA 2A7QA 1EFCA 4JL8A 4OI4A 3KDSE 1AQYA 4IHQA 1T8UA 3THXB 3D6TB 1RZ3A 1XCPA 1TX4B 4LHZA 4WAUA 1YR7A 4CYMA 3HWSA 2ZITA 2QRZA 3WBKA 4TYNA 2NO7A 4P4UA 1TTTA 3CM0A 1M6NA 1VIYA 2OLJA 2VLIA 1OXVA 3GLIE 3CIOA 1XJ0A 3C4JA 4BLTA 1A2BA 4XVUA 1ZCBA 4Q47A 1W1WA 1XMSA 2Q21A 4JL6A 3SJBA 1LS1A 1NN1A 4DDWA 5EUMA 1E1QA 1XZQA 1FX0A 2ANBA 1EK0A 1W2HA 3ADKA 4PXAA 1RRPA 1XEFA 5HE9A 4KITB 5H1YA 4F4CA 1VCOA 4UXIA 3I3SR 3HP1A 1G5TA 4YQFA 1G64A 4P32A 1GRRA 3PR1A 1R5NA 4XIGS 2I1VB 4PR0A 1XFAA 5DYGA 1O3YA 1Q22A 1OXUA 4BPBA 2FF7A 4WBSA 4ZKDA 1WQ1R 2DR3A 4JIMA 1H65A 2V7QD 2VRWA 3UK6A 2KSQA 1DTSA 3KJGA 1P60A 1YZQA 221PA 2OM2A 4YLGA 621PA 5BYKA 3FYHA 4XSGA 1DADA 3L8YA 4DCSA 2BJVA 4ON9A 3RC3A 1NJGA 2REXB 1ESNA 2O5VA 2ZREA 4DIDA 2CHVA 2Q0HA 2BDTA 4M9SA 5HTKA 2FGJA 2AKAB 3LBNA 1UEIA 2IYRA 5FOUA 2QPAA 1CKEA 3CRRA 5L3RA 4ASUA 4EJSA 1OB2A 2XXAA 1BMFD 3WMEA 1P2VA 2GF9A 4X8OA 4TMTA 2V54A 2ZANA 3QPWA 4GOKA 3B8HA 4B3GA 2V4ZA 3SJZA 1WF3A 1W4CA 2YNMA 2PZEA 1KZ7B 1OV4A 1OYWA 2VTKA 1G8HA 3EZ9A 4B71A 5AUOB 1P2TA 4RY2A 3T06B 4D80A 2NGRA 4F92B 1M34E 2OILA 3NBZC 3IPXA 5DN6D 1SVOA 2NO6A 1DG3A 1WP9A 4JLPA 1Z0FA 3W5IA 4O3MA 1P61B 4ZPXA 2X2FA 1N5LA 5L8VA 1U0HC 4MRSA 1ZUIA 3OAAA 4DLVA 4KV9A 4PO8A 4U7DA 1JR6A 1E0AA 3KUDA 4D6PA 5AUNB 1W36C 5DI9A 2F1HA 5M04A 3A4MA 1PLLA 2AKYA 2W00A 5AWFC 5FPKA 2RGGA 3ZJYA 3MRSA 3CX7A 1G18A 5EE1A 3QKUA 4QNRA 4R98A 5L3QB 2FX3A 1N6NA 3OIYA 2I4IA 3PJRA 3P1JA 4NPHA 3W6OA 3Q5EA 4LHWA 1G9XA 5FTLA 2XOKD 3SDZA 4O25A 4D82A 2FOLA 1NY5A 2EFCB 2JASA 2A5YB 3ASZA 4JJZA 3NBYC 5KUTA 1JALA 1Z0IA 2PCJA 1AA9A 1M7GA 2QE7D 2PEZA 4B6FA 1FNNA 4CIDA 1AJEA 2HLDD 4A92A 1GAJA 1VG0B 2FSGA 1RYHA 3SNHA 2CLCX 2IUUA 1KNQA 5KSYA 5FPYA 1W0JA 4QXAA 2CHGA 5KU1A 2CCGA 1AM4D 4UXJA 2PMKA 2JGNA 4HATA 2F3TA 5KHOC 3E70C 1I2DA 521PA 5IT5A 2W6JD 1DAIA 1U99A 2ZI6A 2D2EA 3PG5A 1KY2A 1UBGA 1AGPA 3L0SA 3W6NA 2NPFA 3DOEA 2QU8A 3KXLA 1G3RA 4KHZA 1E2IA 3RDPA 4GOJA 1SQ5A 3IGFA 4KFUA 1KI6A 4Q1EA 3THWA 4EJSB 3AVOA 2ZRHA 4Q4AA 3K0FA 3I5YA 2TMKA 1ZC4A 2QAJA 1FPMA 3LY5A 4DUGA 4HAYA 4UNNA 4US1R 3GLFB 2ZRCA 3DM5A 2QT1A 2ANCA 2G0TA 3HYTA 1EX6A 2BKUA 1GNPA 3PQCA 3L0OA 5FOXA 4LV8B 3CRW1 4M1SA 2Z4RA 1G8GA 2H16A 4EFLA 1CJTC 3TUZC 1RRGA 4V0LA 2X8AA 4Q00A 5DHAA 4E03A 4FWTA 2GDJA 2HXSA 4TMZA 1UDWA 2FMXA 2OBNA 1P73A 1KDRA 2GJAA 3MAAC 3SYNA 4PPNA 3DDCA 2GK6A 3B1XA 3BXZA 3R9WA 2CE2X 3PEVA 1BKDR 1XEXA 2A5DA 1L2TA 2XJ9A 1U98A 3SYKA 4AC9A 1FTSA 5EP4A 2G9NA 3VHXA 4RFVA 3MWLA 2G88A 1UFQA 4L16A 4V0OA 2VP6A 4JSYA 4M8NE 3PUVA 6Q21A 2FFAA 4K8OA 4DEYA 2VHCA 2IXEA 1XMVA 3L0PA 2JLVA 1ZNWA 4CEJA 4YMSA 2ZRLA 4B3FX 1HT1E 4OHVA 3EA5A 1KJZA 2AD5A 1W48A 3NIBA 3DL0A 3RS2A 3CZPA 2F1RA 3AVYA 2OEPA 4ZCLA 5LPNA 2AWOA 2V55B 2GZAA 4C0BA 1JB1A 4TQUS 4GDFA 1UKYA 1E0SA 1FMJA 4A0FA 4ILEA 4ERNA 1R5OA 3D7MA 3NEYA 3BK7A 3W3AA 1KGDA 3I73A 3RYTC 3KJIA 4WOPA 5UKDA 4TZ0A 2W83A 2WICA 5DLQC 2F9LA 1XJCA 4H9GA 3THYB 4WVFA 4AKGA 2GJ8A 4YC7A 5FL7A 5HR5A 3LXXA 2D06A 5FI1B 5EE3A 1K6MA 3HR7A 4FCWA 3CH4B 3IIJA 5E7JA 4WXRA 5LB4A 5GVSA 4PO9A 2QA5A 1KK1A 2PX3A 4X8MA 3AVXA 2IWRA 2EVWX 4KO8A 3CRVA 3KKOA 1JXOA 2G3YA 1LNZA 2UZ3A 4I1UA 2OE2A 4DT1A 3K0CA 4LCBA 1KKLA 1KZGB 1Z0JA 1KDTA 2ZE6A 4A36A 3FMOB 3Q3JB 3ZS9A 3IUYA 1VG9B 3SYLA 2XNSA 3UG6A 4IDPA 2F55A 4O2RA 3TUJC 3GCGA 2R6FA 4QBIA 3EIEA 4AWXA 5AR1A 4QG7A 1Z29A 1EG7A 1ZJ6A 2DWQA 4HYYA 4JLNA 4BFTA 2NIPA 1I4LD 4HSEA 4LDJA 2JLWA 2CCKA 4DLWA 2JJ1D 3B82A 2FZLA 5GJWC 5FPSA 5CB8A 1N0VC 1SVMA 4NYJQ 5L3QA 1JI0A 4ZDIA 4B3CA 3TK1A 5JS8A 1J2JA 4PSVA 3Q9LA 1FMLA 1TADA 3A8TA 3A4LA 4OHWA 2A5FA 3BRWD 4KXFB 2XX3A 1ZD8A 4FINA 1HA3A 1II9A 4LBZA 5KNDA 3OF5A 4M2LA 2RGCA 4HZIA 1ZIOA 4JLOA 1YJ5A 3BERA 3CBQA 1T6NA 3CF6R 3EC2A 2NTYC 4HLQB 4JVMA 3ZH9B 1XX6A 3U5ZB 2OXRA 4V03A 3U7HB 3G0HA 1WMSA 3DKPA 2W6IA 3Q72A 1HV8A 1G5PA 3OFND 4IDHA 4DSOA 1SXJB 4PHTA 3GLIA 1A82A 3EARA 1VHTA 3WMFA 4JBXA 1PZNA 3IIKA 1DG1G 1QHXA 2KWIA 4J0QA 1GL6A 4EPTA 3VU9A 1RKBA 4M21A 4MQBA 2P65A 3PEYA 4TMKA 4A8JB 1AZTA 3LX8A 3QKSB 3GD7A 4KSCA 4HLDA 1CR1A 1IN8A 2ZUBA 3TNFA 3MSXA 3S1AB 4S35A 4WXPA 2PCLA 1TPZA 1OYYA 1E9BA 3CR8A 2ZETA 1E79A 2ZS8A 5GJBA 4NONA 2QMHA 3TGPA 3DPUA 5CDFA 1F3OA 1TL7C 3QBVA 4UXHA 4B43A 1Q3HA 4Q4JB 1BH2A 4F91B 4WW0A 3OE7D 2P5TB 5GVRA 3VR1A 4B48A 4DUGD 5J4HA 2AL7A 2BVNA 2PT7A 1E2NA 1U8YA 2BWJA 3HU3A 3SBDA 4JLBA 1KJYA 3AVQA 2REBA 3BH6A 5LD2B 3KFVA 1OIXA 4XH9B 5FFMA 3VKGA 4C7OB 2HJVA 4A2WA 3SR0A 2JCSA 2N42A 2D2FA 4GMDA 1XD9A 2CK3D 1FX0B 2ZYWX 4V0ME 4GOXA 5FOSA 2W2XA 4M0LA 4P3YA 3RWOA 4ZDJA 4PHHA 4NCJA 1NBMD 4PC7A 2WM9B 4POAA 2QG6A 1X6VA 3M0EA 4Q48A 4DXAA 4KVGA 1E9EA 1WE2A 5FTKA 3PCRB 3A4NA 1CJMA 3LBIA 3T15A 2RGNC 1R0YA 3FWYA 3EX7C 3AVUA 2C9OA 3BFKA 5FBRB 4EPRA 3M6AA 5TV2A 3AQ4A 2C99A 4XOIA 3SJAA 3H0KA 2A9KA 1DO2A 4JBYA 4KSBA 4TYQA 1IN7A 4K81B 2PLFA 3B5JA 3QKTA 4F4IA 2CE7A 4LBYA 3KB1A 3PUZA 1CJUC 1YR9A 2ZJ5A 2E9SA 3VNUA 1FUUA 2ONJA 4DHEA 1W49A 3I62A 1U9IC 1VIAA 2RGNA 2KJQA 2A5JA 3O8CA 2FWRA 1OSNA 4FD2A 1QHHA 1NVUQ 1G3MA 2IC5A 2OESA 4HAVA 4LJAA 2JA1A 4RVCA 2C2HA 5CIQA 2ZROA 5J40A 2QMUA 1DAFA 2FEMA 5IRCD 2Z0MA 3DMNA 1TF7A 1WRBA 4MRPA 2Q9BA 2O8EA 3WYFA 5GJCA 2J0UB 4URYR 4GMXA 1S8FA 1ZNZA 4MKHA 5JEDA 3K0SA 1KO5A 4ASUD 5FPTA 5KSPA 4LHVA 2MMGA 4KBFA 2QRNA 1G19A 4KJZA 4LK2A 2PJRA 5HCNA 4NYJR 3QOFA 2NO1A 1QZXA 1IJEA 3AEZA 4IOKA 4LV6A 3EZFA 3R8CA 4U02A 5BN5A 1XRJA 5J4VA 2KE5A 2V8OA 2ZSDA 3TW8B 5EP2A 1GG2A 4W7SA 1Q0UA 2G6BA 3E2IA 3VR2A 3LNCA 2B7BA 4MDFA 2XTNA 1J70A 4RD2A 2ERYA 4EJSC 1NIPA 1ZNYA 4PAQA 5HE8A 3F5FA 1NBME 1QG4A 2QP3A 1VDZA 4HB2A 3EW9A 2O0KA 1D2NA 1Z63A 1IXSB 1UDXA 4MYCA 1DEKA 4OQMA 4QOSA 2ZRAA 3IPYA 3DOFA 1VMAA 3FPAA 4DCUA 3VR5A 2WAXA 2QROA 1QRAA 1XD2B 2G83A 2JIZD 2YC4C 5J5CA 3UIEA 3UMFA 1RYFA 2CDNA 2G1JA 2IS6A 3QVVA 3ZIAA 2Z83A 3K70C 1E98A 4A1FA 1U9IA 4DLTA 5DHFA 3IO5A 1PLKA 1Q1ZA 1KDOA 3C7KA 1IAQA 4Q7KA 1XXHB 2RGEA 4LJ6A 1E9AA 4LJYA 4JVSB 3FHTA 4TT3A 4RKEA 2O8FB 1XEWY 1XEWX 1DELA 5CYPA 3EC1A 4Z8YA 4NTZA 2ZRGA 3CLVA 1TMKA 5F2EA 3RC8A 2A78A 4FMBB 3AKCA 1OFUX 5KNBA 2RKOA 3TIFA 2XTMA 2WBLC 2YV5A 3LVQE 4LOAA 3GEHA 4LSGA 2W6JA 1V5WA 1G4UR 3QKRA 4C3ZA 2CL6X 3QBTA 3ZZ0A 2XNDD 4IFEA 1B23P 3F8TA 1VHLA 2WWGA 4GL2A 4Q4LA 3B7GA 3GFTA 3U4QB 1IOZA 4DLXA 1CF4A 1EESA 4N0DA 2QQ0A 2WWIA 4GSYA 4EQ6B 2O8DB 1XD8A 1Z0DA 2VP2A 3B9PA 3NWJA 1JECA 1OKKD 3A1SA 2ZQ5A 4QM6A 4JT4A 3PFIA 5G41A 1S1CA 2ZRFA 1E0KA 2ZSEA 2MSEB 1PV4A 3ADCA 5C4MA 4D0LB 3QXXA 4PC2A 4CEIA 1AK2A 3NC1C 3CZQA 4QGFA 3WRXC 2IX3A 2VH5R 3EIQA 4HEJA 1UBCA 4Q66C 4OI0A 5FBLB 4IOMA 1OIVA 2ZE5A 2Y8EA 3K70D 2D74A 4HLUA 5EE5B 2HDNB 4KYIB 4MKIA 4NL4H 4PSKA 1CIPA 1YZGA 2WWYA 5CLLA 2ZJ8A 3CWZA 1R5BA 3OEHD 4RD4A 1XP8A 2IL1A 1MABB 5TVKA 1F2UB 3EASA 3K0CC 1XPUA 3CONA 2WJGA 4RJLA 1II8B 3FOZA 1E9SA 3K9NA 2WJVA 1NBMA 5BN4A 1KNXA 5LD2C 4Q4HB 4TWZA 1U2RA 1KK0A 4JSTA 4Q18A 2J7PA 3EXAA 1GKUB 1GFIA 4HAUA 4M53A 4PQYA 5BXQC 3R7WB 3I72A 2O0HA 4I1VA 5CJPA 1MO5A 1E4YA 3VHLB 1NMYA 1GP2A 2IF0A 3BB3A 2B8TA 5TDHA 1J90A 2GWHA 4YONB 4GFDA 4B73A 3BB1A 3NTUA 4IDNA 5JWOA 2FSIA 2O8CA 1JR3A 4RFSA 4ZV4A 3JVUA 3ZQJA 1A5TA 1GILA 2WPDD 3IDQA 4BEBA 5KNCA 2UVQA 2YC2C 1H8ED 3B1WA 1EX7A 1Z28A 5E95A 1E9DA 4WZBE 1ZYUA 3I4LA 4OHXA 1DAGA 2X77A 2PZGA 4FWIB 1T5LA 2HEIA 3I92A 4IW3B 4TLDA 1CJKC 1E9CA 3MWJA 1COWA 1KO8A 4MYUA 2QN6A 1XXHA 1Z6TA 4A0RA 3TE6A 3GQBA 4PSAA 1ZM2A 1K5DA 1VYVA 3OIWA 1Z0AA 4Q1BA 5C18A 3SZRA 5D3MB 3LLMA 5EZ5A 5JHGB 4PANA 2ZAMA 4CEHB 2H8KA 3DZ8A 3TMKA 2J3EA 4TL6A 3TKLA 2BMJA 1UBFA 4US0R 1MT0A 3MGCA 1MH1A 4XD7D 5FUXA 1G8PA 2BMDA 3RWMB 1GUAA 2DYKA 4R2HA 4TMWA 2QNRA 3X1WA 1BOFA 3CWQA 2EFHB 1OW3B 5K8UA 1E1QD 2C9YA 2FPMA 3VR4A 5B2ZA 4PPFA 3PENA 2F43A 4TSFD 3VQTA 2LKCA 3H84A 1P9NA 2G0NA 3MJRA 1W36D 5CK5A 1E2GA 2BHRA 1QVAA 5F98A 5A4JA 1CR0A 2Q6TA 3EZ2A 1ZP6A 5KYKA 3EPHA 1F6BA 1L4YA 1VG8A 1HQCA 2ZRMA 4NKRA 4I99A 1X86B 2H5EA 2WWXA 2R6DA 3AF2A 3FHOA 4XWKA 4PHFA 4IRUB 1Z8FA 4JKIA 2R6GA 3EPLA 1IONA 1D6JA 5D3MA 5L3SA 2XITA 1IXRC 2IYZA 2J1LA 2WIAA 2HT1A 3THOA 2KBEA 4A0HA 1IY1A 4QHSA 3TAHA 3I61A 1IHUA 1UAAA 4CDGA 2QENA 5JJLA 2VHTA 3OIVA 2IEZA 1L7VC 4XTRA 1JQJC 1MO6A 2ZPTX 2CVHA 5JSZA 2L0XA 3EPKA 3J81k 1HY3A 4NYIQ 2IYXA 3TSZA 1NIJA 4NH0A 4QGGA 2GAAA 2CLSA
chains in the Genus database with same CATH superfamily
1IMJA 4YXWD 3OO1A 4HYEA 3EAGA 4ITVA 1CR6A 1S2OA 4R9UC 3TQOA 3C3EA 3RUPA 1MVNA 3B2EA 3E9EA 4E07A 1H5NA 2HFJA 2HA3A 2I9KA 5E4JA 1BG6A 1K3TA 1LRKA 1WEHA 1ZD1A 2PGXA 4UBJA 5BRJA 1HT0A 1PJZA 2MYUA 2P30A 2XE7A 1TU3A 3CUUA 3U81A 4H0NA 5U1PA 4RHTA 2B99A 5DTMA 3DKVA 1VHWA 3EY9A 1GGJA 5ECYA 3VSEA 5KQSA 3TRKA 2Z8ZA 5K6RA 5K1ZA 3MWKA 3N6XA 1YQEA 4G24A 1A3CA 1DNPA 4G63A 4R16A 5DXJA 5C80A 4Q82A 1UBJS 5KJEA 2QLBA 3WKCA 1Z56C 2VZ9A 1II0A 3VU8A 3RRFA 5KVSA 5TIIA 1JHZA 4P33A 1NTOA 5HMMA 5GZ6A 1E1DA 1NKTA 1V11A 2J4CA 2K2WA 4G23A 1DPGA 3KKNA 1LPOA 2TECE 3FM9A 3C43A 5ESXA 1LDYA 3M6XA 3OE7A 4R2XA 4EAQA 4OLHA 2WHXA 1QK5A 2QQEA 2WNHA 1JIIA 1AQIA 2J4FA 5KYWB 3O75A 1AHNA 3RAEC 4LZWA 5F2NA 3VDQA 4D97A 3GFSA 3A28A 1DPFA 3LG2A 3ZDEA 4CN9A 3BM5A 1SUBA 4NJMB 1EJ0A 3K1ZA 4FGLA 4II7A 4BBPA 3FVTA 4QJIA 4LHYA 2QJRA 3QFTA 2OCPA 1DDGA 2XMGA 3HYRA 3WWYA 4C0SA 1WB9A 4ITRC 1VI5A 4ZIRB 3V1NA 4NWIA 2JBWA 2QRMA 3RU7A 3L93A 1QG0A 3GLRA 5A04A 2I1QA 4MR9B 4MJLA 4I5EA 1JAIA 4MI9A 3GYBA 3KYCB 2Q1SA 4OLAA 3A70A 4W9RA 3K2EA 2BGTA 1FNBA 5AVRA 4DTIA 5FEUA 5EKXA 4Q4JA 4DB2A 2RHJA 2AJDA 1JXAA 5B7GA 3BWCA 3ESBA 2RMKA 1M8KA 2VCYA 3QFSA 4PFQA 1JT2A 5I7UA 1WB4A 3HLTA 3IQEA 3PXCX 2YJTD 1PHPA 4QRIA 3M33A 3OQNA 2HBRA 4UM9D 1RJ9B 1NP7A 4NG5A 5FBVB 3E5HA 5AJVB 4BOYA 3TPCA 3CF0A 4GR9A 4XX0A 3L7MA 1ULHA 2NZXA 2YZ2A 3K92A 5TSDA 3WYCA 1GGFA 1ZGCA 1FLDA 5TC4A 1CBUA 2HFKA 4JT9A 2DG2A 1HSOA 3AL2A 3ONWA 4B7XA 4BLWA 4OGFA 2GCPA 3F8WA 4J9UE 3LGXA 4X84A 3CN7A 3WGKA 4QJ5A 4HUQA 4PX3A 1TYBE 4YLYA 1F2VA 1T5BA 3OM1A 5EI5A 3GBSA 2Y0PA 1CDDA 1DP4A 4XWTA 5AP9A 4DKXA 4BFVA 3ELYA 3X1MA 1ELOA 5MN4A 3PUXA 3W7AA 2XE6A 2QZZA 4DLUA 4HX9A 3VO9A 2BEWA 3D3JA 5C8YF 2UYCA 4MA4A 1HBJA 4QQ8A 1R15A 2P9CA 2QXYA 2NQ2C 3WNDA 3ZZTA 2AYYA 1Y5LA 4P3OA 2X8LA 3IDZA 3MMPA 4G97A 2ZSJA 1GTRA 3ANXA 1N6RA 3NBKA 4UU1A 2WFLA 2CDBA 5JRZA 1CRQA 4TXMA 4Q02A 4RQTA 4B40A 3DA8A 3MUNA 5AW9A 1DAMA 3F98A 2R4UA 3A37A 1NDUA 1DV1A 1IZ7A 4Z0PA 4B84A 1QVWA 1X8KA 2OQ2A 3BMOA 4KIGA 3HCBA 1V1JA 4D25A 4EGFA 2HRQA 3ZW8A 4DLZA 1WCIB 4BFWA 3KIPA 2RGAA 4NMXB 2QTFA 5DBGA 4GBMA 3RASA 3U7EB 1JEQB 3PXEA 2WHEA 4TKVA 4RJ2A 1J2EA 2PXCA 4DLNA 1SPXA 1G2QA 3DKIA 3FUCA 1Q0QA 1F2UA 1T5IA 2B8NA 2C82A 5FNZA 4PONA 5JMWA 4XJXA 3KQUA 3UH0A 3R5HA 1OV6A 1POWA 2ZYUX 4OUKX 3QEMB 4LJRA 1AKUA 3NP7A 1JMVA 3AF4A 3G0DA 3QMPA 1OZ0A 3TGWA 1R0KA 4A4DA 1E3WB 4U5XA 4ENVA 1Z2AA 4WZAA 1FS5A 1LPAB 4B5KA 2ZRIA 3GJYA 3USES 2JJQA 3IP8A 1PUXA 2XA1A 3DLCA 5B6JA 1QH9A 2YQ5A 4KO3S 2WZCA 3UW1A 2OGUA 1CNEA 3ENZA 2QX8A 1CUHA 3O4IA 1CR2A 3F5MA 3P9QA 4DCNA 3CUVA 3PD7A 3CLRD 4EA6A 3NBXX 4Y6RA 5DEIA 4EUKA 2O8EB 4IIEA 3LDFA 4R7TA 3QVWA 5ED0A 1I3LA 2DT8A 5HFJA 1C7ZA 1SG6A 4KQ9A 4XAQA 1QDEA 1WMAA 3WZLA 3HL0A 2G36A 4AO7A 4W4TA 3IB6A 4GUDA 3DBRA 1LWOA 1NDQA 1CJSA 5CX4A 1W5AA 3B6JA 3GRUA 3IO3A 3RNLA 1KMHB 1O9GA 4UEOA 2O8BB 4FPXA 2ZBDA 4G2TA 3S2ZA 5KYYB 3T1VA 2C0CA 2QX7A 3OLVA 1DRWA 1ONOA 3H3FA 4N3GA 4R2KA 1OT3A 2J3QA 5C1PA 4LXUA 2I1WA 2X0DA 2GZ3A 5J4LA 5J2UF 5JDCA 4MVYA 4CQMB 3E35A 2YXPX 3AJDA 1RWXA 1ZRSA 3R3XA 2PUJA 2QVZX 5IDYA 1UPXA 2ZIEA 4W1QA 2CGEA 4X1IB 3CVJA 1LDNA 3DFMA 1M8GA 3IPAA 3PPVA 5CEFA 4CEJB 5C7LO 1U0TA 3AV3A 3NAGA 3RT9A 4P7JA 5LUBA 3VISA 4BRWA 1WHTA 1SK9A 2IZ6A 1LNSA 3RT7A 3WDKA 2ZRDA 3UQYS 4ZI2A 4MCIA 3KOZA 4BNZA 3FTDA 1C9KA 1DQNA 4Y2UA 3NUGA 2BTEA 5AW5A 4JXZA 1ILWA 1TEVA 2PLAA 2WDPA 1T5TA 1V2HE 3DJYA 4WBNA 1O0CA 3NBFA 1SXJC 4R3WA 2HJHA 3FZYA 1DL5A 3GDFA 2AVDA 5D6OA 2Q29A 3TAXA 5AJTA 1D2CA 3DEJA 3G9QA 3LHIA 1GPH1 1UKZA 2CBXA 1KDPA 2JHFA 2ZSHA 4P5DA 3H13A 3LQ2A 5DHTA 3D81A 1J0EA 4UKDA 2HK7A 2JF0A 2PXXA 1P2FA 4CUJA 3DE6X 4FCCA 1C4XA 4NZYA 4YCSA 4MHTA 3UG7A 2N75A 1V95A 4JDUA 2QTZA 1GFWA 1RP7A 4LY0A 4XTCS 2JGDB 5IKOA 4D0NA 2MSCB 3BQ9A 3C1AA 4P3XA 1K89A 3IT2A 1FRVA 3EVBA 4O4HA 4O4IA 5JADA 1T1IA 3REOA 1B74A 5MFZA 4LX8A 4I6JA 4M8LA 4C43A 1KYIA 2R96A 4IP0A 2F43B 1FFXB 2XXBA 1RFLA 4IINA 1KC3A 1Z0ZA 4I1OA 4EHJA 5EIWA 4NBWA 2EEPA 3PD1A 1E7QA 1BCRB 1GVNB 1EE1A 4V0KA 4L8GA 1ZW6A 3TQCA 1KEPA 5K3EA 3FMVA 3LDGA 4URVR 4MMXB 2H65A 1M2NA 2VHQA 3O93A 1FTYA 3G8CA 1OH7A 3IULA 3IHLA 4GT1A 3MLEA 4UMDA 2QR3A 2XMPA 4ZOBA 3RFFA 4ARAA 1XIVA 1NSTA 4DV3B 2VBCA 1KSHA 3P0HA 1WWKA 3LAWA 1NVAA 2O7SA 1S2GA 4QU9A 1WZCA 2XUAA 1RFGE 1WKCA 2IYWA 4OXIA 1ZL0A 5BMVB 2PIDA 2W0MA 4Y2SA 4ARUA 2JZOA 3SF8A 4ZC1A 1CUJA 1T13A 5KCMA 5ER9A 4G1MB 3V32A 1IC6A 3FWPA 1SG9A 4P5PA 1R12A 4EITA 3G49A 3OJLA 1K75A 4ZVKA 1F5NA 4NBNA 1R4ZA 1CZLA 1T3TA 4B6JA 4JYCA 1ENZA 4GPD1 4DLPA 1EUQA 3OF3A 4NSNA 4JLKA 4MS4A 4BVEA 1ZFNA 2P90A 4ACBA 2X13A 4ZZ0A 1JEYA 4UQLA 5BW8A 3EFEA 1R27A 2DULA 1MHTA 2WLSA 3LV8A 3ER6A 1LY1A 4N3BA 3WFZA 2XUFA 1G5FA 2YVUA 1XAJA 2VVTA 2IEYA 2BEKA 4G1UC 5LM3A 2SCUB 3QSGA 3GFRA 4LJ5A 3HUDA 3RRYA 2EKLA 4IDBA 4U39A 3VVLA 5KTMA 4B3TB 4LPSA 1ZIPA 4MICA 3SZUA 4BFSA 3C5HA 3CUSA 3C24A 4I1SA 4ZKEA 3PC4A 4E22A 2VH1A 1G8FA 2O4UX 2XCQA 2ZB8A 3DB2A 4FYJA 3CX8A 4UHKA 1M8PA 4BECA 1ECCA 1KI4A 2JVKA 4YAKA 2PNFA 2GZDA 2RHGB 2IWHA 1QIKA 4UEQA 1Y63A 3NDBB 3IHWA 3VV3A 1EVQA 1FZQA 1QFSA 2R3SA 4MWZA 3JD0A 3FF1A 4JQZA 4R40A 2JAWA 1C8LA 5IM4A 3SYRA 3FSEA 2H0AA 2W8BA 1KYWA 1DHRA 3REFA 2VBGA 3KAPA 3CB4A 2DJ5A 3M83A 3RHTA 5JXHA 4ISBA 4MARA 2YV4A 4KK3A 1E94E 2GILA 4R5HA 3SG0A 3WYBA 3O74A 4DJTA 3SN6A 2Q5EA 4REQB 3UY4A 1LD3A 1GEGA 4X1KA 4WL0A 3B38A 1DQYA 2JCXA 3F3SA 4JB8A 3T7KA 4BBZA 2P2YA 4ZYVA 5B4UA 3DYBA 4X6XA 1BFKA 1N2OA 1Z6ZA 1PL0A 5JH7A 1Z4QA 5E7IA 1YQWA 1NMEA 3N8HA 2L18A 4B8YA 1NG1A 4Q1VA 4ZK6A 4FGUA 5B1YA 2QSYA 4I5FA 4KXLA 5JS1A 1HUQA 3A3OA 1ULZA 4G0OA 2GXQA 1XAIA 2ZR7A 4DJDC 3G0BA 3ZOKA 4YQZA 4PAOA 3WGQA 2ERXA 4ZZ2A 1MTOA 3UMBA 1NUHA 3GUCA 3RR2A 2J0QA 4N5LA 1Z82A 4MULA 1HG0A 3B3GA 1IHYA 2YN2A 2GRUA 2JB9A 2OFWA 3JX9A 4FNOA 4OK3A 3JYHA 3RIGA 3U6BA 3O7WA 1EXVA 4XVQA 3U7FB 2JCYA 3W6PA 1RBYA 4LJ7A 5JMTA 1Y4SA 1GRCA 3N76A 5GV7A 4YCBA 3JPYA 4CDNA 2I6TA 3G6KA 2DKFA 3LYAA 3TSOA 1QUFA 1OLUA 5BV8A 4L9SA 1KA9H 4BO4A 4O4HB 4FUTA 1P7ZA 2V96A 4K7JA 1L1RA 2P1DA 2IOFK 1E2JA 2W6CX 3LUHA 5AKGA 3BFVA 3UA4A 1HORA 5HW0A 1G1MA 1RQPA 3E0XA 1DX6A 1V1MB 2H18A 2H92A 4M0EA 1XMIA 2X0KA 1P72A 1DVRA 1J20A 3B1JA 2YV2A 5GMOA 1QKKA 4TLLB 5IMSA 3PUYA 2GF2A 4NXMB 2EDCA 4QSMA 3NEPX 1N2BA 4QQNA 4KP7A 2VJMB 4PWZA 1Z2EA 3T3GA 3FN4A 3SS7X 4TS3A 5HCUA 3LE8A 3X0DA 1JU9A 5ALFA 5AOCA 5T4EA 1OFIA 2ZYIA 4K9NA 3KZNA 4Q1AA 3M5CA 4WESA 3VR6D 2NPIA 3F7MA 2NAPA 1HOXA 1L4HA 3GRYA 1EH5A 5DOVA 2JLRA 1XTVA 3HB1A 1P1JA 2B9VA 3D8RA 4MI1A 4O29A 1DBSA 1E1MA 1RE1A 4I4CA 3OZCA 2PMDA 4HNUA 4OO3A 4UULA 4MVXA 1J06A 4WN9A 3DTTA 2IHNA 3FCCA 3RJ9A 1C9EA 2JARA 1UFRA 2K87A 3Q7QA 3KZMA 3ZYCA 4GVXA 2IIQA 2HGSA 5T41A 4BJHB 4RHFA 4WLVA 1QP8A 2X19A 1SU8A 2J85A 3ADOA 3EVDA 2GYYA 2AYZA 3B1VA 3L49A 3OJXA 1CQIB 4B2PA 5KQLA 3OOJA 2X58A 5A3VA 4FFDA 1AKYA 1PZXA 1HT3A 1Q2XA 3K0BA 1B1CA 4RVNA 3D4OA 4QODA 2ZJBA 1JDPA 3KM0A 4DLRA 4Q6BA 4TS9A 5SY9A 4CF6A 4BGDA 5AHRA 2E85A 1KRXA 3EPJA 1QJ4A 2C9MA 3PI6A 3G2JA 3MTQA 4ZT5A 3KELA 2CMFA 2OORC 1BO6A 3SOPA 3KV1A 2W6PA 4AJ9A 2VYFA 2ABWA 3I05A 4YJHA 1C1XB 1V7QA 3M7IA 5FA6A 3KT6A 5FTNA 1M1ZA 4MROA 1NF3A 5ADUS 3KQHA 5JD4A 2WJYA 3T7JA 4E2FA 5KX5A 4Z3KA 3AKYA 4JB3A 3TLEA 4HZUA 2XOXA 1O0SA 4AWAA 3DDNA 1AQLA 1K1EA 3S2EA 4DYHA 3IQIX 3IQWA 5FQOA 1NW3A 2F3SA 4OHBA 3ITKA 5TMPA 1VP3A 1KI9A 4EI9A 2VJDA 2FK8A 5B6PA 1D1PA 2ZUWA 3PFKA 2DFKB 1GAXA 4BVHA 1N7IA 3LHSA 4R3NA 4XFKA 3ZZNA 5C5CA 5DV9A 3VSBA 5K2OA 3GJRA 2IU3A 3C5VA 3C6KA 1EE2A 3ONEA 5HDQA 5H02A 1EX9A 1UF9A 2CZQA 3OTIA 3EPRA 3QVGB 5FUWA 1PJ2A 4RH1A 3FCUB 5BR4A 4HN2A 1M2VA 2UZIR 2ZSIA 1UPBA 4QECA 1YRYE 4UQOA 4BC1A 4BE7B 3KVNA 3N2EA 2VATA 1KSFX 4R05A 3S2SA 4Y9RA 3CCFA 2RGWA 5LOVF 3HPQA 1LDBA 2FPOA 1XWIA 1ZJJA 2J9GA 4URUR 4NG4A 4UU7A 1KFJB 2OHVA 1E2BA 1AKVA 2VHZA 1E6CA 3JASB 1SEPA 5LIPA 1W30A 3C1UA 3CKKA 1HLFA 3ROPA 1XTKA 1E7WA 4AYTA 3SJ7A 4PAGA 3RVBA 4TYWA 2PRSA 3L1KA 1Q1QA 3N2GB 5AW8A 1KFKB 2YOHA 3GQVA 1BN7A 2Q3BA 2CXOA 3PHGA 3QG5A 4QHYA 4QXRA 4JOSA 5CLQA 4AMGA 5JY1A 2Z2XA 3HZRA 1Y8RB 1XPJA 2RCNA 2V0CA 1Z88A 4OQQA 8OHMA 1D9ZA 2R47A 2JHAA 2V7QA 1DAPA 5CLJA 5LKRA 1CFZA 4MIYA 4HUTA 1YQUA 3MOSA 3FOAA 3VSCA 4CIVA 1I6MA 4RCVA 5HXAA 3HCWA 4JC8A 2C57A 3QPVA 3SI7A 1VE3A 2GLTA 1NOJA 4G5HA 3PHLA 5HK9A 1KSGA 4D4GA 3JVVA 1KE1A 3N8NA 5JJ5A 1ZAYA 4EG5A 3AP1A 2IZ1A 3R4VA 4Z86A 3ET5A 4DC0A 3LYUA 1JT9A 4JLAA 3CVVA 4S05A 3T1TA 4WERA 3RHZA 2PBRA 1R0XA 1B8OA 3A6HA 1M33A 1DBWA 3SHTA 4TL9A 3V6LA 4D3DA 3PWSA 1EBBA 3Q88A 4R7ZA 4UHDA 4YV0A 2OXTA 2YWJA 3MQFA 4MWTA 1ECGA 1E8NA 3GCXA 4XX0B 3ZY5A 4TLAA 3ZCXA 2OCAA 4QTYA 3IT0A 2Y4OA 3K71B 3FJ1A 4TTPA 2LTAA 3WLTA 4YAGA 3O9ZA 1X1TA 1E5VA 1D7OA 1Q1BA 4PAMA 4BAUA 3LLCA 2J9RA 3UJ3X 5BYBA 1L5VA 4LI3X 2OD9A 1YULA 3WK5A 3AHFA 1ZS9A 1BEZA 4X45A 3NM4A 4OQDA 3SD7A 3DVAB 2J3MA 3RIXA 1JEEA 2OOKA 4NBTA 2VEOA 1F8FA 2V0NA 4N1AA 1J1ZA 1EX1A 1WXFA 2CEKA 3KUUA 4UVHA 3QKSA 2H4JA 5EIFA 4BGEA 1Y3AA 4E09A 1OH5A 5BN4B 1OAAA 4B31A 4K9SA 2R4TA 4D42A 3FROA 3K20A 4RM3A 4F06A 2QSZA 4JBNA 4PYMA 2XA2A 1OGJA 3A1VA 3AUYA 2BSXA 4KXWA 2C96A 2OCBA 2D62A 1TE2A 2E6KA 4ZODA 2JGLA 4B46A 2HAEA 3DGFC 3TZEA 1ZQ9A 2G1UA 2GVZC 2HDOA 2RHRA 3E8SA 1UOPA 4OVKA 4TV9A 3PITA 5HX7A 2JLQA 4U0JA 1H2WA 4WT7A 3R6TA 4K9DA 5MGBA 3GEIA 3R8FA 1OLOA 2P9QA 1YBAA 3JQ7B 4EZEA 3U7GA 2QNIA 4CTOA 1W36B 1RJGA 2IA5A 3NTOA 3QE0A 1MLDA 4K0RA 4MQFA 4JT8A 4CMIB 3SR3A 2V7EA 1M1YE 3WGLA 4EB0A 5H7XA 4MLCA 1JGTA 5KDLA 4BRSA 1KU0A 3K9CA 3RTDA 3I53A 1ANKA 3U19A 3CKLA 3L0DA 3EB9A 3IE2A 3O0TA 4PC6A 3T3MB 3UJBA 3LDUA 3BMQA 2AFHB 2JIPA 1O87A 4IDAA 1E9RA 1ZIYA 3DBHA 3ICOA 3GMTA 4DEXA 1WV0A 4CZ2A 4U2BA 2BF7A 3LUKA 3JQGB 2CD7A 3DLHA 1VPWA 1ZOIA 2HMTA 3AMVA 2I7DA 1JFLA 1T4GA 3BN3A 3NANA 3RFTA 2QMOA 3UANA 4HO1X 4BFZA 1MB4A 1XQ9A 1M3SA 1YQXA 4N39A 5D86A 3TEFA 5BWOA 4W5OA 2HU5A 1BIFA 1PS0A 1P8AA 1R8SA 1CUDA 3B1KA 3HWWA 2RHCA 5M3BA 2IS4A 3L40A 3NTRA 2DUJA 4LECA 2Q50A 1SRQA 3FX2A 1MQAA 4QFBA 4I6GA 1SUAA 2DF8A 2XR1A 4ND5A 3LYLA 4MSUA 2FRXA 2W4QA 3AI2A 3TI9A 1PUJA 3UEOA 7AT1A 5JAOA 3A31A 3L4JA 4IGEA 4DBLE 3QWFA 3G3EA 2AA3A 3DZIA 3O26A 4J2HA 3B3FA 2BM0A 3A27A 3R4CA 4WASA 3MHTA 1HQDA 1XLVA 2PLWA 2V8BA 3L5KA 3DZGA 4MZXA 1VKOA 2I8CA 1Z07A 1WA5A 2FSVA 5CTJA 2QQGA 2H2IA 2J3LA 3KXDA 1W88A 3LQRA 3HCOA 4NQZA 2HHJA 3KFXA 1T9CA 1LB1B 2FN7A 3EGXA 3HBMA 1V25A 2F1JA 3Q5DA 4PGMA 5D5HA 5J43A 1X9IA 3C3CA 4DW8A 1VYUA 3QZUA 4ZAGA 4YP1A 1FRNA 1PD0A 3GAMA 2DPHA 2OBYA 5AM4A 4N5IX 3RANA 3VI4B 2ZFUA 1N9GB 4FFNA 3NC4A 4LF7B 4XPIB 3OU2A 4X85A 3H05A 2B21A 4ER3A 1PVOA 4HQKA 4CV0A 3FVVA 1EJ6A 3LU1A 1IHPA 2A14A 3EQ8A 5CVCA 1F2TB 3U44A 2ZSFA 3RE1A 5LP6F 5F9FA 1RYBA 4OLJA 2QKYA 1WLSA 2V9PA 2WJIA 4LKOA 3R0IA 1WMFA 3CLUC 3F4KA 5HP4A 4HX2A 3OP4A 2OR3A 1GU7A 1ACJA 3EGEA 1TMGE 4FEYA 5FWYB 3IAUA 4D9IA 5IBRA 1XMQB 1FXWA 2VP4A 3I5XA 4F7DA 4FMCF 1RYEA 1DC5A 2EZUA 2BBOA 2X8JB 3FG9A 1VQ1A 3AF5A 4EGQA 4H1UA 3KR9A 2ZRKA 1KXJA 1H6AA 1OAKA 3FZGA 2WTNA 3WBFA 4IQ8A 1LVGA 1USGA 2OCDA 4I9FA 5CVEA 1DBQA 3G0OA 4ZI7A 4I5GA 1POXA 2YWRA 2DCMA 2VYVA 3NXKA 3QFRA 3DDOA 2VJQA 3H6HA 4FFMA 4LN1A 1TZCA 4MUIA 2JA2A 2IUTA 4WNCA 2EGGA 3EQZA 3GHHA 4YPOA 2GM3A 4R6XA 5INTA 3EDCA 5T4HA 1OFHA 3DBVO 4B3MB 3OEYA 2WSBA 2ZI4A 4CQLA 4N9QA 4AICA 2VRBA 2H9AA 2HADA 1FLNA 3V1YA 1IWOA 4KVAA 2R8EA 1G66A 5C31A 5TXGA 2VBIA 2XTZA 4C88A 1NX9A 1OHHA 4K28A 3U2QA 3ZXXA 5KQPA 2I78A 3QMWA 9ATCA 3OPYA 4CM4B 4PBTA 2AFIA 4NCNA 3RAJA 1X1EA 1ADGA 2GJSA 3G7UA 4O4LF 5G2OA 2GTIA 2QE7A 4OMDA 1E2MA 4CRWB 2VN8A 4TM7A 3GY0A 5DRYA 1NDHA 4J0GA 2HO4A 2WFAA 2FB9A 2ZEJA 4QBHA 1WCWA 2QBYB 4D4KA 4I7EA 4TTTS 4B34A 1TYZA 2GEFA 3HCPA 2Q3DA 2RI1A 4Y0VA 4PRYA 3B8EA 2C1EA 2D6FA 1EA7A 4YBZA 1NMZA 1PE0A 2AKEA 1FEZA 2FMKA 4LZJA 5I47A 4O3FA 1RLOA 4BTVA 4C2UA 5JSHA 4Z51A 2BKAA 3EIWA 2N46A 1XPRA 1CUGA 4EEXA 3PDHA 1HLDA 4J16A 4LUCA 5DM2A 3VNRA 5BP7A 2FU5C 3CZRA 5EHZA 2OTCA 1DS6A 2M6RA 3TNDA 4PLYA 1A72A 2P4UA 4WCFB 1VP9A 2BKVA 4GX0A 2AOUB 2I03A 2FEOA 3SXUA 2QD5A 3TKAA 2FEPA 3HFGA 4HGQA 1MC1A 3IIMA 4IX1A 4PZYA 4WFQA 4C6SA 3I2FA 1HNXB 1IWBB 1F8XA 1NLYA 1M34A 1TJYA 5TMBA 2DRIA 4XD7A 1YQTA 5DK6A 2V45A 4RTMA 3CR7A 2GSDA 1QSGA 1ZUNB 2IXBA 4IEEA 4QLBA 5M29A 5AVVA 1E32A 1FP1D 3KQMA 4YJDA 3WNCA 1I9GA 4BDSA 4BNXA 1F8UA 1LX6A 1XLTC 2ILVA 3O8DA 3TB4A 4N0PA 1N8NA 4R6WA 4NJEA 3W9YA 4CIBA 1XVVA 1APBA 1BA3A 1TA0A 2BP7A 2QPOA 4L8WB 4DLKA 2J6IA 4V1CI 3DOOA 4LWQA 2D2IA 2VC2B 4Q5IA 1U3CA 2C7BA 2WMNB 4CUZA 2P1ZA 3W4KA 1SGWA 4L07A 4OQPA 2VJPA 1R4MB 4TTAA 2FQXA 2OWDA 5ELXA 2MYTA 2XUDA 3VRHA 3WL4A 4C05A 1JHOA 3T3HA 4C7OA 1W96A 4JLUA 2BHLA 1T8TA 3AFGA 2QTHA 5PNTA 1FC0A 1EQUA 1TLFA 2LE0A 2QNBA 2EP8A 3KUCA 5F3DA 2C2MA 2DTXA 3G2LA 1XTIA 4PE5B 1I7DA 2ZJ2A 3D3WB 2ZUDA 2QTVA 4G37A 3QNWA 4WNAA 3NYQA 1DJNA 1O03A 1W93A 5KU7A 2I6FA 1NW9B 1JKXA 2MHCA 3HPRA 2GAOA 3K9LA 2Q7DA 1U0NA 4EF6A 4PF1A 2IITA 1N3BA 2I8AA 4N0QA 5JLJA 4JELA 3LDHA 2ICAA 1EDOA 5CNIA 2JFHA 4R71A 2FVXA 3E7WA 3EEIA 1LLUA 1I80A 4H3SA 1YJAA 1LK0A 2JLYA 4FYYA 3YASA 1KIFA 1NVBA 1TU4A 3FPLA 2JFBA 1V2GA 5FOTA 3IP9A 3JQAB 2I3BA 4C5BA 2ZJ7A 4RE5A 3R7NA 4ZCIA 4L3VA 4B4WA 5DISB 4DSUA 3U09A 3RCBA 3TRDA 3KZVA 1I32A 2PK3A 5EUBA 2PX0A 4C0LA 5IJZA 1W85B 2IZ5A 4TLBA 3FOEC 3CPJB 3SCZA 4NZZA 2RH4A 3KTAB 4EY3A 2HIAA 1UK9A 1VBMA 4CCYB 1AGXA 5A3QA 4OFWA 2DPGA 2PX8A 1T4BA 3W34A 4H77A 1JR3D 1N78A 2I2DA 3BMXA 2FN4A 2FNAA 4Q3EA 1PSDA 1P3JA 4A0QA 2HJWA 1QAOA 3JU3A 1L8AA 4JROA 3V8VA 2PH1A 2J9YB 1X1CA 1RWWA 3AJ8A 4QXOA 3VI3B 2G7MC 1X87A 1O6ZA 1ZZEA 4MRRA 3VAYA 4G5RA 4AIIA 1U3TA 1GA4A 2G04A 3VOAA 1ODTC 1KF0A 1P1KA 1QZTA 2D7CA 3HNOA 5EJGA 3UJHA 1UQRA 3QLJA 4BP8A 2QE6A 4HXYA 1JBKA 1NQ5A 2V7BA 3QUSA 1UDBA 4Q9IA 1TT5A 4HGNA 4UTZA 4WD3A 4WH0A 4EHIA 2OCGA 2XUZA 3KSUA 5BVHB 1LI4A 1GSIA 2NSJA 4YQEA 5IKPA 4I55B 4NCXA 2E0IA 3DPSA 2A84A 1O4WA 5FEMA 4ODIA 3HACA 3D3WA 1M7BA 2AFHE 3OEHA 3PDJA 4ND3A 3QYAA 4NYIR 4WDQA 3U4MA 4RC9A 1OXSC 3FFBA 3WYAA 1YXMA 4X3OA 3ZWKA 4DWOA 3DDHA 4M37A 3ZR4B 2SKEA 1Z5GA 3A1UA 1VGVA 4GVPA 2ZIVB 2YY6A 1OX4B 1YF3A 1BDIA 1LFDB 1G4AE 4RZXA 3GLHB 3FPFA 4OGGA 1Z3IX 2WB4A 4QKQA 4INOA 5KYXA 2HJGA 3T3IA 4TL8A 1G20E 2XMSA 3PYMA 3MMZA 3R23A 5ALMA 3I83A 3EH1A 4PR3A 2XQKA 4KU4A 5EQTA 1PGPA 2H2WA 4FHZA 4DMUB 3ADDA 3DV0A 4PINA 4B3BA 3DAFA 5HMLA 2ZPUA 2YINC 4QQRA 1IPFA 1GR1A 5BQOA 2G5TA 4FR0A 3IPRA 4NZ9A 3ZZUA 3UCEA 4LVCA 5CK4A 2EHJA 2E55A 3L01A 4RKFA 4HNQA 4O2BF 1UPUA 4YRRA 2PAAA 3UJ9A 4AJ1A 4BB5A 4WJKB 5B36A 2X4IA 2EFJA 1OH6A 3PE3A 1MT3A 2I67A 2Q4BA 2Z3ZA 3C3KA 3IP3A 3KT0A 2CNWD 5CYOA 1N6OA 4KO4S 5FI0B 2PKEA 5C4GB 3NKVA 1RC0A 1Z9BA 5CTAA 1B1AA 1P75A 3I9KA 1PNOA 2D2XA 4TKLA 3RYFB 3B13B 2FEXA 4BZQA 1B00A 2M32A 2O8DA 3U31A 2VL7A 3S99A 2VHUA 3U3RA 3HRIA 5DHQA 4FKZA 3DDZX 3C6MA 4EPXA 1MIOB 1N3IA 1Z17A 4I46A 1AA6A 4LBVA 4QDXA 3FDXA 4U8HA 5DZSA 2EL9A 5DSTA 5E9AA 3CCCA 4AJIA 2A9VA 1YUNA 1DC8A 1J0BA 2C58A 2HPZA 1IUNA 1YU9A 1Z2NX 5CT9A 5JZSA 3PC2A 4RLFA 1U2DC 3GNTA 4OJYA 4Y1EA 4DIMA 2OP0A 1U7OA 1EHCA 3GLGA 1CV2A 2PMWB 1G5IA 3FGZA 1BS1A 3ORQA 3W0LB 1E7YA 3GJ0A 2X2PA 4TMVA 4YXWA 1C7QA 2UUBB 1Q7CA 3CPEA 4CKBB 4QDZA 1XXLA 3WLNA 1M7HA 1C1HA 5BNWA 3TX6A 2ECOA 2DGDA 2HUNA 1HURA 3SDBA 3KLBA 3BTOA 4E2ZA 4DWJA 4KZKA 1FXUA 1LJUA 2QG9A 2BEUB 4JQOA 5B4TA 5KVVA 2ODWA 1E2KA 3LP5A 3P26A 3UT5B 1OREA 1Z4LA 1B6RA 4UTXA 3RSOA 1HK7A 3ECCA 1NI5A 5BN1A 3U1BA 1QR2A 3OTHA 4RBNA 4C78A 1RDFA 5KYXB 4OAOA 3OD5A 1L7DA 4LDZA 3KSMA 2AD1A 3OESA 1NVVR 4R2MA 2V5AA 4DILA 3LGAA 4D9MA 3A1CA 1O2DA 1R7RA 3J81A 1L4BA 1REQB 5HOEA 1FXWF 1RYYA 1XDWA 2WA2A 4IVPA 4JAVC 4OF4A 5FOWA 1MCZA 2IBMA 4UNPA 3NRBA 3SEAA 3SC2A 1GNSA 4I9HA 3ZGOA 5BMOA 4RCYA 3STHA 2FHSA 2ZI3A 2C5FA 3AOEC 4NV3A 2QN1A 1DLIA 3TVTA 3Q8LA 1M9NA 1TT5B 5F1YA 1P9RA 2KMLA 4ZVLA 4LYAA 3REGA 4Q9NA 5JCZA 1S0UA 4BVLA 2WABA 2P4QA 4E88A 3AETB 1W0JD 5E1DA 3I5UA 2NO0A 4EJFA 1OOEA 4BUJA 5CD9A 4RDXA 1OYOA 3GLFE 1XCGB 3HZOA 4PIMA 4NMMA 6ADHA 5AKEA 1AS0A 1HDXA 3D6VA 4XYGA 4ARSA 4RHCA 2Z30A 3X1JA 2ZJ0A 121PA 3IVAA 4GNKA 3UV6A 3KQNA 2D7DA 4HAXA 1N3LA 2DUMA 3MFYA 1PJAA 2XNDA 1YR2A 3GJ4A 3NVDA 2E21A 1UFVA 1NLZA 1BE0A 2IPAB 2ZIGA 1KZYC 4MRAA 4LYDA 4MRNA 4D57A 2AG5A 1A7JA 2TRSB 3NM5A 4E12A 1H1DA 2PBFA 1YUBA 2BONA 2ODPA 2OZVA 1SCKA 2HTFA 1AKMA 1Q21A 3AG5A 4WXHA 5JG7A 1QMGA 4KK4A 3KQWA 3ZQUA 1M54A 1PGOA 1SIOA 1B8NA 2PLRA 3DJFA 3GD5A 2I2CA 2R1VA 2WFMA 4I4NA 4MB0A 4Y9UA 5EE9A 4U7GA 2A9RA 3KKMA 1SOVA 1KPGA 3SHQA 2B6HA 3MB5A 1PDVA 4JB2A 3TUIC 4CKXA 1T3SA 2IDZA 3LPNA 3UFXA 1HM5A 2AUNA 3SS8A 2LXNA 2Q3LA 4H1WA 2O8CB 1D3AA 1UZNA 1MW9X 4C6RA 5J5VA 3N3AC 5JJKA 1FBNA 3MOIA 3RSQA 4HL6A 2ATIA 4HLNA 4MV7A 4R1OA 1CB0A 4D4IA 4G1BA 1D8TA 1DKPA 3JWGA 4OQEA 3TZKA 3N7TA 4RABA 4HKTA 2CXQA 3MERA 3TO5A 3NVKI 3OTGA 1MAAA 3D4BA 4KTTE 4YS6A 3PXXA 4MGKR 3DONA 1J97A 2VP5A 1RRKA 4RVOA 1T4CA 5DGCA 4GOND 5IDWA 3S2GA 4PTZA 4ZT4A 3WI7A 1D5WA 3EFOB 1X80B 3WTBA 5J47A 4PZ9A 1WPRA 5KINB 5KTRA 3G7NA 1Y1TA 2NT3A 3J7TA 1R88A 1NP6A 1S02A 3DGEC 3KKQA 3L8MA 3ZWDA 2VQ6A 1Q20A 4BWFB 1SHJA 4XQ9A 5KAMA 1URPA 1QFJA 4TLCA 4F7WA 5MDHA 1QM5A 1G8KA 4JLWA 5I9LA 3IBGA 4B44A 5K0NA 5KREA 2A2ZA 5P21A 3WL8A 4E21A 3DO6A 5KKAA 2VI5A 3DLBA 1GPAA 4JJAA 4QHTA 3G0CA 3KLNA 5EXPA 4HV4A 1V8ZA 2IHBA 2IX9A 3KVOA 3OPMA 4P4LA 3CLUD 4PX2A 3SY8A 1W2GA 2GD0A 3NDRA 4BQRA 4C0QC 4ZU3A 4E7OA 4X62B 3VNVA 3MJEA 1FRFS 2IOQA 3DXYA 1SKQA 3AW8A 2Q49A 1T8SA 2WJJA 4W8OA 2QAGC 2V3WA 2BGUA 3GLTA 4ZO6A 1M34B 1NA5A 3MPUA 2G06A 2Y9PB 4POOA 2RG1A 2YXEA 1A76A 2B1RA 3B3JA 2ZDHA 4IIBA 4PTLA 2O2GA 3THYA 1FSPA 1BN6A 1EUDB 1EJ2A 1SEVA 1XQWA 2B9EA 2I34A 3H1FA 1SKYE 1J24A 3Q41A 4PNZA 5EQDA 9LDTA 1QANA 1XDGA 1XDSA 3M1IA 1D6NA 3PEFA 4IJMA 4PO1A 2WWWA 4D9GA 1X39A 4Y2HA 1ODCA 2QD1A 2WYOA 5AOAA 3A11A 3ISTA 2JBHA 3QVKA 5LC1A 3LW7A 1LF0A 3HC7A 1N2XA 3LT1A 3PR2B 4UBMA 3KUKA 3PBKA 3TKYA 3EIHA 5CVVA 2AC4A 1SULA 4ZRNA 1C4OA 2ZE7A 2HMSA 1U2QA 5KTTA 1YFLA 2YL2A 1UM9A 4MQ5A 4X3CA 4AD8A 2QBYA 4EFMA 4FFVA 3F0TA 1JQDA 4N01A 1R66A 4CIXA 2IBSA 1OZHA 2UV8A 2JC3A 1THZA 3KCQA 4HDOB 1BWRA 1E2QA 1XB2A 1FE8A 3ODPA 4YI5A 4BNLA 3U4DA 1E63A 1QDUA 4KQJA 4MW5A 4YMIA 4Y3UA 4UJ3A 2AFIB 1DOZA 3AXTA