2IYWA

Shikimate kinase from mycobacterium tuberculosis in complex with mgatp, open lid (conf. b)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
178
structure length
178
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPSPSEAATLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords SHIKIMATE KINASE
total genus 67
structure length 178
sequence length 178
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iywA00
2OFWA 1G6HA 1Z6GA 3K09C 4PHGA 4OI0A 4DEYA 3H4MA 2JLVA 3B9QA 1OKKA 1JJVA 4HAUA 3AEZA 1M1YE 2DBYA 3WP0A 4BPBA 2IYRA 1Z2CA 1CU1A 2V7QD 4LZZA 2B21A 1Z3IX 1GOTA 1KDTA 2ZTSA 2NZJA 1NVVR 4DHEA 2ZRMA 3Q8XB 1AZTA 1D9ZA 2F43A 2V3CC 3PJRA 1HYQA 2ZSDA 3I32A 1IQPA 3O8RA 2WJVA 4LHYA 2RGCA 2X19A 3WMEA 1A4RA 1LF5A 2AD1A 4GP7A 4BLQA 4M1TA 3NHBA 4DEXA 2VRWA 1C4OA 4JYBA 2YKGA 4V0MA 5KOYA 1U0JA 4QRHA 1KK2A 1Q0UA 1HH4A 4P32A 1BMFA 3U7EB 1OHHD 2CVHA 3AP3A 4ESHA 5GVSA 2Z6VA 3CZQA 4Q18A 4KBGA 3I92A 2BVNA 2Z0MA 5HCNA 2CMKA 1WB9A 4V0NA 1N6IA 2VH5R 4A6PA 4CT4B 2Q9AA 4DCTA 4RD0A 2H18A 2VSFA 4D25A 5JECA 2O8BA 1AK2A 3B8HA 3SJBA 4C2UA 3EPJA 4DLXA 1FFHA 5G3YA 3B78A 1OIXA 1TU4A 5JWRA 1WXQA 1GTVA 2QGNA 4AYTA 2WIBA 4IVQA 4DXAA 5G40A 3ZDQA 4Q4HB 3RHFA 3GLHA 4TLAA 2GZAA 3GLFE 2IA5A 1R8QA 3THWA 1YQTA 1GL9B 3QI2A 421PA 3L0SA 2VSXA 5AJXA 3L0OA 1Z6TA 2RAPA 4Q01A 4LGMA 4NYJQ 2HCBA 2NPIA 2P2LA 4Q9JA 4IOMA 5AJVB 3QKUA 4P31A 4RVCA 4DSUA 5J40A 2ODEA 2VL7A 4OHXA 3ZVRA 1YZTA 2Z5FA 4M22A 3R8FA 2AWOA 1G5RA 2WV9A 1NMXA 3LXRA 4EJSA 1RYHA 4RZXA 3SBEA 1VYUA 1ZRHA 2O8CA 2BV3A 4CEJA 4GL2A 1YU9A 2RGDA 1TADA 3JVVA 4MA4A 4EJSC 4YMTA 2MMCA 2G3YA 4PPGA 1HE8B 5JEEA 1SVMA 2VHUA 2D7CA 4RKEA 1XJ0A 2HJVA 3OESA 5TXGA 5J4VA 3RNLA 4D4KA 2SHKA 4V0LA 4A2WA 4A0RA 1Z8FA 4XTCS 1TX4B 4JT2A 3BB3A 3FDIA 5HZHA 4QGAA 2EW1A 3R9IA 4QKQA 1T8UA 4LJ6A 3S1AA 3NKVA 4RD3A 1GITA 3OEEA 1B23P 4NYMQ 2I1VB 2OM2A 1XXHB 4Q4JB 1P73A 1XXHA 1H8HA 2NIPA 5CIQA 1R10A 1RW4A 1T4GA 3BWDD 2OFXA 4DJTA 4Z54A 1P62B 1JB1A 3VNUA 3ASZA 1JAHA 4CEIA 2GHIA 3MUFA 3I73A 1U99A 2VA8A 4JZKA 4BWYA 4KSCA 3MD0A 4JYCA 4IFBA 2DY1A 4ZCLA 4G5OA 5AUNB 1H8HD 3U3JA 1EXMA 1Z22A 4PZYA 4KBFA 1DADA 3IPXA 4LOAA 1NMYA 1Z47A 4LJ8A 4EPTA 4MRSA 5J4KA 121PA 2EFHB 3GLGB 1U94A 1RKBA 1OXTA 4Q7JB 2RGGA 3A1VA 3KL4A 3WYAA 5B57C 1AA9A 3EPLA 2O5VA 2C04A 1LF0A 4JVLA 5C2JB 3KQLA 1H8ED 3GJ6A 3GLHB 3UWKA 3V9PA 3CONA 1J99A 1COWA 3QXHA 4TTQA 1Z0KA 4CT5A 4ERNA 2XTZA 3TIFA 1E4YA 4WZ6A 2FMXA 3R9XA 2WJGA 3W5JA 2ZS7A 3RRYA 3NBFA 5DN6A 4IDQA 2B7CA 1CR1A 2IYVA 4ESVA 3KFXA 3KQNA 2IF0A 3GEHA 3LFUA 2P6RA 2Q3MA 4N3NA 4CDGA 1FUKA 3MJRA 1CS4C 1KI1A 4U7DA 2DYKA 1DVRA 1TQ2A 3QENA 2BBOA 1IN6A 4P4UA 1QDEA 1I2MA 2GBLA 1E2LA 1ZC4A 2HYDA 3P20A 1QG4A 1SULA 2JLSA 1E2HA 1OH7A 1XF9A 4F7WA 2QRNA 1CEEA 2J87A 2AN9A 3EAQA 4US0R 2N42A 2NG1A 2QNRA 1VMAA 3K70C 2PLRA 2CEAA 2XOKD 2AL7A 4YLGA 2A5FA 2QAGC 3S1AB 1H8EA 1ZNXA 3GFOA 1ZVQA 2IEYA 1SVKA 4ARZB 3SFZA 1S9DA 1W48A 4OQXA 4Q4HA 2C8VA 5P21A 2YC2C 4LC1A 4JLMA 2OCBA 3TK1A 2FPLA 4CYMA 1HEIA 2JJ1A 3RSLA 5F9HA 1MO5A 3UK6A 4B3BA 1OT3A 3VQTA 4D4MA 3AVVA 3LWNA 4XOIA 1GKUB 1NJGA 4HSEA 2EWWA 4JBWA 1U0HC 2YWEA 3RABA 4FW9A 2J9RA 2UVQA 1ZD8A 5HCIA 4IKEA 2OZEA 4JSTA 1MRSA 5M04A 3LW8A 2ZRNA 1KJWA 1N6NA 5FFMA 1QBKC 2OHFA 1XTRA 3PEWA 1Q1EA 2RGEA 2ZITA 2ZXUA 2ZR9A 3MGCA 2A5GA 3C15C 3SS8A 1UM8A 5J4YA 1ZUIA 4Q4AB 1W36B 4IVPA 1U2RA 5FOVA 1LV7A 1I2DA 1XD9A 2FA9A 2ZSEA 1VG9B 4B2PA 1SHZA 2F43B 5JS7A 4TMWA 2EWVA 4POAA 5DHAA 1G3RA 3CH4B 5CM9C 1RVDA 5DSZA 1XTIA 1NKTA 3CPHA 4R2HA 3GEIA 1Q1QA 3SN6A 3QPWA 3K0FA 1JR3E 1QHNA 4IW3B 1KTVA 1GRRA 3NBYC 1OH5A 4Q1BA 1W49A 3M0EA 4V0OA 1R0WA 3U3KA 2QT1A 2JLQA 2H92A 1XD2A 1KDOA 3QG1A 2ZYUX 5KNDA 2ATXA 2XB2A 2DFNA 2CDNA 1G7RA 3FMOB 3EPKA 4PAQA 4C0SA 4HDCA 3TSOA 4DLUA 2IYTA 1FP6A 4O2RA 4HLCA 2HF9A 4ZI3A 1ESMA 3C8UA 1US8B 1UBGA 1ZMXA 1G16A 4Q4LA 3PVSA 3RS2A 1IJEA 5FPYA 4DKXA 3P26A 2QORA 2QE7D 3ZJYA 4GRAA 3FOZA 1ZU5A 4PO1A 5EP1A 1Z2AA 1YZUA 1BS1A 3KKNA 5FBLB 1P2TA 2HUPA 4HUTA 4CEHB 2OBNA 2OLKA 1Z0AA 3THWB 2HDNB 3H2YA 1GNRA 2CXXA 2CHVA 3W6PA 3X2SA 2D06A 4Q48A 2HCJB 3AF1A 1G9XA 3DOFA 2PT5A 3A1TA 1N5IA 3THXA 4HZUB 4IOJA 2PCJA 2IC5A 3MWKA 1QZXA 4N1AA 1DAGA 2FU5C 4ZCMA 4ACAA 2PJRA 3TUJC 1CJMA 4IVRA 4B73A 2W0SA 3CRQA 4DDUA 1KI2A 3LO5A 4U00A 3U3MA 2ZJ2A 2QPOA 1P3JA 4PAMA 1P9NA 2J3EA 1KIMA 2NQ2C 1P2SA 1BO6A 1N0WA 4D80A 2GCOB 2GDJA 4LJ9A 1SXJA 1JEEA 2CNWD 1QHHA 1NI3A 2VEDA 1NLZA 3U3RA 3LVRE 2KSQA 1DELA 2DR3A 4GOJA 4Q66C 4RCZA 1II8A 1U9IA 1YRAA 4JBXA 1C1YA 4FINA 2J1LA 1GNPA 1MABB 2F1RA 4RFSA 4NP6A 3SBDA 2IS2A 2ZI9A 1AN0A 4B34A 4F4JA 1CP2A 1OHHA 3RS5A 5H1YA 2VTKA 2W6ID 4Q9HA 1UADA 3QUSA 3RS4A 3IUYA 2NO0A 2YVUA 1W36D 1VCMA 2QMEA 3TGPA 5JJKA 2J0VA 2A30A 2O8EB 3LAWA 2O8EA 3CX6A 1XU4A 2ZVQX 3H84A 4JJKA 5J47A 2ZU6A 1TNDA 3QEOA 4H9GA 1W0JA 2ZI7A 4LCBA 4MGKR 4ZDIA 2VQSA 1F6BA 1T9HA 5IK2A 2F55A 4QBFA 2QTFA 4GNKA 3DM9B 5KDOA 1LNZA 2RH5A 5FUWA 3SJCA 4FMCF 3TUZC 4Q7MB 4A8JB 2FSFA 1O87A 1IHUA 1NSFA 2GEUA 3P27A 1XPOA 4N0EA 1L7VC 1SVLA 1UPTA 1WA5A 1WBDA 4W9MC 5BYKA 3K70B 4M53A 1SXJD 3FMPB 2FG5A 2HXYA 3AVPA 1EWRA 2GCOA 4DT1A 1UKYA 3C7KA 2EFGA 3GJ0A 1G8FA 2IYYA 4L15A 3PENA 2Z4RA 2ZE6A 4C0QC 1HA3A 3CW2A 1M6NA 1Q1BA 1XD8A 5DISB 4JMPA 4Q5IA 4ON9A 1W4CA 2F1JA 4HZUA 4URYR 3CWZA 2CLCX 4Z8XA 1GVNB 4FWTA 2UKDA 3KXIA 1QVAA 3FKSA 4TLBA 3CPJB 1BKDR 4BFWA 2QTVB 5J4HA 3W6OA 1NRJB 3M6AA 2X77A 4QNRA 2V9PA 4DB4A 4AIIA 1UKEA 2H57A 3LX8A 2QT0A 4NBSA 2YOHA 4JJZA 4IDNA 3T61A 1J7KA 4R7ZA 3OEHA 1SXJB 3ZS8A 3K9HA 4EQ6B 2RGNA 3OFND 3GFTA 1YVDA 4DBLC 4TLEA 1IXRC 4M9ZA 1UKZA 4OQNA 2CHGA 2J7PA 5FL3A 3PV0A 1QVRA 2QL6A 3RDPA 5A5GA 3B1XA 2QMHA 3I8SA 1MT0A 3KB2A 2ZRPA 4X8OA 3A37A 3DDCA 2YV5A 1E1RD 1TF2A 1KO7A 1LW7A 2P6NA 3NTUA 2LWIA 3AGQA 3CRW1 1OV4A 4IJMA 3OF5A 4KVAA 4PSVA 5FOWA 5EE9A 4MRPA 1OYYA 5LD2B 3HU2A 4M4SA 1SXJC 3QKTA 4JLBA 3IDQA 4U5XA 1NLFA 1WF3A 2IUSA 2LKCA 1EFTA 4DVGA 4JSYA 1XTJA 5FOSA 4UJ3A 4P0TA 1KO5A 1N6LA 1XP8A 5AUPB 3FB4A 3GLIA 3ZVLA 4E07A 4PFSA 3RAPR 3FFBA 4X8LA 2KJQA 3GLGA 2W0MA 1E2JA 3EIQA 1KMHB 2E9SA 5FI1B 4MKHA 3EZ7A 5UKDA 4DT1B 1G6OA 3F3YA 1K6MA 4JLJA 3T1OA 3ZVMA 2NGRA 1FP7A 5KPJA 1W4RA 3K0AA 5D3MB 2VSOA 1XCPA 4M1WA 3A1UA 4Q03A 4HAVA 1Z6YA 3U7GA 4XSGA 3MLEA 4LJ5A 3KQUA 2QE7A 2Z4SA 2ZPTX 1M8PA 5FL7D 3B2EA 2R2AA 4Z8YA 5IK2D 2JLXA 3ONWA 4FCTA 1T6NA 3N70A 3PFIA 2VHQA 3AF2A 4C0HA 1Q3TA 1T8TA 5BN5A 1UDWA 1PV4A 1A1VA 3GJ3A 1GILA 2A2ZA 1CJUC 1M74A 1VG0B 4URZR 3RS0A 3KKMA 2CCKA 4TMZA 4Q9KA 4AD8A 2P3SA 2C78A 1OIVA 1SVWA 4GZLA 2OCYC 4US2R 3TMKA 4GT1A 1R0YA 5LDDC 2I3BA 5C1BA 2WWYA 2PX0A 3IGFA 4TYPA 2CLSA 2QMOA 3UXMA 3PUXA 2XSZA 4A6XA 1OFIA 4TQAA 2ZR0A 1KMHA 5K8LA 4KV9A 3VKHA 4UNSA 2IWHA 4BZXA 2FDCA 4ZCIA 2FPKA 1Z0DA 3FKSD 1FUUA 2WOOA 1D6JA 4M9QA 4NPHA 4M8NE 4LUCA 1Z28A 1XWIA 3MWLA 3LNCA 2AR7A 4JLOA 5E7MA 3MWJA 1MRNA 3T35A 4O2LA 5KDDA 3A1SA 4URWR 2P0EA 1PUIA 1SKYE 4MDFA 1ZIOA 3KUDA 2AK3A 2ZIAA 2FH5B 2CHQA 4D4LA 2YWGA 1XX6A 1G17A 2XX3A 3EIEA 1E9EA 1AM4D 3MWYW 4LC0A 4RKFA 2OE2A 3WP1B 5IRCD 4TYNA 1X86B 4WBSA 1NNEA 4F4IA 5HKKD 2WSSA 4LHWA 1OXSC 5BW8A 4TQ9A 2BM1A 4EQ6A 4GSYA 1G5TA 5GVRA 2AKAB 2BWJA 4A0FA 4WIAA 3RLFA 1RRCA 1OFHA 2IW3A 1V43A 1E2EA 1XEXA 2ZRHA 3K0AB 3FVQA 2VP5A 3Q85A 2FSGA 1E98A 1U8ZA 5BQ5A 1GDDA 4MGIR 1E96A 3HU1A 3ADBA 1E2IA 4IRUB 1N5KA 1JECA 4UXHA 5EE3A 4DIEA 2IYUA 4EPYA 3QXCA 2FZLA 3WMGA 1E2QA 3OAAA 1DAKA 4ZPXA 5CIWA 1YZLA 2YZ2A 1XPUA 1QRAA 3VR6A 5CB6A 4UQOA 2IT1A 1ZNWA 1DARA 3IPYA 4PQYA 3O8DA 3QQ5A 4NE2A 5SZHB 2HV8A 4KFRA 5H8WA 1TPZA 1TUIA 1NY5A 4BRUA 4UJ5A 1UDXA 4LBZA 5FPHA 2PZEA 4XWOA 2G1JA 2PLFA 3EARA 3HPQA 1E2KA 1IXSB 1FPMA 1N3BA 2GNOA 1US8A 4UXIA 2YINC 4PXAA 2GEVA 3RSOA 2DCUA 2X2FA 3X1DA 4BQSA 4TMKA 4XD7A 2BEKA 4C7OB 4OBEA 2J0QA 2VBCA 2P67A 1VPLA 3K9LA 4PC7A 1P2VA 2R6AA 5FR1A 2IYWA 5DN6D 2HLDD 4YQFA 3BD9A 3KZ1E 3T15A 2FFHA 2GRJA 5EE1A 2XXAA 2G0NA 2DB3A 3N2IA 1XMIA 1XEFA 4DLRA 3KTAB 2BDTA 4D26A 3GMTA 4S35A 5KTYA 1Z08A 1ZD1A 1NG9A 1Z5ZA 1II9A 2O0KA 3B7GA 1GIAA 3W8RA 4NCNA 2FX3A 3ASYA 4O3MA 4FIDA 3VR5A 5BN3A 3FE2A 2B92A 1J70A 1UBEA 1D5CA 4Q1AA 1JXOA 3BIFA 1L8QA 4M21A 3AV0B 3AKDA 2QP9X 4A2PA 1G3MA 3FFAA 5AR1A 4BZQA 3OIYA 4RSGA 4OHZA 2VP0A 4HI0E 5EQTA 4B75A 1N2CE 1NN5A 3LLUA 3L0IB 1XEXB 5LBIA 2OBMA 1ZM9A 5AUOB 1KOFA 2ZRDA 2IWRA 1VKJA 1XJQA 4B74A 4ZI2A 1ZM4A 3CNOA 3DPUA 3LW7A 4QBGB 4NCIA 2OAQ1 2R6DA 1E2NA 3L82B 4ZDWA 3KJIA 2ZRGA 3HPRA 2ZUBA 3RWOA 2BMFA 2QGZA 5KSYA 3B1YA 5EXSA 1EX7A 3AVWA 1RRFA 1U90A 2VO1A 2ODBA 2ECKA 2CJWA 1COWD 2E1RA 5C4GB 3ZVNA 3V4FA 1NVUQ 2WMNB 3QEJA 1GWNA 4Q02A 3CKLA 5GJWC 1R4AA 3KJGA 3CRMA 4UNRA 1XMJA 2FGJA 1VHTA 1G7CA 1LY1A 2H1LA 3M1IA 3KQKA 2XGJA 3AH8A 2JDID 4FI3C 4B6FA 5L3SB 1JBKA 2VLIA 4F4CA 2ZS9A 2KE5A 2R6GA 4RD2A 5L3QA 4MKIA 4Q1FA 1T91A 4IFEA 2O8DB 2JJ8A 4OHVA 4CRWB 4I81A 1HY3A 2ZS8A 4XSHA 4UNPA 3RRNA 3SYKA 3BK7A 1T3HA 1GZSA 1SGWA 3CUEF 4HATA 5B30A 2A7QA 4G0NA 2O8CB 4KFTA 1OE0A 2XXAB 3RS3A 2CVFA 1CLUA 2CK3A 3D31A 5DH9A 3V4RA 1OLOA 3HR7A 1KKLA 1LFDB 1ODFA 4OJKA 4HB0A 4AKGA 3KDSE 3B5JA 4KFSA 3B1VA 4HAZA 3NIBA 2IXFA 3UWOA 1Z6AA 1K5GA 1AS2A 3GLFA 1DTSA 4KI0A 1W4BA 1XMVA 1W0KD 1FMJA 2XNDA 2ZJBA 3CF2A 2WAYA 3GCGA 4JLPA 3WY9A 2GXAA 3QKSA 1DO2A 3EZFA 3U6BA 4M9SA 2ZM5A 1CR2A 3BBPA 3I1FA 4MYHA 3WBJA 2ZRJA 1IY1A 1E3MA 4R2IA 4M0LA 2JLYA 4DCNA 5BXQC 4JS0A 4URVR 1JR6A 1E9FA 3QVUA 1YZGA 4K8OA 1G8HA 2WKRA 4GDFA 3A4LA 2UZIR 1F2UB 3BJIC 1KZGB 1DE0A 4YMUA 2IF2A 3QVVA 2D2FA 2OG2A 1AJEA 3BFVA 3TJZA 2HT1A 2JEOA 4TWZA 2QAGA 4JL8A 1NP6A 1Y3AA 4V0ME 1KZ7B 2ZRKA 4HAXA 4KO8A 5CJPA 3RS7A 2QENA 3EPHA 2VF7A 3H0KA 2NO7A 1MR3F 1G20E 1YJ5A 2LCFA 2YJTD 2QPTA 3AM1A 3HP1A 1KDPA 1Q21A 5DI3A 2GJSA 5KSZA 4KODA 4D81A 2IHYA 3FHCB 2GBLC 2IBMA 2OXCA 5E3HA 5G53C 3SJAA 221PA 1IY0A 1W0JD 1W5SA 1F3OA 3CH5A 5D3QA 3K0SA 3U3OA 4KFUA 1M7HA 1RE0A 4JBYA 1KYIA 1HV8A 4UNQA 5EXXA 4AURA 3U6KA 2ZJ8A 3EZ2A 4DIDA 4LY6A 4QHTA 4KYIB 2OAP1 4A15A 3T5DA 5JSZB 2ZEJA 3IQXA 2XEXA 2CL7X 2DHRA 2OXRA 1NN1A 2C2HA 4RZ3A 2C9YA 5F3WB 2VP9A 4Y0VA 3SC3A 3UG6A 3ADKA 1E99A 1IY2A 3L0PA 3U61B 3THYA 4A36A 4LPKA 2WBLC 2AD5A 4TT3A 4GOXA 4YONB 2EYQA 2DFLA 1M2OB 1J8YF 1A2BA 3VX3A 2O8FB 2J45A 2QAJA 2JCSA 4OQMA 5CJ2A 5LB2A 2IEZA 2W6JA 3FMIA 1PLLA 4Q47A 2W83A 1KI9A 4TZ6A 3AVXA 1EGAA 1ZNYA 2QM7A 4XIGS 1HTWA 5DI3B 2RGBA 4HB4A 4LJYA 2WSSD 4HUQB 3AP1A 3W3ZB 4LBWA 1OFTA 4JKIA 3R7WB 1BYIA 1HT2E 1KAOA 2JJ2A 5L3SA 1DS6A 1TAGA 3EIHA 1LB1B 2VPPA 2V1UA 4GZMA 5LPNA 2A9KA 2BJVA 4LV5B 5IF9A 3T1TA 3AF3A 1RJ9A 3RRZA 1NBMD 2P6UA 1FQKA 2IUUA 3K53A 3RYTC 2OUKA 2ZR7A 1F60A 1E79A 1Q3HA 2DWPA 2Q9CA 1N0UA 4RY2A 3EC2A 5G3ZA 2ZREA 2J46A 1NL3A 4IOKA 3N2EA 4MH0R 3WXMA 1R5NA 3NWJA 2R8RA 4DB2A 1AGPA 2ZJZA 1E2PA 1DBSA 3F5FA 4B47A 3KFVA 1UJ2A 4S2EA 4EIWA 1E0JA 1ANKA 2AX4A 2FJUA 2EVWX 1T3LA 5FPKA 4L8GA 1FX0B 4WZBE 4C0KA 3AKEA 1KK0A 4XVQA 3CIOA 4Q1CA 1OH8A 1YKSA 3IEUA 3BOSA 3WRYC 1NBME 5HPYB 4NH0A 2OV2A 3GJ5A 2HF8A 2IL1A 1RYFA 1Y63A 1BIFA 6Q21A 2BBSA 1Q12A 1NVXQ 2Z83A 4BRWA 1SKYB 2H8KA 3ZQJA 4C0LA 1FQJA 1W2GA 2GCPA 1PJRA 1WBBA 5IHPA 2ONJA 4MYTA 1TUEA 1U9IC 2X1VA 3LA6A 3H86A 4ZDKA 2IYZA 4PX9A 2JJ1D 4RZUA 1JJ7A 2QU8A 5SZIA 1QG2A 4P4SA 4IEIA 4DWJA 1OXVA 3EG5A 4IHQA 4MGYR 3D6TB 1V5WA 1EWQA 1YR8A 5GJCA 2C95A 1N6RA 4FMCB 2CE2X 1ZINA 4EPXA 3VTKA 2OESA 2QMUA 2ZYVX 2G77B 4LHVA 2Q0HA 1J2JA 5FOUA 2B7BA 5EUMA 3AVOA 2B8TA 3GLHE 2YYZA 3Q72A 1J8MF 2NPFA 1JALA 2R6CA 4ACBA 2PH1A 4ZO4A 1MO4A 4LJ4A 4E09A 1DAIA 5CDFA 3TW4A 721PA 3VU9A 4LJAA 1T5IA 5CLLA 4XWKA 2GILA 1ZM7A 2JGNA 1LS6A 1P9WA 3ND9A 2J41A 3THXB 1DOAA 5EUQB 3T34A 1N5JA 1NIJA 3CNNA 3HU3A 5KSPA 4A9AA 4GMDA 3QKRA 3DZDA 4KAXA 1XTSA 4QJ3A 3QKRB 4Q1EA 5SZKB 1PVOA 2QP4A 2WJJA 2F6RA 4G5GA 5FL7A 3IHWA 3P1JA 2YC4C 1KI6B 1N0VC 1X6VA 2A5YB 1VCOA 1W2HA 2MSEB 3DOEA 1KHTA 1AQUA 4OHWA 3X1YA 1ZP6A 2BCJQ 4L9WA 3O8CA 2BC9A 1G64A 2Y8EA 4NTZA 4R9UC 3OIWA 1RZ3A 2OEPA 2KBEA 3E2IA 1KI8A 3FYHA 3LD9A 3BORA 3OIUA 1OW3B 1W47A 1ZNZA 3P4XA 1IN5A 3NEYA 4QXAA 1P2UA 2JA1A 1UEJA 5TB5A 5C46F 3C16C 3TH5A 3CB4A 1GSIA 1RRPA 3AVQA 2RHDA 2BEJA 2Q6TA 1NBMA 1U98A 1GKYA 2QZ4A 2FFAA 3EW9A 4Q7LA 3IIJA 5L3RA 1XEWY 2QA5A 2QRZA 3UIEA 3CRVA 2IXEA 2DFTA 2N1BA 4P4SB 2BM0A 2PX3A 3WNCA 2GJKA 3GLIE 4OI2A 2QQ0A 3C14C 4AC9A 4FWIB 1S9HA 4XWAA 1NJFA 3TSZA 4TLCA 3ND8A 4PO8A 4V0KA 1N6HA 1W0KA 2XNDD 1KAGA 2Q3FA 3QY0A 4I99A 2GXSA 4NDZA 3B60A 4M1SA 3UMFA 1A2KC 4MQBA 3EC1A 3AGPA 3HR8A 3BE4A 5A0FA 1YR6A 2XTNA 2QSZA 5EP4A 3TR0A 1R6BX 2KWIA 5DO9A 4PTLA 3LBIA 3QNUA 2R44A 2ATVA 2R62A 4CVNA 2XZLA 2WWFA 3AVUA 3HJNA 1LTQA 3UKDA 1GAJA 3ADDA 2GVDC 3AVYA 5FUYA 2NMVA 1XB2A 4D82A 4YMVA 4CZ2A 1P9RA 4FMBB 1TL7C 5KDLA 4QGFA 2NTYC 1KK1A 2FZ4A 3EA0A 4WVFA 1XPRA 3OFNA 2FFBA 1VCIA 2V55B 3TRFA 3FGNA 1IONA 2J0SA 4QGGA 3NEJA 4GFDA 2OILA 4C4PA 4WXRA 1IN7A 4PC1A 1XXHE 3GJ7A 4EJSB 4C9BA 4AG5A 4NHOA 2D7DA 2JJ2D 5JHHB 3VX4A 3AUYA 3AB3A 3KKPA 3QXXA 1NKSA 5TARA 4II7A 2AXPA 2OCAA 2BMDA 1E4VA 3PUZA 1XMSA 4KHZA 4NCKA 1AGRA 4C2TA 2JASA 3ZS9A 2ORVA 3K9NA 3IEVA 5JCPA 1Q44A 2J0UB 4TTPA 3BH7A 4TMVA 3BGWA 4TL8A 1T0HB 3O8BA 4TTRA 2V8OA 4BLSA 3IIKA 1R7RA 3ZQ6A 2ZROA 3U60B 2G1KA 3SHWA 3B82A 3K1JA 2ZSBA 3QIAA 2FNAA 2I1QA 2ZRBA 4DZZA 1IAQA 2QG6A 5DYIA 4OKSA 2VP4A 1G7TA 1S8FA 4LYFA 5FUXA 4BLOA 2H17A 4NYIR 2ZANA 4KITB 3ZZUA 2K5UA 1G7SA 821PA 4OK6A 1RJ9B 4G1UC 3MRSA 4B6EA 2DFKB 1ZCBA 3REFA 3B6EA 3L2OB 1OKKD 3MCAA 4LHZA 3WMFA 1D2EA 4AYXA 1ETUA 1SZPA 2D2EA 2RGXA 1C9KA 3JZMA 4TLDA 5C18A 2BMEA 5FH9A 2ZJOA 2H5EA 3DZ8A 2JLUA 4J0QA 3CO5A 3TLXA 3EX7C 3MJHA 3FHTA 1EG7A 1O3YA 1R2QA 2PBRA 4NZYA 3VU9B 5KHOC 5KU1A 2V6JA 5BYJA 2REXB 4TYWA 4XD7D 4AKHA 4OK3A 4HLUC 3HDTA 4LRWA 2CL0X 2VHJA 3FKQA 4BFSA 5L8VA 1TMKA 1E2DA 2PL3A 2EFDB 2GA8A 2C98A 4AK9A 4DSOA 2CCJA 4ZIRA 4TYYA 1N6PA 4N0DA 3SR0A 1XZPA 2DWQA 2EFEB 3MMPA 3K70D 3CR8A 1XTKA 5DIFA 3BXZA 4H1VA 5LD2C 3NBXX 3W34A 4MRRA 2GJ9A 3I5YA 4KLZA 5KNBA 4G01B 2HXSA 4ZDJA 1D2NA 4Q4AA 4DCSA 2GXQA 4LBVA 4RD6A 3SQXA 1UAAA 3NH9A 4OJQA 2OCPA 2PT7A 1F2TA 4TN1A 3TR5A 3TVTA 5JJIA 3LLMA 1N6KA 4L9SA 3PQCA 3NDBB 1NLYA 2ZYWX 4Q1DA 3HYTA 3K8YA 5K8UA 3G5UA 2IXGA 1Q20A 4Q4JA 2KB0A 5TY0A 5AK0A 1QHSA 3ZLJA 1G19A 1CXZA 2RCNA 4BUJA 4QG7A 1EFHA 3Q5EA 4CEIB 5EZ5A 1CF4A 1P75A 5FR2A 2VHCA 1KJZA 5AWFC 2REOA 3GJ8A 4RFVA 4XTRA 3FHOA 3SYLA 1G4UR 2C9OA 4F38A 2JIZD 1ZM2A 3GQBA 4Z51A 1TEXA 1VCNA 1ZM3A 3CNLA 2BIFA 3L8ZA 621PA 5JZVA 2F9LA 1G8PA 3IO5A 1XNJA 2ODWA 4MYCA 1RIFA 4JLNA 1M34E 2RHMA 2WPDA 5B64A 4FXPA 3GJXC 3N5CA 4GPTA 1T0JB 1KI7A 2FPMA 3EXAA 3IHLA 4G3XA 5KNCA 1KO1A 1FMLA 1KI3A 2FSHA 3OIVA 1U81A 1TF7A 3TKLA 4DSNA 4URXR 1XRJA 1G8GA 1JNYA 5CB8A 1CJTC 4QHSA 2ORWA 5FTMA 1A82A 1KI4A 4HLDA 4DDVA 1DPFA 3L8YA 4MDEA 3ETLA 3CZPA 2EFCB 4QL3A 3RRMA 4PQFA 4MITA 1S4QA 1G3QA 2ZJYA 4BASA 1JQJC 2W2XA 4BLTA 4EUNA 4PANA 2O0JA 4R98A 2ZUCA 4A0HA 4KJZA 1IN4A 1ZIPA 2HT6A 1DG1G 3U4QA 3PEVA 4PHFA 3CWQA 4QFMA 4RD1A 4BECA 4DCUA 2G83A 2D4HA 2OBLA 3K0EA 4MGZR 4Q7KA 4UXJA 1MH1A 5E4FA 1II8B 1A7JA 1EX6A 4EPWA 3I4LA 4FCVA 3E5HA 2W2VA 3NC0C 4DDWA 1P72A 3PEUA 3UPUA 1ONBA 2VIIA 4CW7A 3U2QA 3NBZC 3TW8B 4B3GA 1G4AE 5AUQA 1ZYUA 2B8WA 5AJYA 2A78A 4PPNA 3IBGA 3P4YA 2ANBA 1SVSA 3KXLA 3ECCA 2GCNA 3D7MA 3QPUA 3TUIC 4HLQB 4CEHA 1A5TA 3QE0A 1K5DA 4YDSA 2P5TB 4MKFA 2ZE8A 3IBYA 2BKUA 3VHXA 2BBWA 3EWAA 3BFKA 4L16A 2ZUDA 1E9RA 2EQBA 2ERXA 1ELOA 4C0AC 4EDHA 4AYWA 3VMFA 3PG5A 3K0FB 3BH0A 5GADl 3F8TA 1T5LA 1NY6A 4TMTA 2C03A 4JL5A 4NU0A 2IS4A 4UKDA 5TDHA 4BFVA 1P60A 1S3GA 4QBHA 1E32A 3PUYA 3GLGE 3SU8A 3TAHA 3WNBA 3OE7A 4QM7A 4JLAA 2A5JA 4D6PA 4IDHA 3B13B 5E7IA 3W90A 1G291 5KSOA 4GBMA 2CBZA 1H65A 3BH6A 3QF4A 3WBKA 1SVOA 1KSJA 1VYTA 1W46A 1AKYA 1ZC3A 2WHXA 4PC6A 1X8JA 4XJXA 4TYQA 1KY3A 4TL7A 1YHNA 1TU3A 4RJLA 1F2TB 3V00A 2Q21A 5B2ZA 5H68A 3RVBA 1L4YA 1MV5A 4IEEA 3CLVA 1YZKA 5JHGB 1NF3A 4LK2A 2GJ8A 4D2IA 4B44A 4FD2A 2G9NA 1E2FA 1W44A 3W9YA 2GAOA 4M1OA 2AFIE 1G5PA 3QBTA 4JVMA 3VKGA 1YRBA 1VDZA 4P4TA 4W5WA 2XZOA 3PCRB 1F48A 4C0JA 1EESA 1GRNA 1KKMA 3EZ9A 3Q3JB 4A82A 3ZD6A 1DAFA 3BRWD 2O0HA 2J7PD 1FTSA 1U0LA 3QG5A 1KK3A 4DRZA 2PZFA 3GLIB 1YZNA 3NHAA 3T12A 2XZPA 1E1QA 4NYIQ 4QOSA 1VG8A 2JDIA 1HT1E 1WE2A 2YOGA 4IDOA 2GK7A 2BCGY 5HR5A 2F1IA 5JI2E 4LWZA 5FTNA 3GP8A 3WHKA 4BE7B 4C0BA 3I3SR 2ANCA 2IUTA 5FBRB 5FTJA 2FE4A 2QY9A 5JCZA 4B43A 3NH6A 1GUAA 3ZGXA 3P32A 4DLSA 2QUZA 2C96A 3T1VA 3GLFB 4FCWA 5FOXA 2XSZD 5JJLA 1BYUA 2I4IA 3C4JA 1VYVA 4F92B 1EFRD 1S3SA 1NN0A 1I4TD 4MKGA 4CIDA 4DC9A 1EFUA 2FF7A 4Z1MD 4UNNA 2GVZC 3AUXA 2ASEA 1XDBA 2YHSA 1GL7A 1Q57A 4D0GA 4BLPA 2GK6A 4QGHA 1E9BA 1G1MA 1TEVA 2EU8A 2RMKA 2YWHA 2QN6A 4L4UA 1GNQA 4BGDA 1LVGA 4YC7A 5TMPA 1CBUA 5BWMA 5F9FA 4LSGA 2WKPA 4MYUA 1MABA 1HE1C 2D62A 3Q5DA 4Q19A 1EK0A 1D9XA 1W1WA 2NO1A 3K9GA 2J0UA 3WHLA 3VHLB 1UKVY 1E69A 4Q9IA 2GEDA 2VF8A 1KO8A 4O25A 2W00A 4AG6A 3LBHA 3LBNA 4GOKA 4M1YA 1WP9A 5E7JA 2ZI6A 4LV8B 1DAEA 3GD7A 3QF7A 5FBVB 4KYUA 4B35A 3UANA 3J81k 2V6IA 5JMTA 1RC8A 2V4ZA 2C9CA 5JEDA 4LV6A 2QQEA 4B32A 2KI5A 2AKYA 4M1KA 5E95A 3WYGA 2WKQA 2ZRLA 2HLDA 1MO6A 2ZRIA 4PHHA 1CRPA 1JEDA 1ZU4A 1P5ZB 3QSYA 2Z43A 3JZAA 4A8JA 2DWOA 3ZIAA 4YXWD 1NIPA 3I62A 2VHTA 1KY2A 2O8DA 5K8IA 1R0ZA 3W8NA 5FBQB 1QHIA 3QJYA 4I1VA 1TQ6A 1NVVQ 3VFDA 4NONA 3CM0A 2WWGA 4C30A 1RPZA 4NL4H 4LDJA 4L5BA 1E94E 2XJ9A 4NYJR 5FBWB 1P61B 4YXWA 3ZIAD 1ZUHA 4DSTA 5J4LA 3QF4B 3AKCA 3KTAA 1G18A 4DDTA 4W7SA 4RFSB 1NN3A 1VIAA 2ZVPX 1XTQA 3A36A 3OHMA 2O8FA 4R71A 2ODNA 4OI1A 1E1RA 3X1ZA 1KNXA 2XAUA 5SZJA 1D2MA 1SHKA 1IM2A 2FSIA 1CKEA 2IYQA 1CIPA 1E9CA 1Q22A 1TTTA 2W2TA 2G88A 2XITA 5EE0A 1G41A 4KU4A 2WPDD 3ZH9B 1UFQA 1S1CA 4HUQA 2PEYA 1IXZA 1OF1A 2OSBA 1QHHB 1UBFA 1FL9A 3LDAA 1F2UA 1XFAA 3AP2A 4WXPA 2IK8A 3A4NA 3DMDA 3IO3A 3BFXA 4JVSB 3KKOA 3D8BA 1AS3A 4OHYA 4JLVA 1T3SA 4QHYA 1CRQA 4JLKA 1R0XA 5J5CA 1KSGA 3A8TA 5CYOA 2RKOA 1VG1A 1SVIA 2ZSAA 2XTMA 3U44B 1E0AA 2WMOB 4QBIA 2AXNA 4GMXA 3BAFA 2ORIA 4URUR 1X8KA 3Q7QA 4ASUD 4I1OA 2P5SA 5JFGA 2FN4A 1S96A 3ZZ0A 3MSXA 3MFYA 2W6JD 4G5SA 2IHBA 4QC2A 4LYJA 1ZAKA 5FTLA 3DHWC 4PPFA 1KSFX 3IKJA 5HZKA 2AHOA 3UG7A 3KJHA 2ZE7A 1FX0A 4XH9B 4PC2A 3GFPA 3LX5A 4EFNA 3DEFA 4TSFA 4PQRA 4YMSA 2G6BA 3JVUA 4ASUA 4O0MA 4Q9LA 3AF0A 5CITA 3AVTA 1S1MA 4AKEA 4PSKA 3PUWA 2VP2A 2GF9A 1DG3A 2HJGA 1IOZA 2R65A 1U8AA 4OL0A 2ZQ5A 4TL9A 1NG1A 1PLKA 3EWSA 1AIPA 2FV8A 2AK2A 5CM8B 3VAAA 2CL6X 1W5TA 3TAUA 1FNMA 4EPVA 1YR9A 2ZI3A 1G3UA 3QOFA 2ZU0C 4DLVA 1FW6A 3KUCA 4G5RA 2Q9BA 1HUQA 3WYFA 1X1SA 5D3MA 521PA 5FPSA 1E79D 2ZRCA 3U5ZB 4E03A 5EZ6B 1Z0FA 1JAIA 4DLYA 4US1R 4HDOB 4WZAE 2BJWA 4NKRA 2AWNA 4LBYA 3CX7A 4HLUA 4PR0A 1CR0A 1ZW6A 1E9SA 4JKYA 3G82C 4U02A 3ZD7A 2KBFA 3DMNA 2Q3HA 2ZE5A 4E5UA 1BOFA 2QROA 1ZUNB 1RFLA 3DVLA 4LI0A 3KQHA 5KYKA 4BFUA 2N46A 3U4QB 2F3TA 3TVDA 1NSTA 5FPTA 1JPNA 2FOLA 2P65A 1HQCA 1JR3A 4F91B 2GESA 4HYYA 1SQ5A 1YE8A 4Y0AA 2RGAA 4D4JA 1XJCA 5LB4A 2W58A 2FEMA 1NVWQ 1KDRA 3SEAA 4ZV4A 3DL0A 1GL6A 5EP3A 4IOLA 4BFTA 3OEED 2RB4A 5ELXA 1E0KA 1EFRA 2ONKA 2PMKA 4JIMA 1UBCA 2J59A 4G5QA 3CPEA 1XZQA 3CF0A 3DO6A 3G0HA 3VKWA 1GM5A 1DO0A 2CE7A 1FNNA 3AF4A 4A8JC 5K8TA 2WSMA 2IYLD 2C99A 5DI9A 2PJZA 4LYHA 2G0TA 2C77A 3W3AA 4PPQA 5EE5B 5CK4A 4EKDA 4IXMA 3THOA 4NMMA 2WM9B 4A4DA 4CGZA 2IYSA 4EPRA 4Q21A 4DCVA 3U7FB 3DKPA 1DAHA 2XB4A 5FI0B 3UATA 1ESNA 3VR4A 4M1MA 1Z63A 1CULC 1IBRA 1AKEA 4TL6A 2ZSFA 2TMKA 1WCV1 4FN5A 4TT3D 3MG9A 4HZIA 1TQDA 4OQLA 3QPVA 3CX8A 1K8RA 1JI0A 5DGXA 3RANA 1VTKA 1SKQA 2QPAA 4WAUA 2BOVA 5JWOA 2V1XA 4RZ2A 3I8XA 4ITRC 3QBVA 4QJ5A 3HWSA 4JVNA 1CJVC 3FPAA 1FZQA 4NYMR 1N5LA 2R6FA 5L3VA 1R5BA 4K81B 2A5DA 1KJYA 2CK3D 5JWHA 3NXSA 2J5XA 5AJZA 2MSCB 2WWXA 5HE8A 3O47A 1W4AA 4PZZA 4KLNA 4P3YA 2O52A 5F2EA 3I61A 4JT4A 3I72A 1X8LA 2GAAA 2F7SA 4B2LA 1VECA 2O8BB 3H1TA 3NDPA 1GP2A 2QM8A 2H7VA 2WJIA 2ZRAA 4BFYA 2LKDA 4Z1MA 2F1HA 3TNFA 4K46A 2GJAA 1DEKA 2A3RA 3W6NA 2XNSA 3OEHD 1W7AA 5IDVA 3EA5A 3RC3A 2B6HA 5HE9A 4YMWA 5DLQC 4MUAA 3WRXC 4B33A 4QNMA 1AZSC 1Z6XA 1QHGA 1Z07A 2C5LA 2OFOA 2WJYA 3BS4A 3DKVA 3T06B 4DUGA 3SNHA 5JRJA 5KPDA 1MKYA 4PO9A 3B1ZA 1UEIA 3IIMA 3K0CC 2E87A 3NG1A 2ZYTX 4B3DA 4KVGA 5ANRB 3LVQE 2OO7A 1LS1A 4WW0A 5CYPA 1J90A 3BERA 1OJLA 2YWFA 4MRNA 3A4MA 1Z0IA 3E70C 3PITA 5CK5A 1BMFD 3W5IA 2NO6A 3EASA 1BH2A 1TF5A 2GZDA 3QXJA 1G21E 4V03A 4BEJA 1XBTA 1HURA 5F98A 1UF9A 3IILA 2BHRA 3SE0A 3EZ6A 2BKEA 4D0LB 4AY2A 1IJFA 4CF7A 4KSBA 4BFXA 3TBKA 1XCMA 1HQYE 2GXUA 2JAQA 2XOKA 2GETA 2W6IA 3R9WA 3U7HB 3R20A 3SYNA 1E1QD 1PZNA 2WWIA 4Q00A 2WWWA 1ZCAA 4XVUA 3LQRA 5A4JA 4GP6A 4W5JA 5KUTA 1CJKC 4FMDF 4ZKDA 1QF9A 4I1UA 4LYAA 5DHFA 2QBYA 3TQFA 1JXMA 4AI6A 2CJWB 1I4LD 3B9PA 1PUJA 1IN8A 2CLDX 5B58C 3ICEA 3C5HA 1I4DD 3SHFA 1CTQA 3SOPA 1SXJE 1G8YA 4TZ0A 3B85A 2YOFA 3VNVA 2QSYA 1R8SA 3VR2A 2GTPA 1OPXA 3T5GA 3UMRA 2FFQA 3A58B 4AKIA 3UMSA 4B3FX 2FWRA 4M2LA 4PAOA 4HAWA 3B1WA 4PHTA 2GKSA 3U44A 3MAAC 3ZYCA 3F0TA 4LJ7A 3VR1A 4QJ4A 2R9VA 2H16A 3WNDA 4B48A 4OK5A 4JL6A 1AS0A 5FUVA 4P33A 1VIYA 2PCLA 2NOAA 3KB1A 3KXKA 3LY5A 1WMSA 1ZBDA 4M9XA 2RGNC 3RWMB 3SI7A 4GI7A 4AWXA 4QM6A 2OT3B 3OE7D 3A6PC 3NVAA 4I4LA 1Z06A 1JQLB 2WAXA 2GZHA 2ZAOA 3OZXA 4PZLA 5IT5A 2JLRA 5AJWA 4I1SA 4ABYA 1L2TA 2JIZA 4B76A 2WTUA 4X8HA 3FTQA 4MUBA 1P4SA 2QI9C 1M7BA 4LX0A 4C7OA 2WJHA 5JLJA 2QBYB 1KGDA 2ZAMA 5JSZA 5JBQA 1Z83A 4OQFA 1WQ1R 2ZI5A 1TQ4A 1NMZA 2QP3A 1XCGB 4PSAA 1U8YA 1ZD9A 1YR7A 4V02A 4HAYA 3LV8A 4C3ZA 1CR4A 5FOTA 3QXSA 1E2GA 3VR3A 3A1WA 3I5XA 1X3SA 4DLWA 3KKQA 3IQWA 3SJZA 4BLRA 5DYGA 5EJEA 2QTHA 3LXXA 1QHYA 1E6CA 3T1QA 3CRRA 3KJEA 1B0UA 3TSWA 1MO3A 3ADCA 1GKIA 2ZRFA 2X8AA 1VHLA 2V54A 2L0XA 2F9MA 4MRVA 5FTKA 5C4MA 1KSHA 4EFMA 4IDPA 3NC1C 4DUGD 2CNWA 2PEZA 3K0CA 2ERYA 5HKKA 1QHXA 3K09A 4OI4A 5HTKA 5TVKA 3TQCA 2JATA 1OFUX 2DPXA 2HYIC 3LH5A 4X8MA 2BBTA 2X2EA 3PIRA 2WOJA 3R7WA 2UZ3A 1AQYA 3CBQA 4DLTA 1E0SA 4YDHB 1F5NA 2J7KA 4LPSA 3HYRA 1N25A 2AFHE 3CR7A 2VP6A 1GRQA 4OYHA 5JS8A 3X1WA 1E9AA 1KMQA 1KO4A 2JLZA 3KX2A 2PZGA 4B3XA 3TE6A 4KXFB 2FGKA 2FEOA 4EAQA 1M7GA 1OYWA 1II0A 4ZKEA 5TV2A 3ZZTA 2HEIA 1WDTA 4A2QA 1Z0JA 1OXXK 4PC3A 8OHMA 1KI6A 3BB4A 3AKYA 3RC8A 1OB2A 3THYB 3OAAD 2IS6A 1OH6A 3SQWA 1RRGA 1OSNA 1GG2A 4NCHA 3E1SA 1JR3D 3C5CA 1P7CA 1G3IA 4H1UA 5EP2A 2CCGA 2GF0A 1E2MA 3LRPA 5DE3A 1PLJA 1XEWX 5JRZA 3ICQB 4IXNA 3GJ4A 2D74A 3QKSB 1OXUA 4LHXA 5GJBA 3PXGA 3BC1A 2WWHA 5G41A 4ZIRB 5KO2A 1ZJ6A 3Q9LA 1N6OA 4A0GA 5CDFE 3X1XA 1GFIA 1P6XA 3C41J 1YZQA 2ZJAA 4CEJB 1KNQA 2NZ8A 1WRBA 2WVJA 4HEJA 4TQUS 4TSFD 1XD2B 4XVRA 4FMDB 3L43A 5H70A 4F93B 3GEEA 5GJVC 2F3RA 1FTNA 2QAGB 1EFCA 1JPJA 3Q7PA 4RD4A 1Z29A 3PR1A 2JLWA 3D3QA 3DM5A 2D3WA 3CF6R 4B2IA 5DNYB 3REGA 2EYUA 3SZRA 5EXPA 2REBA 2ZETA 3PUVA 2MMGA 3FMFA 2WIAA 3SFVA 4BFZA 1D8TA 4DLZA 3FWYA 3GPLA 3AQ4A 3M4YA 4NCJA 4HB3A 2NO9A 2WICA 4ARZA 1L4UA 2IYXA 4HB2A 2PMDA 4WA7A 5JI3E 3BB1A 1E9DA 2IX3A 4EFLA 2MSDB 1R5OA 2ZI4A 1MOZA 4B71A 4ILEA 5CLQA 1DAMA 5L3QB 4RCYA 1S0UA 2VYFA 4B3CA 4BEBA 4KCGA 2QEQA 1Q1ZA 2XJ4A 2YNMA 5BN4A 3R8CA 2WZQA 4E22A 1OB5A 3SDZA 1X1RA 2V7QA 4A92A 3PEYA 1FOEB 4TMXA 2ZJ5A 4BZPA 4D0NA 2IS1A 1S2MA 4HDQB 4W5HA 2GWHA 3LQQA 4JLDA 1W36C 4A1FA 2OLJA 1OIWA 5EXTA 2BMJA 4WOPA
chains in the Genus database with same CATH superfamily
4H3KB 3EXFA 1JDBB 4U6SA 4D3SA 3FTDA 4R5HA 1XZEA 4GE3A 3H4MA 4EW6A 7ABPA 1JA9A 5FJIA 3P0JA 4N65A 4RLQA 5I5EA 1A8PA 1IUNA 1YGPA 2YRFA 3NIGB 2KMLA 3AEZA 4HAUA 3JQAD 4ZGGA 3WP0A 3PA6A 1PJTA 1FRQA 5KREA 4X85A 4R2XA 3E9MA 3LT4A 1QOQB 1Z3IX 3GUHA 2M6RA 4PZAA 3K1AB 2WJ4A 4DHEA 3AUKA 4XB6B 3PJRA 3I32A 2B4RO 1X1EA 3T9DA 5A5FA 5CFNA 2M1ZA 2X19A 1KZ6A 1MFPA 5K0EA 3QV2A 2A1UB 2AD1A 3DXFA 4GLOA 4DEXA 1DWQA 1C4OA 1ES9A 2AVNA 3OH8A 4CIXA 4QWMA 3FLBA 3RFFA 3RU3A 3DCJA 5AOCA 1D0SA 3TXYA 4DV6B 3OIFA 1WW8A 1KK2A 4E08A 3AW9A 4URHA 5EWLB 3T7RA 4R68A 3AP3A 4ESHA 2BFEB 3AIKA 3CZQA 4MW6A 1JA0A 2EKZA 4IV0A 5J2UF 4WNAB 4WH0A 4FZ5A 1T1GA 1OWNA 5JANA 5JS1A 4H15A 2Z0MA 3DVSX 3WLLA 4MGEA 3LQ1A 1C9MA 1JKXA 1T9GR 4A6PA 1ONPA 5F21A 1A9TA 2Q9AA 4DCTA 2Y4OA 1ISRA 1XE3A 4RETA 1PP4A 3LY7A 5EJ4A 4PLZA 3SJBA 1U8FO 1GAQA 2H1SA 2PUTA 3KVYA 3Q6NA 3G3EA 2VTBB 3JASB 3LFHA 1OIXA 1WXQA 3TNJA 4DXAA 5E3JA 2WIBA 1X70A 4R2WA 4H08A 1U0OC 3A0UA 3HRIA 4XGQA 3FPCA 3P2OA 4KQHA 1DJLA 2YMQA 3G0IA 4TLAA 3HCNA 4QTUB 2CV2A 1VL2A 4UU7A 3QNMA 4BX2A 4C4ZA 4DN6A 1XWFA 1E61A 3THWA 2JLVA 1GL9B 3ZTYA 3RVMA 4M1QA 4BJHB 1KFKB 4YP0A 5AJXA 3AXTA 1GXSA 3QP9A 4JITA 1MQ9A 3FYSA 4Q01A 3HI4A 3QUTA 5A71A 4TM7A 1R8JA 2XCQA 3A9SA 1YCDA 3AG5A 3RUPA 1MF7A 5CB4A 5LNK6 1S3IA 1NUAA 3QHQA 4IOMA 2ZKIA 5GM2A 1R50A 2NU7A 4GPIB 1I10A 4YAOA 2Z2IA 1K1EA 4J7CA 4Y2JA 1L4MA 4DSUA 1QVZA 5BWCA 4I9NA 4LTDA 4UHEA 1YZTA 3PYLA 4ARSA 5BW4A 3NHWA 1BS9A 3UOGA 1QP7A 3E35A 3H2IA 3MN1A 1TT7A 4L2IB 3ZNQA 5HA5A 3IAEA 5I9IA 3T4UA 3TNDA 2O7NA 3ZGYA 5G02A 3GF4A 4LRQA 2UXDB 3LWZA 1P2FA 3JVVA 4RDHA 5LXTB 5JQGF 3RARA 4DCPA 3WB0A 1TM4E 3GJQA 1R9GA 4PPGA 3D54D 3BFPA 2C8KA 2X7XA 5P8WA 4ER0A 1XJ0A 3P9PA 3ZHYA 5LMUB 4IG9A 3KSZO 1CY2A 2YN2A 5CD1A 4A0RA 1IU9A 4XTCS 5IKOA 4K1XA 2VDOB 5JD4A 4JT2A 1SOUA 3FDIA 3JPWA 5KKCA 1PW7A 3R9IA 3UUWA 5TQJA 3NEAA 4EB6A 5LYYA 2YNMC 4JI1B 4BQFA 4LJ6A 1GZ7A 3OEEA 4WKPA 4EGAA 5TJHA 3BE6A 3WYNA 5I7EA 2OM2A 1XXHB 2VJNA 4R6WA 5A1JA 4JC8A 3L0BA 1JG6A 3QPDA 4NULA 1PFVA 1FSFA 3BWDD 2HA6A 2OFXA 5KYWA 4YR7A 1P62B 3UWMA 1TFRA 4RANA 4BLVA 2D1TA 2GHIA 3MUFA 2IUFA 1TLFA 2XD9A 2G4VA 3IQZA 3GMIA 2IBSA 4PW0A 5M29A 1M2FA 4IFBA 3S8EA 2GNAA 2NU7B 4DMKA 2H7YA 4DIOA 2QE6A 3IT3A 2IU6A 3N58A 4B8YA 3IPXA 4LOAA 3HA3A 1FFGA 2JCGA 4LJ8A 3F4BA 4MRMB 3VU0A 5FWNA 1R0CA 5HFAA 2QK4A 4OF4A 1L0BA 3HVKA 3UT5A 5KTSA 1GHTA 3BYZA 2RGGA 3A1VA 1V16B 4G41A 1ECFA 1WDKA 2O5VA 4FDTA 2C04A 1LF0A 1A3CA 1IEQA 1EUDB 1N7IA 3OJCA 3UWKA 4JP5A 1M72A 2OV1A 3L6OO 3L6BA 3ZU4A 3CONA 3LPCA 4ATNA 1COWA 4UAVA 5B4UA 4KN9S 4RVUA 4QEZA 4WZ6A 1AUQA 2WJGA 2WW8A 4N7JA 4TRJA 2NTNA 2P68A 3R5XA 4GPZA 3OE4A 3RRYA 1XIVA 3AUFA 4IDQA 1CR1A 3VA7A 3KFXA 1RFGE 1FC0A 1FCJA 3CEJA 3DLTA 4ZXFA 4MVJP 3RG8A 3KOUA 1Q6YA 4TXHA 3NAMA 2YWDA 2OZVA 4O8ZA 1H0SA 3OPYI 4YALA 1FUKA 1UWKA 3LQFA 3D8HA 2R8ZA 2HHAA 3KB8A 4HFMA 4TUYB 3ES9A 4UC0A 1SRQA 4K6GA 4YIHA 3EPRA 3S40A 1GFZA 3ANMA 5FJJA 5TMBA 3BD7A 4PZUA 5JOQA 2R4QA 4B3HA 3WK5A 2GBLA 2PXAA 2PD3A 2QDXA 4KVFA 2NADA 5AM0A 1EMDA 1QFJA 1ZZGA 1RXVA 3DLCA 2IHVA 4GEKA 1H6DA 4MEJA 3Q0EA 3R0ZA 4TTIA 1BGWA 2NW6A 2WG1A 4G1CA 2PWPA 3SCZA 3DMTC 4FU0A 3AX6A 3U4IA 4HXGA 2XHZA 5G4KA 2J09A 1CEEA 3E0XA 1V8DA 3EUEA 4V39A 2JRLA 2QNRA 2R68A 4ZC1A 4QZVA 2ZWOA 4MVYA 3QU9A 1Y37A 2CEAA 3VZQA 2AL7A 4ENRA 1A9XB 2E7ZA 5IAJA 1AV7A 1RCTE 2GYVA 3DVRX 3H5NA 3GFOA 2Q62A 3SY8A 1HG1A 1WMEA 2NWQA 4HGZA 4RYDA 1CUEA 4BKQA 4Y30A 5B6PA 1TZBA 2C8VA 3RIEA 4L4XA 2IYFA 3IIIA 3UMJA 2YC2C 4EBBA 2OCBA 5A4KA 5HJEA 4N8SA 3TK1A 1LX6A 5JAUA 4NFSA 3PPWA 4P86A 4D0SA 2CWDA 1QRTA 1MO5A 1GA6A 1OT3A 3O93A 3FYDA 3OIGA 3R5KA 4Y2XA 3M82A 1HDCA 2HJHA 1T8SA 2XYHA 2Y99A 3FOBA 3PBKA 1NJGA 1U5BB 1EX9A 1JDSA 3IQHX 4HSEA 1ORTA 5B6IA 2QTWB 2YWEA 4CV0A 1DEXA 4MJ3A 4R1UA 2J9RA 1JFFB 2UVQA 3RABA 3HJUA 3HHPA 2BAGA 5HCIA 4U2FA 2QZ9A 4AX4A 3BMQA 1QQBA 3IOBA 4JSTA 1PWXA 4Z0HO 3LW8A 4IUDS 3RBAA 3C8ZA 2JJYA 1DOHA 4DWVA 5LU8A 4RA6A 1UC5B 3KQPA 4QPNA 2OHFA 1XTRA 4D5GA 3VZSA 2ZITA 5JAHA 2ZXUA 3P4UA 4X6UA 4DMGA 3P8ZA 2O20A 1M6VB 2G67A 5ECYA 1U2RA 1HDYA 1LV7A 3GT3A 2CZQA 1G60A 3QFHA 5FNVA 4FUQA 4MMXB 4LZJA 1E6KA 2Q5IA 2ZSEA 4RX1A 1VG9B 1LNQA 3VUEA 4J1QA 4ZOQI 2JFYA 5JS7A 4TMWA 2EWVA 4POAA 1YQEA 5DHAA 4B80A 3FCAA 5DSZA 2DQSA 4OJNA 1WWKA 3QPWA 3K0FA 1GPDG 1M34B 1QX3A 5LNK1 4QG3A 5ICCA 1X1DA 3OSZA 1GRRA 3NBYC 1M67A 4N6OA 4Q1BA 2C2KA 3WVNA 4F0JA 5CLJA 1E5VA 4EUKA 4W5RA 3H5VA 1DJPA 1R0WA 2LP4Y 5EESA 3ZHXA 4PYKA 3WDSA 2Q5EA 4KR9A 1KDOA 2ATXA 1F8XA 1MFZA 2DBZA 4UPEA 3EPKA 3G5TA 4QOJA 1ZCFA 4PAQA 5FLKA 1V8BA 2RBKA 1RWMA 2F62A 1Q7RA 3AR6A 1HYHA 1ZH8A 3PFFA 1A9YA 1ZA2A 4DLUA 4Z4IA 1E20A 3D1VA 3G2LA 4IGKA 5ESDA 3ENKA 4WEOA 3I3OA 1M6EX 4ZI3A 1ESMA 5G0VA 2JD2A 2EBHX 2PSDA 4MP3A 1AC5A 2IVZA 4WKNA 3FSGA 3CEMA 4I9HA 5FPYA 2VOJA 3E7DA 3TMYA 1OC4A 1GT6A 1T1EA 2QORA 2ZIZA 2GN2A 3L9WA 5ALIA 3WL6A 3VDNB 1ZU5A 2GYYA 3KEFA 4HRVA 4LYDA 1FP1D 4Q3EA 2ZDHA 1Z2AA 2W5UA 1P2TA 3ZC3A 1P18A 1P44A 3GNSA 1HSZA 2NTEA 4QULA 3K9FC 3E58A 3H2YA 4WQMA 2CXXA 2CHVA 1QR6A 1EVKA 1XAHA 2D06A 2HCJB 1ILEA 3DMFA 4E30A 2C5FA 1M2KA 3RSGA 1EBUA 1Q6ZA 4J0IA 4QEKA 1RRVA 2JH9A 1Z7GA 5AXDA 2UZ4A 4IVRA 2W0SA 3A6JA 1KS9A 1KI2A 4N9QA 5LZ5A 5TS2A 1Q7TA 2QPOA 1YH3A 3LYLA 4XKJA 4P7KA 4PAMA 1P9NA 5I7AA 1SR8A 5C4IA 4L74A 2NXEA 1BO6A 4MB2A 4P1ZA 1ZITA 5DTMA 3VYWA 4BNYA 2C7QA 1M8JA 1VFPA 2CNWD 1QQ7A 3DE7X 4H7FA 1OLUB 2B36A 4HK4A 4KQ2A 2PH3A 4M8SA 1SXGA 2I4TA 3LVRE 2V65A 5KQRA 3OTIA 5IF9A 2PLWA 1YMQA 3O1IC 5DYNA 5TVGA 1NBWB 3QPBA 3NT2A 4FBMA 4GOJA 3TL6A 3WK4A 4FINA 4NZNA 3K1AA 1GNPA 2IS2A 5SYMA 3E81A 3SEQA 4BX0A 3HB0A 1BC5A 4L8VA 5FORA 3UHAA 4CWAA 4F4JA 3RS5A 3DNFA 4LOHA 5T4BA 3ELYA 4F72A 1KU0A 2O6LA 4D9KA 2YN4A 4HBGA 1XZFA 3I8OA 3KVNA 2XMCA 4KZPA 1VCMA 1G1AA 5JJKA 3PXAA 1H0HA 3C45A 3CX6A 4X3OA 2R7KA 2ZVQX 3F46A 3H84A 4XGNA 5EZQA 4ZZ2A 5HUQA 4H9GA 1X38A 4ZAGA 2ZI7A 3EDQA 1F6BA 2MINB 4DV5B 2UYOA 3MMSA 1UXOA 3T7AA 1L4GA 1EZ4A 2QTFA 3H16A 4O2AA 1LNZA 3WQSB 2FSVC 2RH5A 3SJCA 7AT1A 1BDIA 1V7ZA 4YUXA 1QE5A 4TRMA 1GQRA 3B1KA 1G9SA 3KKLA 5K9ZA 1L7VC 3R7DA 1ZD3A 4IIUA 3K30A 1F6DA 4MVJE 2X6TA 3URMA 1EFLA 4F9EA 1SXJD 4AG3A 1YBAA 2FG5A 3ZDXB 2HXYA 2WSLA 4ZAWA 3BXPA 3D4IA 5E38A 1DFHA 1X7HA 2BE7A 1R6DA 2XMPA 5TQ2A 3C7KA 2EFGA 3GJ0A 1DKNA 3EXHC 3U3ZA 1T9GS 1L9KA 1JKFA 2B8NA 3CMCO 4P08A 4OQQA 1L5SA 3TDKA 2CJXA 3CW2A 4GKAA 2JI6A 5HHTA 1Q1BA 4EFKA 5DISB 3JR7A 1I1QB 4B46A 1RWWA 4URYR 2G1UA 10MHA 1GVNB 4FWTA 3FZGA 4GOMD 3V2HA 3EVEA 5FEUA 3EEIA 3CPJB 2QTVB 2LCQA 1O54A 1O97C 1VC2A 2OPBA 5EG5A 1N7JA 3QOWA 5T8KA 5AVZA 3KG2A 3DD1A 1KJIA 1UKEA 2X13A 4FB5A 1KEPA 4Z9BA 1V2GA 3N3BC 4IMRA 1NE2A 4JJZA 1GTJ1 3T61A 1J7KA 3HUDA 1ZCZA 1PSZA 1SXJB 3COZA 3ZS8A 3K9HA 1ISSA 1Q1AA 3GRCA 4EQ6B 4GL4A 4BKUA 5TGZA 1U9YA 2WZDA 1P5FA 1IXRC 2DPHA 2WI8A 1E3LA 1C8LA 3PHLA 3Q3VA 4OQNA 4ZOLA 2HRDA 5AYVA 1UJMA 5C5EA 5AQEA 5MGNA 2WF9A 2I0FA 1U7UA 5BT8A 4AQDA 3I8SA 3N1UA 2EZ8A 4DOMA 3KB2A 3I28A 4IBOA 1RP1A 1VL5A 5EVCA 5CG1A 4G65A 1QP8A 1OR8A 4NECA 4OXQA 3EJ6A 4GQIA 4KXYA 4BQOA 3GZNA 3AGQA 1OGJA 3TZCA 2DERA 3O8OB 3B1JA 2QVGA 4I4IA 2H7CA 1OVGA 3V4ZA 2GWRA 3A6EA 3CEAA 4OQEA 3WAGA 3WSWA 4O08A 4M4SA 4LKRA 5IVIA 3RVRA 5JBNA 4PNZA 2P9JA 3R2JA 3PXBA 2QVBA 5IABA 3ONFA 5B2FA 4JSYA 5IAAA 3TM4A 3P2KA 4ZYTA 1KVQA 3D7RA 3AWIA 1LSSA 4UJ3A 4EKYA 4GX0A 3LVBA 1NVMB 1N6LA 3FB4A 4RXMA 1TTPB 3B12A 3I6ZA 1VBKA 2ATCA 2C0CA 4WOBA 3UAGA 1I30A 3SZRA 3ZVLA 2O23A 4DTCA 3Q7RA 4UBJA 1RADA 3M5PA 3PFGA 2W0MA 3VC1A 3EIQA 2ON6A 2E9SA 2VJPA 2I54A 1EWTA 3OQJA 5FI1B 1K4KA 1LDBA 1V1RA 4ZU1X 3AINA 1K5PA 1SC9A 1U2GA 3OUZA 2JFGA 4BB0A 3F3YA 1L7MA 3KYBA 5TQ2B 4B4UA 3T1OA 4ER6A 1QYRA 5SY9A 5JYEA 4MINA 1CUIA 3ZVMA 3KWFA 4NXNB 2FRXA 2I87A 1T2DA 1TAUA 4O4IB 5KPJA 1UODA 2R1TB 3GDFA 5D3MB 4MWOA 3U56A 2E6KA 3B6KA 4HAVA 3FBGA 4JT8A 3U7GA 1O96B 2VQDA 2DTEA 2JFVA 2ODPA 4LJ5A 2QE7A 2Z4SA 3ADPA 1JMYA 2AOTB 4TKLA 1RKVA 4W7IA 2QTTA 4JQCA 5ES3A 4WZAA 3DZHA 5FL7D 4Z8YA 3GPCA 1YAHA 4GW3A 3JD4A 4EEZA 4COKA 5BN5A 3ORHA 1T8TA 3H5AA 1PV4A 1A1VA 4YJFA 1V3UA 4GS5A 3IBSA 3JZFA 2A2ZA 4S1OA 4M6WB 2B5VA 4F85A 2GMWA 4AP6A 2XE7A 2JBAA 3JQGA 4Q9KA 2P3SA 1H69A 1JDPA 2CEKA 2CMFA 3N28A 4GZLA 2OCYC 1BDBA 4GOOD 4LVCA 4N4AA 4ERXA 1YDGA 4H35A 1RWKA 1TAQA 2I3BA 3HKDA 5J43A 1SIBE 5C1BA 1H3EA 1T5OA 4OPMA 2N75A 3HY3A 1I4OA 1TYBE 4AF7A 3QFTA 1DJOA 2PT9A 1HI9A 1Q0PA 4ZCTA 4KE9A 3IXQA 1M66A 1KQOA 1JVBA 1PZEA 1SZDA 4MUFA 5HKOA 1NXOA 4KV9A 4X63A 1R15A 3VKHA 2EG5A 5AHWA 4Y6LA 2BR4A 1Y82A 5DNEA 2IWHA 1Y4UA 4BZXA 1Z0DA 3E2PA 4X20A 2WFAA 2W2LA 1B1CA 3K72B 3L49A 1XTUA 2IU3A 1V6SA 2PH5A 4FOTA 4BTVA 3HM9A 2O1XA 1OXMA 1RWXA 1XWIA 3EIWA 3FNQA 2Z6UA 3CTMA 3L0CA 1FP4B 2CSXA 5KDDA 3T35A 1MRNA 3PE3A 2VUSA 3BA6A 3OUUA 4O2LA 3OQOA 3BWXA 4URWR 1RQ7A 1PZGA 2P0EA 4FJ1A 4R8RA 1SUWA 1SKYE 1EJ0A 4ARAA 1NW5A 5TPZD 4MDFA 2F48A 1T2CA 3H9EO 1EQ2A 5PNTA 2CHQA 5I9LA 1VZ2A 4K9NA 5IRCD 4RKFA 1L7DA 1AM4D 3W2GA 3WP1B 4C78A 2F3UA 3ZNOA 1JIJA 3OTOB 1O08A 4F4IA 1DRUA 1H6AA 4UVIA 3KJXA 5CW2A 1HG0A 4LMPA 4JV5B 4WERA 3MW8A 3CIFA 1L5WA 2R97A 2AKAB 2BN4A 4RFLA 2OPHA 1ZWKA 3D3EA 4N03A 1V43A 4X6LA 2WFLB 1XEXA 2ZRHA 2ZQYA 3F78A 3LUCA 3IP5A 4QUEA 5FTWA 1N78A 2P4HX 4UVHA 3V8QA 3X1MA 5I9BA 4K9OA 3CJQA 3GQVA 3I23A 4BP9A 4AS1A 1GPLA 1KQPA 3WL5A 1JECA 3DV2A 3RIGA 1WL8A 5K0NA 1GQYA 2CC2A 3EIOA 4WXYB 3WIUA 4ZPXA 5CIWA 5BN5B 4F71A 4KRYA 1V3TA 2P7HA 1XPUA 1HMYA 1ARZA 1QRAA 1YUMA 5CB6A 3GLQA 1GT91 2IT1A 2PU5A 1AK9A 1B6TA 2N1MA 3GFSA 1PL7A 4RF2A 1EVJA 3K6RA 1MOSA 1RAGA 2FRDC 3B3GA 4KFRA 1TPZA 1TO2E 4TWIA 2ZIEA 1AVTA 1X7ZB 3DMHA 1U1CA 1WY7A 2PZEA 1V6AA 3LZ6A 1UPCA 2PLFA 3EARA 4FEEA 5EWMA 1E2KA 4RMNA 1IXSB 1FPMA 1MCZA 1X87A 4UXIA 4P38A 4C87A 1ATZA 2C31A 1LFAA 2GEVA 5FI3A 2FUCA 3EMBA 1YC2A 2J6CA 2BEKA 1U2PA 3V8PA 2J0QA 3ENNA 2I62A 2P67A 1Q0LA 2Q6IA 4TLMB 1QTQA 3LECA 3ZPXA 1GUDA 3UV6A 3T1HB 4KHPB 3KZ1E 1LRLA 1Y5IA 2FFHA 2VPIA 5T6BA 1YS2X 2XXAA 2G04A 3N2IA 1XMIA 1KQGA 2DWCA 5T41A 5IFKA 1A4IA 2AQKA 5C52B 4LKOA 5CA1B 2QVLA 1QZTA 2ES4A 3LKVA 5C80A 3G9QA 1E92A 2UUPA 3H05A 5CFMA 4G97A 4XSVA 1NG9A 5I7OA 1FXWF 2Q2WA 3T8YA 1II9A 1PO7A 1IOLA 3B7GA 3WO1A 3K9CA 3VVLA 2G09A 1M1NB 1KAEA 4F60A 3BMNA 4P7JA 3F3SA 1QRRA 5DGTA 4FS3A 2B94A 3VR5A 4J6FA 2PRSA 3FE2A 1J70A 1RWBA 3FJOA 2TS1A 2BHLA 3QU7A 4Q1AA 3TI7A 2QVXX 1EI9A 5E2IA 2KLBA 2K7FA 1SOAA 3C3XA 2V8BA 4CODB 1GTMA 1X0VA 4PSCA 5H3HA 3RFUA 4DMCA 4Z6KA 3OIYA 2AI2A 3HVHA 1UBJS 5ALJA 5KDOA 3PDHA 4HI0E 5H02A 2P6MA 3HLKA 1N2CE 4YQYA 3LLUA 3STHA 4B75A 4LTNA 2G5PA 5LBIA 3MBIA 2AFHB 1AX9A 4UUBA 2R3SA 5AUOB 2ZRDA 2IWRA 2GD6A 3MTBA 2OHGA 4WK2B 1T4BA 3DPUA 3N0RA 4TOIA 1AHNA 3GDWA 5BN1A 4MEBA 4NCIA 5EPOA 5B3AA 1PSDA 4ZDWA 1ZSNA 2ZRGA 3KD3A 5H4HA 4PU0A 1HL7A 1H2BA 2P1DA 3OLVA 2BMFA 1QK3A 4I6JA 4RY0A 3M81A 4IICA 1Y4SA 3KT6A 5KSYA 4FCCA 1EX7A 4XIIA 3QKIA 2FZVA 4FFMA 4EYKA 5MFPA 3DQPA 1UJ6A 1GV1A 1QE0A 4LVUA 3ZU3A 4BYGA 5BR7A 2ZT7A 4Y8VA 1U7DA 3QMPA 5C4GB 3IT1A 1QH8A 2K87A 1U11A 3JW8A 3MS4A 3QEJA 4Q02A 1BXGB 4LHSA 1QQ5A 3SIXA 4B09A 3IR7A 3ZDRA 3CRMA 4UNRA 4W82A 3LUPA 1KL7A 4OXXA 1MQSA 1VHTA 1PX2A 1LY1A 1DFIA 3AH8A 5CXUA 2JDID 3HCCA 4HGYA 4JX8A 4FI3C 4ZCRA 4F4CA 2KE5A 3AONB 4Q1FA 4ZEXA 5HOEA 4IFEA 2J67A 1FTGA 1RYYA 3CNBA 2JJ8A 3JVIA 3B1FA 1HY3A 3U40A 2ZS8A 1HF3A 3DFMA 3DMPA 5FRDA 4EB3A 3BK1A 3AEUB 4I1IA 5KAMA 1GZSA 1LRJA 1OI4A 1SGWA 1T26A 3V2IA 4EABA 5ENZA 4MV4A 2MOKA 1TVMA 3LOPA 4RV4A 3UJ8A 2P5UA 4DDMA 1OE0A 1UQTA 3GROA 2XXAB 1CLUA 2CK3A 1CCWA 2ADMA 3D31A 2X0EA 3QYAA 1A8IA 1ODFA 4OJKA 4K6FA 2PPVA 5K8JB 4FFRA 2FSSA 3G0CA 1E59A 4HX5A 1M2OA 2E49A 4HAZA 1WHSB 2GBIA 4F3YA 3GLSA 1Z6AA 4QUGA 3UWOA 4OGWA 5KYUB 3VDRA 2ZJBA 3LPAA 3WY9A 3IAM1 4FHGA 1QPGA 4JC4A 3TOCA 4G5HA 4WBNA 3EN0A 1DC6A 2VF4X 1X9GA 2WHPB 1HGXA 2QHXA 4GG1A 3EYAA 4BS9A 2H8GA 1GCGA 3BBPA 3IBFA 3O0TA 1F3LA 1Z5GA 4RLSA 2WNSA 1OGIA 5KAPA 4LGVA 5TNXA 3K5WA 5C8YA 1F0NA 5ED0A 3TRKA 5CD9A 4EX7A 4JLUA 5IKXA 2WKRA 3FF4A 4DADA 2UZIR 2GN4A 3WZ2A 4YMUA 4ES6A 1CX9B 2D2FA 2ILVA 1RQGA 2IJGX 3LYAA 4NEQA 1FLVA 2HT1A 5GZ3A 2OHIA 3R41A 4D3ZA 2H4WA 2UUOA 5DF1A 2TECE 1T6BY 4CM9A 1DDIA 2R86A 2FOIA 5AW6A 2FPSA 4RSMA 5H9WA 2QENA 1FUEA 1I2AA 3CLTD 2VF7A 2WIFA 3H0KA 5JD3A 1BS2A 1HK7A 3NRJA 1MR3F 3T4PA 4UPDA 3IP1A 3LE8A 4ZZIA 4PEVA 1UQRA 2X6QA 4KDFA 2CFIA 3I64A 3QIVA 4RORA 5A05A 1B8VA 3EDOA 4CHTA 5KSZA 4KODA 2IHYA 2XUIA 3FHCB 3SDBA 2IBMA 4RC9A 4K3VA 5E3HA 5HM6A 5G53C 4C0WA 2PN1A 4TPKA 5CNKA 3UCFA 3ETDA 4FS8A 3H99A 4HEHA 1L4EA 2IHTA 5K0LA 1ADGA 4FWBA 1I7PA 2OOSA 1RHMA 5J2UB 1LLQA 1NMQA 2P9CA 2Y1OA 2O59A 2Q5JA 5HK8A 4OUKX 2COKA 2G5TA 1TT5B 3EZ2A 3JQ7A 1V8FA 4QHTA 2Z2YA 4F2PA 2X0FA 1UPXA 1WB6A 3L4SO 3Q9UA 4HDMB 4F8EA 1EDZA 2Q5OA 4REQB 4A15A 2QXTA 5FV4A 1TTHA 5CFLA 1JEYA 1Z56C 4AZ3B 3L4BC 4ESOA 1P74A 3KKKA 2VYVA 3IV7A 4LHEA 4LVOA 4RZ3A 3TW0A 3V4OA 4MQ5A 4ZJZA 3NGXA 5F3WB 4GDMA 1WVMA 3L0PA 2PBFA 1CDZA 2RFLA 2YASA 3VH4A 3B7PA 2AD5A 1FSPA 1YQDA 2EYQA 2G9VA 3CUSA 3G0GA 3HDHA 1W88A 4IJVA 5B37A 4DLKA 1JHPA 1QRUA 2VNIA 2BH2A 4OQMA 2XGOA 1KPGA 4RH1A 5EGSA 3H1AA 1DOZA 2Y93A 3FW1A 1KI9A 3T52A 2L82A 4PN7A 2VAPA 2C9DA 3AVXA 1VRWA 2A1TS 1EGAA 1ZLYA 1XLTA 5JAZA 4P0PB 4KQCA 4RA9A 2UXBB 1HTWA 3GMDA 3LXMA 4FUTA 4KMRA 2RGBA 3C6MA 3J80A 2QW1A 3AY7A 2WSSD 1Z2PX 3G2KA 3AP1A 3OZUA 4EITA 1QLWA 3CLUD 4WINA 4D44A 3MFQA 1GLNA 2GJ4A 4PLYA 2WINI 4JI5B 4Q1VA 1KAOA 2GAIA 1BZYA 2VNSA 5J23A 2XCTB 3SQLA 1DS6A 1D2CA 3TBHA 4UBMA 1LB1B 5LYJA 4X7RA 3IKVA 4BIMA 1OU4A 3I83A 3D6UA 5LPNA 4MUEA 1VMKA 4I3GA 4PIVA 5CDUA 4NOLA 4DR1B 1T24A 3LFTA 3N05A 2XCRB 4B6PA 2JZNA 1FQKA 2PL1A 5KYXA 3K53A 4GLFA 2ZR7A 4L5AA 1PNQA 2HPVA 7ADHA 1T5HX 4UUMA 3SSMA 5CDHA 3MHPA 4IOKA 5CT9A 4MWEA 1FRFS 1H2AS 2A94A 1R5NA 1YA6A 1JIUA 1XZHA 3NWJA 4LDNA 2R8RA 1AGPA 1JHZA 1YB7A 4KIUA 5CDSA 4BL5A 3F5FA 3JS5A 1BXGA 2RGWA 3KNZA 4FFNA 4Y2TA 4OHOA 2F4VB 3PDCA 3QFRA 3V80A 3KSDO 4QRDA 5LBUA 5KCZA 3KETA 3RUCA 2AYXA 3E9YA 3WL8A 2JAXA 1C1DB 1J2YA 3C24A 1KEWA 3I58A 4DJDC 4WZBE 3HEMA 4BV2A 1KK0A 1IATA 2PMFA 4XVQA 3CIOA 2YTZA 3HCEA 3UMYA 2H9AA 3IEUA 2GI4A 2P4QA 1P2BA 4O4JB 4QU0A 3WRYC 5C7OO 2OV2A 5KX5F 3HO8A 3RD5A 3WFIA 4RQTA 2J30A 2RH8A 2AG8A 1Y63A 3GRUA 3M49A 3UJ6A 3FRIA 1ISFA 2H8KA 1EX1A 1JEAA 4OYYA 4C0LA 1WBBA 1SG6A 4FDUA 5IHPA 2ONJA 2FPGA 4NDNE 4XPIA 2HH9A 3KVRA 2X1VA 3H86A 3OOHA 1R0KA 3UEOA 3TG8A 5BNIA 3HC7A 4PX9A 2VDNB 1ZHHA 4KMMA 2FPPB 4WCDA 1UZMA 4U7TB 2YIJA 1QG2A 4I8IA 4KTTE 4DLBA 1ZISA 4R1TA 1ATIA 1ZX1A 4NS1A 2HSGA 2J5BA 3JQ6A 3A9RA 2HWUA 1SCJA 1F4LA 1WZEA 4BKRA 5CDYA 4U7GA 1KAMA 1ZINA 1JR4A 1ULBA 4EPXA 3HLTA 2I8LA 3VTKA 3G9ZA 1EPUA 4DQ0A 4QXPA 2O1EA 5D6NA 1X13A 4KR7A 2GD2A 2G77B 4LHVA 2Q0HA 3G2HA 4WNYA 1TZ2A 3I34X 3HN2A 2B8TA 1A8QA 1Q84A 2YYZA 4G84A 2YXPX 3JWPA 2NPFA 4F96A 4HNRA 4MP6A 2CDBA 2WE8A 2R6CA 4ZO4A 2V0NA 3CUKA 1MO4A 3P9NA 4LJ4A 721PA 5F3DA 3TEJA 2A3NA 2FUEA 1NQUA 2H4JA 3A27A 3VU9A 1ZL2A 4E31A 1PKEA 3GCZA 1UKBA 3RM3A 5A9TA 2IUYA 2GILA 1ZM7A 1TJNA 1B74A 2IH5A 2P35A 1P9WA 3ND9A 3LWBA 1YIDA 5EUQB 2QU7A 1N5JA 3GEGA 3OKCA 4IIDA 1NIJA 2DCMA 4XWYA 3HU3A 4XQEA 5AHOA 1UOQA 4IDAA 5CU7A 3RSZA 4OEHA 1N2JA 2AGVA 4KAXA 5ALOA 3H1FA 3LZDA 3O8NA 4BNKA 4NZOA 3AL2A 1PJAA 1PVOA 4KMOA 3PX2A 3IHWA 5FL7A 2GTIA 2I65A 3P1JA 1W2WB 4ZQEA 4FHDA 2VBIA 1KI6B 1X6VA 4OHWA 3LLCA 4UVEA 3QX8A 1XGKA 3O8CA 1EQAA 4UTVA 4H59A 2Y8EA 4R9UC 2OP0A 3FR7A 4F56A 3IQEA 2ZBGA 1PNTA 4ICIA 4KRGA 1N33B 1UT6A 1Z5VA 1I7NA 2L69A 1RWOA 1W47A 1EFKA 3OIUA 1U8EA 4IIFA 1F5SA 1IZZA 2HIGA 3K4QA 1IN5A 3NEYA 4NATA 4QXAA 3AIIA 4V0RA 3G79A 3RQSA 4X1IB 2AFIB 4GKBA 2UVPB 1FNBA 5D85A 3TH5A 3HJHA 4HDMA 1CEQA 1BMDA 3HP7A 3AVQA 1QIGA 2Q6TA 3OPNA 4S2UA 4TUYA 3W06A 4AZ3A 1XRLA 2I7TA 1YI8A 3EXHA 3IUQA 4JR0A 3ZWPA 2X8WA 4RADA 4E88A 1EGVB 4E2FA 3UIEA 2OBFA 1CVIA 4D92A 3LTNC 2FPIB 3QVGA 4OHKA 4P4SB 1GAXA 2WHQA 3PWZA 3BXEA 4MV7A 5AKXA 4AC9A 2EKLA 1H9AA 1P3Y1 2JBHA 4O4LF 4P54A 5DLPA 2V58A 1C0LA 3ND8A 3TSZA 4NENB 5FBZA 5DXFA 2IIBA 1Y34E 3UQYS 1A2KC 4MQBA 3LYUA 2AX3A 5TE9A 4AJOA 3HR8A 1YR6A 3DZGA 3L0DA 1EVLA 2QSZA 4JJAA 4Q93A 4WKBA 5EP4A 3FJ1A 4OX9B 3G5LA 4PTLA 3LBIA 5E1OA 2ATVA 5TS3A 1TJ5A 2BW0A 1GV0A 4ZQBA 4O5AA 4U7JA 1H1LA 2BGLA 3HJNA 4HN4B 1GAJA 1L5VA 3ZXXA 4XB2A 4TTSA 6PFKA 2BZGA 2JGAA 3H2BA 4UU0A 4DQVA 2VTVA 1XB2A 1ZRMA 2RG1A 2BD0A 3VR4D 1P9RA 1BCRA 2ZJ3A 4GXNA 5KDLA 3N8GA 4L6IA 4L5IA 2R47A 1ZCJA 1TIPA 2FDCA 3PRJA 4WVFA 5DRTA 1LW6E 3OFNA 3WQQA 4MW5A 4CV1A 1VCIA 4YUAA 1NYLA 4BDSA 5AI0A 2HFKA 3NEJA 4DQLA 1U3GA 4WXRA 4PC1A 1JEQB 4ZEWA 4UMFA 1O57A 4XARA 4I50A 3RFCA 1XXHE 4EJSB 1EIWA 1DT5A 4PM4A 1YVEI 4JD5A 4ZCQA 4N6NA 3KKPA 1NKSA 1T1SA 2OBYA 3OU6A 2JI4A 1F9AA 5TARA 2I78A 3PCXA 3QUCA 1JG1A 2OCAA 1PFKA 4PCLA 3QVMA 1SEVA 4X0EA 4GGPA 1W75A 3WLIA 1Z4OA 1DUSA 2PMCA 1PR1A 5CGQB 3TZQA 3AHJA 2H4HA 2P9GA 3OTWA 3IEVA 4NMWA 4Y2RA 5JCPA 1ACJA 1LGYA 2BSQA 5CJJA 3BH7A 4TMVA 4KK3A 1Y7LA 1XKTA 4GVXA 4JGBA 4CQMB 1T0HB 1FEZA 2Z57A 2QQ5A 4GWKA 2C58A 5EMJA 3GLUA 3VDQA 3U7JA 4HS4A 2XGMA 4DY4A 4CHGA 2G1KA 2PSFA 1LDNA 3B82A 3SHWA 3PFKA 4DANA 4L08A 3LP8A 1GKLA 3WYCA 3TG2A 3DT9A 3NNNA 4KLAA 2ZRBA 3QSGA 1XRQA 4DZZA 2QG6A 9ABPA 1BJRE 4C03A 5KYYA 4LF9B 3VR6H 3W2IA 5IX8A 2QRLA 5FUXA 1JLMA 4AUNA 4CTOA 2AHRA 5H3CA 5AM2A 3C70A 3H9JA 4BO0A 2GT1A 3MQ4A 4KITB 3GDOA 4BKOA 4GECA 3QWFA 1XTPA 3W6UA 5BNFA 3WTCA 3MRSA 2J9XB 1XNRB 3BICA 3B6EA 4L8LA 5BPFA 4FJ0A 4LHZA 4JR2A 1EP9A 2AW3A 1LEHA 2NXJA 3P9ZA 3BUSA 2KYRA 2J5KA 5DU2A 4N3CA 3S2GA 3DE1X 1J8QA 3C5WP 2WVHA 3QM1A 4YT5A 2VFAA 3ENZA 3DZ8A 3AZQA 3UBMA 3ICCA 3I30X 4MMYB 3OPVA 2IELA 3ER6A 3TLXA 3MJHA 3WFZA 4BQEA 3FHTA 1H1LB 1EG7A 4QU9A 5KU1A 4LOJA 2G5GX 1NJ5A 2FQXA 3VU9B 3UC5A 1JXQA 3WAKA 2V6JA 2PL5A 1NFRA 5JXGA 2PLNA 2Y1GA 4TYWA 2O3SA 5FD8A 4AKHA 5EMMA 2NNLD 4PLGA 4FYVA 1UC9A 3CGWA 3HDTA 2VHJA 4HLUC 4YWHA 2CSUA 4MV0A 4RXUA 4WLEA 2ZQZA 2YYYA 4AK9A 5EYPB 2CCJA 3KPJA 4ZIRA 2CZGA 3H5RA 1NR7A 4KR0A 1F1JA 2H7XA 1OVMA 3MT0A 1XZPA 4TS3A 1S8OA 4ID9A 4RTSA 1SXPA 2EFEB 3PZRA 3CR8A 2OZLA 1YJQA 1E7MA 3P94A 5DIFA 3VV2A 2MTBA 3BXZA 4H1VA 2HO5A 1N7HA 4R0NA 4BOYA 2B0JA 4XAQA 4K9RA 2CUTA 2P75A 4RL6A