2IYWA

Shikimate kinase from mycobacterium tuberculosis in complex with mgatp, open lid (conf. b)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
178
structure length
178
Chain Sequence
b'APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPSPSEAATLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHIKIMATE KINASE
publication title Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 67
structure length 178
sequence length 178
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iywA00
4LJAA 1E79A 2OLKA 1F2TA 2JDIA 1WCV1 4OQNA 2WSMA 3KKNA 5FFMA 4NE2A 4Q1FA 4XWKA 3HU3A 5DSZA 4HLCA 4LZZA 2REBA 3VR6A 1KKMA 1G21E 1VCNA 2PLRA 5HE8A 3QF4A 1XEWY 2TMKA 2WM9B 4L5BA 1EX6A 3SYKA 4PAQA 1QG4A 1KJZA 4ZPXA 2NO1A 1UKZA 1NMYA 4RFSA 4BLRA 2Q9CA 4JLMA 4YXWA 2IS4A 2V6IA 4F92B 3VQTA 2VIIA 2Z4SA 3L2OB 4ERNA 5GJWC 2JLVA 2RGAA 1E9EA 2VSFA 4KJZA 4URZR 4D0NA 4LHZA 4JYBA 4XSHA 2OFWA 2O8CA 1E1RA 4BEJA 4MUBA 2HF9A 4IFBA 4LYFA 4OI4A 1D2NA 2OT3B 3EPJA 2ZITA 4LHVA 4RY2A 4TT3A 4Q1BA 1DVRA 2ANCA 1OH6A 4JL6A 5E7MA 4B2PA 2ZRNA 3TIFA 5KSZA 2MSCB 4HI0E 3W6OA 5BW8A 1SKYE 3KUDA 4P4SA 1ESNA 2Q9BA 3RS0A 4ILEA 3E70C 1R5BA 1YZNA 3PQCA 2A7QA 2YC4C 4IDOA 2HCBA 2Q3FA 5J40A 3ZJYA 4JVSB 1R8QA 2CLDX 5EE1A 2ZUBA 3K8YA 2DFKB 2FFAA 4QBHA 3CM0A 4M21A 1XPRA 1UDXA 4QHSA 1Q3HA 1CS4C 1QHHB 2FNAA 2PH1A 1AS3A 2DFLA 4JVMA 3ZS8A 4B3CA 4V0KA 1EFTA 1CR0A 1TPZA 3DOFA 1W0KA 4BGDA 1HURA 5KO2A 2PJRA 5J5CA 4GFDA 4KYUA 2EQBA 1CKEA 3KQUA 3V9PA 4HB4A 4S35A 3GQBA 1IJEA 3W3AA 2WJHA 2R2AA 1ZMXA 1Z28A 1XU4A 1II8B 2VTKA 5IK2D 5AWFC 2CHQA 4DLXA 1P5ZB 1TADA 1D2EA 3JZAA 3VR5A 4Z54A 3PEYA 4DDVA 4ZO4A 3A6PC 3R7WB 3OEHD 1FW6A 1DELA 3LBNA 1KSJA 1MH1A 4RZUA 1Q22A 2OSBA 2YWHA 4HUQA 3QG5A 1OXVA 4Q9LA 4XJXA 1CJVC 2QE7D 1XD2B 3EA5A 1ZUNB 1YR8A 4D4JA 1M2OB 3GD7A 3BS4A 2YHSA 4FCVA 2GEDA 4HLUA 3X1ZA 1SKYB 2CEAA 2CHVA 3KZ1E 3I61A 3NC1C 3VU9A 3MMPA 1US8A 2QTFA 3D8BA 3G0HA 3U6KA 1P2VA 1OHHA 4O0MA 2GEVA 4BQSA 5IT5A 2J7PA 4R2HA 2XEXA 1YZKA 3LD9A 4V03A 3M0EA 2F7SA 1OE0A 1OW3B 2ZRPA 4OQMA 3GLHA 4KFTA 1W4AA 4U02A 1EFRD 2FA9A 3AGPA 3VNUA 2ZR9A 1WMSA 3K0AB 2F9MA 3H84A 4UQOA 4M4SA 1DS6A 5G40A 1WXQA 5EP1A 2QPTA 3X1XA 4II7A 4DLRA 1KI8A 4DB4A 4TLAA 1CJMA 1OH7A 2O0KA 4EQ6A 2WKRA 4B34A 1U2RA 1IXZA 2IF2A 3UK6A 2H18A 1ZM2A 2HT1A 3KKPA 4H1UA 1G6OA 4PO1A 5L3SA 3S1AA 4BUJA 5FTKA 1F5NA 1YRBA 1G5PA 1DPFA 821PA 1AJEA 4JLOA 2JJ1A 4PFSA 2PMKA 2XJ4A 3GJ5A 1KO8A 5JJIA 2HYDA 2PCJA 4GP7A 4BLQA 2C99A 2QAJA 4U5XA 4XTCS 2R65A 1II9A 2FPMA 1EX7A 2X8AA 1Q21A 2NO9A 1UBFA 2VHUA 2OFXA 4MRVA 2O52A 4M9XA 3TAHA 2FSIA 4WOPA 3GEEA 1PVOA 3CKLA 3OE7D 2PEZA 4Q66C 4W5WA 3RSOA 1R8SA 1VG0B 3LBHA 1NI3A 3NVAA 4Q21A 3SU8A 4HLUC 1XNJA 4D80A 2EVWX 4Q5IA 3BB1A 3U6BA 4OQFA 1JJ7A 4JL8A 1T5IA 4YMWA 1KOFA 4E03A 1KZGB 2ZI5A 2VPPA 4ON9A 3U5ZB 3GPLA 5JMTA 4KLNA 4DT1A 1ONBA 4I4LA 2IUUA 4QFMA 3CUEF 3THXB 2W2TA 1G64A 3AVWA 1XD9A 3TRFA 3N5CA 4Q1CA 3N2EA 4KVAA 2ZM5A 3EZ6A 2IUSA 2LKDA 4DDWA 4NCNA 3V00A 2FGKA 1NVVQ 4JLNA 3PR1A 1E0KA 5EZ6B 4PSKA 2QBYB 3L0OA 1AGPA 4LDJA 3K09C 5G3ZA 3GLIB 3AM1A 2F1IA 3EZFA 4NKRA 2EFEB 2IYZA 1JR3D 5DISB 4HDOB 2V4ZA 4IDPA 4A0RA 1IJFA 3AVPA 3I32A 5DE3A 2HXYA 1AZSC 1D9XA 2B8WA 1NG1A 2ODEA 1U0JA 3SQWA 1COWD 3MCAA 4LCBA 4LYHA 4NMMA 4MQBA 3SYLA 4ARZB 1AZTA 3DO6A 5M04A 5F3WB 2HLDD 3U44A 4URYR 1KI3A 2KBEA 4X8HA 4AY2A 1Z07A 4KBFA 5GVRA 1DAGA 1C9KA 1NJGA 1UBGA 2ZANA 4LPKA 1Q1BA 2Q21A 2GJ9A 2R62A 1KMHB 5GJVC 2XOKA 5HPYB 4XVQA 4DVGA 1HQYE 1G5RA 2F43A 4TYPA 1S1CA 4P33A 4I1OA 1X1RA 2NMVA 1QHGA 4W7SA 4G1UC 5HKKD 4UNPA 2P5SA 2ZS8A 1O3YA 2DR3A 2VHQA 4GI7A 4LJ7A 4R98A 4CEJA 4Q4AB 2ZRAA 4IHQA 5LD2B 4KI0A 5LB2A 2FFHA 3RS7A 1UKEA 2B92A 5B30A 5KPJA 1VCOA 2ZJAA 1YZGA 2P5TB 2P6RA 3K53A 4M1TA 4M1YA 4JSYA 2FPLA 2C9CA 1Z83A 5L8VA 4L15A 1U0LA 1OXUA 3MD0A 3EPKA 3B13B 1ZU4A 1FL9A 3CWQA 2RGGA 2G0TA 1JEDA 1S9HA 3NBZC 4M9QA 3DM9B 2RHMA 1W46A 1VMAA 1ZC3A 1CF4A 2C5LA 1LFDB 3LFUA 1G6HA 1BYIA 2VEDA 2ZI6A 2ZSBA 5FOUA 1G41A 2E87A 2G77B 2PBRA 2QMHA 3EZ9A 3LO5A 5FI0B 721PA 3ZGXA 1XTRA 4EPRA 1UF9A 3AH8A 1F2UB 2IWRA 4IXMA 1E32A 4Q4JA 2V54A 3C5HA 4ZI2A 3A1SA 3FGNA 2XXAB 1ZNZA 2KSQA 3OAAD 2HXSA 1RFLA 3DVLA 3UMRA 1KO4A 2KWIA 2XSZD 3OEED 4HATA 1YR7A 4OK6A 2WSSA 3H2YA 3M6AA 4M9ZA 3KJGA 4Z8YA 1UKYA 1ZD9A 521PA 2Z5FA 1XFAA 2H7VA 2O8BA 5BWMA 3FKSA 2CLCX 3BD9A 3BBPA 1G7SA 3SBDA 3LH5A 3EC1A 2ONJA 3QVVA 2JLYA 2ZVQX 3SHFA 5KTYA 1K8RA 2VP9A 5EXSA 2OEPA 1MR3F 2XZOA 5H70A 4D0LB 3LX8A 2R6FA 5H68A 1J2JA 2F3TA 2J87A 3T15A 3ND8A 1VYVA 4DCUA 4D6PA 5IRCD 5FPYA 4C7OA 2G9NA 1P6XA 2W6JA 3PG5A 2WIBA 4UJ5A 1IN4A 2KB0A 3IBYA 3ADCA 5CLLA 3C14C 5E7JA 1DAIA 1Q0UA 1ZCBA 2HT6A 2WBLC 4RD3A 1XP8A 4JYCA 4MDFA 2WOJA 2GXQA 1NVWQ 3CRQA 3QXHA 5JS8A 2GCNA 5AK0A 1KDRA 1SVSA 3PXGA 4GOJA 2QTHA 3D31A 1NNEA 3U7EB 4OBEA 1JI0A 1T8UA 4NYIR 4M1SA 2GAAA 4B73A 2CLSA 3LX5A 3RRYA 4B2LA 4DUGD 3P4XA 4A36A 3KJEA 1DADA 1XTSA 2QTVB 5FTLA 3EC2A 4TYNA 4HUTA 2JASA 3HYTA 4ABYA 4HAXA 2YJTD 1GRRA 1KKLA 4HZUA 5EZ5A 4D2IA 5EUMA 1WBBA 1ZW6A 2ERYA 1OYYA 3V4RA 4WVFA 4UNRA 1J8YF 4PZYA 1W48A 2QSYA 4XD7D 3DZDA 4LRWA 1J90A 4JIMA 2NTYC 2ODBA 2QP9X 1E2LA 1P9RA 2L0XA 2WAXA 3FMOB 4IOLA 3W90A 4IVQA 4Q47A 4ZCMA 2CE2X 4GZLA 4RD6A 2ERXA 3T35A 4PHGA 4Q1EA 1AQYA 3CRW1 3RDPA 2BKUA 3KB1A 3K0SA 3U3RA 1ANKA 2VBCA 3TKLA 3W9YA 3O8RA 3QPUA 5SZHB 3LQQA 3CBQA 3IIMA 3G82C 4RZ3A 2GJSA 3TVTA 4BFXA 2NZJA 2QMUA 3VHLB 1AIPA 3TR0A 4DB2A 4C0LA 1E96A 1BS1A 3FVQA 4U00A 1TUIA 4JVNA 3F0TA 4DCVA 3NKVA 3I73A 2XTMA 5G3YA 1VG9B 1GKIA 3W5IA 1ZAKA 4KFSA 2PMDA 5CB6A 3WMFA 4AKIA 3AP1A 1Q1ZA 2NPFA 5DYIA 3TW8B 4PPNA 4TZ6A 2HJGA 3GLGB 4MKFA 4NYJR 4YMUA 5LPNA 1UJ2A 1TU4A 4OI2A 4TLBA 2HJVA 2WJJA 1CBUA 1ZNWA 3ZQ6A 1KK0A 1NBMA 2IS1A 1KSGA 3RWMB 2YOGA 2ZROA 2IYWA 4KFRA 1HTWA 1KAOA 1FUKA 4G3XA 2AXNA 2IHYA 3RNLA 1CEEA 4LJ6A 1JNYA 1R5NA 3L82B 3A4LA 1E2NA 2ZU6A 4P32A 3K70B 4KCGA 5FBWB 2VSXA 4KODA 1GRNA 3IEUA 3OIVA 2V1XA 4MGKR 5HE9A 1KY3A 1T5LA 1VPLA 2QPAA 1G3QA 4HDCA 3GEIA 3AKEA 3K0FB 4C0AC 1ETUA 1H8HA 4LJ9A 3CNLA 3IILA 1A7JA 2OBNA 1H8EA 2W58A 5JHHB 3NDBB 2C98A 5FPKA 1NBME 5D3MA 1G4UR 3CNOA 1LNZA 3PUVA 2VF8A 2R6AA 3LAWA 2ZI9A 4IFEA 3OIWA 4QGGA 1SVOA 3FKQA 5DO9A 5KSOA 4B3GA 3R8FA 3B6EA 1M34E 1P2UA 1YU9A 1KO7A 1JAHA 2WICA 3JVVA 5JJLA 4BPBA 3CX7A 2VYFA 2QQEA 2ZJ2A 1Z0AA 2FSGA 1W5SA 3H0KA 4JT4A 4RKEA 2QAGB 1K5DA 2P6UA 1F60A 1I4DD 2JLRA 4RZ2A 4A2QA 3LBIA 3VR2A 4TYQA 1XEWX 2WKPA 1G16A 1DE0A 2CJWB 5KNBA 1SXJB 2G3YA 4JLDA 4QXAA 1GL6A 4GOKA 5F9FA 3Q3JB 1XEXA 2GK7A 5FBRB 2YKGA 2O8EA 2NZ8A 3AVTA 2ZRBA 5A0FA 1JPJA 1N5LA 2OFOA 3AKYA 1Z5ZA 3ZVLA 2GXUA 3AVVA 5JSZA 4JKYA 4O2RA 2QM8A 8OHMA 1AK2A 2ZRKA 2MMGA 2QNRA 3ASZA 4C0KA 3D3QA 5FR2A 2QM7A 2DPXA 2CL0X 3RS3A 4HAYA 4WZAE 1NF3A 5EE3A 1E98A 1W7AA 2Z83A 1S2MA 1N6RA 3GJ4A 4DRZA 5J4LA 4RVCA 5E7IA 1CP2A 3VX3A 2FE4A 2ZAMA 3EW9A 3W3ZB 1KSHA 3WBKA 3RANA 4TTRA 4NP6A 3SN6A 1CR1A 4GBMA 2VLIA 2FPKA 4XH9B 1DAFA 1G20E 2IT1A 2ZRIA 3DKVA 4TL8A 1YQTA 2G88A 5JFGA 3PJRA 1GITA 1QVAA 2CCGA 3I5YA 5L3QA 4B3XA 3AUXA 4URUR 4NCJA 1E9DA 4EJSA 2IBMA 4J0QA 2A5FA 3PVSA 2J0UA 3PEWA 3ONWA 1QRAA 2E1RA 3QG1A 1Y3AA 4C0QC 2XNDD 1IBRA 1TTTA 1N25A 2EFHB 2WJYA 1COWA 1R0XA 3C4JA 1KAGA 4R7ZA 4NPHA 5CYPA 4CF7A 3BH6A 1YE8A 4ASUA 2WOOA 1NVUQ 2QT1A 4GPTA 3MUFA 4CYMA 3KFVA 1EFHA 4MGYR 1G1MA 3ZZTA 3CLVA 1JAIA 2CNWD 3MG9A 4C0HA 3D7MA 3PEUA 4JT2A 4B75A 1KZ7B 4BWYA 2ONKA 2YINC 4QGHA 1HV8A 4KO8A 1IN6A 4MUAA 4B76A 1IN8A 3LW7A 4JKIA 2C03A 2ZIAA 3EASA 5J4YA 1KI9A 2V1UA 3VR3A 3WXMA 1NLZA 2WKQA 4B43A 1SVKA 4A1FA 2FFQA 1HY3A 4DLYA 1XMVA 1OF1A 1HT2E 2B8TA 3SE0A 1NVVR 1OFIA 1N0WA 4BFTA 3THWA 2C77A 2NO0A 4PHFA 1XEXB 5FTNA 3NBXX 3DKPA 5FOVA 2V6JA 4KAXA 1MO4A 2OCAA 2OZEA 4B3DA 1M8PA 1JQJC 2EYQA 4IW3B 1OB5A 4C3ZA 4NYIQ 1VECA 4L9WA 2Q0HA 4PC2A 3QBVA 4EJSC 5JHGB 1EGAA 4UNQA 5KDOA 4Q4HB 2VP4A 4LC1A 4Q01A 4C30A 1G7RA 4WXRA 2H92A 4HAZA 5BN4A 5DI3A 4AYWA 1OFHA 3LQRA 4FINA 4UXIA 2V8OA 4D4LA 4I81A 4AKGA 3RRNA 1KIMA 1QHNA 3RS5A 4DCSA 5JEEA 4LWZA 5KNDA 1XDBA 4NDZA 3U2QA 2FFBA 3K9HA 4YMTA 2BMFA 1BO6A 1Z6GA 3CRRA 2A2ZA 3BORA 4V0OA 4JJZA 3B8HA 3OEEA 2J46A 5FL7D 4M1OA 1NG9A 1G18A 5ANRB 3KJIA 4O25A 5G53C 3U3MA 4Q9JA 2I1QA 3I72A 2D62A 3UKDA 4CZ2A 4D0GA 3VHXA 4MKHA 3PUYA 4RJLA 1R10A 3KXLA 2J1LA 4FWIB 3C41J 1LVGA 4LV6A 2YOHA 4OQLA 1OXTA 2FOLA 1L4UA 2H57A 5FPSA 4IDHA 2IXGA 5BYJA 2BMEA 1AQUA 4FMBB 1QDEA 4WXPA 1U98A 4ITRC 4URXR 4CEIB 2RCNA 4A8JA 2WWFA 2AL7A 3TVDA 4BFZA 4BEBA 3C8UA 4H1VA 4DHEA 1NN1A 2JLQA 4NYJQ 2B21A 1M7BA 2OE2A 1VYTA 2A78A 3K70D 2ZS7A 3U4QB 3CW2A 3K9NA 3KKOA 3SJZA 1EXMA 2MSEB 2GK6A 2ZSFA 1PJRA 2BCGY 5C4GB 2NG1A 4ZDIA 4DZZA 3AP3A 4YC7A 2BBWA 1XMJA 2H16A 2YWFA 5FBVB 1T3HA 2LKCA 1P3JA 5BYKA 3THYB 4PTLA 3ZQJA 3TQFA 2VA8A 1WA5A 1SVLA 4D4KA 2J5XA 4PANA 4ZIRA 4A15A 2OBLA 3X1DA 1KY2A 2OXCA 3TW4A 1JQLB 3E2IA 3R9XA 1JALA 5CJ2A 1Z6XA 3T34A 4JLAA 1XJQA 4YQFA 5E3HA 2QSZA 2GESA 3HWSA 4HAUA 4DUGA 1XCMA 4LC0A 1CTQA 2RGNA 2FSFA 1XMSA 2AXPA 3EG5A 3PUXA 4R9UC 1KI6B 3PUWA 2O8DB 1LS6A 2AWOA 3MWYW 4FW9A 1IQPA 2O8FA 4QGFA 1WBDA 5DGXA 4Q7JB 4AIIA 4LBYA 1E1QD 3MFYA 2DFNA 4DLSA 4OHWA 2FU5C 4NHOA 1SXJD 4XD7A 3UANA 1F2TB 1KGDA 1CJUC 3R20A 4G5SA 4ZCLA 1G9XA 3FE2A 1OKKD 1Z6TA 2YWEA 3FPAA 2A9KA 1KTVA 3FHTA 1BH2A 4BFSA 5CK4A 2VQSA 3QF4B 2IHBA 5BN3A 1DBSA 1ELOA 2BWJA 4W5JA 4RFSB 1OYWA 2D7DA 2DWPA 4V0NA 3QIAA 1I2MA 3WMGA 1XCGB 1NP6A 2GJ8A 4OHVA 3VAAA 1D8TA 2CXXA 2EFDB 3FTQA 1FTNA 2O8CB 5B64A 1W4CA 4PXAA 2OUKA 2WWHA 1XTJA 1NIJA 4DEYA 2IYQA 1KI7A 1X8KA 3AV0B 1DEKA 2G6BA 4V0MA 2R6CA 3WYGA 1RC8A 2V7QD 2X2FA 4EAQA 3LVQE 1G5TA 2IF0A 3HR7A 2ZJ8A 1S8FA 1TAGA 3CRVA 5KSYA 1H65A 2F1RA 2NPIA 1GVNB 2XTZA 1LTQA 1TQDA 5K8IA 2IEYA 3U61B 4NONA 3QKSA 4P4SB 1Z0IA 3CZQA 1KO5A 2ZYVX 2RGNC 4B3BA 5HTKA 1XTKA 1W36C 1U8AA 2C9YA 2QG6A 3OIYA 3VTKA 3HP1A 1GRQA 1E2QA 1S96A 1T4GA 1FQKA 3P26A 4Y0AA 4A6PA 4GDFA 2VHCA 1P62B 3BOSA 4LJ8A 4R2IA 4JMPA 4RKFA 2W0MA 3P32A 2NO6A 3ZZ0A 3GLHE 3BH7A 4F93B 5SZIA 3CRMA 1RYHA 2OV2A 3ND9A 1D2MA 3T1VA 3X2SA 3GJ3A 5JECA 2R44A 5F9HA 4V0ME 1UBCA 4RCYA 1PUIA 4OQXA 4TWZA 1CIPA 1XB2A 3AEZA 4URVR 1W4RA 2AK2A 2Z0MA 3GJ0A 4IEIA 1IONA 4TQUS 1W4BA 1TMKA 2BHRA 1S4QA 1U81A 1DO2A 3B7GA 4BZPA 5JI3E 2NGRA 4G5OA 1TQ2A 2JA1A 1SVWA 3KFXA 2ZYTX 3Q72A 1EESA 3DMNA 4UNNA 3RHFA 1K6MA 4GP6A 3FYHA 5SZKB 2EFGA 4GT1A 5CIQA 3RVBA 1CXZA 1O87A 3WNCA 1P60A 3U3OA 2ZYWX 3Q85A 3WNBA 1E2FA 1NLYA 1YR9A 1E4VA 4HUQB 2CK3D 3RRMA 3K0CA 5KUTA 4GL2A 3ZZUA 2JIZD 3CWZA 2CDNA 5P21A 3FB4A 2DFTA 1CRPA 2WJVA 4ZDWA 1K5GA 3T61A 4Z51A 2JJ2A 4BZXA 1S0UA 1LS1A 3SEAA 3OFND 1D9ZA 4JLBA 4TN1A 2UZ3A 4Q9KA 3LV8A 4EFLA 4KBGA 3TGPA 2FMXA 1YZLA 1US8B 1Z06A 1R6BX 1U94A 2BBSA 2REXB 3CR8A 2ZSEA 4LK2A 4LOAA 3BWDD 4OYHA 2RGDA 4ZV4A 5C1BA 3OIUA 2C96A 3B5JA 5CDFA 2JEOA 3QXSA 1YZQA 2V55B 3DHWC 4B2IA 1J70A 1RW4A 3GLHB 1ODFA 3FHOA 3KKMA 1E3MA 1M7GA 3RSLA 3WP1B 3L0PA 4BECA 2BV3A 2JLSA 1FZQA 5DN6D 1FUUA 4TSFD 2UVQA 2P65A 4EFNA 4EQ6B 2EWVA 3KQHA 3EPLA 3REFA 3A4NA 2R6DA 3A37A 2ODNA 4OKSA 1N6IA 1ZM9A 2VF7A 5JRJA 4B3FX 1DOAA 4EPXA 1DAHA 1HA3A 4QHYA 2I1VB 5L3SB 3S1AB 3B2EA 5FBQB 1YKSA 1XX6A 3OHMA 3AVYA 1IXRC 5FR1A 2GXAA 3IIKA 5L3RA 4BRWA 5CDFE 5LBIA 2GZDA 1Z0DA 4NCKA 1GG2A 3WHLA 4M1WA 1FFHA 2ZSAA 5C18A 1Y63A 3AKDA 2QMEA 3ADKA 1XZQA 3GEHA 3K0CC 1QZXA 1FOEB 1TL7C 1TQ6A 2C9OA 2JAQA 3CX8A 4RCZA 1XJCA 4AG6A 2ECKA 2ZS9A 2IXEA 2X2EA 3PV0A 5DHFA 5H1YA 2BCJQ 4PQFA 4EDHA 3NWJA 2D74A 2IYRA 1B23P 3FMFA 1E2GA 2ZE7A 4BRUA 3SI7A 2RGCA 1DTSA 3U3JA 1JEEA 4MKIA 3B1VA 4JSTA 1ZIOA 3DEFA 2JJ8A 1YZUA 2JATA 1QHSA 5G41A 1RRGA 2HDNB 2Q6TA 3FWYA 4B71A 4DT1B 4TTPA 3W8NA 3WYFA 2N42A 4DBLC 3Q5DA 4XTRA 2WWIA 2YVUA 3ADBA 1ZNXA 1OH8A 1PV4A 3ZLJA 421PA 2KBFA 1N6PA 1ZM3A 3Q7PA 4GMDA 2DHRA 3EWSA 5CB8A 3WHKA 4OHYA 1Z2AA 1ZU5A 3ZD7A 2FEMA 3SC3A 1E94E 1G17A 2Z43A 3AF3A 3QPWA 3AF1A 2AK3A 5AR1A 5FBLB 1ZC4A 1E79D 2JDID 3A1UA 4M2LA 1W49A 1NSFA 4PAMA 1XWIA 5FPHA 4RZXA 3IIJA 3IDQA 4H9GA 1ZUIA 3HPQA 3EIQA 2PX3A 3SOPA 3VKGA 3OZXA 1DAEA 2OG2A 3IHLA 4PQRA 2IWHA 4LX0A 4AG5A 4DKXA 2ZE6A 2G1JA 2ZAOA 3R8CA 2CMKA 3B60A 1A5TA 5JLJA 4A9AA 4P4UA 1GP2A 4QG7A 4CT4B 1KJYA 3L8YA 2OHFA 1GKUB 3U44B 2LWIA 2VRWA 1E4YA 1OV4A 2A5DA 2AWNA 1V43A 2IS2A 3P20A 4MYUA 1IAQA 4IKEA 3ZYCA 5HZHA 2ZPTX 2FV8A 4MDEA 2H8KA 3ZIAD 1S1MA 2WWXA 4ESVA 3LY5A 1NMXA 2WZQA 3HDTA 2F43B 4LHWA 4LBVA 5CLQA 4D82A 1Z63A 2QU8A 3GP8A 2IYVA 1AN0A 1OIVA 4LBZA 5AUNB 5KOYA 3QXJA 4Q00A 4TT3D 5DIFA 1N0VC 3R9WA 2RKOA 3JZMA 1BMFD 1ZD8A 1T3LA 4JBXA 1MO6A 1Z29A 4B33A 4CEJB 4DCNA 3IGFA 4JLPA 3GJ8A 3C15C 2QY9A 4LI0A 5EQTA 2QROA 1P73A 4BE7B 2AFIE 3MSXA 3MRSA 3BB3A 1NKTA 4YONB 5HCIA 1E9CA 3R9IA 1LB1B 3TR5A 2XB4A 3SQXA 3IQXA 5SZJA 4Q9HA 5JBQA 1JJVA 1N6KA 4B6FA 1UFQA 3EX7C 1VTKA 3C16C 1LV7A 3H86A 3Q9LA 3ZS9A 4TMZA 5FL3A 4IOJA 4IOMA 2KJQA 3BFKA 1XTQA 2Y8EA 3RABA 2PT5A 3GLFA 2FDCA 2VL7A 3SJCA 3UWOA 1FTSA 1F6BA 1XD8A 3AF0A 4QC2A 2R8RA 4KVGA 4B32A 4DXAA 2I4IA 1W0KD 4M1MA 3KTAA 2XX3A 2AN9A 4Q7KA 3BGWA 4IDQA 5EE5B 1A2BA 4BFUA 1IN7A 2GCOA 4EIWA 4X8OA 3AVUA 3T1TA 4YLGA 1KYIA 2VP6A 4WZ6A 621PA 3QQ5A 4Q4JB 4Z8XA 2PZEA 4MRNA 3WYAA 1G3MA 5IK2A 5DNYB 4QOSA 1N5KA 1OXSC 2RGXA 4DJTA 3GLFE 4G0NA 1KNXA 5HZKA 3L43A 2XXAA 3PUZA 1E1QA 3OEHA 4NYMR 3RWOA 3EZ2A 4MYHA 5IDVA 4FMCB 2O8BB 1G4AE 1Z3IX 2OAP1 1HE1C 2J45A 4GOXA 2IEZA 2QE7A 1Z0KA 3CF0A 3F8TA 3QF7A 1E2MA 3SNHA 3GMTA 1BKDR 2ZRCA 4US0R 1AS2A 2FN4A 5HR5A 1UM8A 1OHHD 3MWLA 2GHIA 2NQ2C 2J7PD 3TAUA 5JI2E 3B1WA 3QOFA 2PZFA 1J99A 2ZE5A 1W44A 3BRWD 1E2JA 4AK9A 2H1LA 3WY9A 4C7OB 1GUAA 2CL7X 1MABA 2YYZA 2QI9C 4EPVA 1NSTA 1XTIA 2RMKA 1DAMA 4XWOA 5KYKA 1EFRA 3BAFA 3P1JA 3TUJC 1P2TA 3N2IA 1EK0A 5TDHA 5K8TA 2EYUA 3ZVNA 4WAUA 2V7QA 4D26A 1E9FA 4C0BA 2FG5A 3HR8A 1G7CA 2QGZA 1TUEA 5EJEA 2Z4RA 5UKDA 4YMVA 1Q20A 1DAKA 4JVLA 4LJYA 1E69A 3CONA 4M1KA 3T5DA 3TH5A 4DDTA 4HB3A 5JWRA 2JJ1D 2BIFA 1LF0A 1RYFA 4G5QA 5TV2A 2QMOA 2XNSA 3QEOA 4GNKA 2J59A 3QSYA 3HU2A 5TARA 1KDPA 4QJ3A 3A1VA 4CW7A 2GILA 1VCMA 2QP3A 1VIYA 2O0JA 3QENA 2UKDA 4OK5A 5EXTA 1ZCAA 1X1SA 4HLQB 4HZUB 3RC3A 5KU1A 5CM9C 2YOFA 1P2SA 2CVHA 2AKAB 1ZINA 3TLXA 3ASYA 3OE7A 5DHAA 4RSGA 1KI4A 4MGIR 2X1VA 4FD2A 1ZNYA 2ZUCA 2JGNA 3P27A 1TEXA 4C0SA 2PCLA 4G5RA 4XOIA 3QPVA 1GTVA 1R0ZA 4RD4A 1NKSA 1UDWA 4PR0A 1IM2A 1TF5A 4RFVA 2ZRJA 4DIDA 2F3RA 2MMCA 4HEJA 1G3IA 3IHWA 4QL3A 4B35A 3A4MA 2W6ID 2ZJYA 5E4FA 1UAAA 1E0AA 4CEHA 1Z0FA 1FX0A 4N1AA 2D4HA 4POAA 4DDUA 5EP4A 4OL0A 1N6HA 2R9VA 1MV5A 1T0HB 1L2TA 1G8PA 1TX4B 3FFBA 1G291 3PIRA 4PO9A 2CK3A 4DWJA 1DG1G 1TF7A 3VU9B 2O0HA 2OXRA 2DCUA 1PLJA 2P0EA 2JIZA 4LY6A 4XVUA 3U60B 4HYYA 3EIHA 4ZKEA 4D81A 4UXHA 5TY0A 4PO8A 4OI0A 1Z0JA 2VH5R 5EP2A 1GAJA 3ICQB 3LNCA 4KSBA 4Q1AA 3W34A 1RRPA 1RE0A 5JJKA 2CCJA 3BC1A 1E0JA 1JR3A 3NBYC 5JEDA 4ZI3A 5HCNA 5CK5A 4CGZA 2AD1A 1V5WA 2V3CC 4US2R 2GVDC 2XAUA 1MRNA 2BMDA 5FH9A 3UWKA 2J7KA 4LV5B 3KKQA 1PLLA 4TTQA 2BJVA 3LVRE 3QI2A 4TSFA 2HLDA 3AVQA 4L8GA 1C1YA 1U0HC 3EZ7A 1X86B 5FOXA 2XOKD 4MITA 4F4CA 1N0UA 2BBTA 4DLVA 2GRJA 5D3MB 4NTZA 3GJ6A 4QNRA 4W9MC 4QBIA 1GZSA 3QXCA 3PFIA 1JR3E 4IDNA 5BN5A 1U90A 5HKKA 1SGWA 4ACBA 5JS7A 2GEUA 2WVJA 1MRSA 2BC9A 3SR0A 1WF3A 5LDDC 2B7BA 2EWWA 3AF2A 3A36A 2GVZC 1N6NA 2ZSDA 4HB2A 1TEVA 4L4UA 2J0QA 4WW0A 3CNNA 4F7WA 1IY2A 2C2HA 1X6VA 2PX0A 1ZRHA 1LF5A 4ZCIA 3WRXC 4MYTA 5D3QA 1E6CA 1NY5A 4EPYA 4TL7A 3RLFA 2O8EB 1Q1EA 4MH0R 2IW3A 1SVMA 1Z6YA 5JSZB 1NVXQ 1Z08A 2YWGA 1GKYA 1QHHA 4A6XA 1OFUX 4Z1MD 3T1OA 4G01B 4BLSA 5J4VA 3I8SA 2C95A 2WWGA 5FOWA 3E1SA 4TYWA 2C8VA 1W5TA 2ZETA 3ZD6A 2OM2A 3AP2A 4GMXA 3B1XA 3U7GA 4HSEA 5KNCA 3FMPB 2OBMA 3IPXA 2GZHA 1II8A 3LLUA 4JL5A 2ORIA 4PC3A 2ZI7A 4O2LA 1Z8FA 3OAAA 4I1UA 2WSSD 3REGA 2SHKA 1YVDA 2XSZA 2ZYUX 1G8YA 3K9GA 2GAOA 3R7WA 3ZH9B 1T0JB 5L3QB 1A82A 4QJ5A 4DCTA 3AUYA 5KHOC 2GDJA 3FKSD 1P61B 3BERA 4EJSB 1XD2A 2N46A 4M0LA 2F6RA 2Z6VA 3MLEA 2J0UB 4LHYA 4FXPA 3W6PA 5FUVA 1X8JA 2I3BA 4Q1DA 3B1YA 3CH4B 2GETA 3QKRA 4NYMQ 4TMVA 1ZVQA 1GNPA 1UPTA 5EXXA 5H8WA 4UXJA 2ZQ5A 3NEYA 3WBJA 3T5GA 2FSHA 5KSPA 2W6JD 1N3BA 1NN5A 4Q18A 3GJXC 1GNRA 3T1QA 2WAYA 3A58B 4DLTA 3ZIAA 3RRZA 3BK7A 4LJ5A 1F48A 1XCPA 1YZTA 2QP4A 3Q7QA 3KQLA 1FNMA 4X8LA 3K0AA 2BBOA 1GDDA 4AYTA 4A0FA 1VG8A 3F3YA 1BMFA 2FZ4A 4HAWA 4TZ0A 3W8RA 1L8QA 3B82A 4WA7A 3FHCB 4E07A 1VHTA 2ATVA 2FWRA 4N0EA 4Q03A 4XSGA 3QXXA 1BYUA 1IHUA 3SJAA 1E2DA 1Z2CA 4C9BA 3O8CA 1IN5A 3TUZC 4JS0A 3EARA 3THWB 3BFXA 4I1VA 3ZVRA 2CCKA 1CU1A 4YMSA 2W00A 2A5YB 4JZKA 3QE0A 4PQYA 4QNMA 5F98A 3DZ8A 2OAQ1 2A3RA 1RPZA 2HV8A 3CPJB 4QGAA 3I62A 1FQJA 3W6NA 3NBFA 2QUZA 2J3EA 1ZUHA 1MOZA 1W2HA 2GTPA 4E5UA 5L3VA 1OB2A 3QKTA 1T8TA 4NCHA 4NBSA 5JWOA 4U7DA 1S3GA 2C04A 2OLJA 2AFHE 3B9PA 1G3RA 1S9DA 5J47A 5DI3B 2GNOA 1IXSB 5JCZA 3VKHA 4FN5A 2GWHA 5FTJA 4RD2A 5AJZA 1GFIA 4FCWA 4TLCA 3O8DA 5KDDA 4PZLA 3VR1A 4M9SA 1AM4D 4A8JC 2EU8A 2FZLA 2QORA 3DL0A 1X8LA 2KI5A 3NEJA 4WBSA 2N1BA 1XZPA 2HCJB 4EPTA 2GJAA 3LDAA 3KB2A 3O8BA 2WTUA 4QHTA 5JZVA 5CITA 2OESA 3THXA 2ZRHA 5C2JB 4PPGA 4TMKA 4A4DA 2BOVA 3NDPA 4QKQA 2F55A 2GZAA 1T9HA 2RGEA 2WIAA 4NH0A 5DH9A 3FOZA 1SZPA 4TQ9A 4P4TA 1HEIA 2GF9A 2IK8A 2MSDB 2KE5A 2GA8A 4TYYA 3QKRB 5FUXA 1NMZA 2RH5A 1AA9A 2RHDA 5TVKA 1IY1A 2QBYA 1NBMD 4Q4LA 1IY0A 2DY1A 2IC5A 2OO7A 1HQCA 4GSYA 4IEEA 1M1YE 3GLIA 1PUJA 4A8JB 5B58C 2F9LA 3QUSA 1J8MF 3KX2A 2ANBA 4NU0A 3JVUA 4DLZA 1TU3A 3BIFA 2D7CA 2ZU0C 3LW8A 1OH5A 2ATXA 2ZRFA 1N5JA 3GCGA 3K9LA 3I4LA 3UIEA 5ELXA 2D2FA 3DDCA 4CRWB 1G8GA 1SQ5A 5DLQC 1NJFA 2R6GA 1OT3A 3ADDA 4ARZA 3TQCA 1H8HD 1M7HA 1VCIA 5JCPA 3SDZA 3X1YA 5EE9A 1A4RA 1QHXA 1CRQA 3IPYA 4ZIRB 6Q21A 2A30A 1QHYA 4LUCA 1H8ED 2D2EA 4Q19A 1RRFA 2BJWA 1ZM4A 1YHNA 3DM5A 1KMHA 1YR6A 1XRJA 3K09A 1F3OA 1U9IA 1T91A 2BMJA 4BZQA 2ODWA 3GLIE 2ASEA 1OIXA 1E9BA 1FPMA 4PHTA 5EP3A 5GVSA 3I5XA 3T12A 1TNDA 2DWQA 1W36B 3UATA 3I8XA 4CIDA 4F91B 2NOAA 4Q4AA 2CHGA 3QNUA 2ZREA 2NO7A 2O8FB 1R4AA 2J41A 3V4FA 1YRAA 1RVDA 2DWOA 2QN6A 2WPDD 4IVPA 3SYNA 3TBKA 2GKSA 2DYKA 4HAVA 4Q48A 1JXOA 1E9AA 4A0GA 4BLTA 2WJIA 2JLWA 5B2ZA 2IYXA 4KU4A 3QVUA 1EFCA 1AKEA 1L4YA 2CBZA 2P2LA 4KYIB 4OI1A 1IOZA 5FTMA 1JR6A 4DSUA 2JCSA 2WV9A 4BFYA 4XVRA 3ECCA 2V9PA 3CR7A 1GNQA 2BEJA 3W5JA 3BJIC 2B7CA 2GJKA 2W6IA 2VSOA 2ZI4A 1U99A 1XJ0A 3EXAA 4D25A 3RYTC 5TB5A 1ZYUA 4MGZR 3K1JA 1UKVY 3IQWA 1R0WA 4LJ4A 2JLUA 1EWQA 4KXFB 5BQ5A 2O5VA 3Q5EA 4OJQA 1NRJB 1F2UA 1XMIA 4PAOA 1A2KC 4PPQA 2BVNA 4BLOA 2IS6A 2P6NA 2G0NA 1UBEA 2GF0A 5E95A 4LHXA 3CF2A 3EAQA 1KI1A 4IJMA 4X8MA 3L8ZA 3DPUA 2P67A 3AVOA 3IO5A 4OHZA 1U9IC 5C46F 2ZRDA 2QRNA 3U7HB 3SFVA 3QKSB 2ZRGA 2HYIC 1CULC 1RRCA 3PENA 1CLUA 1OSNA 3SS8A 2FGJA 4C2UA 1BIFA 3CPHA 3F5FA 1Z47A 2OCYC 3CPEA 1EWRA 1R2QA 1YJ5A 5J4KA 2D06A 4QM7A 3MAAC 1II0A 5LD2C 2XNDA 2PL3A 3L0SA 4UJ3A 1U8ZA 3NG1A 3VR4A 2FEOA 4ASUD 1P75A 3CX6A 1P72A 1Z22A 2ZRLA 2ORWA 4PHHA 4B47A 3LLMA 3H1TA 2VP0A 2YC2C 2VO1A 3RS4A 2CE7A 4W5HA 4AURA 3UPUA 1TQ4A 1G8HA 4P0TA 2ZR7A 3E5HA 2XZLA 3LXXA 1N5IA 2CNWA 2IYSA 4I1SA 1FNNA 1FP7A 4Q7MB 1ZBDA 3TSOA 1R7RA 2YV5A 3TUIC 3UXMA 1CJKC 1DG3A 221PA 3MJHA 4A2WA 4US1R 4PSVA 4A82A 4UNSA 1E99A 5EXPA 4KLZA 121PA 2VHJA 1T6NA 5AJYA 5J4HA 4TMTA 4TL9A 1FP6A 4FMDF 5KDLA 4IVRA 3SZRA 4LBWA 3TJZA 2WHXA 4C4PA 1W0JD 5DYGA 4JBYA 5KPDA 4L9SA 1S3SA 2IYYA 3GFPA 4HDQB 3A8TA 1MO5A 5C4MA 1VKJA 2DB3A 4JBWA 4OK3A 2C78A 2F1JA 5IF9A 5K8LA 3QJYA 1DARA 4QBFA 3Q8XB 2WWYA 1AGRA 3BXZA 4WZBE 3THOA 4Z1MA 3H4MA 2FH5B 3LA6A 4TMXA 4WIAA 2BKEA 3WMEA 3NXSA 1CJTC 3VNVA 1JB1A 1XF9A 2GCPA 2UZIR 2IUTA 4IXNA 4CDGA 1Q1QA 4BFWA 4M53A 1KK2A 3QEJA 1SVIA 4V0LA 3VX4A 3AKCA 3VFDA 3I3SR 3ETLA 4M8NE 1N2CE 4YXWD 1E9RA 2ZXUA 1X3SA 3RAPR 2QENA 1EG7A 1MO3A 2ZJOA 5BXQC 1KDOA 5FL7A 3PCRB 4AD8A 5AUPB 4AI6A 1R5OA 1GM5A 1E1RD 1LY1A 1KK3A 3RS2A 4UKDA 2FX3A 1RIFA 3U3KA 3B78A 4PX9A 4C0JA 3AVXA 1JECA 3GLGA 4Q02A 4QJ4A 3MGCA 1B0UA 3GJ7A 3N70A 4DLUA 4FMCF 4FMDB 3OF5A 1KI2A 1W47A 3NC0C 4F4JA 1KHTA 3QKUA 4Q7LA 1LW7A 2QPOA 4KFUA 2QT0A 1HUQA 3D6TB 1BOFA 1QHIA 4MYCA 3CO5A 3UMFA 2Q3HA 4JJKA 4IOKA 1T3SA 2FF7A 4V02A 1KO1A 1Q3TA 4PC7A 3AGQA 4NCIA 3EA0A 3HJNA 2A5JA 4FIDA 1NIPA 1KSFX 1OJLA 3DMDA 4HLDA 3SHWA 3IEVA 2WJGA 1KNQA 4G5GA 1W2GA 1WDTA 1JPNA 3K0FA 3UG6A 1NN3A 3G5UA 4N3NA 5FI1B 3ICEA 3HPRA 2W83A 3GLGE 1CR4A 4LGMA 3BB4A 1P9WA 3NH9A 4TQAA 2D3WA 3M4YA 5FUYA 5JWHA 1DO0A 2IYLD 2BEKA 2PEYA 1WQ1R 5CM8B 5AJVB 1G3UA 2CL6X 4TL6A 4URWR 3L0IB 3P4YA 1XBTA 1NY6A 3KQKA 2IXFA 2J9RA 3QBTA 4B48A 1W36D 1ZD1A 1OIWA 3AQ4A 3CZPA 4PC1A 4Q9IA 3QY0A 2ZJZA 1RJ9A 4BLPA 4MKGA 3UG7A 1P7CA 3TNFA 4D4MA 3ZDQA 2QAGA 1AKYA 1C4OA 2RAPA 2IL1A 4N0DA 4F4IA 1G7TA 3A1WA 2EW1A 1GIAA 2CJWA 2XGJA 2AD5A 2AKYA 1SXJA 4S2EA 1P4SA 1NN0A 1HYQA 2X19A 1VDZA 4LPSA 4MRPA 1OKKA 3CH5A 1WP9A 1KDTA 4I99A 1GOTA 3NH6A 3BH0A 3AB3A 3SBEA 1FMJA 1RZ3A 2JLXA 4OHXA 5A4JA 3VKWA 3M1IA 1D5CA 5B57C 1U8YA 1GL7A 3K70C 4B6EA 3MWKA 2W2VA 1XXHA 3EIEA 1A1VA 1XPOA 1J7KA 1E0SA 2F1HA 1UADA 3U7FB 3UMSA 4JLJA 3VMFA 2QZ4A 4A0HA 2REOA 1JXMA 2WMNB 2OILA 1SXJE 1Q57A 2YNMA 2IX3A 4A2PA 2QL6A 4ESHA 4GZMA 1GILA 4AYXA 4ACAA 5A5GA 2XB2A 1XEFA 2ZE8A 3TSWA 1HE8B 2PT7A 3TMKA 4DC9A 4IRUB 1AS0A 3RC8A 3NIBA 1VG1A 3EPHA 2AR7A 3KDSE 4HZIA 1MKYA 2AX4A 1I4LD 3KL4A 1XXHE 4KHZA 3GLFB 4RD1A 3LRPA 4XIGS 2QAGC 4EUNA 2XZPA 4O3MA 2PLFA 2ZJBA 4TLDA 5AJXA 1SKQA 4DSNA 2JLZA 2NIPA 2EFCB 1ZM7A 1P9NA 2H17A 1QF9A 1EFUA 2FJUA 4B44A 3BE4A 5FOTA 4CT5A 3B1ZA 4JLVA 1CR2A 1GWNA 1SXJC 3TE6A 3KTAB 1G19A 5CJPA 4AKHA 1UEJA 5K8UA 2BM1A 1N6LA 3SFZA 1XPUA 5CIWA 4FWTA 3TSZA 1SULA 2GCOB 2XJ9A 3KUCA 1Q12A 4GRAA 1M74A 1UEIA 4DSOA 4ZDKA 2IYUA 1ZIPA 1SHZA 1E2HA 4ZKDA 4A92A 5IHPA 2G83A 4LYJA 4QM6A 1RJ9B 4JLKA 1L7VC 1MT0A 1ZJ6A 4B74A 1N6OA 3T06B 3A1TA 2K5UA 2QEQA 1ESMA 2BM0A 3EWAA 4EPWA 1HH4A 1PZNA 2OCPA 2WPDA 2BDTA 2VP2A 2W2XA 2WWWA 3B9QA 2H5EA 3LWNA 5JRZA 2J0SA 2DBYA 1OFTA 3GFOA 5EE0A 1JBKA 2CVFA 2W0SA 2AHOA 3I1FA 4K46A 2GXSA 1SHKA 3FDIA 1I2DA 2JJ2D 2RB4A 3C7KA 4E22A 3X1WA 2ZEJA 3OFNA 2J0VA 1QVRA 4XWAA 2QRZA 4F38A 4LYAA 1TF2A 4YDSA 1M6NA 4PPFA 1PLKA 4LSGA 1WRBA 1KMQA 2ZRMA 1G8FA 4Q4HA 3IO3A 5TMPA 3LXRA 5GJBA 5AUOB 4NZYA 4K81B 3KXKA 1XXHB 3NTUA 1MABB 1VYUA 4BASA 3K0EA 1KK1A 3NHBA 2XITA 4P3YA 4HB0A 3BFVA 4QBGB 2GBLA 4QRHA 4CVNA 1RKBA 2G1KA 1GL9B 2X77A 1W1WA 3PEVA 4R71A 3IBGA 3PITA 4PSAA 5CYOA 1NLFA 1QBKC 3KXIA 3KJHA 1GSIA 3OESA 2IA5A 1VIAA 4KITB 4MRSA 5DN6A 4ZDJA 4EFMA 1OLOA 2ZI3A 3WRYC 1FMLA 3DOEA 4FCTA 2IYTA 4RD0A 2VP5A 5GADl 2ZR0A 2Q3MA 2HEIA 3HYRA 4C2TA 1Q44A 1R0YA 4MRRA 2OCBA 1E2IA 4YDHB 2ZVPX 4AWXA 4E09A 1KJWA 2PJZA 2ORVA 4KV9A 1WB9A 3FFAA 1E2KA 3WNDA 2ZJ5A 2WMOB 4TLEA 4MA4A 2VHTA 4CEIA 4DIEA 3FMIA 4DEXA 4LV8B 5DI9A 3WP0A 3GFTA 4PC6A 3MWJA 5TXGA 1E2EA 2ZTSA 1OPXA 4TMWA 3C5CA 3SJBA 3U4QA 5FUWA 5F2EA 2A5GA 2QGNA 1Z6AA 4BFVA 2RGBA 2YZ2A 4DSTA 3B85A 4DLWA 3IUYA 1OXXK 1E9SA 4K8OA 3IKJA 3HU1A 5LB4A 3THYA 1D6JA 4Y0VA 1QG2A 4CEHB 1HT1E 4PZZA 1FX0B 2P3SA 1I4TD 5AUQA 4AKEA 4OJKA 2GBLC 2PZGA 3MJRA 3CB4A 3NHAA 5FPTA 2XTNA 2HUPA 3CIOA 2QA5A 4AC9A 3ZVMA 5EUQB 1W0JA 3TK1A 4FI3C 4L16A 3I92A 3AF4A 2ZUDA 4M22A 2LCFA 4EKDA 1E2PA 5GJCA 2B6HA 2QQ0A 1WE2A 1KI6A 2O8DA 2E9SA 3J81k 4KSCA 1NL3A 4NL4H 5FOSA 2Q9AA 1VHLA 5AJWA 3KQNA 4P31A 1ZP6A 3CF6R 2HF8A 3O47A
chains in the Genus database with same CATH superfamily
3BXXA 3BVPA 2OLKA 4M55A 3LF2A 1E4EA 1C4WA 3H04A 1FJHA 3MMXA 4HLCA 4LZZA 1DBRA 1GLGA 1SUFA 4UAJA 4ZVRA 1KKMA 1G21E 2GPSA 1BFUA 2OZLA 4LQLA 4LK3A 1T43A 2WM9B 1W2WB 4L02A 4M8LA 4P81A 3D8NA 3SYKA 2NU6A 4NZNA 5TT1A 1KJZA 2C92A 2NO1A 4QOFA 2LCQA 3ZU5A 4ZMSA 1CV2A 4RFSA 4WHMA 3LWDA 2Q9CA 1B8PA 4JLMA 4YT5A 4YXWA 3VQTA 3AOGA 3DDNA 3OCZA 2E4UA 4BN4A 4R4JA 2RGAA 5JE8A 4D0NA 4OU5A 4FC6A 4NOKA 4N82A 4C7XA 1VKNA 4YRSA 4KLRA 4I5GA 2OFWA 5K45A 2O8CA 1E1RA 3JQGB 3ZHTA 1O95D 3DC7A 3F98A 5DWVA 3U5ZB 5REQA 1K8QA 1QQBA 4RK6A 3K94A 4OI4A 2QYOA 4LYFA 5EMNA 2W2KB 4E7OA 1E3LA 2OT3B 4MQ6A 5FLKA 1LDMA 2ZITA 3CO0S 1XAIA 4RY2A 1CY4A 2AOUA 3N8HA 4M6WB 5BN5B 4O2BF 2I66A 1VDMA 2H1SA 3LM8A 1RXIA 3S44A 3AL3A 2MSCB 4HI0E 1DQPA 2BJHA 1KZYC 4MZDA 5BOVA 2Z2XA 5AD1A 5BW8A 5C8ZA 5KEIA 5JYDA 1ESNA 2A88A 3E81A 2EL9A 4ZZ2A 3V1YA 3QE4A 1P1IA 3UM9A 1YZNA 5HCUA 5J2UF 1JXAA 3PQCA 4TUYA 4BO2A 3KWJA 4JT8A 1OV6A 1L1FA 3T9CA 4DHWA 1UC5B 3RG2A 2FEPA 3ZJYA 4JVSB 1R8QA 5JXJA 3IB6A 3GOHA 5E3JA 1KMCA 4AUMA 5AVWA 4DFDA 2ZUBA 5A71A 4EJ2A 4L6IA 1ZH2A 2OGTA 4B8YA 4MWSA 4M21A 2PH1A 4BDSA 2FNAA 2YWCA 3G6KA 1AS3A 3OX1A 1CR0A 4X61A 1TPZA 1W0KA 2I8CA 2J5BA 3RUIA 1YZVA 3TMYA 1HURA 3GT4A 3NRCA 4PYLA 1U7DA 5GZ3A 3BULA 3D1VA 1ZJWA 1CKEA 5TR9A 1L5KA 4DQLA 4HB4A 3UPTA 2I3ZA 1ULUA 1JAZA 4RACA 1ZK3A 8MHTA 2Q5CA 1IOWA 2Q62A 5EKDA 1I5EA 5IXSA 2O8VA 1P9LA 1C7EA 1D2EA 4Z54A 5A62A 1L4EA 5HUHA 1JTVA 4D8WA 3PNLA 5DSTA 1QRRA 2O3RA 2VWQA 3OEHD 4I50A 1FW6A 5ADVA 3CU5A 3BKWA 4UC0A 1H2RS 3HP7A 4RZUA 4H3HB 4ENTA 2HA5A 1Q22A 1QIKA 4K9NA 4CGYA 1J2UA 3QG5A 4Q9LA 1I24A 4D97A 1B0AA 4QQ8A 3WQSB 3I2GA 1CJVC 1Q0TA 2XKKA 3HKEA 4PBTA 2XT0A 1H66A 2OZLB 1JYFA 5AKGA 1SHUX 3EZGA 3THSA 5J23A 3JQAA 1DC5A 1Q14A 2XKAA 2J08A 4FCVA 1RAAA 1SKYB 2CHVA 3KZ1E 4DMMA 4D0SA 3NC1C 1NYLA 2V7TA 3D5TA 3EDMA 3LMKA 1JA0A 1US8A 3LL4A 2HO4A 1DZIA 3MMPA 4KN8A 1OHHA 1GZVA 1B76A 3QIVA 4O0MA 3NBUA 1AN9A 4R2HA 2H0AA 1YQXA 3EFOA 3BRWA 3OQ1A 3LD9A 1VSVA 4TKUB 4V03A 1SXIA 5EINA 1HFKA 2F7SA 2PA3A 1V7QA 2QZSA 5AJTA 3L05A 1FVFA 1ORRA 4MB2A 3EWNA 3V4OA 3ABSB 1T4DA 2JCXA 2O7RA 1EFRD 1XF1A 2EL7A 3FVTA 5BWLA 4AECA 3ZQKA 2R2GA 2ZTVA 2ZR9A 1WMSA 4OQDA 2F9MA 4UQOA 4YJGB 2I8AA 1DS6A 2E5WA 4M4SA 5TRTA 2IPAB 2IP1A 5EP1A 5B6IA 4YCLA 1QU3A 4DLRA 3U49A 2JHCA 4PLHA 4TLAA 3F6RA 1ZGCA 1WXHA 2AFHB 4BNLA 1SOWA 4EQ6A 5JR3A 4FP9A 2ZYGA 3DWGA 5LYYA 3ERCA 4I5IA 3DDUA 4JOBA 4RGYA 4XR4A 4N6GA 4H6PA 3DAGA 3KKPA 3KZCA 3Q5GA 1G6OA 4PO1A 3KQYA 4BUJA 3JZFA 2P7HA 1EVIA 1NUHA 1UT8A 1YRBA 2YQ4A 4JLOA 4QOEA 3TQSA 821PA 1RCFA 1KXZA 4JJFA 5ALHA 1ODIA 1T5OA 3B3QA 4FOSA 3GZ4A 4D9EA 3ETHA 1T1GA 4TS4A 4DWWA 2Z5GA 3A6LA 4U5XA 3RNOA 4KNYA 2R65A 1II9A 2FPMA 2QIOA 4QU5A 3W9UA 2GM4A 4PLPA 1GPLA 2X8AA 1TJ3A 2BP7A 4I9GA 3A7EA 4OO3A 1JIVA 1NQOA 1XHFA 5EIFA 3WB1A 1L7XA 4BLUA 1UQTA 2O52A 3GJQA 4W9NC 3HRHA 1PVOA 4ZVPA 2PYZA 3IAEA 2PEZA 3EQ9A 4Q66C 1OVGA 1X9GA 1VG0B 2CB0A 4I0WB 4ALMA 3G2IA 4JUCA 1C7RA 1O54A 5FP0A 1VJ1A 2D1SA 3GPDG 1MJFA 1SUDA 3QQPA 4C1NA 2X9QA 3RUCA 4B31A 4EW3A 1JJ7A 2CZGA 4INAA 3VSEA 4DMGA 3EOZA 1XHLA 3EX7C 3HSKA 2I2WA 3BHJA 2RH9B 1KZGB 4ON9A 5EKTA 1PJZA 1J25A 3I64A 4EJ6A 5IMSA 1X7ZB 2IDMA 2PD6A 3PDIA 4NULA 2R1VA 4XB2A 2IEGA 4KLNA 4DT1A 2QUHA 4S24A 1XA3A 3KCNA 4I4LA 5C5DA 2IUUA 5U4XA 1ZGGA 5CTAA 3THXB 1G64A 1VMEA 4RHXA 3D1LA 3IESA 1AVTA 2YW2A 3AJAA 3N5CA 1EAYA 3OZAA 5F33A 4LCJA 1OASA 4UUPA 5CB4B 3DONA 4Q1CA 4YWHA 3O8QA 2O7QA 1JEAA 1IWPB 2FPWA 3T7CA 3ZU6A 2Z2JA 4XGKA 1TM1E 4GF5A 3V00A 4DW8A 2VT2A 2W6PA 1AY0A 1Y3HA 3L0OA 2QBYB 1AGPA 4S05A 3WLNA 1L7MA 4B6OA 1N4DA 2FOXA 3UMBA 4BP9A 4CKBB 4E30A 3C85A 4YJKA 5FPQA 5ES4B 4NKRA 5E8RA 1KPHA 2W6ZA 2Y9PB 1JR3D 3DEAA 3EHEA 1X1AA 3L8EA 4TRJA 2O06A 3GJZA 1L0BA 5EA2A 4A0RA 1IJFA 2WT8A 3I32A 5DKFA 1WOMA 2WZBA 2HXYA 1E7MA 2Q2OA 3QP9A 4EJMA 1FU8A 3LWBA 3TLZA 1SOUA 1WDLA 4IUBS 5JARA 2ODEA 2L69A 2UZ1A 3NASA 2VWGA 4LCBA 2PUWA 4XGQA 2AZDA 5E2AA 4RW0A 5ILQA 1HE3A 4JODA 3DO6A 5LZ5A 4W6ZA 5M04A 3WGTA 4C20A 4MLPA 3L5KA 3OTQA 3A3OA 1GV0A 5A02A 3PE4A 4ZOLA 3IEKA 3Q2IA 1Q1BA 3EDYA 2ZZKA 4LTMA 2GJ9A 1KMHB 1XNGA 4NQZA 1G5RA 2F43A 1BC5A 3EZXA 4LDRA 3WQBA 1MTZA 3H5WA 4P33A 3IMGA 4HPJB 4QPCA 1VBKA 3OIGA 2I4RA 4UCQA 4UNPA 5DK4A 1EZ1A 1O3YA 3MPOA 4EY4A 1X9HA 1EUCB 2D1RA 1L8XA 1NQAO 1W85A 4ZQIA 4GVXA 3WB9A 4KI0A 2XA2A 5LB2A 1YSCA 3PDCA 3K96A 4EUHA 2VHWA 2VUUA 5KPJA 1XVIA 4KDCA 1YZGA 3EISA 2P5TB 3AJEA 4M1TA 4M1YA 2HIAA 3UC9A 2C9CA 1NJ5A 1C7QA 1N7GA 4PRZA 1U0LA 4IJVA 3IJ5A 4J49A 3RSSA 3CE6A 4CWAA 2FJPA 2R6HA 1Q2UA 4YUAA 4TV8F 3EPKA 1IHXA 3VVLA 1U3CA 1I4EB 1ZU4A 4CUZA 5B1EA 1A5SB 1RABA 4HQRA 3Q7EA 3FFXA 3S2SA 4CG1A 2VOJA 4YPOA 4UASA 1ECCA 1OY1A 2WUWE 1VSBA 1YMQA 3DM9B 5IJWA 3N7TA 1VMAA 5J5VA 1AX9A 2E3JA 4RPKA 1LKZA 3KBBA 1LFDB 2ZWVA 4R5MA 5HIJA 3KYDA 1G41A 5EJGA 2G77B 2HSJA 3C3EA 2QMHA 3EZ9A 5ELMA 3VBCA 2NU9A 1XI2A 2HQBA 3UUEA 4UMDA 4DC0A 5KNCD 2GTIA 1LRJA 4EPRA 3ZE7A 1NBWB 1RAGA 3F74A 2OVBA 3OCWA 4IXMA 4CUJA 2J9YB 2V54A 4CM8A 3A1SA 1G5HA 1ZNZA 3AEKA 3OAAD 4LHEA 4OXRA 4AI6A 1RFLA 2FWMX 3DVLA 1K3TA 3WO1A 3O4JA 4YYEA 5HJEA 3D6AA 1MW8X 4ND8A 4AJLA 2VA9A 3C6MA 3FGOA 4Z8YA 5BSWA 5JS2A 1ZD9A 1XUOA 3TXYA 3TZEA 1HI9A 3E48A 1ZQ9A 2Z5FA 1XFAA 1DNPA 1MQ8B 1P91A 3DBVO 3W2FA 5BWMA 2CLCX 2W2MA 1GO2A 3BD9A 4EBFA 3HVKA 1FTWA 4OD0A 5A3VA 4DCPA 2D5AA 2JLYA 4RQUA 2OOKA 4D9KA 3L49A 1VSQA 1VE7A 2FPGB 3WBFA 1FLVA 1C30A 5K3SA 2LIPA 3K5PA 4D0LB 3LX8A 2FSVA 1XOIA 3COVA 3AF5A 2VDJA 2AIRA 2XUIA 3M6WA 2W98A 4YP7A 5IRCD 3CVWA 3SEQA 4M7PA 3DWFA 4OB8A 5LOVB 2BTOA 4ZI7A 1O95A 1C3LA 4N65A 1DAIA 1TM7E 5E7JA 2HT6A 5KCMA 2XGSA 4C78A 4DR7B 4RD3A 4UHEA 2J3JA 2D2IA 1XP8A 3T1HB 4JYCA 1J1IA 1O5TA 4MDFA 3P2YA 4I6JA 4U3JA 4URFA 4UDYX 4YJHA 2QLJA 3CKKA 5C8YA 3SGLA 4L76A 2GCNA 1JFFA 3K72B 1LD3A 2IKQA 3KD3A 2FAXA 2GCIA 3P9QA 3EGDA 1SVSA 4TX1A 1R27A 3ZOZA 3PXGA 4AMVA 3F4KA 3OFSA 2WU1A 2HRQA 4FE3A 5D00A 1NNEA 1V8PA 5JS1A 4OBEA 3D59A 5EIOA 1R9NA 4PWZA 1T8UA 2G4CA 3G2OA 4QO7A 3NIDB 2CLSA 1WQ4A 3LX5A 3RRYA 4J07A 2Q3BA 1U4NA 3KJNA 3PXBA 4KO1S 5CEJA 5LP1A 4GHWA 4A36A 1MB0A 1NLMA 2ROQA 3MJEA 3TG8A 1GCGA 1XTSA 2QTVB 4DV6B 4QUEA 3FDFA 4QXMA 3M6FA 1V11B 4NESA 4TGLA 4ABYA 4BO9A 4CR7A 1PGNA 3K71B 1GRRA 3CV3A 3BREA 4NATA 5EZ5A 1X9IA 2X0IA 3PD0A 4FM9A 2Q2QA 4UNRA 1JAYA 1RYBA 1W48A 4WE3A 5E0OA 2QRJA 2WFAA 4JUIA 5CCXA 4XD7D 2PUFA 1J90A 2FQWA 4EA9A 3UO8B 1JVBA 3NAZA 3UWDA 4RWEA 4OJNA 3ZBUA 4KQJA 4R1PA 3MTQA 2WTAA 3FI9A 4IOLA 4GH5A 4KC0A 4MV7A 3PTLA 4Q47A 1GPH1 2CE2X 4RA6A 2FSVC 4DGQA 1U2EA 1H6AA 1UC8A 1IXKA 3T35A 3DQQA 3KYCA 4UCXA 1AQYA 2FETA 3CRW1 2BKUA 3EJ6A 5GAJA 1P0FA 3S8MA 1GUYA 2B2CA 3U3RA 5KQGA 3TKLA 1PNOA 3W9YA 5FWAA 3LQQA 3GVHA 3NHSA 5HFNA 3ZI4A 3O31A 5I7HA 5FEMA 3RU9A 3UGTA 1KR2A 1QLWA 1VIMA 3MW8A 5DXAA 1BS1A 3OCUA 4FFSA 3LXUX 2Q99A 5GM2A 4DCVA 3WDKA 2Y1GA 1U7XA 2EJUA 1NLUA 5LNK6 1U0RA 1GKIA 2NSYA 2VAVA 4KIJA 3W5IA 3FJYA 3L1VA 3RF6A 3AP1A 2NPFA 5E6UA 5DYIA 3TW8B 3RIEA 1ETHA 3K1AB 2HJGA 4DV0B 4MKFA 3TD6A 4NICA 3SIXA 4Y9RA 1UJ2A 2WIKA 3ONNA 2WJJA 1C41A 3A6GA 1ZNWA 2C3OA 3ZQ6A 1KK0A 4LTDA 4YMGA 2WB4A 3ZY5A 2FWPA 1AT1A 2VDOB 2YOGA 3P9NA 4RA9A 4X1YA 4MP8A 2HRCA 2ODTX 5FO0A 3PE3A 1KFCB 1RLMA 1KAOA 3WLQA 1PWXA 1YTLA 2AHRA 2G17A 5TQ0B 1CEEA 2V7UA 2FMIA 3ACDA 1JNYA 1R5NA 3L1KA 4RU1A 3A4LA 3ZI0A 4BWGA 4D6XA 4DZRA 3TD2A 3WGKA 5ECGC 1TAUA 2VSXA 2ZPUA 3WLRA 3IEUA 2WR8A 3K15A 2V1XA 2ZBVA 4WOBA 3V8EA 1T5LA 1G3QA 2I65A 3ZXIA 2XCQA 4M8SA 5KX5F 1WB6A 1ZD4A 3H9JA 2YCBA 4PINA 3G9XA 2EZ9A 1RLUA 3GZNA 3K0FB 4X95A 3VDNB 4EO9A 2BI4A 4LJ9A 1F8FA 1Z17A 4ZJPA 1GTL1 3IILA 1A7JA 4ZJUA 1DB3A 2W58A 5EJ7A 2C98A 3QFCA 2R60A 5FPKA 5LR6A 4MW9A 1ECPA 1NBME 4OYLA 4NR0A 3G1TA 1PQYA 1L5OA 1LNZA 1QGZA 3MB8A 3TCNA 2X1MA 4Y6RA 2R6AA 2ESRA 4O5AA 1YOBA 2OQRA 3FKQA 5M34A 1U3FA 1Z4QA 4MA5A 1P2UA 1YU9A 2PS3A 2WICA 4UOZA 2Z8YA 2HNAA 3GH3A 3LUPA 1CUZA 2ZVJA 1QCDA 1W5SA 2C31A 1TZBA 2DLDA 3H0KA 3QMWA 2QAGB 4RKEA 4OA5A 4UZFA 1K5DA 1E5XA 1EFLA 1Z0ZA 2JLRA 4RZ2A 4FYIA 4IIJA 5HS4A 1FLDA 1G16A 1QIEA 1MU0A 4AJJA 1PE0A 4JLDA 5DTQA 4GOKA 5F9FA 2J09A 2GBGA 3Q3JB 4RKYA 1VLLA 4FEEA 2ZRBA 4M98A 5AESA 2OFOA 3AKYA 1SUAA 3ES9A 3KR1A 3HV2A 3ZVLA 2GXUA 4MB0A 1QO0D 2XAAA 2QM8A 2F2TA 3TNDA 4E4RA 3FPCA 5A03A 5EJ8A 1V6CA 2XB9A 3CVJA 1CDOA 4UD6A 5DM70 3P7MA 4D46A 2PNJA 2I7DA 5AW8A 1C0KA 2DPXA 2I6TA 2RHLA 4LOKA 3RVJA 2JIBA 1SR8A 2ZDGA 4WZAE 5EE3A 2IP2A 3DXYA 3GJ4A 4HO1X 4R2LA 4FYPA 1L5QA 3ZDYB 3CBGA 4GR4A 3WBKA 1GPNA 1U7TA 3VKUA 3KUUA 5A3SA 5CNJA 5L3VA 4JEIA 4G1EB 1HLFA 1XXLA 1O6ZA 2Q6OA 3DDHA 3SZUA 3VPDA 2VUHB 3ECSA 1FP4B 1NR1A 4FNAA 1W9MA 1QVAA 1X7YA 4X1YB 3PYMA 2VRCD 2VYVD 5B1SA 4IYJA 4RZIA 3NHUA 4GOOD 4CMJA 3NX4A 1A4IA 2O6LA 3NOXA 4EJSA 3E9DA 5AYVA 2MYNA 3G85A 1ZQ1A 3PVSA 3VR6H 2J0UA 2A92A 3ONWA 2E1RA 4P4NA 3Q9NA 4QULA 1Y3AA 2Z3ZA 1ZHFA 1F20A 3BF8A 4Q9NA 1TA0A 3S7TA 4C0QC 5HW0A 5IS2A 2EFHB 2MJLA 1R0XA 3C4JA 4LYDA 3RREA 4NPHA 4XVCA 3BH6A 3TXXA 2QJTA 4HWPA 4JXKA 4B5LA 4KJXA 3GZNB 4M1EA 2H1FA 1AGNA 1D09A 1M1XB 1H5QA 5GGXA 3GZJA 5AI5A 3W2IA 5CDUA 3KJFA 4CYMA 4B3TB 4PBRA 3DS8A 3DXFA 4C2AA 3D1JA 1ZD2P 4UEJA 3W77A 3EXFB 3ZZTA 1XMOB 3MG9A 2PSHA 4O4HF 3C87A 3L7OA 1KE2A 3LY8A 2YINC 3D3KA 1CRPA 3KAJA 2GF2A 1HV8A 4MV4A 2IUEA 4B76A 1IDN1 2PSSA 3KTDA 1IN8A 3LW7A 2R86A 4PGHA 4JKIA 1H9CA 2C03A 2VJNA 3EASA 5B1HA 1KI9A 4G1VA 4WERA 4BB9A 1GSHA 3PR2B 3ZGYA 4F6CA 3KM0A 4CLRA 4UBNA 4GI3A 1RYNA 1NLZA 1TK3A 2J9ZB 3H16A 4O1HA 2R7MA 4WJZA 2W2OA 4Z9BA 1APBA 2FFQA 1V0JA 4O4IA 1LX6A 3HQ4O 1HT2E 2B8TA 3L6OO 4UM9B 1E7YA 5HK8A 4ZO7A 2VNAA 2WINI 5BWBA 1VA4A 2CB9A 3E84A 1C7IA 3IQZA 2GD2A 1LI4A 5LMZA 2BFPA 3DBHA 3W5SA 2Y27A 2ZXEA 3TBHA 2IH4A 3UJ6A 4J7AA 3DKPA 4LXXA 5FOVA 3F3SA 3QK7A 4RVGA 1URPA 1Z25A 2J3QA 2OZEA 2OCAA 2HJSA 5FQNA 3T3OA 1TVMA 4KN6A 4IQFA 2N9UA 1ZOLA 4QFCA 1TXGA 1JBEA 1IHOA 3QBVA 1C0PA 3UYKA 2BR3A 4EJSC 8GPBA 1SD1A 5NLLA 4F4HA 4U5QA 4Q4HB 1YB4A 1CK4A 1P0PA 1G7RA 4FT4A 4WXRA 2PV0A 4HAZA 4C30A 4DPKA 3LQRA 5AW9A 4FINA 4XLZA 4ZI5A 2HR1A 4Q6WA 1N9GB 2WF8A 3TSCA 4EKNB 5KWEA 1XDWA 4DCSA 1PEAA 5AVJA 5HDBB 4C76A 3MM4A 4LRYA 5JEEA 5I5EA 2QW1A 3U2QA 3OLVA 5IC6A 2OGWA 4L7QA 1BO6A 4RTKA 4FPXA 3BORA 1U5BB 4C4RA 5BSHA 5CD1A 4IIVA 1NBIA 1WOYA 4I4IA 4GMFA 4K3UA 4L5AA 5T4HA 4U7PB 1BD3A 3D2LA 1SAYA 2ADMA 2W2QA 4FYMA 5ANRB 4LRTB 2PBFA 5JOQA 1CUAA 3ZBTA 3L0CA 1WY7A 3MF4A 5A7GA 2PH7A 3DMTA 4MLCA 5CG2A 1EA7A 4M46A 3VHXA 4RJLA 2J1LA 4E88A 1WHTB 3TL2A 3C41J 4ZAZA 1LVGA 2OCXA 2HJRA 1BAPA 3U5TA 2VJMB 1OXTA 3GLSA 4U63A 5FORA 3HJRA 3ZZ1A 5EFOA 1JHAA 2IXGA 3TYXA 4J1SA 3VHRA 3ZIUA 2BMEA 2CWWA 4XQ0A 5JNTA 4YP5A 4J91A 1QDEA 3UK2A 1CYEA 4D42A 4PCLA 1P2FA 4G2NA 2YXPX 3HHPA 4IXWA 5ECWA 4CEIB 3LBYA 1ZK2A 3MPUA 5DNCA 3GA5A 2O54A 3GRPA 1X1CA 1YT5A 4PV7A 1JQBA 1Z7BA 1E1DA 4ZVSA 5M29A 1IYZA 1FU4A 3E9MA 3IUNA 1WUKS 3V7FA 1E6UA 1FMFA 4IMJB 1TYZA 3RE1A 4LZOA 4CE6A 1W25A 2ZSFA 3QE9Y 4LF4B 1PJRA 2C84A 2BCGY 4AJ1A 3I83A 1RVV1 1FYFA 1DJOA 4ZDIA 4GS5A 2JF0A 2H2HA 2GFHA 5FBZA 1N1DA 3FOCA 4EUEA 3JALB 4U0KA 4IJUA 1T3HA 3COZA 3UMVA 4CLRB 2QV7A 4WKCA 4O4LF 3R6TA 4EX7A 1FRNA 4OYYA 1EWTA 1WA5A 2QX9A 4ZZ1A 2J5XA 4X7PA 5IM5A 3TOXA 3WYCA 2JAPA 3UWSA 4D1YA 1KY2A 2OXCA 2ENUA 1JALA 4IIEA 1Z6XA 5C37A 4JLAA 5IP5A 1XJQA 3D0QA 3C3PA 1FUYB 1TJ5A 2OO3A 4GMKA 4YQFA 4KGDA 4G0YA 1D4ZA 3QW2A 3AT1A 2V58A 3EEIA 2E2WA 3HWSA 4TSRA 3X2EA 4AS2A 4Y3UA 3FPJA 2D7JA 2EIXA 1CTQA 4X00A 4F1WA 1AB5A 1XMSA 2A0UA 3CLSC 3EG5A 1JH9A 1N9KA 4PFJA 2O8DB 3UYLA 1Y37A 1CNMA 1QZ3A 1IQPA 2XYQA 5KI6A 3WICA 3DMTC 3M9WA 4Q7JB 3A6EA 5DGXA 4AIIA 3VTZA 2DFNA 5EZYA 1V8DA 4DLSA 5AK3A 2FU5C 4R81A 4XD7A 5MN6A 1CJUC 2MSNA 3IH5A 1T2AA 3A7DA 4U6QA 1DQSA 1G9XA 3FE2A 3I12A 2Q5LA 2A9KA 1EEHA 1I3KA 1BH2A 1UOPA 1J06A 3PC7A 5BN3A 2QRVB 4I6EA 1T1EA 2XYGA 3ZV3A 1DBSA 1PAUA 4MOWA 4YVFA 4JJGA 3TTXA 4FIZA 3FZGA 4JVOA 3IRVA 1OYWA 3UC5A 3H2IA 2AS0A 2YX1A 3UVEA 4HN2A 4V0NA 3QIAA 1I2MA 3WMGA 2HMTA 1WUYA 2IYEA 4K87A 4OHVA 1D8TA 2CXXA 2OBXA 4PONA 5D6OA 4JXZA 1XTPA 2WIJA 5DZSA 2W93A 2I55A 1Q0ZA 4TPKA 4RBNA 1PI3A 3RBVA 2VCYA 2WWHA 1I5OA 1XTJA 4WA8A 4DEYA 4LXYA 2IYQA 1X8KA 3CZMA 4JK3A 4A1OA 1DEKA 4MQFA 3P5SA 2R6CA 4NCXA 1OBFO 3FCYA 2X2FA 4MHOA 4MQEA 3WYGA 2FWIA 3COWA 3HA5A 1G5TA 3VPAA 4BQOA 1G8KA 5E1MA 3GFBA 2AE1A 2ZJ8A 3MB5A 4FOOA 1TAGA 3CRVA 4ZTBA 1H65A 2F1RA 2XNKA 3OECA 2JFVA 2OCDA 1TQDA 4RNDB 2IEYA 1JWBB 3RYIA 3U31A 1SG0A 3OQBA 4L75A 5CT5A 1JU4A 3OTIA 3CZRA 5A4FS 4OQ4A 1KO5A 1RR6A 2P4QA 4EMTA 3FSEA 5HTKA 2BEVA 3I0MA 3MWEA 2EX4A 4HK4A 2C9YA 1WMAA 3OIYA 4K05A 3URMA 4Q12A 1UEXC 3AR2A 1LTKA 1X94A 3HZOA 1S96A 2X3FA 3LC2O 3DLCA 3P26A 4QJIA 4XI9A 4A6PA 1L6RA 2W4QA 3G02A 2WYHA 4R2IA 1FFBA 1K7EB 5LQMA 4CV2A 2NO6A 2XQVA 3VR4H 3M5PA 3HSYA 3MTJA 4R0MA 3MBIA 1TM3E 4XEHA 4HNTA 2JD1A 3MIZA 2Z98A 2OV2A 1GPKA 3FIUA 4N8EA 5HF6A 5JECA 1RSZA 4CQLA 5DBEX 5F9HA 4V0ME 1AHIA 4IBOA 5KYGA 1GQYA 2VDNB 1MDFA 5EPOA 3PDWA 1MV8A 3V8VA 1P1BA 1YDGA 4G85A 1IONA 4NI5A 4TQUS 3VH1A 5HF9A 2QLLA 5BURA 2NXEA 1DRUA 1TMKA 3A32A 3ESZA 3CCCA 3WWOA 1U81A 5IHXA 4CM6A 3CUYA 3PE6A 2ID9A 1SVWA 1ABEA 4Z4HA 1PFVA 3DMNA 3N75A 3GRVA 3SR3A 5I7FA 4Z4IA 1K6MA 4GP6A 3FYHA 3IT1A 4ITVA 4P1ZA 3RVBA 1XEAA 2RJNA 4JC8A 1ZVKA 5ENVA 4BNYA 2PK3A 2OMKA 3DFIA 5IANA 1E59A 4TV9B 4MX8A 1N2ZA 2HRBA 4Q3OA 3W8DA 4F5ZA 5JT1A 3Q85A 4D79A 3LECA 3WNBA 1E4VA 1ZGJA 4HUQB 5DOVA 4E5YA 5KUTA 3OZ7A 3ZZUA 4EI7A 1X87A 4EYQA 1UMCB 3AFGA 3JATA 3QV1A 2CDNA 3E7PA 5P21A 5JZSA 1YVEI 4AF7A 1MB2A 2HDOA 5JMWA 3AERA 1UODA 2JJ2A 1LS1A 1F4LA 1BVHA 5K0BA 3EFEA 4URHA 4EFLA 4G0VA 3ZTTA 1N78A 4D3YA 3BK1A 4Z7OB 3TGPA 3AF6A 2W6NA 3RFUA 1WMBA 1YZLA 2YJ6A 3O90A 1U94A 1XRMA 4LK2A 4LOAA 5CP8A 1YF3A 3BWDD 3TLJA 4U8GA 5I45A 5JS6A 2FDRA 3PRHA 2AZXA 4F3CA 3N2KB 2JEOA 2Y76A 3OPYI 2LPMA 1H22A 4N5LA 3VNSA 4Y7CA 1RW4A 3VPSA 3GLHB 3KHKA 4R3NA 3C7DB 3HXTA 3WKCA 3WSWA 5KYUA 4KK3A 5JJBA 5BSVA 1QGAA 3RSLA 1PN3A 3ZHYA 4MQEB 1PWZA 2JLSA 3MUNA 4ZARA 4AMZA 5I4CA 1WNTA 4OM7A 3I9NA 3NCTA 2B7LA 1U0FA 4MPDA 4XM2A 2GYUA 1P2BA 5AHXA 4IIDA 3K6KA 4X7RA 3GX1A 1N3IA 1EYZA 2VYVA 4YASA 4EYEA 4KRXA 1V71A 4B3FX 4XOUA 4EPXA 2HMUA 4WKOA 1I1NA 2FW1A 2I1VB 3IURA 4G9EA 2BEVB 4ARSA 2GKOA 3NMUF 1JXQA 2XADA 3OHMA 3WAJA 1AKQA 1MP0A 1IH8A 2QD4A 3LUCA 4QTXA 1IXRC 2DH6A 5FR1A 2GXAA 4K9OA 2NUPB 3IAM1 2Q3EA 5EIXA 3ZWAA 3HZHA 3HXLA 3Q0EA 1TJPB 3TPFA 4LKOA 4FFOA 1E2BA 2VJKA 2JGKA 4M1WA 3ZCUA 5I7UA 5EJMA 1A9QA 3CMMA 4AU1A 4BAUA 1XZQA 2AI1A 3NHFA 1GNSA 1K9SA 3CA8A 4BNHA 2WHYA 4FQ7A 1XJCA 4AG6A 1Y4ZA 2KLHA 4XPZA 3DA8A 1B6GA 1RP1A 3OH8A 3OQHA 4Y2PA 1DRVA 4PQFA 4EDHA 3P9KA 4YLYA 1X7WB 2OYSA 4OHMA 1IVNA 4LZAA 3R7DA 4BGVA 1VJDA 1E2GA 3BZBA 3OKPA 4ER7A 1NM5A 2RGCA 4QVIA 4MKIA 4FFBA 1TLTA 3DZFA 5CD9A 3DEFA 4U7GA 3S55A 2DAPA 4AKSA 1NAHA 3EDOA 1MJHA 5ADHA 3KYJB 2PMWB 2G06A 2ILVA 2N75A 3I6YA 2H52A 4GBED 3CW9A 4BNNA 2ZWIA 3Q5DA 2HKIA 1WL8A 1KYXA 3KR9A 1XWWA 4XTRA 5T3UA 4R1TA 1TECE 2C94A 2V3WA 5B1YA 1ZNXA 3UW3A 3W5BA 3FCAA 3ZLJA 4G07A 3CH7A 1JRLA 2KBFA 1K08A 4FQ8A 3HRIA 5HRUA 1NPYA 2XUOA 3AUTA 3G88A 2ZUVA 4L5CA 3SEFA 4GPIB 4WLOA 5CB8A 3GBSA 3WHKA 2QZZA 1QUFA 3CLRC 4W4TA 3ZD7A 3GLUA 1E94E 4QYXA 3I9OA 1LC3A 2X14A 1NW7A 1O1YA 3AF3A 3OBBA 3QLUA 2AK3A 4BZZA 3VZBA 1EXDA 3N86A 2X5NA 2C4MA 2Z3VA 4FN4A 4UZEA 3L93A 2P3OA 1U2TA 2HK8A 3C6YA 3IIJA 5AW2A 3HPQA 2PX3A 1J1ZA 3KIPA 1DAEA 3RYCA 4K9LA 4N03A 2HWWA 2ZAOA 2JAOA 4PICA 3WDLA 1FYEA 3QTTA 1N1EA 1A5TA 1E1CB 2IY8A 5GV8A 3V7YA 5GGYA 3LPCA 4OLFA 4QT4A 4ARCA 1KVUA 3MIIA 1FBTA 1GKUB 5K6AA 3U44B 1PUXA 1BMQA 1IVYA 1W0CA 1OV4A 2IS2A 3MTAA 3P20A 2VC2B 2WWVD 3VUEA 1IAQA 5DSXA 3B51X 1X80B 4KOAA 1PEYA 2ZIEA 1FSZA 2ZJ1A 1JGTA 2I9KA 4HGYA 4MDEA 3ZIAD 2WWXA 1NM5C 1P4AA 3HDTA 4GOND 2VRBA 4TTVA 4S0XA 4CF5A 4YRFA 2O6HA 2VT7A 3RV4A 3GP8A 1OIVA 3R0JA 4AFNA 4ARIA 4TT3D 5DIFA 4Q3BA 1N0VC 2XD4A 1BMFD 1T3LA 2B34A 1JJIA 2PL9A 4WXYB 9LDBA 4OGWA 1Q1NA 4TWRA 4CEJB 3HA2A 5TQJA 4YWJA 1P1KA 4LI0A 2I7CA 2QN8A 4PSCA 3S27A 1P73A 3L5OA 1AZLA 4Z0NA 4BE7B 4E5KA 3MSXA 1SBZA 3MRSA 3H1PA 4YONB 3Q3HA 1E9CA 1QP7A 3ZV6A 1P0QA 1LB1B 4EF4A 3SQXA 1CG6A 4XWWA 3OF3A 5D1HA 4HPWA 4ARVA 2GYWA 4EW6A 1VL0A 5DX1A 2FP3A 5FL3A 1SH7A 1JMVA 1I6KA 3O8OA 4IOMA 3V7UA 2FDCA 3IELA 4I5FA 2VL7A 4HTFB 3SJCA 1FTSA 1ZGAA 2HUNA 3H1EA 3ZYZA 3AF0A 3QLUC 4QC2A 3B3GA 3ILSA 1I30A 3RUDA 4HXEB 3RFTA 4DABA 4DXAA 5JD3A 4GEKA 1Y9JA 3O0DA 4M1MA 2AN9A 2I4LA 1EQAA 5J9FA 1GN8A 3HY3A 3ZV7A 1TVEA 2BF4A 4LX8A 3BJRA 5E4YA 1BXZA 4G6ZA 3OA0A 1A2BA 1Y5RA 2F17A 3KOMA 3AM3A 1BE0A 2YBEA 3BEOA 4QYWA 4REOA 5CX4A 5BMOA 2OBFA 1ODCA 1M1ZA 2CLMB 1QNLA 3T1TA 3IUJA 3VSDA 1LPAB 3JASB 5EWMA 3B6MA 1KYIA 2JRCA 5K6AC 3DDOA 4Y6PA 5A05A 3AETA 3VXKA 3L6UA 4MRNA 1NBAA 3V46A 2G9RA 1G3MA 1D7AA 1SHTX 5IK2A 1P19A 4YJFA 3SQDA 4ZT3A 2PR2A 2X2OA 2GLUA 5F7XA 4G0NA 4HFJA 5G1NA 5AW5A 3TLMA 1RZUA 4MS1B 4DY6A 4ZYTA 2A0FA 3BGIA 4FU0A 2CXTA 4A73A 2A6PA 3RWOA 3GGCA 3IYLW 1NVEA 2IIVA 5ESDA 5IDVA 5E1DA 3HB9A 4EHIA 1FQWA 4DRYA 4GOXA 2J45A 3QF7A 1I2BA 1Z0KA 5AOAA 3W2GA 4H60A 4UTVA 2G1PA 1YH3A 4Y6OA 3SNHA 3GMTA 5M3BA 1BKDR 1IJBA 2GRUA 4JLSA 2C9MA 4HRAA 1OBHA 4O4JB 2XGGA 5BSKA 1U0EA 3A1CA 5HR5A 5FFNA 1IEVA 1UM8A 2YYSA 1FEZA 4MJ7A 4DPMA 4DADA 4Y1RA 2GHIA 3JVDA 2J7PD 3E61A 1J99A 1CY2A 1YQGA 3ITDA 3JVIA 3LC7O 5AM1A 1ID1A 3FCUB 1VJ5A 4FOTA 2JIQA 3JYOA 4HDMB 4AK9A 2PXXA 1GUAA 2HK7A 1MABA 4O33A 2QI9C 4GXRA 2UVDA 1V4NA 1XTIA 1VJCA 3BXFA 4KUGA 3WL7A 1ORHA 3QYJA 4PF1A 5GINE 5KYKA 3HUDA 1JKJB 4NZMA 3IUMA 2ACKA 4RHEA 1IHPA 4BQNA 4GWKA 4D26A 5DM2A 5JQGA 3HB0A 2UYCA 4HNQA 2QGZA 3R5FA 2NV2B 4BEWA 1A9XA 4G09A 1E62A 1YKFA 3ZE1B 3HVRA 4YMVA 1Q20A 5JALA 4YIHA 5JZ9A 3T5DA 3O1IC 4WH0A 4CMCA 4QG3A 4G0OA 1CUBA 4PNPA 2TMYA 2NSJA 2YMMA 4ZT6A 1LF0A 1RYFA 4G5QA 4F2DA 4MPJA 5H7XA 2HK9A 2QMOA 1TDJA 3ZJUA 3QSYA 2I29A 5TARA 1H2YA 1CZNA 1PGOA 2BSAA 3TTYA 1F8YA 3O3MB 2RHRA 2YXDA 2O0JA 4MVCA 4RLSA 1GLNA 1YDEA 3F6SA 2HDWA 1ZCAA 2GPJA 3P9YA 1JKFA 3BD8A 1PKXA 4HLQB 4HZUB 4MLDA 3CUWA 4WFIA 5KU1A 4E2FA 1LSOA 1SCNE 4XIYA 2CVHA 4IM7A 5K05A 4ZRMA 3E3OA 1ZINA 4C5BA 4BNGA 5JSKA 3EIFA 4F2PA 4RSGA 4RTOA 1NV8A 3N2NA 4C4AA 2X1VA 4FD2A 1ESDA