2IYWA

Shikimate kinase from mycobacterium tuberculosis in complex with mgatp, open lid (conf. b)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
178
structure length
178
Chain Sequence
b'APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPSPSEAATLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
pubmed doi rcsb
molecule keywords SHIKIMATE KINASE
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 67
structure length 178
sequence length 178
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iywA00
2AKAB 1YZLA 3THYA 1V43A 4MGKR 1KYIA 1FX0A 2J5XA 4NYJQ 4CEIB 2O0JA 4Q4AB 3NDPA 5G53C 3KJEA 4WIAA 2W2XA 1ZC4A 1KI2A 4X8HA 2F43B 4HATA 2I3BA 4C30A 2GWHA 5FL3A 2JCSA 1J99A 3NC1C 4P4SA 2W6JA 3W90A 1E2HA 3FOZA 1COWA 2GCPA 2CDNA 1JAIA 3IQWA 2IYZA 2DWPA 4IDHA 2ZI5A 4URXR 1IY2A 1T5LA 1Q0UA 1E2IA 2JJ1A 2A7QA 2QGNA 4ZCLA 3UWOA 1AKEA 3ZS9A 3K9LA 3SYKA 4OQNA 3K0FA 1TEXA 2Z0MA 4OHVA 4M1SA 1EWRA 1TQ6A 4RCZA 3U3RA 2ORVA 4A0HA 1P2UA 2J46A 4RZ2A 1R5NA 2FGJA 1IN7A 3W8NA 1R0YA 1G8GA 4CZ2A 5L3SA 3TMKA 2QEQA 3CM0A 1NY5A 1ZYUA 4Q9HA 2RGGA 3FHCB 3Q5DA 4Q1BA 1ZUHA 2QPAA 1ELOA 4LWZA 4GOKA 3IPXA 2BEJA 2OBNA 4DXAA 2ZQ5A 3OFNA 2QN6A 3AGPA 2IXFA 2OUKA 3HPQA 2FFQA 2XB4A 1P2SA 2HJGA 2ZE6A 3HYTA 2DWOA 4MQBA 2ZTSA 2FJUA 4ASUD 2Q3HA 1GFIA 3P27A 3TLXA 1DBSA 1II8A 1LFDB 3SFVA 1W7AA 1VIAA 4MRSA 4PO8A 1L2TA 2FEOA 1OIWA 1GM5A 3L2OB 3LW7A 3X2SA 1WA5A 4DC9A 3BJIC 5A4JA 4TMVA 4UXJA 1XNJA 4FW9A 3T35A 3QXJA 2Q9AA 2KBEA 3AKEA 3MG9A 2IEZA 3NBXX 1N6OA 3KTAB 5J4YA 5AJWA 1LW7A 1Z0AA 4RCYA 3JZMA 1P5ZB 4C0KA 1ESNA 4F91B 2OSBA 5FBQB 5BYJA 2J59A 4GBMA 3B13B 4UNQA 1TF7A 1KSGA 5KPDA 3CPJB 3FGNA 3QF4B 1S1CA 2Z6VA 3I32A 1W0KA 3AM1A 1KIMA 1ZM9A 1W4AA 2IXEA 1QRAA 2W0SA 3HJNA 3Q7PA 2ASEA 4IVQA 4B3CA 2BM1A 2GDJA 3SDZA 3TSWA 2OG2A 3K8YA 1Z22A 1QBKC 2GESA 3ECCA 5FFMA 521PA 1R10A 3E1SA 3VR6A 3RS5A 2J7PD 3R8FA 3UG6A 1W49A 2FSGA 2YWGA 2Q9BA 2AKYA 3I72A 4GPTA 3AV0B 1OFHA 1FMJA 2FNAA 5E7JA 1QVAA 1OXSC 2AK3A 4G5SA 4RVCA 5FBWB 1ZM2A 5AJXA 4M1OA 2OCPA 3B6EA 5JCPA 1ZIOA 5DHAA 3ZLJA 4A0RA 2CLDX 1PZNA 3QXXA 4QFMA 2ZXUA 4QM6A 3DPUA 3ND9A 2WAXA 4QHYA 1KSHA 1H8EA 1M6NA 2F7SA 4ERNA 2RGNC 3IIMA 1N6NA 3E5HA 4PZZA 4RD2A 2J0SA 1XDBA 5KPJA 1YU9A 4A2QA 3EZ9A 1DPFA 4QGHA 3M0EA 1G9XA 4LJ8A 2KI5A 1BKDR 4KSBA 4PFSA 5L3VA 2DBYA 5JWRA 2O8EA 1J8YF 2WHXA 4I1VA 1N2CE 2QE7D 1XXHE 1G8PA 4G5QA 4AYXA 4Q9IA 4B44A 4BRUA 3LX8A 4BLQA 1NKSA 2EFHB 2HT6A 1G1MA 4TMZA 3NBYC 1IJEA 4FI3C 1NLYA 5FOUA 3GLFB 4LUCA 1JR3A 2OZEA 1YR6A 2ZRLA 2ONKA 4YDHB 5ELXA 5FR2A 2CE2X 2ONJA 4KFUA 3Q85A 4W5WA 1G291 4HUQB 1ZM7A 3T1VA 2GETA 4MGYR 1U90A 4R98A 3WRXC 4EFLA 2HV8A 3VTKA 2ATXA 1ZCAA 3EW9A 1QHGA 1NSFA 1UM8A 2REBA 3GEIA 4FMCB 3TUZC 3AKCA 4Q1EA 1DARA 4EPTA 1HY3A 1Z6XA 3QEJA 5K8TA 1Q1QA 3MAAC 4E07A 1Z08A 5EXPA 2ZYUX 3VQTA 2V4ZA 2QM7A 4IDPA 4BFVA 1ESMA 2H7VA 3AEZA 4D4LA 4WXRA 2ZRAA 3PENA 2ZRKA 3MWKA 2Z4RA 1HQCA 1SHKA 3PEVA 3VHXA 1Z83A 4IOMA 4IVPA 4PHHA 4FWTA 1CBUA 1XTRA 2BC9A 2EFGA 5KDLA 1KJWA 5AWFC 2Q0HA 3PQCA 4B35A 1F2UA 4HB0A 2DHRA 1X86B 2OBLA 4K8OA 5AUQA 2ZUBA 3AQ4A 4TLEA 2HT1A 3I92A 4B6FA 4C9BA 2ZUCA 4JLPA 4JLKA 2R6AA 1NN5A 4RJLA 1OIXA 3BERA 3LQRA 3QY0A 1DE0A 3OEED 1R7RA 2ZJ2A 1NN0A 1AZTA 4DCSA 2BMJA 4C7OA 1VYVA 4PQRA 1DADA 2NO9A 1D2MA 2ZVQX 4D80A 5H8WA 1SULA 2LCFA 5HR5A 1CJMA 2JGNA 1G5PA 1UAAA 4OI0A 3HP1A 1OHHA 3CPEA 5FTJA 2TMKA 4A9AA 2AX4A 1KMHB 5G3YA 2CVFA 1OB5A 1L4UA 1NVXQ 4MH0R 4YXWD 1HA3A 2GILA 5FPTA 4DLYA 1Z06A 2A5GA 1NMYA 3PUWA 2JLRA 2IYLD 2GVZC 2O8FA 2CCJA 2B8WA 2CEAA 1D9XA 3KB1A 5F98A 2FDCA 1CIPA 1FX0B 2N46A 3DEFA 2XJ4A 2QP4A 1ANKA 1N6PA 4RD6A 4TL8A 3RS0A 4D0NA 4BLOA 1DG1G 4WOPA 3TSOA 2O8CA 4UQOA 1P6XA 4GI7A 3ZVLA 4DLUA 3K70D 4B3BA 2WWWA 4XSGA 1RRCA 2L0XA 1IQPA 3K53A 2XX3A 5CJ2A 2QSYA 5AUOB 1Q57A 2AHOA 1G3UA 1JI0A 5EP1A 2PZFA 3AVWA 2QM8A 3B1WA 3PG5A 3B1XA 3N2EA 4NMMA 4D4KA 1FNMA 3B7GA 5F9FA 1P73A 3ONWA 4LDJA 3R9IA 3GP8A 2C9CA 3RC3A 4AKGA 5EP2A 4NDZA 2OCBA 3O47A 1JBKA 2KBFA 1S9HA 1GP2A 1UKZA 2ZRMA 2XJ9A 5CLQA 5L3SB 1Z28A 4POAA 4ASUA 3AVPA 1RJ9B 4M1WA 3AVUA 3KDSE 3GLIE 4QM7A 1HURA 2WWFA 4Q21A 3ADDA 4CW7A 2NGRA 3UG7A 3AP1A 2MSEB 3LDAA 3B60A 4BFSA 1II8B 3FPAA 4LHWA 3OIYA 1DAHA 3GJ4A 3E70C 1GSIA 4DB4A 2PMDA 2HYDA 3R7WA 4N0DA 4MRNA 4QGGA 2GJ9A 1RPZA 4MDFA 4X8OA 3QI2A 1IY0A 3BB3A 5DI3A 4LJYA 1GRRA 3L0SA 4E5UA 2CK3D 2HXYA 3L0IB 3AVXA 1U8YA 3WYGA 2I1QA 4JKYA 1VG1A 4XVRA 3FKQA 1VHTA 2B92A 5J4LA 3EPKA 3TE6A 1VPLA 2BV3A 3SQXA 4C0HA 2XXAA 3C4JA 4DSNA 3OEHD 2Z5FA 4E09A 2R6DA 1OH5A 4I1OA 3B78A 2JJ2D 4MUAA 5H1YA 3T1OA 2R8RA 1M2OB 2OO7A 1R6BX 5DI9A 5JRJA 5BXQC 5JCZA 1Z6AA 3B2EA 3GEEA 5DH9A 4D0LB 4F7WA 1LS6A 3B9PA 1AS3A 3QG5A 5C46F 2GJAA 4JSYA 2ZRHA 4L9WA 4BQSA 8OHMA 1UBGA 1E9FA 3ZQ6A 3CRW1 4PXAA 1UADA 1OFUX 1X6VA 1RC8A 2XSZA 2QMEA 2ZS9A 4Q18A 1E0KA 5L8VA 4LYHA 5TY0A 1G8FA 2V54A 4TL7A 3CLVA 4HDQB 4G01B 4QBGB 4PC3A 2YWHA 5EZ6B 4Z54A 3RSOA 1CJVC 4Q03A 2ZE7A 2BCJQ 1SVIA 1NBME 3GJ5A 1AN0A 4IOJA 5TXGA 1S9DA 4FMBB 1TUEA 2VP9A 2QBYB 1ZINA 4GOJA 4Y0VA 3I62A 3K9NA 4ZO4A 1SKYB 2P67A 4LBWA 4OYHA 2X77A 1SQ5A 3JVVA 2GJ8A 1QHSA 4PQFA 3NEYA 1RE0A 4UNSA 4BFYA 4BFZA 5IHPA 4IXNA 2J0QA 2H1LA 2PEYA 3AB3A 1G3MA 2FPLA 2QROA 4BZQA 1A4RA 1XEWX 5FBRB 3L43A 3QBTA 4LRWA 2WM9B 3IDQA 5LB4A 4XTCS 2VP5A 2PCJA 4D82A 2ZSBA 2QZ4A 3KFVA 4MKIA 1QF9A 2XGJA 3RDPA 1P60A 1NVVR 2HEIA 1NMXA 1WMSA 4A0FA 1ZC3A 1MR3F 4XSHA 1XPRA 3LNCA 4ZCMA 2AXPA 2QTHA 2A5FA 1NF3A 2MMGA 4LJ7A 3TAHA 1XJCA 5CB8A 4ZDIA 2F3TA 3CBQA 4TQ9A 3AKDA 4ESHA 4BFTA 3QF7A 1VDZA 2BKEA 3DO6A 1KI8A 4QHTA 3QQ5A 1P9WA 2ZROA 4U5XA 2Z83A 1ZD1A 4BRWA 1HQYE 3OF5A 5FTMA 1XB2A 1PVOA 1CR1A 2FEMA 2VBCA 2IEYA 3QSYA 1E1RD 3EXAA 3FMOB 2IHBA 1T91A 3NG1A 3W34A 3BFVA 4JVSB 1ZNZA 1IONA 4PZLA 4OBEA 4U00A 3S1AA 2B8TA 1E9AA 1A7JA 3LLMA 1FQJA 2JLXA 2FPKA 2XTZA 2UKDA 2IS4A 4M9XA 2QSZA 3MJRA 1Z6YA 1U99A 2IS2A 4IDNA 4Q1AA 1P9NA 5KSPA 3KTAA 2OM2A 3OEEA 3WYFA 4PR0A 4KFRA 3WXMA 5FH9A 1XD9A 4JVMA 2C78A 3T1TA 4BFXA 2Y8EA 3CZQA 3FHTA 3O8RA 1E4YA 1KDOA 1GRNA 1ONBA 1D9ZA 3T61A 4J0QA 1W44A 1GRQA 2ZITA 3QF4A 1G4UR 3MWYW 4V0ME 2F3RA 1HE8B 4BFWA 5C18A 1EWQA 3CW2A 4C7OB 3F0TA 4B3XA 4JLBA 5HPYB 2OE2A 2ZRDA 4R2HA 3CWQA 1R5BA 2R9VA 1II0A 1Z2AA 4JLDA 1YZUA 1CKEA 4OK3A 4Q9KA 3W6PA 3SHFA 5JS8A 1Z6GA 2DB3A 1I2DA 4PZYA 3AP3A 2YKGA 2ATVA 4ZDKA 1LVGA 4TT3D 4I1UA 1SVOA 1N25A 4XVQA 2O8FB 3IGFA 3SJBA 2V8OA 2ZJAA 4IFEA 3X1DA 1M8PA 1CF4A 2PMKA 4D0GA 4F92B 3K0AB 3GFPA 2QRNA 2GF9A 3SEAA 4JMPA 3KQKA 3KFXA 5B30A 2JLUA 3AP2A 3QOFA 4GP7A 4KLZA 2PX3A 3A8TA 5GVSA 1OIVA 4NBSA 4R71A 3SOPA 1L8QA 1XD2A 4GFDA 3RRYA 1Z0FA 4M8NE 5K8LA 1LNZA 3F8TA 1G7CA 2MSCB 2QT1A 4G3XA 1QZXA 4M1KA 3RAPR 5G40A 3VFDA 4IRUB 4OHWA 4QG7A 4Q7JB 4P32A 1W2HA 2GXAA 1W36D 3KJHA 3AF3A 1KOFA 3CIOA 1JJ7A 5D3MA 1U9IA 3QEOA 2PEZA 1EXMA 2WOJA 1OXVA 2HF8A 5JWHA 3TR0A 5LD2C 1NI3A 2PX0A 1KO4A 2WJVA 5C4GB 5AUPB 4URWR 5CM8B 5FL7D 2BMDA 3C5CA 1DG3A 1BH2A 3J81k 3ZZTA 1EG7A 1TMKA 2GXSA 2YOFA 4KO8A 1FW6A 1S4QA 1W47A 1FUKA 2FU5C 421PA 1J70A 2CVHA 2VHUA 1NVUQ 2GBLA 2X19A 3ZZ0A 4RKFA 2WPDD 3UMRA 4DLSA 1OT3A 3K09A 1JQLB 4PSKA 5DO9A 4QGFA 4G5GA 5DI3B 3SJZA 3UPUA 1BOFA 1JALA 2VHJA 4DHEA 2IS1A 3R8CA 3TUJC 2C96A 2QT0A 3KB2A 4NYJR 3IPYA 1E2LA 2JJ2A 3LQQA 1A1VA 4PSAA 3GLGB 2QMOA 1XEXB 2RCNA 3C5HA 4TLCA 1U81A 1N6IA 2ZAOA 2XXAB 3B5JA 3KUCA 1LF0A 1E94E 3W5IA 1XP8A 3ZD6A 4LBZA 1NBMD 3EA5A 2ZEJA 2OBMA 3GPLA 3CNLA 2WIAA 4HDOB 2P3SA 3W9YA 3GJ8A 2YINC 1XXHA 1BS1A 2AD5A 2CNWA 1KK0A 2ZJOA 3W5JA 1N5LA 1LF5A 4NHOA 2V1UA 5EUQB 4B2PA 3EWAA 3AF2A 3SBEA 4DCTA 3MMPA 1T8TA 4MGIR 2KWIA 3W6NA 1N6LA 4E03A 1HT1E 3AVTA 1KI6A 2XOKA 2YOHA 5H70A 4AKEA 1FNNA 1JNYA 3DOEA 4TLAA 4RFSA 3OE7A 1E2NA 1YR9A 3O8DA 4TYQA 1UDWA 3FFBA 5SZKB 1KMHA 2DCUA 1JXOA 2BMEA 1AJEA 1RYFA 1Z2CA 2CCKA 4JBWA 1AGRA 1T0JB 2ZJZA 2B21A 4KXFB 1SVSA 2WWYA 2D4HA 4LOAA 4QBFA 1XPUA 4LGMA 1X1RA 5TARA 1G18A 4BEJA 4EFMA 4HAVA 3OZXA 2C95A 3T34A 5JI3E 2H17A 2BBTA 2ZRFA 4QKQA 1TF5A 5FI0B 1RZ3A 3NTUA 1RRFA 3QVVA 3K9GA 4NH0A 3M1IA 5TMPA 3RYTC 1D2EA 2OAP1 4BWYA 3EC2A 2IF2A 3QG1A 3QKTA 4RFVA 1R0WA 2GK7A 3CRVA 2A5YB 2IYSA 1U2RA 1ZW6A 3FE2A 4EPYA 5J47A 3EZFA 2QY9A 1SXJE 3HU1A 3K0CA 4URZR 4Q02A 1D5CA 2FWRA 4W5HA 1E1RA 2IUTA 3CUEF 2R6CA 1YJ5A 4OQXA 4P33A 4H9GA 2ZR9A 1RJ9A 1NL3A 1TNDA 5TV2A 1R5OA 3LY5A 4JLOA 5K8UA 2RKOA 3U4QA 3TAUA 4CEHA 4TQAA 2W6IA 1XRJA 2A30A 3NBZC 4DT1A 3SU8A 1DAIA 1OPXA 5IK2A 3I61A 1UKVY 2JLSA 2YHSA 2YOGA 4II7A 3N5CA 3BK7A 4NTZA 3S1AB 1N6KA 2JLQA 4ON9A 1CLUA 4YMVA 2PLRA 2KE5A 1E9CA 2MMCA 3R20A 4JBYA 3THWA 3GJXC 4D26A 5LDDC 5HCNA 5GJWC 5EE5B 2CHVA 5DN6D 4MGZR 4HAZA 5EXXA 4R7ZA 4BLRA 4B2LA 3LV8A 3RWMB 3X1YA 3BS4A 1TQDA 3BIFA 2GHIA 5IF9A 1IAQA 1TAGA 1NJFA 1A2BA 1E2GA 4KODA 1S0UA 1NLZA 4HI0E 3UANA 4ZDJA 3AF4A 1N0VC 1FMLA 1NIPA 2A3RA 1KSJA 2G77B 1OKKD 4I99A 4G5RA 1F6BA 1MO3A 1HUQA 5KSZA 4URVR 3IBYA 4TTPA 1N3BA 4TT3A 4C0AC 4D6PA 5KDOA 4A15A 4BASA 1R0ZA 4URYR 1TUIA 3IIKA 3ICQB 4URUR 2PBRA 3SJAA 3L0PA 1Q20A 2BJVA 4TZ0A 4QXAA 1DELA 1YVDA 4YLGA 3VAAA 3SQWA 3EAQA 1RRGA 2RGEA 5AJVB 2O52A 2QU8A 3CZPA 3FFAA 1VYUA 1F3OA 3AF1A 3MRSA 3GLIA 3NBFA 3CRMA 2AFIE 1DAMA 5CIWA 1NSTA 1IHUA 4YMUA 3K70B 1FPMA 2NO6A 1XTKA 1T4GA 2ZRJA 5CITA 1KJYA 1P7CA 4AG5A 3I3SR 2XTNA 3KKOA 3IILA 1U9IC 4ACAA 1XJQA 1RKBA 2ZJYA 4O25A 4Z51A 3X1ZA 2VP0A 2QBYA 1WBDA 3A6PC 1F48A 1VCMA 3DMNA 3PIRA 4FXPA 2GZHA 3MD0A 2F9MA 2IK8A 3L0OA 4LV6A 5FOXA 3RSLA 1XD2B 3KKPA 4IJMA 1E3MA 4KVAA 4BLPA 3Q5EA 2EYQA 1E98A 4EJSB 4HUTA 1ZNWA 2FFBA 4F93B 4M1YA 1G41A 5KU1A 1FTSA 5TB5A 2YNMA 2ZRIA 2GBLC 4B47A 5K8IA 4TTQA 5FL7A 3UWKA 3K09C 1KNQA 4RD0A 4Q5IA 2ODWA 1GKIA 3AH8A 3FKSD 2BIFA 5D3MB 3TIFA 1Q12A 2P6NA 4BGDA 4DLZA 2OHFA 1T3LA 3HPRA 5FPHA 5FTLA 1DEKA 3CF0A 4NPHA 2D2EA 3PV0A 2UVQA 1KO7A 3U3KA 1FZQA 3TJZA 2W83A 3ZZUA 4X8MA 3TSZA 1JXMA 1NG9A 3OIUA 4PC1A 5AJYA 2V7QD 3REFA 2KJQA 4FCWA 3A1VA 1HEIA 4FINA 5F2EA 3A4MA 3T5GA 3ASZA 4OJQA 1JECA 3IEVA 4GZMA 5BN4A 4JL5A 1T3HA 2D7DA 4DCUA 4ZKDA 2AXNA 2JLZA 1M1YE 1NBMA 2EWVA 3WNBA 1OB2A 3BBPA 3U7FB 1C4OA 1AS0A 1XTQA 2VF8A 5L3QA 1EFTA 2QUZA 1ZIPA 1UKEA 3QIAA 3MLEA 1E2DA 1XZQA 2VTKA 3THOA 2P5SA 3ETLA 3ZYCA 1AS2A 1G7SA 1FQKA 5JMTA 2QL6A 2G3YA 3PUXA 1I4TD 4IDOA 3RS3A 3V4RA 5TDHA 2V9PA 5IRCD 1XXHB 2EFCB 5JECA 4U7DA 1G21E 5F3WB 3KJGA 1TU3A 1OXTA 3ZH9B 3D31A 1SVWA 1KKMA 3AVQA 2J0VA 3QKUA 4BE7B 2QGZA 4CT4B 2P0EA 4XWKA 1F5NA 3ND8A 2IYQA 2BBSA 5D3QA 4KLNA 1KI6B 4TYWA 1JPNA 1WE2A 5KSOA 2XZPA 4MYCA 4RFSB 2QP3A 1E9SA 4PPFA 2LKDA 4F4IA 2ZI4A 4CEJA 3M4YA 2VIIA 3VR5A 4AYTA 2H8KA 4A92A 3CWZA 3RVBA 1ODFA 5SZJA 4N0EA 3HR8A 4EDHA 3FYHA 1N5JA 1U0LA 1KO5A 1N0WA 5H68A 1GITA 3LAWA 1SXJD 3BB1A 4PANA 1FOEB 1LTQA 3DHWC 1AIPA 5JEDA 5KUTA 3K0CC 3T12A 2DFNA 2QAGA 1UF9A 1ZNYA 3EA0A 4FCVA 1CS4C 3P26A 3WRYC 4NZYA 2ZETA 4K46A 3K0AA 4YMWA 2ORIA 4LZZA 1UJ2A 3MWJA 3UKDA 1QHXA 3PJRA 1VG8A 3LLUA 4KFTA 4AC9A 3MSXA 4C2TA 1XEWY 2WKQA 4DDTA 1GTVA 2IL1A 1U0JA 4UXIA 1R8SA 1ETUA 1Q1BA 3HWSA 1FP7A 1N0UA 4PC2A 3RNLA 4JL6A 2GRJA 2XTMA 4LJ9A 2IC5A 3T5DA 1FUUA 4Q48A 2HLDD 4A1FA 2BBOA 821PA 2ZI9A 3EG5A 4CRWB 4PHTA 2ZYWX 3VKHA 2X8AA 4V02A 1NKTA 2WOOA 1E9DA 4M53A 3SN6A 4HYYA 3Q72A 3IUYA 4GL2A 1G7RA 2KB0A 4H1VA 2F6RA 1Z0DA 1W4CA 2WBLC 2HF9A 4V0MA 4B32A 1KY2A 2RGDA 1HV8A 1KI9A 1JEEA 3HU3A 3NC0C 3QUSA 5KOYA 5JLJA 1X3SA 3C14C 4IDQA 1E79D 4LJ6A 4LV8B 5FPSA 1XMIA 3I8XA 1NIJA 3U4QB 3NIBA 4CEHB 2XZOA 3LBNA 2IYXA 3VR1A 4DT1B 4BPBA 1T6NA 1YZQA 1DVRA 3U3OA 4KV9A 4M2LA 3T15A 5FPYA 2WTUA 4L9SA 2ZI3A 3UATA 2YWFA 2BCGY 2UZ3A 3THWB 1KHTA 1ZM3A 2H57A 1XCPA 3HU2A 4MYHA 2ZR0A 4WZ6A 5HE8A 3WP0A 4AG6A 3H1TA 4EPXA 1E0AA 3P4XA 2JEOA 4KSCA 2WAYA 4QRHA 1ZD8A 4LJ5A 1OKKA 1YRAA 4D4JA 5JSZA 2JIZD 4UKDA 1KSFX 2FOLA 3GLGA 1KI4A 3PFIA 2HXSA 1XEXA 2LKCA 4M9ZA 3QVUA 1OJLA 3DL0A 2EQBA 2FE4A 2J7PA 4EPVA 3VR3A 1AM4D 2ZANA 2G0TA 1IN5A 2NO1A 1XMSA 5P21A 4LHYA 4G1UC 4NP6A 4RD3A 2QTVB 3BE4A 4M9SA 2OILA 1K5GA 4F38A 1I4DD 1S3SA 4NCIA 4FWIB 1JEDA 4GDFA 1WDTA 2ZAMA 2ZI6A 4WZAE 4IW3B 4TYPA 4N3NA 4NE2A 4P0TA 4V0KA 6Q21A 1W36C 3NEJA 1XU4A 4KVGA 1UEIA 2IWRA 3WNDA 1KO8A 4GRAA 4LJ4A 2VP6A 4Q9JA 5BYKA 4CF7A 4Q19A 4LHZA 4EPRA 1KGDA 4PO9A 4Q00A 5FTNA 3GLIB 4M9QA 3TQFA 2OEPA 3Q3JB 1VTKA 2C03A 5EE0A 4BEBA 4UNPA 2NTYC 4Q4JA 5BQ5A 2G1JA 1AQYA 5LPNA 1BO6A 1EFRD 1XJ0A 3IO5A 1YR7A 4ITRC 1B0UA 2XAUA 4HEJA 2FF7A 3EIHA 3SE0A 2QE7A 1KK2A 4WZBE 4ZIRB 1IOZA 3K0EA 2CHGA 5EP3A 4XIGS 2EW1A 4AURA 1UBEA 1S1MA 2ZM5A 1HT2E 1W36B 3B85A 3CH5A 4JVNA 4Q47A 4KBGA 3PITA 4NL4H 1EK0A 3FKSA 3F5FA 2GZAA 1IXSB 3IKJA 1XCGB 4FMCF 5EE3A 1S96A 3LBHA 2ZRBA 2A78A 2O0HA 2VSXA 4ARZB 2QP9X 3LWNA 3KQHA 3A1SA 1Q1EA 5JI2E 2ZE8A 4HLUA 4P4UA 4DDWA 2V7QA 4KCGA 1B23P 2CL7X 4PPQA 4HLDA 4NYMQ 1P2VA 1OH8A 4B73A 1VMAA 4WBSA 1ZUIA 5KSYA 3TW4A 1W0JD 4QNRA 5FUWA 1AA9A 1ZD9A 2YVUA 1ZU5A 5CYPA 4V0NA 3ADCA 1GVNB 2IA5A 5CLLA 4TZ6A 1CXZA 1JJVA 2CE7A 4Z1MD 1GKUB 4FMDB 3GJ3A 4DLTA 4EAQA 1KTVA 1KY3A 2BBWA 1K5DA 3EIEA 3OAAD 1QHNA 4PC7A 4BFUA 3PEYA 1UBFA 2OFXA 2OESA 1WB9A 3A4LA 5G3ZA 3D6TB 1LS1A 2NG1A 3N70A 4RY2A 1WP9A 1COWD 1DAFA 1I4LD 3EZ7A 3CH4B 3CB4A 5L3QB 4S2EA 2JJ1D 4DEXA 2ZJ5A 1H65A 3O8CA 3U7GA 2CLCX 1XF9A 2ZE5A 3T1QA 3T06B 4HZIA 1T0HB 3GJ0A 4QBIA 1WXQA 4TSFD 5HZHA 4Q66C 4KI0A 5JBQA 3ADKA 3L82B 3BAFA 4JJKA 4MA4A 1E2JA 3Q8XB 2YC2C 4KU4A 1DOAA 2YWEA 1SHZA 1U8ZA 2DWQA 2QAGC 4QBHA 1NVWQ 4DSUA 1EESA 3V4FA 2VP2A 1Z29A 5B57C 4LYJA 2VYFA 3OHMA 4A4DA 3PXGA 1XFAA 1FTNA 2QAJA 3TRFA 4YXWA 3SI7A 4Q1DA 5KO2A 3AGQA 2FPMA 2Z43A 4RKEA 3Q7QA 2Q3MA 3H84A 4Q1FA 3W3ZB 2R44A 4AWXA 1CJKC 3LXXA 3DKPA 1SXJA 2R62A 1A5TA 3BXZA 3SZRA 3BH0A 4XOIA 2RAPA 4CEJB 2J87A 1FL9A 2ZSAA 1GDDA 4M22A 4PSVA 1E69A 4HLQB 4P4TA 2NPFA 5EJEA 3UIEA 1OW3B 2WIBA 1QDEA 4LYFA 4EPWA 1GNPA 2AL7A 2KSQA 2G0NA 4NKRA 3GLHE 1KDPA 2QAGB 1SVMA 3FDIA 3O8BA 4YC7A 4DIDA 1GILA 2QQEA 2RHDA 2FSHA 2HLDA 2CMKA 1Z5ZA 1KJZA 3WY9A 2WJGA 5GADl 3QBVA 4WW0A 2FSFA 4OK5A 5B2ZA 1O3YA 3AVOA 3NHBA 2PH1A 2FA9A 5KTYA 4EJSA 2QPTA 2ZJBA 2SHKA 3LW8A 5DLQC 1OFIA 1UFQA 1KMQA 1NN1A 1MRNA 2MSDB 1SGWA 3TVTA 1G5TA 2VA8A 4AIIA 4PAMA 5AK0A 1E79A 4BUJA 3X1WA 4DB2A 3IEUA 2G88A 4O3MA 2J1LA 1DO2A 3WYAA 2JASA 4ZV4A 1ZM4A 1TPZA 2ZRCA 4K81B 4HLCA 2AN9A 3F3YA 2J0UA 3K1JA 2DFKB 2OCAA 3A4NA 1PUJA 1OYWA 2AD1A 3AUYA 3MJHA 4G5OA 3RHFA 3WHLA 4BZXA 4KITB 1MO5A 2CJWA 1GG2A 3EZ6A 4M4SA 4MRRA 4MYTA 1IN8A 2DPXA 2GTPA 3PVSA 2PCLA 4MRVA 4UJ5A 1US8B 3VNVA 2CXXA 3HYRA 2UZIR 1VCIA 2CK3A 3NDBB 4DLWA 4EQ6A 3ADBA 1SVLA 4TLBA 4V0OA 4ZPXA 4MYUA 1VIYA 2JLVA 4OHYA 2FZ4A 2JIZA 2CL6X 1OH7A 4Q4HA 2GK6A 5GJBA 4KYIB 2QORA 2O8BA 2GKSA 3LRPA 2BEKA 2ZU6A 5KHOC 2VSFA 3OEHA 4DJTA 1KKLA 1EX7A 1RVDA 1NNEA 1OLOA 1JR3D 1NY6A 2C9OA 1XWIA 5JSZB 3P4YA 4IHQA 2WJIA 1G64A 3RWOA 4C0QC 1Z0JA 5J4HA 4LJAA 2GJKA 4C2UA 1BIFA 1RFLA 3TBKA 4DCVA 3OESA 5DISB 2EFEB 5J40A 3GQBA 2WJJA 3G82C 2GCNA 4TN1A 1CRQA 3TR5A 1QHYA 4U02A 2F1IA 4NYIQ 5DYGA 3VR2A 1RRPA 2Q3FA 1G3RA 4HB4A 4I4LA 4C4PA 4RZXA 4TL6A 5CDFE 3U6BA 4WVFA 1KZ7B 2PZEA 3BRWD 5EE1A 2K5UA 3WBJA 3EPLA 1XTIA 4KHZA 3CRQA 5IDVA 2OLJA 4B74A 4M1MA 1TQ2A 4LHXA 3KKQA 1CP2A 1UKYA 2BMFA 4B34A 3THXB 2C9YA 2X1VA 1ZUNB 1F60A 2BJWA 1IN6A 4DCNA 3KQNA 2OLKA 1KAGA 1ZVQA 4Q4JB 2N1BA 1VCOA 4JS0A 2VF7A 4HLUC 3B8HA 4JBXA 2ODBA 5C4MA 1KO1A 2ZS8A 1SZPA 5C2JB 4MITA 3P32A 3JVUA 2WVJA 2C98A 4C3ZA 2IYVA 2WJHA 3LBIA 4Z8YA 3A1UA 4P3YA 2BKUA 4GSYA 4EIWA 3UMSA 3KZ1E 5ANRB 2GVDC 4DLXA 4L5BA 3DDCA 3QXSA 2OV2A 1E2KA 1Z07A 4PQYA 4UXHA 4A36A 4C0JA 4XWOA 4AK9A 1W0JA 3GJ6A 2DY1A 2QG6A 4DDUA 2NQ2C 2DFTA 1YKSA 1WBBA 2B6HA 3SHWA 2NIPA 2GCOA 4I81A 1GNRA 1OHHD 3IQXA 1XEFA 1W46A 3SNHA 5HKKD 2WMOB 3QKRA 4Z1MA 1IXZA 3L8ZA 3C16C 2FV8A 5M04A 4B3DA 2NPIA 2ZU0C 3WHKA 1V5WA 2EFDB 2VPPA 3OAAA 4KJZA 5DE3A 3ASYA 4CYMA 1JB1A 3EWSA 3EC1A 3KKMA 1GZSA 1T3SA 1U98A 5KDDA 2JDID 5BN3A 4F4CA 1MABB 1GIAA 2ZUDA 4M1TA 4AKIA 3KJIA 3AF0A 4DSOA 1OV4A 2FG5A 1A2KC 3U7HB 3WMEA 2HUPA 1G20E 1E9RA 4B43A 2RGAA 3GEHA 4QHSA 4Z8XA 4B3GA 4TTRA 3DZ8A 2RH5A 4Q7LA 4PO1A 1J8MF 4GZLA 4TSFA 4LHVA 1PLJA 1X8JA 3E2IA 4GMDA 4HDCA 5JS7A 1W4BA 4B75A 2ZVPX 1SXJC 5EXSA 1QHHA 1ZP6A 3SYNA 1XBTA 3I73A 4HSEA 2IYTA 4M0LA 2IYYA 3IBGA 3RS7A 4BLSA 2QNRA 2R6GA 1I2MA 3G0HA 2FFAA 4W9MC 3QPVA 1VKJA 3WBKA 1A82A 4H1UA 5KYKA 2WKPA 1KNXA 4XD7D 5SZIA 1E32A 4B2IA 4B3FX 1Q3TA 3QPUA 3REGA 1K8RA 4B76A 3K70C 2F1HA 1VECA 4DKXA 621PA 3GMTA 2O8DA 1RYHA 5HTKA 1U94A 2DFLA 4GOXA 2AFHE 3I5YA 1YZGA 4AYWA 1EFCA 2BVNA 4QJ5A 2WWGA 2D74A 1N5KA 4ABYA 1J7KA 4OQFA 3N2IA 3CPHA 1SXJB 2A2ZA 4NCNA 4PX9A 1YR8A 1AQUA 5E3HA 3VU9B 3I5XA 4MDEA 1J2JA 2CCGA 1PJRA 1C9KA 2I1VB 1ZMXA 2H16A 3D8BA 1P2TA 2FSIA 4EJSC 4Q7MB 3GLFE 2E87A 1Y63A 1TL7C 3KL4A 1BMFD 1KDRA 2IXGA 3BWDD 2GEUA 2BDTA 1Q22A 4FCTA 2CBZA 5J4KA 5JEEA 1VCNA 1NLFA 1YE8A 2YC4C 4JLVA 4OJKA 1CR4A 1WCV1 1P61B 4JIMA 4TMTA 4EFNA 2D7CA 1KI7A 2VO1A 3BGWA 4WXPA 1E2QA 2FMXA 2P65A 5EUMA 3QKSA 2GNOA 2WSSD 2IWHA 3VX3A 1GL6A 4ZIRA 1U0HC 4PAOA 3BFXA 4Q1CA 4QOSA 1CRPA 2V6IA 5FBVB 2JLYA 1DAEA 3M6AA 221PA 1AK2A 1Z8FA 5DHFA 1KI3A 3CX7A 1W5SA 1QG2A 1M74A 2D06A 3FTQA 3DM9B 3LX5A 1E2MA 2XSZD 3AKYA 5J5CA 3QENA 4HZUB 4QJ4A 4YQFA 4NCHA 4ARZA 3MFYA 2IT1A 1H8HD 1XZPA 2GEVA 5EZ5A 4JKIA 5HCIA 3DM5A 4DDVA 2A5DA 3KXLA 2G9NA 2ERYA 2XEXA 1J90A 3SBDA 3D7MA 2GXQA 3NH9A 3BC1A 3CF2A 3X1XA 1PUIA 1UDXA 2J0UB 5FOTA 3RRNA 3ZD7A 2ZSDA 4GT1A 2ODEA 2IS6A 4OKSA 1R0XA 5EE9A 3VKWA 2CJWB 1QVRA 2WPDA 3WP1B 5FPKA 2WKRA 4PHFA 3B1YA 121PA 4OHZA 5LBIA 2RHMA 2H5EA 5DSZA 3SS8A 4TWZA 4EQ6B 2AK2A 3U61B 2J45A 3B82A 1VG0B 5FI1B 1P75A 2CLSA 2PT7A 1ZRHA 3A58B 1T5IA 3MUFA 3B1ZA 4L15A 3DZDA 4Q4HB 5FTKA 2FZLA 1D6JA 2O8BB 4DLVA 5JJLA 4JLAA 3VKGA 3WNCA 1KI1A 4HAYA 4A0GA 4D81A 1S8FA 3SFZA 3AVVA 1JAHA 3DVLA 5JHGB 1Q44A 3H2YA 2GJSA 1TEVA 1LV7A 5KNCA 3FMFA 3PEWA 4TMXA 2QPOA 1TF2A 3GJ7A 1E2EA 2VH5R 3K0SA 3ZVMA 3ICEA 4LC0A 1YZTA 4ILEA 4US1R 3U60B 3EIQA 4UNNA 4YMTA 2P2LA 3KKNA 1HTWA 1MH1A 2OT3B 2V6JA 1XMJA 4OI1A 4DWJA 3TH5A 1ZU4A 1QHIA 1X1SA 1Z6TA 1XX6A 3BOSA 4D2IA 1E99A 4O0MA 4PC6A 1W2GA 2BHRA 4AKHA 3CO5A 5JHHB 2REXB 2XNSA 4TLDA 2GAAA 5CYOA 3RS4A 1W5TA 4RSGA 1GL7A 4JLMA 3NH6A 2P6RA 1K6MA 3P1JA 5JJKA 1MKYA 3QJYA 4XH9B 3KQUA 2CL0X 4HAXA 2ZRNA 3B1VA 3ZDQA 4IOKA 2W2VA 4GP6A 1DTSA 4KFSA 4OK6A 5SZHB 1TQ4A 3U3MA 4LBVA 4CDGA 3A37A 1E6CA 3FMIA 4DLRA 1KK1A 4ACBA 5E7IA 2AWNA 1XCMA 2O0KA 3V9PA 4OHXA 4C0SA 4PTLA 1O87A 4OQLA 4V0LA 4CIDA 1PLLA 1EFUA 1KK3A 2NMVA 1EGAA 3LVQE 2GAOA 2BWJA 5FR1A 2GXUA 1Z47A 2VL7A 3U5ZB 2XITA 5BW8A 2C8VA 1F2TA 2IYRA 2V1XA 3CR7A 1TU4A 4MRPA 2FX3A 1OXXK 4DZZA 3FWYA 2IYUA 1HE1C 5HKKA 1P3JA 5KNDA 4EKDA 1G16A 1G6OA 3G5UA 5JRZA 1CULC 4US0R 4ZI2A 2WSMA 3FVQA 3ZJYA 4Q7KA 3W8RA 5TVKA 3BD9A 3I1FA 3KX2A 2IW3A 2GCOB 1RIFA 3THYB 2JDIA 2VRWA 3QKRB 1E2FA 3HR7A 2BOVA 2HCJB 2ODNA 3QPWA 5LB2A 3R9WA 4DRZA 4Y0AA 3EARA 2JLWA 2DYKA 3QNUA 5JWOA 4GNKA 4DIEA 3CRRA 4YDSA 4PHGA 4A8JA 2X2FA 2V3CC 4P4SB 5A5GA 5FBLB 2QQ0A 4JZKA 1T8UA 1U8AA 4IEIA 2P6UA 3TQCA 2W0MA 3NWJA 3EZ2A 2PZGA 4BLTA 1E9EA 4V03A 1P9RA 1W4RA 4W7SA 5BWMA 3K0FB 5FOVA 1US8A 4TMKA 5DN6A 1CEEA 3ZVNA 1G3QA 2J7KA 3W6OA 1PLKA 1G6HA 5FUXA 1S3GA 2PLFA 4TMWA 5IT5A 2GF0A 1IN4A 2P5TB 3GFOA 2R65A 1EFHA 4JLNA 2VSOA 3TUIC 4XD7A 4OL0A 2JA1A 3GLHA 1OYYA 1QHHB 5B64A 5JJIA 1G3IA 4JT2A 2RGBA 1CR2A 3R9XA 2X2EA 2HYIC 2JAQA 4IOLA 4NONA 5GJVC 4DUGD 4PPNA 1JPJA 2B7CA 3U7EB 2IUSA 2VQSA 3C41J 1ZCBA 2H18A 2J9RA 2VHQA 4OQMA 2O8DB 3H86A 2C99A 3BFKA 5CIQA 4AD8A 2DR3A 3U44A 5DIFA 3GCGA 3I4LA 1SKYE 1GAJA 4B6EA 1ZJ6A 2ZR7A 1E1QD 3MGCA 4B48A 2ANCA 4RD4A 2QRZA 3TNFA 3MWLA 1DS6A 2ZRGA 4LV5B 2NZ8A 3EX7C 1BMFA 3EASA 3P20A 4JL8A 1MO6A 4NYMR 4TYYA 4MKHA 4LY6A 1NP6A 1G8HA 4XJXA 4KYUA 3SC3A 3IIJA 2ZJ8A 1OE0A 1GL9B 2BM0A 3LXRA 1JR3E 1L4YA 2A9KA 3LO5A 4LC1A 3THXA 4A6XA 4QL3A 2WSSA 4XTRA 4JT4A 2ZI7A 4A6PA 3MCAA 5CK4A 5AUNB 1UBCA 2PL3A 1EX6A 2WV9A 1DAGA 4RZUA 2J3EA 1Q1ZA 2ZRPA 2QMUA 4O2RA 4IKEA 4KBFA 4MKFA 4OI4A 1YZNA 2XNDD 3QKSB 4XVUA 1UEJA 4JYCA 4ZDWA 3PUYA 4UJ3A 3GFTA 2IBMA 2VHTA 3JZAA 1OXUA 1UPTA 5A0FA 3RLFA 4M21A 1LB1B 2QI9C 2CNWD 1H8HA 3PR1A 5F9HA 2IYWA 4A2PA 2FFHA 3OIVA 2C77A 3H0KA 1XTSA 2B7BA 4LCBA 1WF3A 4FIDA 3WMFA 1PV4A 1M7BA 3U3JA 2D2FA 3CONA 4L4UA 1G5RA 1MO4A 4ZI3A 2EYUA 2CHQA 1X8KA 2XOKD 2NOAA 2WWHA 4IFBA 2C5LA 3NVAA 5CJPA 3OE7D 4DEYA 3RC8A 1R8QA 2R6FA 3NKVA 3ZIAD 4LX0A 2IX3A 4CEIA 4Q4AA 1CR0A 3DMDA 3IO3A 2ZYTX 5L3RA 2RGCA 1CU1A 2F43A 1SKQA 3LVRE 3A1WA 1IM2A 2QTFA 1T9HA 5CM9C 2IUUA 2O8EB 5CDFA 5EP4A 2ZSEA 2WWIA 1G4AE 3NXSA 1E96A 3RANA 1MABA 1TADA 3FB4A 3EPHA 2C04A 1GKYA 1N6RA 1TX4B 1XMVA 2W58A 4JSTA 2EU8A 2H92A 5UKDA 2J41A 1M7GA 1GUAA 2IHYA 3DOFA 4A82A 2E9SA 4P31A 2VEDA 3CR8A 3ZS8A 1RW4A 2PT5A 2W6JD 5AJZA 4R2IA 1Y3AA 4RZ3A 2ZS7A 1D8TA 3KXIA 1IJFA 1M7HA 1MV5A 1IY1A 1GWNA 4O2LA 1YQTA 3D3QA 3KXKA 4DBLC 1MT0A 1Z0KA 4NU0A 2JJ8A 3RRZA 5B58C 4X8LA 4B33A 1AKYA 4IVRA 1ZAKA 4KAXA 2I4IA 2IF0A 2OCYC 4QJ3A 2AWOA 4NCJA 4C0BA 3TKLA 1NG1A 4JLJA 2ANBA 2G83A 2ZIAA 5EXTA 2F1JA 4HAUA 4US2R 4ESVA 2ORWA 3LH5A 4WAUA 3U6KA 2WJYA 1GNQA 3OFND 5FOWA 3TK1A 2PJRA 1ZBDA 3CKLA 1II9A 3U2QA 2O5VA 2W6ID 1F2UB 5HZKA 3CF6R 1FFHA 2F55A 4ZCIA 1WQ1R 1QG4A 5IK2D 1OH6A 2NO0A 4LSGA 3SR0A 2XZLA 3TVDA 1JR6A 3VU9A 3BH7A 2G1KA 5CK5A 1IXRC 2GZDA 1CJUC 3ZVRA 3BB4A 1L7VC 2OFOA 1OSNA 2OAQ1 4RD1A 1NVVQ 4F4JA 4EUNA 3ZQJA 3K9HA 4Q01A 3CX6A 1SVKA 2FN4A 3H4MA 1N6HA 3VNUA 1F2TB 4QGAA 4TQUS 3SYLA 4HAWA 4JJZA 1DO0A 2REOA 4A8JC 5E4FA 1GOTA 2XB2A 2N42A 3I8SA 3KUDA 3A36A 2WICA 2Q6TA 3UXMA 4JVLA 1CTQA 1W0KD 2Q9CA 3GD7A 5BN5A 1FP6A 1Z0IA 2QMHA 4BZPA 1KZGB 2OFWA 2QA5A 1G8YA 1NJGA 3PCRB 4TL9A 3AUXA 4AY2A 1KAOA 3Q9LA 2HCBA 5E7MA 4CVNA 5KNBA 5CB6A 2YJTD 3UMFA 4JYBA 3BORA 3W3AA 3C8UA 4NCKA 1OF1A 1YHNA 4CGZA 4IXMA 1P4SA 2VP4A 1Q3HA 2PJZA 1BYIA 4D25A 2V55B 5GVRA 5EQTA 2ZSFA 4HZUA 1MOZA 2A5JA 4NYIR 3CNNA 2O8CB 1XTJA 3PUZA 4A8JB 3GLGE 2YZ2A 1Z63A 3VX4A 4TYNA 2EVWX 4G0NA 4IEEA 2WMNB 4WA7A 2FGKA 2C2HA 4W5JA 4DVGA 1NN3A 3CNOA 4HB2A 4PAQA 2ZPTX 3LA6A 1TTTA 3SJCA 1H8ED 2YYZA 2QENA 4DSTA 3QE0A 1Q21A 4PPGA 2D62A 1JQJC 3WMGA 1P62B 1E0JA 2VHCA 4OI2A 4MUBA 1XD8A 3C15C 3PEUA 1N5IA 2LWIA 1D2NA 3GLFA 1G17A 1W48A 4YONB 2G6BA 4DUGA 5JZVA 4QC2A 4A2WA 2RGNA 3IHLA 3GLHB 4BECA 3EPJA 3VHLB 1MRSA 5DGXA 5GJCA 1AGPA 4HUQA 5C1BA 2ZYVX 4R9UC 4HB3A 4LI0A 4ZKEA 1AZSC 1E1QA 1M34E 2VLIA 1P72A 4L16A 1HH4A 1YZKA 3OIWA 3VR4A 3V00A 1HYQA 4CT5A 1G7TA 1W1WA 4XWAA 1E4VA 4D4MA 721PA 2E1RA 1LY1A 2HDNB 3R7WB 2ECKA 4UNRA 3CX8A 4S35A 3U44B 3LD9A 2RGXA 1YRBA 4LPSA 1WRBA 3RABA 3RS2A 3QXCA 3PUVA 4YMSA 3ZGXA 3KQLA 2D3WA 5JFGA 1CJTC 2W2TA 1OFTA 1Z3IX 5LD2B 3VMFA 3FMPB 2GEDA 4LBYA 4MKGA 1NRJB 3TW8B 5E95A 2ERXA 5HE9A 3HDTA 1BYUA 3C7KA 5DNYB 3B9QA 1DAKA 4N1AA 3AVYA 3UK6A 1NMZA 5FUVA 1EFRA 1ZNXA 1E2PA 1E0SA 1S2MA 2ZREA 4LPKA 2HJVA 2XNDA 3A1TA 2FH5B 2R2AA 3NHAA 4I1SA 1E9BA 2WZQA 3L8YA 1G19A 1C1YA 3IHWA 3FHOA 5FOSA 1KDTA 5G41A 2JATA 2RMKA 5DYIA 2NO7A 4Q4LA 2EWWA 4QNMA 3BH6A 2GA8A 4E22A 2F1RA 2RB4A 4AI6A 2Q21A 2NZJA 2OXRA 3LFUA 4FN5A 3TGPA 3QXHA 5FUYA 1VG9B 2F9LA 1R2QA 2W00A 2AR7A 2OXCA 4L8GA 1X8LA 2WWXA 3ZIAA 1VYTA 4FD2A 4LYAA 3DKVA 3RRMA 4C0LA 1XPOA 2YV5A 4LK2A 2Z4SA 4FMDF 5J4VA 1R4AA 4GMXA 4B71A 1VHLA 5AR1A 1IBRA 4Q9LA
chains in the Genus database with same CATH superfamily
2AKAB 1H5NA 3BEOA 4CLEA 4ZAVA 3LUFA 4MS3B 5A5EA 4YPOA 1N2BA 2JGMA 2P3LA 2R6R1 1C2TA 2ZJFA 4P0QB 1UQTA 2O0JA 4CEIB 3A2LA 4JYPA 5JASA 1P5FA 2CFSA 3GNTA 1UWVA 1AUVA 4S3MA 3KKLA 3RFVA 4E2FA 1JMVA 1T1EA 1ZC4A 3C6MA 1UJ6A 4X8HA 1IMOA 3TIGA 3MB5A 3FKJA 4ZWNA 2EP8A 5H3CA 5IAGA 5TMBA 3KYCB 4K9OA 2N3ZA 2ZZMA 4YAOA 3NC1C 2P8JA 3UWDA 3QU4A 1BROA 5HM8A 3PCTA 1COWA 1CUHA 1H5UA 2CDNA 1LVUA 3JD0A 4NJMA 3D8SA 4RIHA 2FE1A 1LI4A 3O4HA 2XADA 2IYZA 2JLBA 4ZCPA 4BV3A 2FP3A 5IT4A 2ZI5A 1HFWA 3P8ZA 4E94A 1Q0UA 3L7NA 4ZCLA 2A7QA 3EGEA 3KUUA 3ZS9A 1AKEA 1ODKA 2W2QA 3ZDFA 5EKUA 4K1XA 3SYKA 3RG8A 3P5SA 4AMZA 4QOEA 3N8IA 3N7AA 2YTZA 2I7CA 2H2DA 3M7IA 4OHVA 1O6GA 3M49A 4FGZA 3JPYA 4BX9A 1LQTA 3G02A 2B36A 2X8JA 1UBLS 2XRFA 3GRVA 1YAHA 1EEXB 1IN7A 1QFMA 4MS1A 1R0YA 4CZ2A 5F2NA 3MQ4A 3T4PA 1KJNA 1ZYUA 3FHCB 2W8ZA 4EECA 1HGXA 2QPAA 3TDKA 2FWMX 4KRFA 1VHQA 2OBNA 2ZQ5A 1CE8B 3N2LA 4DXAA 3AGPA 2ADMA 2IXFA 2PMCA 1UWKA 1K9SA 1XOIA 2VJCA 2Z2KA 4RV4A 2ZE6A 2DWOA 4CTOA 1W85B 3HE3A 1F17A 3I83A 4QWMA 3SFVA 1R9JA 1TTPB 3E0QA 1VIAA 5ES3A 5F35A 3IMEA 4PO8A 1R16A 2GFIA 4GQIA 3RUIA 3NTQA 3DMYA 1OIWA 4GEGA 3VSBA 1T25A 3L2OB 3LW7A 4NE7A 3INGA 2W6ZA 4L8YA 4DC9A 5CEEA 5BNTA 6NULA 5IVPA 3GEBA 1SQGA 1KFEB 4TMVA 1PWZA 1Y81A 3INYA 3M2TA 3QELB 1FNSA 5A3QA 4E5KA 2H6EA 2IV7A 3M5DA 3JAMA 1V1RA 3Q2IA 3TOSA 4PS1A 2I99A 4DA9A 3EN0A 1N6OA 5J4YA 1VCHA 4WI1A 4D0RA 2Y1LA 3RUDA 4YUVA 1Z0AA 1ZD5A 4KUHA 4RCYA 1OX5A 2XBMA 1QIGA 4RTSA 5B7NA 2OSBA 4J1NA 1NT2A 4ZC8A 2J59A 3SIRA 2HU2A 3LI2A 1ZOPA 4UNQA 2IEIA 3FGNA 4IKOA 3U7QB 3QF4B 1UBKS 3I32A 4RTPA 3AF6A 1KIAA 2IXEA 3E9MA 3Q1KA 2VA9A 5EKTA 3AEQA 1NE7A 4IVQA 1FP2A 1SC9A 1WVIA 2P1DA 4L6CA 4ZT4A 3CU5A 3AETA 3PD0A 1HFJA 4XARA 1IDOA 2XY4A 3K8YA 4C20A 521PA 1OV6A 3D6HA 2RSLA 3ZH2A 4CM4B 5I7OA 3E1SA 4XUEA 1KMMA 1NXWA 3VR6A 4PLZA 2EARA 2G7MC 4YB8A 2JGDA 4FP9A 2BM8A 3R8FA 2YWGA 3HDQA 2AKYA 3Q8KA 1WU7A 1IULA 1CUFA 1DTWA 1FMJA 1NUSA 2AK3A 3NIWA 1K4YA 4NICA 1H22A 1M8FA 2HCFA 4FE3A 3ZHUA 1V37A 2E6UX 3B6EA 1W5BA 2WU4A 1O95D 2P2NA 3QFTA 5JCPA 1L3BA 3OTGA 1PR0A 3IE0A 5ALUA 4E32A 4JLUA 3ZY4A 3UPUA 4QM6A 5B36A 4LY3A 2WAXA 4HFMA 4GD3Q 4QHYA 1ODJA 2Q7DA 4AFNA 2EQAA 1VQ1A 2F7SA 3VH3A 1EQUA 2RGNC 1N6NA 2Z3VA 3E5HA 3H11A 3HEMA 4O02B 4PZZA 4RD2A 3RF7A 3FH0A 2VHXA 4M8SA 4RF4A 3RVRA 2BY4A 2FG6C 3TCNA 2C54A 3AINA 5BWNA 1AHNA 1QTIA 1WD7A 1DPFA 2AFHB 4QGHA 2VH1A 1G9XA 4D57A 4UCQA 1V25A 4LJ8A 2W71A 3SQMA 2PD6A 2D5LA 5LZ2A 2QF7A 4O1IA 2ZGVA 5EL0A 1M1XB 1Q84A 2CFTA 3A6ZA 3WWEA 5AVVA 2JFBA 5JWRA 4BO2A 5BVGA 4NNJA 4UTVA 3R8XA 3WI7A 1OFVA 2Q62A 3GVCA 4B44A 4BATA 4MGHA 4GRDA 3E82A 1LLCA 5J2TA 1V35A 1EVLA 4BLQA 1MDFA 2R97A 3NI2A 5DM1A 3GOHA 4RF2A 2QVZX 3IAM6 1HNNA 2CDAA 5FOUA 2J3MA 3GLFB 2IPMA 4N3GA 5ELXA 1X7XA 2QPLA 4V3BA 1Q7RA 4OFWA 4B31A 5EWLB 4RTNA 2NP7A 4R2JA 4WLFA 1PL6A 1TMOA 2J8ZA 3OJXA 1G291 1C9DB 1U90A 5DASA 1B73A 1Z56C 3RJ9A 2RKBA 4EFLA 5E6RA 3VTKA 4F45A 3GEIA 3HB0A 4B0OA 1XZIA 3AKCA 4B6QA 3TG8A 1CIVA 1TPYA 4QUDA 4Z9XA 4A5OA 1QV9A 1V48A 1KEUA 3WYDA 4AZSA 4IJ6A 2V7XA 2FN3A 1J09A 3LC1O 3M1LA 3TN7A 3ENVA 3UA3A 4H6XA 1I7QB 3I04A 3VYWA 5LOVA 4KR7A 3KCNA 4Y2TA 1M6VA 1ZA1A 1U2SA 3ZYZA 1WWKA 2H06A 3R3WA 2BSQA 1G38A 2QM7A 2WG2A 3GG9A 3JARB 3NTXA 3O84A 5LA6A 1ESMA 2H7VA 3URKA 3HCPA 3PFKA 1M1NB 2C5FA 3GB9A 1PD1A 1RM5A 4KAFA 2AOTA 1NW3A 4QPPA 2QRHA 2H1RA 1IOWA 3BCSA 3ELWA 3L0YA 1DC6A 3PEVA 4IOMA 4IVPA 4MUEA 4FWTA 1CBUA 1X1DA 3QVGB 1W88A 2HA2A 1TJ4A 5KDLA 3EBLA 5IEJA 4U39A 1SCIA 1SXHA 1ULTA 2DHRA 1X86B 3M83A 3BXGA 3ZU4A 2B9EA 4OXRA 1IL0A 3AWDA 3FNBA 1FU7A 3DWFA 5B6IA 2HT1A 2VWHA 3I92A 4B6FA 1DIBA 2ZBRA 4GICA 3G0OA 4BVHA 5AVSA 3GIDA 4MEBA 1NVFA 4RJLA 3PJDA 4BU0A 4CIBA 4QASA 2QB5A 2MDTA 4GI3A 4RDHA 5JAPA 1DE0A 1R0KA 4BE4A 3WK5A 1AZTA 2ZOSA 3L1VA 4JB0A 4X85A 3QNMA 3B1KA 1MW8X 4FGUA 3C8DA 4DLLA 4PQRA 1TM5E 1DQZA 2LCFA 2X4GA 4ZAXA 4D99A 4EG4A 2HK6A 3BXPA 1CY7A 2HBZA 2WYOA 3R6DA 4ZHSA 4OI0A 3D02A 3CPEA 3O31A 5FTJA 1Z35A 5HHTA 5G3YA 2Y0DA 2FR1A 5DXJA 4MH0R 1FDRA 2DQ4A 1K08A 3AY7A 1HA3A 4YXWD 5HUJA 2YFHA 4GX1A 3DDZX 2GQ0A 1Z06A 4O1HA 1MDBA 3TW6A 1NMYA 4X41A 3B9RA 2IYLD 5KWJA 2GVZC 1JLLA 1FZTA 1D9XA 3KB1A 1MOSA 4WLUA 4AZ0B 2FDCA 3C45A 2PKXA 4JI4B 4WY8A 1E8DA 1N6PA 3IVCA 3VBEA 1F06A 4KLAA 3G89A 3U3ZA 3WQBA 4CHGA 4D0NA 1QMGA 4BLOA 4BNXA 2INGX 2QQ5A 2HIGA 2XVXA 5BN1A 1XVVA 5BPHA 4C1BA 4JOQA 1JDUA 2DFVA 2WJ4A 1BWPA 3DL4A 3P0HA 1P17A 1A71A 4GI7A 2FVXA 1H85A 4XSGA 2L0XA 3K53A 4YQEA 5CJ2A 4C4OA 2H07A 2OCKA 1EK5A 1AUQA 3OMXA 5AUOB 3BULA 4EATA 2XYRA 4GLJA 2IY9A 5D85A 3D7KA 5EP1A 1U63A 1E7YA 2H2WA 3UJNA 3U4AA 3KEFA 4BP9A 3DXXA 2QM8A 3PG5A 4JJ7A 4EG3A 3AUFA 3N2EA 2H29A 2HL6A 3B7GA 2XGMA 2OUIA 1PQUA 3SHTA 3LLSA 4TZKA 5EGNA 3KG2A 2I9PA 5EP2A 3EHEA 3GMDA 1JBKA 1H6BA 3KFLA 4DF3A 3BSSA 1A9OA 1UKZA 3TEJA 1NUQA 2FMUA 2ZRMA 3MUOA 8LDHA 5L3SB 1Z28A 3PUHA 1R6UA 4IZOA 1ULAA 4POAA 4ASUA 2DUUA 2C5EA 1FA9A 2G9UA 3KHKA 3AVPA 4QNNA 3ANNA 2GEBA 5ALZA 1BE0A 1Z4OA 4MR7A 4OAPA 1P2BA 2H9YA 1RQPA 5FWDA 3PR2B 5E0KB 2WWFA 4GR9A 2PFKA 4AMBA 4C04A 1JEYB 1GVHA 1IG0A 4K6HA 3SIXA 1SC6A 3E3NA 1FIUA 4ESOA 3S40A 3AP1A 2O3QA 4KVFA 1XTPA 3BMNA 3N9IA 3RKRA 2PS0A 4D4GA 5JC1A 3BRSA 2HMSA 5ALHA 3OIYA 1GSIA 2PMDA 3JQDA 3QLVA 3R7WA 2WNHA 4E5YA 1KEEA 4QGGA 4JODA 1QDUA 3DBOB 3HBJA 4B3MB 3SF8B 4LJYA 1HDGO 3L0SA 1O08A 3JQ7A 2Q07A 4QUAA 5L53A 2QJWA 3X43A 1G9TA 2I1QA 3GDOA 1BDHA 1QPZA 4HDKA 4XVRA 1EIWA 3IP8A 1AQ6A 3R3JA 3ZUPA 3PDJA 4BNLA 3U80A 5J4LA 3E61A 1VPLA 3EPKA 3SQXA 5KOHB 2NTNA 3AONB 3EGDB 3P4UA 4DSNA 3R3UA 1EA7A 4ZMBA 4H3SA 3GP5A 4AMYA 2R8RA 4JI8B 3VXKA 2OO7A 4REQB 5DI9A 1JLKA 4KIUA 1O1YA 1O7JA 3G0IA 1N4DA 1JJBA 3G8CA 2ZTLA 1QFJA 4TXJA 2PXXA 1LS6A 2RJ3A 2WFLB 5C46F 2GJAA 4GYWA 3H9CA 4TQGA 2I3ZA 4G65A 3NU1A 1UPFA 1L0BA 4PXAA 1UADA 1QWSA 3V8RA 2H7YA 3P5BA 3TQIA 3I64A 2QMEA 3M6UA 1HLDA 2A59A 2IYEA 3K73O 1E0KA 1T5TA 4X0EA 4AM8A 4HNTA 2UUAB 3EF3A 2X0IA 1LBTA 2Y66A 1RLJA 2BPOA 1G8JA 3INNA 4TL7A 1HDOA 4CUZA 3A2MA 1WB6A 2YWHA 4DG9A 3RSOA 5LP6F 1CJVC 2FZ5A 3GXOA 3TECE 1F38A 2BCJQ 1A9YA 2ZE7A 3M6VA 1PEAA 4BWFB 1YK0A 3P19A 2ADFA 4U3JB 4DG5A 2G72A 3EE6A 3RUCA 1S9DA 3PUKA 4MR9B 1UJMA 2QBYB 5TLSA 4GOJA 1Y98A 4ZO4A 4CMEC 5MFZA 4E12A 1NI4B 3Q41A 5T3YA 1IATA 3BKXA 5DRYA 3UBMA 3GT4A 2GJ8A 3HBMA 4BFYA 2I4RA 4LCEA 2PWYA 2OC9A 1IDN1 4M49A 4Y2PA 3UV6A 1M0EA 2MU1A 2PV7A 2PANA 3OM1A 1TCVA 2DPLA 1MQAA 3AUUA 2Y1GA 3OQ1A 1C0EA 1M0TA 3TRIA 3VOAA 2BF4A 5DX0A 4CU5A 1UJ5A 4LRWA 4NFLA 3IDQA 4B3JA 4DQVA 3AT1A 2VP5A 3RW9A 4D82A 2ZSBA 5AQEA 2W22A 2QZ4A 3LWBA 4QARA 2QR3A 4DZRA 4JGBA 1PK8A 4KXQA 1WMSA 1MR3F 4LE0A 5K0JA 2OM6A 3DG9A 3OJCA 3QEKA 4YRQA 5DB4A 2XOXA 2A5FA 1K63A 3QFRA 4ZDIA 5HK9A 3IXMA 4P92A 3AKDA 2H59A 2FEPA 2I71A 4ESHA 3ENQA 1KH3A 3R23A 4FEEA 1KZ4A 2PX5A 2D59A 1WHTA 3KPYA 3D4OA 3HCOA 3SD7A 2VJMB 5DBOA 3NUQA 4IZ6A 5AXCA 4JBGA 4LXGA 3B89A 1Q1AA 2PUFA 2Z83A 4UCFA 1Z7BA 4PYNA 4BMVA 4BO6A 4OHFA 2X0FA 3E7FA 1GHTA 1QK5A 2VQFB 1TZJA 3TD2A 1NRWA 5JRDS 5CCBA 2AEEA 3JWPA 2QRMA 3P9NA 3RC1A 5IFLA 3BFVA 4B4OA 1QRTA 4EKYA 3K16A 1ZNZA 4HAOA 2HIHA 4Y3UA 2GFHA 4U00A 3IULA 4WFJA 3U62A 1J2YA 3LOUA 3TVYA 5GZ1A 2HMYB 4IIUA 4CV1A 3VHXB 3OOHA 2JLXA 2FPKA 2XTZA 1U8TA 3G2QA 2VC2B 3L46A 3ABZA 4M9XA 5B53A 4MVJM 2RI0A 1PR2A 3MTJA 1Z6YA 3CBGA 4WNAB 5IWCA 2IS2A 3L8FA 5A7HA 4IYJA 4YR9A 2QKYA 2YH2A 2HBRA 4C0XA 3OEEA 3V5NA 2Y4OA 4KFRA 2WC1A 3WGKA 4NZOA 3RJTA 2CYBA 1GZ4A 2C78A 5LQUA 4CGYA 4WWHA 1A9XB 2EFJA 5DTRA 1E4YA 1KDOA 2WFZA 3ELYA 2FW7A 1BRTA 1DKQA 2BDUA 4CODB 5FYDA 3DMFA 4J0QA 4OGGA 6ABPA 3ABSB 3QF4A 2I33A 5C18A 1EWQA 5EY5B 3OZUA 3CZ5A 4HVLA 1LTKA 1W1IA 4G4SP 2VXBA 3F0TA 4JLBA 3Q4GA 2X1MA 5HPYB 3QK7A 2ZRDA 5KYXB 4DKJA 3KYBA 1MEOA 1R5BA 2HMWA 2V6FA 1II0A 2NU7A 4CM4A 3D2BA 5D1NA 4YASA 3KLMX 1U7TA 4ND7A 4OK3A 1JU9A 1LDMA 1H1LA 2O2EA 4URHA 3Q7IA 1NUTA 4D92A 4DQKA 2QLFA 4P3XA 2P4HX 2ATVA 4C07A 3TQQA 1LVGA 2WHPA 4TT3D 1SUWA 1V2HE 2A9RA 4LHEA 2X4IA 4W99A 5CYFA 3TD9A 4EAAA 2HV9A 2O8FB 1XR3A 4MOWA 5M3BA 3L4JA 2V8OA 4G56A 5AD1A 2Z04A 3FTCA 1U4NA 5BT9A 4Y2GA 5TC4A 4H6WA 1C14A 4ZJYA 3IT1A 3WIOA 4NG4A 4DQ0A 1APBA 1M8PA 4AJIA 2ODTX 2BHNA 3COYA 4F92B 3ZJUA 5ETJA 5HJ5A 3G9TA 1OBOA 2QRNA 2GF9A 4TWIA 3MN1A 5B1SA 3SEAA 2PUVA 1UFKA 3KT8A 3KQKA 3OZVA 3QOFA 4KLZA 1YA6A 5EJIA 2PX3A 4HNRA 4CR7A 1RPAA 3R7LA 1Q0PA 3GGPA 5TMDA 2O1WA 3OD5A 5BV7A 1XELA 2W4IA 4EQZA 4I19A 2WHEA 1TLFA 4M8NE 5K8LA 2FHPA 3BX1A 4LSZA 1BAPA 2AXEA 3RUHA 4G3XA 4N5IX 4HYEA 2JRLA 4NMXB 5FA5A 1GU0A 1S02A 3QM1A 5G40A 2R7AA 3LPAA 3HZHA 4QG7A 5TR9A 1Y7PA 1W2HA 3HB9A 5ENZA 3TRHA 1A8PA 1HBJA 4KXUA 4YECA 4G81A 2W2MA 1K7YA 3E4CA 3MW8A 4E2XA 3R3VA 1OXVA 1M83A 2HF8A 3T4XA 1LK5A 1NI3A 2ZTUA 4N8SA 4G97A 3TR0A 4Z53A 2YNMD 2O20A 2FAXA 3FBTA 3IRUA 2XRMA 5C4GB 4RQAA 1PEKE 1K7CA 4G0OA 3O75A 4D8VA 5AUPB 3C5CA 2R60A 3C7AA 3E03A 2UYGA 4ITVA 1PFKA 3J81k 5AHOA 2OZVA 1KC1A 2X8WA 4A0SA 3WWOA 2GXSA 1ECFA 3QLUA 4WASA 1FW6A 1S4QA 4AX8A 3F6SA 1A5ZA 1PKXA 2PZLA 421PA 3ZD8A 3C1UA 3I2GA 4OLHA 2HDOA 2P2ZA 1NVUQ 4DQUA 2IU6A 3OPXA 4S1NA 1VLLA 1YQGA 4ODIA 1IHPA 5D00A 3DV9A 3KT0A 4B4WA 5F7XA 3TNLA 2EC5A 1O95C 3SJZA 1V95A 5EZYB 2ZVJA 3IUSA 1E64A 1M1NA 1UBJS 1EWYA 1U2ZA 2Q0SA 3O82A 1D6MA 1E2LA 2JAPA 4CMGA 2P9HA 5K03A 3GROA 3W5HA 1R9NA 2QMOA 1RBQA 3FUVA 2RCNA 3NNDA 1U81A 3QVGA 1N6IA 4N18A 2B8JA 1W94A 5I8ZA 1IFXA 1PWXA 3S2YA 1L7XA 1YK1A 2Q4OA 4IVNA 4Z4GA 4DDKA 2OBMA 4LRXA 5TT1A 3ZU3A 1JVBA 1SBTA 5KNCD 3RB8A 2ASVA 1R1DA 1UWLA 2FPRA 2YINC 4NEGA 2D8MA 2CNWA 5BSEA 4JJ8A 4NZNA 4MWZA 3ZK8A 4NHOA 1ZY2A 2V1UA 3BJZA 4IL5A 1H2EA 1KQNA 1E3EA 1T8TA 1U3WA 1QCZA 3W6NA 3TG2A 2Q50A 3ETNA 4Y1EA 1HT1E 4E03A 4R84A 4GE0A 4AY4A 5H70A 2B4RO 1N8NA 3B7WA 1DHTA 4KR0A 4QGBA 5JAOA 2BN4A 2HJRA 4R5MA 2VZ9A 3EQ2A 4XQ0A 5IXYA 3UENA 1M34B 1JXOA 2FKAA 2OL4A 4OBWA 5J2TF 2FEWB 3R6TA 4BMNA 2Q45A 1FFEA 5FWXB 1QIMA 3O8LA 4KXWA 1YZVA 4MMZB 3VHRA 2ZJZA 2H1WA 4ZZ3A 3KELA 1YZFA 5D51S 2EBWA 1SVSA 5ALYA 2HB6A 5HF6A 2BYTA 1IBLB 1BFDA 1LKZA 1QRSA 1ZOLA 3BJEA 4LOAA 3LYUA 5C8XA 4DR7B 1XPUA 4ZOQI 1BFKA 1XSEA 4W8HA 3MTAA 1XAJA 2A86A 4IHKA 4L3VA 4M0UA 1DDOA 1VHDA 3HNPA 3LPMA 4J03A 4W7HA 5A4IS 3GF4A 2H17A 2AUMA 4OJMX 4B4UA 4CR6A 4R0MA 2O5EA 4RIFA 3WGYA 4MDYA 4BBAA 3HA5A 1TF5A 2ZWPA 3K8ZA 5FI0B 4QKQA 3VZQA 2CZQA 1RZ3A 5JAIA 2VPXA 4LXUA 4OJTA 3SYRA 3L0DA 4MCJA 4YRZA 4WFIA 4FDVA 5LOVF 5TMPA 2CFOA 1KARA 2OAP1 2NLOA 4HDRB 1THGA 3B3FA 3G8BA 3EC2A 4Y8VA 2CDCA 3RU2A 1GTG1 1O94A 1PEDA 3GO4A 3FNFA 2Z2XA 1H3FA 3RHZA 5LA6F 5JAQA 4HX9A 1ZW6A 2Z5GA 2XI4A 2O1SA 3OCCA 4CV0A 3K0CA 4Z3OA 5CLIA 1XT6A 3T7JA 3UC5A 1VLVA 4PYKA 3CX4A 4W5HA 2DECA 3QUTA 2SKEA 3VUFA 1BCRB 4OQZA 3P2YA 5B55A 4OQXA 1KF0A 1Q2UA 3WOHA 3QU5A 3IL2A 1DOHA 3M2PA 2YMQA 1ZH4A 4EUFA 3SOZA 2EEZA 2BR3A 4TRMA 1ZJJA 1R5OA 5TV2A 4EKGA 1N9GB 2A0XA 4I50B 4JLOA 4JI0B 1HQKA 1UUFA 5K8UA 3HJRA 1P81A 5CVJA 2VHYA 5H81A 3P9YA 1CUDA 5CHYA 3DOHA 4DT1A 1V4BA 1NBIA 1ORRA 1OPXA 1WXIA 3DZBA 4BWVA 1UKVY 1HT3A 2YOGA 1DKOA 2NQTA 2V3WA 4NTZA 2JLQA 4ON9A 2HMTA 5E6SB 1CLUA 4DY6A 3K9CA 4EZBA 5HM6A 4OH7A 1CY4A 1L4KA 4GQAA 4HT3B 1G55A 1WG8A 1VLMA 1Y8AA 2CEKA 2NZYA 3AUTA 3PNPA 2B98A 1MOQA 1J9GA 2I3AA 3I4FA 4QULA 5GJWC 3NHZA 3SF8A 3NHFA 2GAJA 2CHVA 3LGSA 5EKSA 3JAKB 1B8NA 4PYRA 1YNSA 4TX1A 2QM0A 2ZIGA 4D9KA 1DBWA 2P62A 4R7ZA 3ZGXA 4B2LA 2P9YA 1P4GA 5AW8A 1U7DA 2VP3A 3RWMB 1W4ZA 3BIFA 2IJGX 2WUFA 4F6RB 3OCXA 4IQGA 3FZGA 1ZUD1 4DY4A 1NW8A 3JYPA 1LBSA 1QH8B 2H2FA 4YT2A 1ZH8A 2B5WA 2DQYA 3EGDA 1JB9A 1JBQA 4HI0E 2B1IA 4K5QA 1N0VC 4UD2A 5F7ZA 3UANA 4CCWA 5IABA 1NIPA 3H2ZA 3ZXIA 4RTJA 1IY9A 4JFAA 4TLMB 2F9FA 3WG9A 5K0LA 1L1QA 2VYCA 4REQA 5IDXA 5I4IA 4XQCA 1N3BA 1YJBA 2CL5A 2X3UA 5JPDA 4I5FA 4BASA 1JSCA 4AJEA 1NV9A 4RK1A 4URYR 2APJA 2PK3A 4G9EA 3IIKA 2PV0A 1YDEA 3QXGA 4R2WA 2C4KA 2OGUA 3VR3D 4DL9A 1P1HA 5KZMB 3T5AA 1DELA 1YZYA 2G1UA 1AC5A 2Q5IA 2WZCA 4UDYX 1IOLA 2WVHA 4ICIA 3PRHA 4YLGA 3VAAA 3EAQA 4YJ3B 2G40A 3RD5A 2XE7A 2G4CA 2P9QA 3JQFA 1LDBA 1Z0UA 3GWZA 3HCNA 5AJVB 3UMBA 3V42A 4XIFA 1KQOA 1A8UA 1KZ9A 4I4NA 9LDBA 3U9SA 2QUJA 5I48A 1CJBA 1F3OA 1MC4A 3H2KA 2J4FA 3OE4A 4L2IB 4DLBA 3GLIA 3LUBA 4N48A 1NSTA 1WCYA 1TCUA 3K1TA 3NMUF 1D2AA 2FUKA 4AG5A 3F9IA 3WIVA 5KBYA 2RIRA 2GLUA 2WABA 3H5VA 4R6XA 1FYEA 3IILA 3I2YX 3VVMA 1JQ3A 4U3JA 1JHMA 1XJQA 4ACAA 5BW5A 3MIZA 2ZJYA 4O25A 4WKNA 2O3TA 1UMBB 1C3VA 4RL6A 2QBYA 3H99A 4XWTA 2J9XB 1M2FA 5A3VA 4FXPA 1S8AA 3E9QA 5LMNB 4MVJH 5DPMA 1C8LA 3OO1A 1J5EB 1CHDA 1TM4E 1YUMA 3NEPX 4JKOA 2CZGA 2GK4A 5LQAA 1K97A 4LV6A 2I2AA 5FOXA 5LJLA 5DCWA 4CT0A 4CKCA 1YC2A 2EYQA 3JPWA 4W8OA 5CLGA 5DK6A 4IDAA 2C88A 4R2XA 2FFBA 4F93B 4K0KB 5KU1A 3IP9A 1ADJA 1HK7A 3NV9A 1F51E 2Q46A 1UOOA 1XKQA 2GBLC 4WRRA 3D6VA 3WQQA 4BNDA 4OLAA 1KTIA 4ZOBA 5CFLA 3KT6A 4A6EA 5FL7A 3DE2X 3PFBA 2C9ZA 1D5WA 4Q5IA 2GEJA 2ODWA 2PA0A 1LNQA 2W48A 2XYHA 3FKSD 2BIFA 2P6NA 3H1BA 1DT3A 2C92A 2QX9A 2B4KA 5FV4A 2BGNA 2CLOB 4OSPA 4GWKA 3SS7X 5CX1B 3WC4A 2QRLA 4WTOA 2BT4A 1Y8ZA 1GGMA 1P9LA 1A7AA 2C4VA 2EZ8A 3LYHA 1KQGA 3FUCA 4RK7A 5FWAA 3L6CA 3U3KA 1PGNA 4DMHA 3TJZA 4J0GA 1QVWA 3ZZUA 2RFLA 3TSZA 3AJEA 3OIUA 4MMYB 4RLSA 3MS2A 3KZOA 4OAOA 2JK0A 3FLMA 3QMPA 3C8ZA 2H1SA 1VL5A 2Q4EA 2Y0CA 5DHTA 3HWX1 2Z1DA 1OBVA 3A4MA 1HYEA 1O5TA 2OQRA 3K2QA 4OJQA 1JECA 5K2MA 3T5GA 3TSAA 3UT5B 4RHFA 3EA4A 2K2QB 4FSXA 1T2VA 4KHPB 4QUKA 4DCUA 3EIFA 3CUTA 2A5LA 3EF0A 1UXHA 3LO8A 3NHWA 1OA1A 2X9LA 4IDBA 4G67A 3L3BA 1NBMA 2EW8A 3WNBA 4DNFA 2BFEB 3BBPA 3CRZA 3LDFA 1C4OA 4QJIA 4U63A 3ZJ5A 3VAZA 1JKJA 2QUZA 3T5BA 3CW8X 3N0XA 4WK6A 2XPCA 3HBLA 1XZQA 4I4IA 4L5AA 2Q3DA 4WNAA 1UDBA 3GCWA 3LIPA 3D7NA 1VGQA 2JCYA 3NM4A 5ALDA 4E14A 1DDIA 1YKGA 4IDOA 3RS3A 2H2GA 3HBNA 1D04A 5TDHA 5TQ2B 2V9PA 1VB5A 2DKNA 3IAUA 5CVVA 3MNFA 2H00A 4ENUA 1XXHB 2X0KA 3AY0A 2NUAA 2EFCB 2ZQYA 2QN3A 4JX8A 5THXA 1U0NA 4AJHA 1A9XA 2GERA 2QIPA 2OK8A 3DDWA 3MIIA 4P9NA 4U7FA 4ZVLA 2OB2A 1JE1A 1P0FA 2QN1A 3CG4A 3GGDA 5K0FA 3I3OA 2J0VA 1FP1D 2FQWA 4QSHA 4L9RA 3FBGA 4BE7B 1L5HB 1ONSA 2DBQA 4RHUA 1GUBA 3ND8A 5F77A 5KYXA 1Z45A 2L2QA 4X90A 4GKVA 5COAA 1BS9A 1KDYA 4ZOCA 4FLMA 1W29A 3ZTYA 1Y80A 1C1XB 2QX8A 2PKYX 4CMIB 1JFTA 2Z5VA 4QOHA 4RFSB 1TQ8A 3LIIA 3O3MB 3PEEA 5DWQA 4CEJA 4Q16A 3ZWYA 1X7YA 1PDVA 2ALJA 2YIDA 2VOJA 3EVBA 2MSWA 4I46A 4AYTA 2H8KA 1J24A 4DIFA 4J3NA 3D8UA 2GWRA 2ZJ4A 3FYHA 2Z9DA 4L4RA 1XZJA 3O5AA 1ZGBA 4M36A 4BNNA 4M55A 2PWAA 4PO3X 4PVDA 4PANA 4UFPA 3DHWC 5A4MS 3CRNA 1AIPA 3JVDA 1WMEA 3UFXB 3DQQA 3T12A 3ONFA 5ALFA 2QAGA 1KDVA 1ADCA 1ZNYA 3TQSA 3ZTTA 1CS4C 4H4DA 3OC0A 1FJ2A 2YMPA 4OYLA 3ZCXA 2X58A 1CJSA 1RPTA 2B0JA 4P3NA 1KU0A 4G8BA 3TTXA 1UJ2A 1MJFA 3FVWA 2H3EA 3ZV4A 1GUYA 2O0MA 3LLUA 4KFTA 3ITNA 3SLKA 4ENQA 1XEWY 1TYAE 3TINA 3ZNNA 4DDTA 1TM2A 3GLSA 3K05A 3CLRC 5BSRA 1H05A 4CM3A 1RMYA 4ZRNA 2H4FA 4MWBA 5LLSA 2XCOA 3AZQA 3HWSA 1NP3A 4PC2A 2CYCA 3HKCA 3Q9NA 2EZ9A 2GRJA 5KOJB 4YV2A 2BE7A 2G9QA 3DVQX 4MVJD 5P8WA 4BQPA 2D5BA 4YI3A 1GJRA 3H5IA 3EG5A 3C3EA 1DC3A 5I7VA 1TMGE 3TLMA 3FPCA 1QR2A 4YH1A 1NKTA 3HJBA 1E9DA 4M53A 4BKRA 1KETA 2IXTA 3IUYA 2EZTA 4HGYA 2KB0A 5J5VA 5K51A 4ZEMA 1LPSA 4KFCA 2P1RA 2RG1A 5BN3B 3F96A 4V0MA 1YFZA 4B32A 4YJ2B 2ZYGA 2WVGA 1KY2A 3BDVA 2JLCA 3IE2A 4PEVA 3U19A 4DLNA 1SBIA 3F9RA 3TTVA 4IDQA 3S2SA 5FT9A 1R4NB 1JDNA 1KAQA 3EUEA 4EW2A 1U5BB 2K87A 4C43A 3NIBA 2I29A 3SCZA 1PZEA 1W52X 3U7JA 2PKQP 3F3MA 4JI6B 2WIDA 3IJ5A 1RBMA 1PTKA 3KJFA 3T15A 1EXWA 5FPYA 1SPBS 1NMSA 1HI9A 1YB4A 2ZI3A 4JOCA 1Z15A 2Z58A 2ATEA 1KHTA 2FTKE 1QZ3A 3HU2A 2ZR0A 5HE8A 1KZ6A 1RQNA 4EHAA 4EPXA 2H4ZA 2YV2A 3P4XA 1IWPB 1DJNA 5DTEA 4C4XA 4LJ5A 1XLUA 2A1UA 4R51A 1YASA 4UVEA 5ECWA 4UKDA 2J5QA 1E63A 2FOLA 2PWBA 4EBFA 4J6EA 1OUMA 4Z3DA 2R48A 1YD7A 4Y6OA 4ZGBA 2OO5C 1XALA 1A72A 2Q9UA 5GZ3A 1PZXA 2EQBA 5G4KB 4A3SA 1Q7EA 2PA3A 2QMQA 4EPVA 4OLBA 2G07A 1XRPA 1N7GA 1XMSA 2I2CA 1E4OA 3HGMA 3Q15C 4NP6A 4PTYA 1PNVA 5IMBA 3ZUGA 1NJ2A 4Y98A 3F3KA 3H1FA 4I3HA 2QTVB 4N65A 2OILA 3JD1A 4ALKA 3VO8A 1K5GA 5MN5A 1X2EA 1DUIA 1S3SA 3TLJA 4JI7B 1VSQA 1QHEA 6CHYA 3JQBC 4GDFA 1YMVA 3GA7A 4N3NA 4NE2A 4P0TA 5B7GA 4GF5A 3ZTWA 4BQFA 4FDTA 3SYTA 1QRDA 3CLUC 2IWRA 2B2CA 5HOEA 5AVKA 5HF9A 4AY6A 3N0WA 1KO8A 5BYKA 4MQ6A 4CF7A 1PYGA 4BMCA 4WOCA 1KGDA 5BQFA 3F67A 4KMSA 2YNMC 2OOSA 5A1JA 3TQFA 3PFGA 3R3ZA 4H7DA 2C03A 3KVVA 1NUAA 3DLPX 4IIJA 4JIGA 3N2ZB 5E7QA 3V2GA 1XJ0A 2C7VA 3F5SA 2FETA 1EDOA 2RAUA 5DLYA 3SE0A 1KK2A 1EVIA 2ZIUB 1JIUA 3IMKA 2XCLA 1GPDG 3K0EA 2PXAA 3GZNA 3PF8A 3OI7A 4UE2A 4XIGS 4AURA 2ZM5A 1HT2E 2VTBA 3VC3A 3ET5A 1DZ3A 1LRLA 5EERA 4AIRA 1P2FA 1GNSA 2EKDA 1AV7A 4ZOLB 2GZAA 1IXSB 1LVHA 1HZJA 1SK9A 2GA9A 3CLHA 3IKJA 4Z4EA 3D7LA 3LKZA 4OYYA 4ABTA 3CY6A 4FUTA 1VSUA 2A78A 4CF4A 5EMKA 2VSXA 4MQFA 1TGVA 2FCRA 3DE7X 4X54A 3KQHA 4Q3AA 4BTLA 3A1SA 4C01A 3QITA 3ILHA 4AKTA 1BU5A 1E60A 5EHQA 4DBLE 5DTJA 2V7QA 1M2NA 1XFDA 1B23P 4U2EA 2R68A 1RCFA 1PW7A 4PPQA 2NXWA 3EY9A 1UFOA 3H1EA 2PTGA 3PGMA 1AA9A 1OLXB 2YVUA 2JIOA 4MUYA 4NLLA 5JXHA 1CXZA 2CE7A 4FFPA 3WLIA 3DTVD 4Z1MD 1GKUB 3GJ3A 4FVTA 4CM8B 4DLTA 2WPNA 4EAQA 2C9DA 3COZA 3EIEA 5H80A 3R5SA 5AKGA 1F7UA 5A0TA 1YVRA 2OESA 1N9GA 5B1HA 1WB9A 3V6LA 3O03A 4ZHQA 3ENZA 3E1GA 2O59A 1U2DC 4B7XA 1H94A 1WP9A 1GPYA 3ZHYA 1I80A 1VLQA 1H4SA 5KHLB 1MP0A 3CH4B 1F2VA 4B6OA 1RM0A 1W5AA 5AOVA 5E6SA 2C2ZA 2JA2A 2XMGA 3RC2A 3JQ6A 3TI9A 3K6SB 2ZW9A 2DX7A 1H65A 4DPMA 4KPUB 5LIRA 4A8HA 2CLCX 2ZE5A 4UQLA 3D7RA 4IO0A 3T1QA 4ONEA 3FNHA 2AI1A 1TW2A 2PZBA 3ANTA 4YJHB 2OV4A 3LBAA 2YHIB 3E2MA 5H9WA 1DCKA 3HRIA 5GONA 1XDGA 5JBQA 1PP4A 1J8FA 3FPKA 1JJFA 3N7TA 3S0JA 3ADKA 2AX3A 3BAFA 3HJHA 2BFPA 4I1IA 4JJKA 2CVPA 4MA4A 1IQ0A 3C3YA 1SQ0A 3HKBB 4H7HA 3AEKB 1CPYA 3OCYA 5F5NA 4TSKA 2ZJ6A 2VYFA 3OHMA 3KQTA 1XFAA 1FTNA 4QBTA 4YXWA 1LFAA 5KO2A 2Z43A 3DLCA 3DJYA 1L7NA 3EGOA 4RMIA 2J3LA 5G1NA 1ECGA 4TWAA 4YP5A 1L4NA 1SXJA 2MOKA 1AKNA 2WG1A 3DZIA 3O26A 5HCUA 1KAEA 1F6WA 1MO2A 2W2PA 1JH9A 3MJTA 2Y05A 4G8CA 4DILA 4EVSA 1GDDA 2GLTA 2ST1A 3D8RA 4YJ3A 3ZK9A 4QLBA 4AF8A 2JFXA 1C0PA 4H7JA 2P7HA 4IUBS 5FPQA 1E69A 1QF6A 3N86A 1MAAA 3H83A 4BNUA 3UIEA 3CR3C 2VDWB 1NTOA 3DLHA