2IYWA

Shikimate kinase from mycobacterium tuberculosis in complex with mgatp, open lid (conf. b)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
178
structure length
178
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPSPSEAATLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHIKIMATE KINASE
publication title Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 67
structure length 178
sequence length 178
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iywA00
4KAXA 1QF9A 2PJRA 1XZPA 2WMNB 3NG1A 2H8KA 3KTAB 1SHZA 1AKYA 3OIWA 4B2PA 3KFVA 4OHVA 1Q12A 2QBYA 1ZYUA 4Q7LA 3U3MA 4Q9LA 1WRBA 1E0AA 1KO1A 5KYKA 2ZU0C 4IOKA 4KVGA 2GETA 4MH0R 4CEHA 1VDZA 1UPTA 2K5UA 2XB2A 2QT1A 4LK2A 2NO1A 1BYIA 4TT3A 5LB2A 4EQ6B 1W36C 2X2FA 4IVQA 4CW7A 5DYGA 4JVSB 3SHWA 1G3RA 2A78A 4TTPA 3SHFA 1LW7A 4U5XA 1UKYA 1XTSA 4ZI3A 1NIJA 1ZP6A 1I2MA 1OH6A 1S1MA 4BWYA 1PJRA 2A5JA 1XXHB 1AGPA 3PUZA 3REFA 1KTVA 4QJ4A 1Z0IA 4A2PA 1E9CA 3G5UA 1E9SA 1OHHD 3QE0A 3UPUA 4TMVA 2GXAA 5JRZA 2MSDB 3BB1A 1OIWA 5KNBA 4PAOA 4OHXA 4C0AC 3QUSA 2ODWA 2WWGA 2ZE8A 4MGZR 1OH8A 4LYJA 4OI2A 2QL6A 4XOIA 1C1YA 3D7MA 4NCHA 4OKSA 1GDDA 1U8YA 1KMHB 1UBGA 4MYHA 1OJLA 4NYIQ 4P33A 4PQFA 3DOEA 2XTMA 4C0LA 4IDHA 1RIFA 4KHZA 1N6RA 2ZRFA 4HYYA 2G1JA 1A4RA 4OJKA 2HXYA 2JJ1A 1LFDB 1OV4A 2VSOA 4IFEA 1US8A 1XCPA 1G5TA 2OCBA 3MLEA 5KSOA 4Q4AA 2QORA 3U3KA 1N25A 2I1QA 3ZVNA 2CL6X 1KJYA 5FOXA 2FU5C 4M21A 2YOFA 4AIIA 5FPSA 2CBZA 1M2OB 2CVFA 3QKSA 4KBFA 3L43A 1W4BA 1AS0A 1DELA 4M0LA 1UBFA 3TUIC 3R7WB 2Q9CA 5JS7A 1N3BA 2F43B 3QVVA 4HB3A 5JEEA 1NN3A 2XXAA 5DISB 3KB2A 1L4YA 2NO7A 2OE2A 2OFOA 3SU8A 3WRXC 1MO5A 3QPUA 1KK3A 1NN0A 3WNBA 3DO6A 3U7FB 2R6GA 1IN6A 5M04A 2ERYA 2PT5A 3MGCA 1U99A 4LBYA 4A4DA 3B9QA 1G8GA 3VR5A 4C30A 1S1CA 4ASUA 1W5SA 3SQXA 4N3NA 4BFWA 3FKSA 4I1VA 4B76A 3ZIAD 5A4JA 4Z1MA 1ZRHA 2ZAOA 3KKNA 4RY2A 5EE9A 2ZYUX 3IPYA 2C96A 1AA9A 2EWWA 2RMKA 1EWRA 1IY2A 3GMTA 3W3AA 1N6HA 1A1VA 3A1WA 5EUQB 3I5XA 4DBLC 2WJYA 2ZRMA 5LB4A 3LV8A 3LW8A 2ZYWX 3OF5A 3NWJA 3DMNA 2JJ8A 2QMOA 1FZQA 3B1ZA 1W44A 2Z0MA 4W7SA 1E1QA 2F9MA 2AKAB 2WSMA 4M9QA 3NKVA 4D82A 1GZSA 4L9SA 2OV2A 4HLDA 1VPLA 1G3MA 4PSVA 2JASA 2DYKA 4JYCA 5BWMA 2QPTA 1KI1A 5EXXA 3RWOA 5CK5A 3GD7A 3K0SA 4KO8A 1G6OA 2DFTA 2H16A 1NVVQ 4JJZA 1W2HA 2CDNA 3EPKA 2IS4A 4WOPA 3H1TA 1CP2A 5KDOA 1UEJA 4QBGB 1KSJA 4DSNA 4EFMA 5AUPB 4B3GA 3AP3A 4HUTA 2Q3FA 4ZIRB 5HPYB 5F9HA 4AURA 3D3QA 4FCWA 1ESNA 1GTVA 1EG7A 2GHIA 3O8DA 3REGA 3GLFB 3PEUA 4DSUA 1R8QA 3LWNA 3FOZA 1KDOA 1Y63A 4CGZA 3MWKA 5JHGB 1Z22A 2PLFA 1K6MA 3ZGXA 3ADCA 5C18A 2QAGA 1OE0A 5JCPA 1S4QA 2AK2A 1CJKC 2YWEA 1TADA 3K0CA 4TYPA 1VHTA 2BMFA 4NH0A 3GJ3A 4DHEA 2BJWA 1O87A 4YC7A 1E2JA 2FSHA 1LNZA 4PC2A 5TY0A 5CIQA 3AUYA 4PC7A 2O0KA 3CF6R 3FFBA 4PZLA 4EKDA 4LPKA 5H1YA 1DAGA 2ZJ2A 2AK3A 4QGFA 1AKEA 3IO5A 4KFTA 1W4CA 3BXZA 4I1UA 1UDXA 4OQXA 3WNCA 5JLJA 5IT5A 4IKEA 4NU0A 2BMJA 4GRAA 3B1YA 2DR3A 2IS2A 2P0EA 3O8RA 2QZ4A 1S3GA 5EXTA 3A1TA 4AKHA 3A58B 4ON9A 4AC9A 4AKGA 1T0HB 2D3WA 1YZQA 2WKRA 1CR1A 2EVWX 1Z28A 4GZLA 1ANKA 4Q9JA 4D2IA 1HT1E 2WWYA 2IYWA 4IDOA 4LX0A 4C7OA 2J7KA 4NKRA 2GDJA 3PENA 3QJYA 3WYFA 4TSFD 1JPJA 3SC3A 5JS8A 3BFKA 1IN8A 3AGPA 4U00A 4A0HA 1HEIA 1JR3D 1DVRA 3CKLA 3OIUA 4ARZB 1RC8A 4D0LB 4Q01A 3P26A 2O8DB 3P20A 2JLRA 4JLJA 2ODBA 4WZ6A 2F1JA 1E9AA 2VP5A 1E1RD 3BS4A 2G9NA 4D25A 3QXHA 1YR8A 1ZJ6A 2OXRA 3ASZA 3KTAA 1V5WA 3NDBB 1Z6TA 1IN7A 2ZRPA 5FPTA 1KI8A 3A1UA 3SDZA 1GKUB 2C9CA 2ZI7A 3H0KA 3AVUA 4A1FA 4WIAA 4Y0VA 2P2LA 4IOLA 3T1OA 1UDWA 4A15A 2V6JA 4BEBA 4P32A 4US1R 2NG1A 4NONA 5D3MB 5A5GA 1CRQA 4OI4A 2GNOA 1II0A 3BORA 2ZUCA 4LJAA 4ABYA 2OFXA 3HPRA 4K8OA 1MH1A 4EQ6A 1JECA 1BMFA 2QY9A 4XSGA 4DB4A 4BFUA 1SVMA 2QSZA 821PA 4WA7A 4P4UA 1E98A 3U2QA 4A8JB 3EARA 3T15A 3IO3A 3VR1A 2J0SA 3PVSA 3MD0A 1ZIPA 2ODEA 1XPUA 1S96A 4MGIR 4TTQA 2QROA 1IN4A 3UK6A 1XXHA 1SVOA 1T3HA 4Q1CA 2ZSFA 3ZZUA 4KFSA 2NOAA 4FMCB 2ZI3A 3BIFA 3ZS9A 1ZM9A 2ZSEA 3AKCA 1XCGB 2B92A 3PITA 4TT3D 1XD9A 4P31A 3TSZA 2G3YA 2OBNA 3U7EB 1R5OA 2D74A 4AD8A 1W49A 2J7PA 4A6PA 4A92A 1W2GA 1X1RA 1E2QA 4L8GA 4FMDF 3TLXA 1YJ5A 2VHJA 2ZJ8A 2GK6A 1Q20A 1DG3A 1Z07A 4M1MA 4DVGA 1KMHA 5FI0B 4CF7A 1U81A 4KI0A 5E3HA 1XJ0A 3GEHA 5AJXA 3K1JA 2MMCA 2DWQA 4X8OA 1SVIA 4IXMA 1EFHA 3RS5A 4O3MA 3G0HA 3TQCA 2HF9A 3TR0A 1N6NA 3B78A 2R8RA 5KOYA 1E0KA 3PEYA 1HT2E 1COWD 1BKDR 3P32A 4ACAA 3ZD6A 1E96A 4Q02A 1XTRA 5J4HA 2WM9B 4FXPA 5DLQC 5LD2B 3LD9A 4Z51A 1HTWA 2ECKA 2BOVA 4Q1BA 2WMOB 3DOFA 3C5CA 3F0TA 4TWZA 4ZDJA 1CF4A 3I1FA 4MRNA 3PG5A 3T61A 2G6BA 1KK0A 2GAOA 5EUMA 3R7WA 3QQ5A 1EX6A 4M1YA 2F43A 2NTYC 2OG2A 2ORWA 3HWSA 3KFXA 4MDEA 2B8WA 2JJ1D 1TPZA 3CR7A 3A1VA 1KI9A 1QVAA 3ZDQA 2OUKA 1Z6AA 3Q85A 5HR5A 1NMYA 3QVUA 1R10A 2EYQA 3AH8A 1GL6A 2EW1A 1XNJA 3EPJA 1KAOA 4GOKA 3UXMA 5F9FA 2IYLD 1CU1A 2RGNC 2ZRNA 1U0LA 1ZM2A 1IHUA 2OLKA 3NXSA 2XAUA 1E9DA 2UKDA 2JLWA 1FFHA 2HLDA 4J0QA 2RKOA 4NBSA 3EC2A 3U3RA 1UKVY 3B1XA 2GEDA 4LJ6A 3VX4A 3A4NA 1JEEA 1VG9B 5EP3A 5GJWC 4MA4A 4ASUD 2DWOA 3FKSD 3B13B 4JLVA 3TAHA 4Z1MD 2ZREA 3H2YA 3GLIB 1VECA 3FHCB 5BXQC 2GXUA 3CRMA 3VQTA 2QPAA 4IOMA 1E6CA 1NRJB 1W4AA 4YDHB 1SQ5A 4B48A 1OXTA 4RD1A 3VR2A 5GADl 2W6IA 4BFXA 2JLSA 3W8NA 2QM7A 5CYOA 5AJZA 1XEWY 1ZVQA 3PUWA 2P6UA 2VBCA 2YWHA 5FL7A 1X1SA 1ELOA 5JWHA 2WWFA 2VL7A 2EFHB 2P67A 4PHTA 4CEHB 3GEIA 5CB6A 2WWXA 4N0DA 4ZIRA 3Q5DA 4B3DA 1ZIOA 2C04A 2V54A 3K0AB 1Z63A 4EJSA 4IJMA 2Z4SA 1XEXB 1TQDA 1RYHA 4M9ZA 1U0HC 5FOVA 3KQNA 3GLFA 4PAQA 3TNFA 5FPKA 4PFSA 2EFEB 4TMWA 3WMGA 3UKDA 4A0GA 1OLOA 3LVRE 5SZKB 3KKQA 4CRWB 3JVUA 4DCTA 3NBYC 4GOJA 4LJ8A 4C0SA 1MRSA 4HB2A 4KJZA 1ZUNB 5EE5B 3QIAA 3ONWA 4ZCLA 1E2FA 1NVWQ 2ZVQX 2CE2X 1E2DA 2BMDA 4HAYA 2VP9A 3FYHA 5AWFC 2LKCA 1ZW6A 3SEAA 4HAVA 1N6KA 4Q4JB 1IM2A 3VFDA 3CRVA 2X2EA 3SYNA 3U4QB 5KTYA 3MWJA 4RD6A 5BQ5A 4G0NA 1TTTA 4NYMR 3TSOA 2RB4A 1GL7A 5TMPA 4R7ZA 2RGXA 2J1LA 2FE4A 2Q9BA 4BFTA 1SHKA 3CNNA 5TDHA 2BDTA 2IBMA 3WHLA 2RGEA 1GIAA 2R62A 3IDQA 4PO8A 2GBLA 5KSYA 4QNRA 2QENA 4HAWA 3X1DA 3T1QA 2E1RA 4PAMA 3H4MA 2IF2A 2ZSDA 1TF7A 2QNRA 2FPLA 4I1OA 3RYTC 4C0KA 4B75A 2JLYA 4BFSA 2NMVA 1KI6B 4HB0A 4K81B 3AVYA 1MRNA 3LX8A 3L0PA 3AVWA 4ARZA 1AJEA 1I4LD 3Q7QA 5DYIA 1MABB 3TUZC 2O8DA 5CITA 3FE2A 2FH5B 4R2HA 1Y3AA 3OFNA 5B58C 4PPQA 4QGHA 1M74A 2JDID 1GRRA 4ILEA 3EASA 2F9LA 2MMGA 3CH5A 4URYR 2PX3A 2QA5A 4MUBA 4DRZA 1DE0A 1P4SA 3VMFA 3UWOA 1EX7A 1CRPA 4EPXA 2OAQ1 1SVLA 1XDBA 3BE4A 3W6NA 3ZVLA 5D3MA 1Z0DA 3QXCA 5DHAA 2MSCB 1G6HA 2XZLA 1IXSB 4DUGA 3AVXA 1T5LA 3OESA 2NO9A 3ETLA 3OEEA 4NYJR 5EP2A 4B2LA 2R2AA 2ZRKA 3BH6A 2CNWA 3PEVA 5JBQA 4A8JA 3AKEA 3AUXA 4G5RA 3FHTA 4OK3A 2Z83A 3K0FB 2QRNA 1CS4C 1E2GA 3RS2A 4BZPA 3I92A 1WBBA 2J3EA 2BCGY 4M9XA 3U7HB 2VP4A 2VLIA 5FUVA 1R0YA 4CEIB 2IYXA 2I4IA 4MUAA 5SZJA 1MT0A 3RRZA 4GOXA 1NJGA 4DKXA 2B8TA 1NG1A 1F48A 4A2WA 3W3ZB 1Z6YA 3IPXA 1YR9A 3NTUA 2QMEA 3FMPB 1ZUHA 2ZYTX 2PZEA 4B71A 1H8EA 2ZAMA 4DLRA 3PQCA 4Z8YA 1XMJA 4MRVA 5FL3A 3NEYA 1OPXA 2IYRA 4GBMA 1G7TA 5DI3B 4WXPA 4TL8A 4PXAA 4PX9A 5LBIA 4KCGA 3DPUA 1IBRA 2CCGA 2C9YA 2KBEA 4GZMA 1P9RA 4KYIB 3ECCA 1R5BA 1N5KA 4MKIA 2X19A 4TLAA 2N46A 4KLNA 4O0MA 1ESMA 2J7PD 4GFDA 4US0R 4BECA 4MKHA 3DM9B 3K9GA 1GUAA 2I3BA 2WKQA 4HZIA 4TTRA 5G41A 1J8MF 2JJ2A 1E4YA 1ZU4A 2D62A 2O0JA 2P5TB 2R65A 3KUDA 2OCYC 3ZQ6A 1EFTA 4DLUA 3K70C 4F4CA 2WWHA 4TN1A 3LAWA 3UWKA 4IDNA 2GVDC 5DNYB 4Q9HA 5KPDA 2IK8A 1E2LA 5JJIA 1EGAA 1ZNWA 3WMFA 2OESA 2OXCA 3KXLA 1GILA 3UG6A 4BE7B 3G82C 1M8PA 3CW2A 3KB1A 4NHOA 5TV2A 1Q1EA 2ZROA 1N6PA 2H7VA 2ZJAA 2AD5A 2EQBA 1PLKA 3DKPA 2XNDD 1QHNA 1TF2A 2PH1A 2ZJBA 1FUUA 3T5GA 5UKDA 1W46A 1P2SA 1FPMA 4F4IA 2Q6TA 3IGFA 4MKFA 3PEWA 2ATXA 4TL6A 5IK2A 3W8RA 2ZJYA 4RD4A 3UG7A 1DG1G 3VKGA 2GEUA 5KSZA 1YU9A 3QG5A 1WP9A 2NGRA 4C3ZA 4BFYA 2HYIC 2GJSA 3N5CA 1DAMA 4FWIB 3B9PA 2EWVA 4IEIA 3THOA 3M0EA 1MO4A 5FUYA 3GLIA 4PQYA 3FTQA 4Z8XA 2XZOA 4HEJA 3PV0A 1BS1A 1DO0A 4Q4LA 3RANA 4BQSA 1Z47A 4HATA 4XJXA 1LY1A 1HQYE 5G53C 4A0RA 2F3TA 2CE7A 3M4YA 5L3RA 3ZS8A 5P21A 2W2XA 3C4JA 3FHOA 4A0FA 1NVXQ 4YLGA 1ZU5A 3X1ZA 1FNNA 2EFDB 3B2EA 4BRWA 4DLYA 4GPTA 1M1YE 4KFRA 1UJ2A 4MKGA 4TZ0A 2DFNA 1OFTA 4E07A 2AR7A 3EAQA 3K0AA 2CEAA 3LFUA 3C7KA 5J4VA 2QAJA 3FPAA 1XEXA 2XOKD 1HE1C 1P72A 4II7A 2OLJA 2P6RA 3WRYC 2W6ID 1CLUA 2VP6A 2ZI6A 4DCNA 5L3VA 1VG8A 1IY1A 2BBSA 3P27A 1E79A 1KK2A 2GEVA 2QU8A 2RGCA 3EZ9A 3IIJA 2A5YB 1DAHA 2N1BA 5EXPA 1Z6XA 4O2RA 2OT3B 2DFKB 2PCLA 4W9MC 2DY1A 4UQOA 4BGDA 3AKDA 1KDRA 1NY6A 2REBA 4GNKA 3OEHA 2VSXA 1PLJA 3H84A 3OE7A 4Q4JA 1IAQA 3U4QA 4CT4B 2JLZA 3RLFA 4NTZA 2XJ9A 4JLKA 4JVLA 3GP8A 2Q3MA 1G17A 3UMSA 2CLDX 2FEMA 4NCNA 4TLBA 1RRCA 2NQ2C 4B32A 5CDFE 4HZUB 4LBWA 1KKMA 1Z2CA 4EPVA 1IJFA 4W5WA 4OHYA 1DPFA 4KSCA 3RDPA 5E95A 1UBEA 4PQRA 2ANBA 3T12A 2H17A 4LJ4A 1G4UR 2H57A 4V0NA 2FF7A 2H5EA 4TMXA 1IONA 2ATVA 1Z2AA 1J90A 3KKMA 4A9AA 3GJ5A 4YMSA 5JFGA 4Q1DA 1Z3IX 1U94A 3VHLB 1E2HA 5C2JB 3IQWA 1JR6A 3MRSA 4DJTA 1DTSA 3GFOA 1KI6A 4Q47A 4IVRA 5EZ5A 4YMWA 3QNUA 1VMAA 5FFMA 1AS2A 1N6LA 5C46F 1VTKA 3LY5A 1MABA 3B5JA 4Q9IA 4UXHA 4C0BA 1PUIA 1SXJB 2GZAA 2IYVA 3ADKA 3AV0B 1IY0A 3QY0A 4HDOB 1XJQA 1KAGA 5IDVA 4ZKEA 4XVUA 3SNHA 4JL5A 3J81k 2Q0HA 3AM1A 3WBJA 4LPSA 1QDEA 2CHQA 2VTKA 2ZUBA 5JECA 1RKBA 2PT7A 621PA 1KGDA 3QKRB 1TEXA 2XB4A 3KJHA 4ZCMA 3GJ0A 3TAUA 1EK0A 2PL3A 1Z29A 4GSYA 4LHXA 2VHTA 4JLAA 2QMHA 4ZPXA 4QJ3A 1TU4A 1I4DD 4U7DA 2REXB 1TQ6A 4D80A 3N2EA 3UMFA 2W00A 3OFND 4MYUA 1TU3A 2D7CA 2W2VA 3VNUA 1KSGA 2J9RA 1DOAA 1W48A 3K0FA 4NCJA 3TW4A 1WDTA 5JZVA 1JPNA 2VIIA 1FX0B 1AS3A 3SJZA 1YE8A 2OSBA 3F5FA 4G3XA 1UAAA 3EPHA 4O25A 3I73A 1BIFA 4CEIA 3T1VA 3QG1A 1Q3TA 3ZZ0A 4ITRC 2ZRJA 2FSGA 2J87A 1EFRA 4DUGD 1E4VA 1UKEA 2FG5A 1KI2A 3I8XA 3OEED 1QHXA 2IXGA 4GP7A 5C1BA 2CNWD 3RHFA 1R0ZA 3Q3JB 1N6IA 1P60A 1MO6A 2DCUA 4PO9A 4NCIA 3KKPA 2J5XA 4B35A 2RCNA 3B1WA 4KVAA 2GF9A 5DI3A 1ZNZA 2FN4A 3GQBA 4UXJA 4LY6A 2AFIE 2LKDA 2ZE6A 3U5ZB 1JQJC 1XTKA 3K09C 1F2UB 1M34E 1SVSA 1TAGA 4B3BA 2ZRCA 2GZHA 1T6NA 1XBTA 5F98A 4EJSB 1G1MA 3ZYCA 2V7QA 2O0HA 1G18A 3OZXA 4AYXA 2RAPA 2ZM5A 5CB8A 5J40A 2IYTA 1H8ED 4AKEA 4QJ5A 2ZE7A 1N0UA 3W5IA 5BN4A 3ND9A 5EQTA 2BMEA 5IF9A 1E2PA 1NBME 1OXVA 1GNPA 4V0ME 4B6FA 4DXAA 1ZD8A 5AUNB 1PLLA 1P7CA 3RSLA 1QHYA 1Z06A 2B7BA 3KZ1E 4NZYA 3SFVA 4MQBA 2QTHA 2P6NA 3W5JA 1A82A 4MGYR 5KO2A 3U60B 3U44B 3A37A 4Q1FA 2AFHE 2KJQA 3PR1A 3QPVA 4R98A 1NKTA 3F8TA 2ZR7A 1WQ1R 4PANA 2FFQA 2JJ2D 3CPEA 2RGGA 4AY2A 3NBZC 4IFBA 4V0OA 3LQRA 4HDQB 1YKSA 4ZDWA 2F55A 1NLZA 2JLXA 3EIEA 3AF3A 3BWDD 2ZRIA 3B82A 1YQTA 1P2UA 2BM1A 2Q21A 5JWOA 1WMSA 2FV8A 5CIWA 1PZNA 3EXAA 2VH5R 4JLPA 1RRPA 2LCFA 3FWYA 4S35A 1S3SA 3BGWA 2UZ3A 1UF9A 5DH9A 4RZ2A 4OI1A 4B2IA 4AWXA 3PFIA 1CTQA 4BPBA 5CK4A 4RZXA 3GJ4A 4BLOA 4MYTA 3EZ2A 1CBUA 3TUJC 1B0UA 1I2DA 2Y8EA 3PXGA 2KBFA 3O8BA 1OIXA 3RS0A 2ZRDA 2GZDA 1XPOA 4US2R 4F92B 1GL9B 4B3XA 4KU4A 4D4JA 3KQUA 1XMSA 3U3JA 1Q22A 3MWLA 2JCSA 2VRWA 1T3LA 2W83A 3SJAA 5TVKA 1CJUC 1AN0A 2CJWB 5IK2D 1X3SA 4Q21A 4M1TA 4Q7MB 3C8UA 1W0JA 3CRW1 4XWOA 4IDPA 1U0JA 2F6RA 4PC3A 5FBQB 1LF0A 3UMRA 3PIRA 1SULA 2Z5FA 1YVDA 2XNSA 1W1WA 2DFLA 3QKUA 4YDSA 2QMUA 1IXRC 2YOHA 1E32A 3MFYA 1H8HA 5DIFA 3TSWA 3BBPA 4FWTA 1YRAA 4DDVA 1OF1A 4XWAA 3C14C 5BN3A 2BVNA 1RRFA 1U90A 1XRJA 4WAUA 2ZVPX 3K70B 2BCJQ 3SQWA 1AQUA 1R2QA 4QBIA 4HAZA 3FVQA 4OQNA 2BV3A 4P4SB 2ZETA 4YONB 3SFZA 4HLUC 3W6OA 1SKYE 4OBEA 1YZGA 4HB4A 1S2MA 3LW7A 3BFVA 1YR6A 2GXSA 1CR2A 2YVUA 4LUCA 4LZZA 1NVUQ 2IYZA 3I8SA 3TJZA 1S9DA 4TLDA 5IHPA 4MYCA 2HEIA 3KXKA 1U8ZA 3C15C 1YR7A 3QSYA 2F3RA 2FZ4A 4RCYA 4I99A 5G3ZA 3RRMA 4TMZA 2HT1A 4BLTA 3B60A 1Z08A 2YWFA 4HZUA 2VO1A 1FP7A 3R9XA 1CJVC 2V3CC 4DLXA 1B23P 1PUJA 2BJVA 1E9FA 2KI5A 4MRRA 2BEKA 4OQFA 1UADA 1R7RA 2IW3A 2PJZA 6Q21A 4V02A 1N5JA 4JBWA 3L8YA 3KJEA 1CIPA 1ZINA 1KY3A 3FGNA 4OHZA 3R8CA 1KZ7B 2GA8A 4DSTA 2WJIA 4F38A 2ZXUA 3CR8A 1GITA 3EA5A 4KODA 2QGZA 5K8UA 3CM0A 2B6HA 1BYUA 3DEFA 4QBHA 3GCGA 3W90A 4Q1EA 2QQEA 2V55B 3WNDA 1G291 1P75A 4G01B 2P5SA 1SXJA 2QT0A 2XSZA 3OIYA 1NG9A 1II9A 4TLCA 1T8UA 1QG4A 1XMVA 1GRQA 1KO5A 1NJFA 1J8YF 3L0SA 5L3SB 1VCNA 3ADBA 3NBFA 3IUYA 2R6AA 4DCSA 3DL0A 1Q44A 2XZPA 4B6EA 1ZM7A 3QKRA 4FIDA 3T06B 3LBNA 1RFLA 1U9IA 1K8RA 2J0UB 3V4FA 3ICEA 4URVR 2ZS7A 2VPPA 4D4KA 1XD8A 2N42A 4M1WA 1XMIA 1W36B 1EFUA 3IHWA 2O8EB 1J99A 2D2EA 3HJNA 1JNYA 2R9VA 2C5LA 3PUVA 4G5QA 3R9WA 4D26A 3K9NA 4KLZA 5L8VA 2EU8A 2C95A 4TQAA 1ZUIA 2WJGA 2AXPA 3HPQA 3OAAA 1FX0A 4LJ5A 2KWIA 3WHKA 2QE7A 1CR4A 4N0EA 4HLCA 5JWRA 5DI9A 3GEEA 5IRCD 2VF8A 4LGMA 1ZM3A 2FMXA 3LDAA 4Q03A 4OK5A 1E2KA 5AJWA 2FDCA 4NDZA 2HCBA 1DEKA 1P9WA 3NH6A 4D4LA 4C2UA 1TUEA 5C4MA 4R71A 4MITA 5JMTA 1G21E 3B6EA 2G83A 4D0NA 3RSOA 1G8FA 3IIMA 4CDGA 1ZM4A 4E03A 2IEZA 4H1UA 1JXOA 2YKGA 5J4LA 3B85A 2IA5A 2NIPA 4D81A 1F2TB 1G3IA 1YZLA 2DBYA 3TW8B 4WXRA 4QKQA 2FA9A 1EFRD 1W5TA 1E1QD 3AKYA 5E4FA 2VF7A 2OBMA 1F2UA 2OCPA 2IYYA 4P3YA 3DZDA 4FMBB 3ZVMA 1Z0JA 1Z0AA 2FX3A 3RAPR 2FSFA 4LJYA 3RC3A 3KQLA 1E2EA 3KL4A 4XIGS 1R6BX 3ZD7A 4IHQA 2YV5A 4OL0A 4YMUA 1GVNB 4EIWA 1F6BA 2C77A 3TH5A 2UVQA 4X8HA 4BZXA 4B3CA 3BB3A 2WPDA 3VHXA 1OHHA 4UNPA 3CRQA 1RE0A 2QQ0A 1X6VA 2IWHA 3HU1A 3U44A 3KQHA 1SZPA 1DARA 3I72A 2GCOA 4MGKR 1V43A 5HTKA 4LYFA 2PCJA 1GWNA 2QPOA 4KFUA 4LHVA 4AG6A 2B21A 3LA6A 4KV9A 4DLVA 1R5NA 2GAAA 1J7KA 1WBDA 4WZBE 2ZUDA 3NVAA 2ONKA 1X8LA 1JQLB 3AGQA 1NN1A 1KY2A 2ZITA 1NL3A 1JAIA 1N5IA 2YC2C 1OH7A 3A36A 1HE8B 4POAA 2V1XA 1ETUA 4JSYA 1R0WA 2ZU6A 2KSQA 4Q18A 5KHOC 4OQMA 1DAFA 2WICA 1SVWA 1RJ9B 1IQPA 3LLMA 5DO9A 4YMVA 5HE8A 4QM6A 3RRYA 1KNQA 1E0SA 3DKVA 4Q1AA 1E9EA 4AKIA 4Q19A 4M9SA 1P61B 4RFSB 4PSAA 2FWRA 4PPFA 1ONBA 4RJLA 3GJ6A 4QGAA 4OHWA 2FGJA 4DZZA 4JLDA 1PV4A 1SKQA 3E2IA 1R8SA 2CJWA 1RZ3A 2OEPA 3LXRA 3KXIA 3SN6A 2RHDA 3IBYA 4GL2A 3FMOB 3I32A 5AJYA 1FNMA 3VR3A 3THYB 4BZQA 5CDFA 1RVDA 4RVCA 3ASYA 1KI3A 1E3MA 3DVLA 5SZHB 1MKYA 5CLQA 1Q1QA 5F2EA 4JYBA 2W2TA 1G9XA 1RYFA 4L5BA 2PBRA 3AVPA 4PPGA 121PA 2HYDA 2IX3A 5FTNA 3ZH9B 4DC9A 3MSXA 2JGNA 3KX2A 3THWB 1JI0A 1KK1A 1NKSA 1G19A 1OFUX 5JJLA 5JSZB 4V03A 4X8LA 3T1TA 3OHMA 4LHZA 3U7GA 2Z4RA 2RH5A 4Q00A 4DCVA 4P4SA 3CPJB 2TMKA 4UJ5A 1NSFA 4JKYA 1H8HD 3EZ6A 3HYTA 2J46A 3UANA 1S9HA 1BMFD 4C4PA 3RS3A 4LBZA 2IS6A 4NYIR 4AYTA 2CXXA 2GBLC 4PC6A 3L0OA 1VCMA 2P3SA 2W6JA 3P4YA 5AK0A 1E2NA 2ORVA 1SGWA 1EESA 3IIKA 4JJKA 5K8IA 2QTFA 1TUIA 1Q57A 3RC8A 3K9LA 3V00A 1M7HA 2QRZA 4LV6A 3U6BA 2C8VA 2VHUA 3D6TB 3UIEA 1JEDA 1XPRA 3ZVRA 4OQLA 3FDIA 2YOGA 3LO5A 2YINC 3CIOA 2P65A 4AI6A 2IUUA 1E69A 2EFGA 2OZEA 3GJXC 2I1VB 4QL3A 5HZHA 1KDPA 3SJCA 4YXWA 4OYHA 3TVDA 5KDDA 4Z54A 3CH4B 3CX6A 1H65A 1QVRA 3EW9A 1XTIA 2F1IA 4FMCF 5TB5A 2OM2A 1GOTA 1BO6A 1OFIA 1ZBDA 4D0GA 4EDHA 2VHCA 2HV8A 4CIDA 5FTMA 4E09A 2ANCA 3UATA 4MRPA 5L3SA 1HH4A 5FBWB 3CNOA 1YZKA 221PA 1XB2A 2QTVB 4ZKDA 2OCAA 1N2CE 2CHVA 4XWKA 2J0UA 2GJ9A 2ZJOA 5F3WB 521PA 1OKKA 4URZR 1D5CA 1W0KA 4UJ3A 1SXJD 4AK9A 2XSZD 2IS1A 2O8EA 1XX6A 4DT1B 4RKFA 3AF4A 1OXUA 1ZCBA 4Q7JB 1AGRA 1CJMA 3AP2A 3L0IB 1FTSA 3QPWA 1U2RA 1GFIA 2ZJ5A 4Q9KA 5CYPA 5FI1B 3EX7C 3RS7A 2G88A 2ZRHA 3AF1A 5LDDC 1VIYA 2ZI9A 2WHXA 4F91B 2WKPA 3BOSA 4BFVA 5ELXA 4TSFA 1KYIA 4JS0A 4KSBA 1NBMA 1II8A 1BOFA 3ND8A 2IWRA 1QHSA 5HCNA 2XEXA 3BH7A 4V0MA 5EP1A 5TARA 3WYAA 4RFVA 1VCIA 3IQXA 4LV5B 2HLDD 3L8ZA 1U98A 1OT3A 1YZTA 2IHYA 3THXB 2H1LA 1NVVR 1W7AA 2YYZA 3TR5A 3SOPA 1NMXA 1QHHB 2X1VA 3BJIC 2ZI4A 3BRWD 2BHRA 2W0SA 4GMDA 4PHFA 3U61B 1G41A 1S0UA 2KB0A 3OAAD 2WSSA 4TQUS 3MJRA 3EPLA 1W47A 2JIZA 2QE7D 1Z6GA 2EFCB 2J0VA 2PLRA 3C41J 4IRUB 4A6XA 1P3JA 1TL7C 1YRBA 4ZDIA 5LD2C 1F2TA 1ZAKA 3JZMA 2CL7X 3LNCA 2ZI5A 3KDSE 2ODNA 3LXXA 3RVBA 3GLGE 4M2LA 4MRSA 1WCV1 4XH9B 2QI9C 3A8TA 5FUXA 2ZR0A 4QHSA 1OYYA 3H86A 2WTUA 4C0JA 3LQQA 5DE3A 1G16A 1M6NA 2A5DA 1XD2B 1C4OA 4HLQB 2IXFA 4JLMA 5FL7D 1G7SA 3CF0A 5GVRA 4G5SA 1JB1A 1T5IA 3FB4A 4FMDB 3S1AB 4KXFB 5CM8B 3ADDA 1N5LA 3TMKA 3MAAC 1FL9A 3LX5A 4TLEA 4TYNA 1A2KC 3BD9A 2YNMA 1QBKC 1CXZA 3QKTA 3WMEA 1T0JB 1EFCA 1XU4A 5FUWA 4DCUA 3N70A 3WYGA 2V8OA 3QXXA 4DDTA 3IBGA 4YQFA 5JCZA 2V1UA 2PX0A 4QHTA 1NSTA 4GMXA 1JBKA 2C03A 4CYMA 2FGKA 4NYJQ 5EE0A 1F60A 4UNRA 3CPHA 3I4LA 1ODFA 3QF4B 2CCKA 4B73A 2JATA 2FFHA 3VTKA 4A82A 1HYQA 4QHYA 4C0QC 4CVNA 1MV5A 2WPDD 4BFZA 4M22A 1D2EA 3WP0A 3EIHA 5B64A 1JALA 1WF3A 4LYAA 5CJ2A 3X1XA 1YHNA 1P5ZB 4K46A 3L2OB 1AK2A 4HI0E 2GESA 1COWA 5E7JA 3VR4A 3ZZTA 3TRFA 3PJRA 3CO5A 2A5GA 1RJ9A 2G0NA 2GXQA 3NDPA 4LC1A 4BASA 4PHGA 1NLYA 3NC1C 3CONA 3GFPA 2GCNA 3QXSA 2JA1A 4TYQA 1LF5A 3B7GA 1G5RA 2ERXA 2GWHA 4PR0A 4RFSA 1MOZA 1OIVA 4FCVA 1LV7A 1X8KA 1TQ4A 2OAP1 4URWR 2ZYVX 1D8TA 4XVRA 5BYJA 2R6CA 2IL1A 4HUQB 3CZQA 3IEVA 4D4MA 2JEOA 1TNDA 3ZQJA 1G8PA 2WJHA 3RWMB 2Z43A 3TK1A 3TVTA 4XTCS 3LBHA 1Q0UA 1TF5A 1WXQA 1KHTA 1HV8A 3CB4A 4GT1A 3THYA 5KNDA 2GJAA 4OI0A 2CLCX 3IHLA 5FOWA 1A7JA 2QP4A 4JKIA 3K09A 2NPIA 4A36A 4LYHA 4QXAA 3U6KA 2D06A 2ZIAA 5DSZA 4OK6A 5L3QB 4UNQA 3AQ4A 5HKKA 3JVVA 1G4AE 1QZXA 2O8FB 1FMJA 1N6OA 4B74A 4JZKA 4Q4HB 2V4ZA 1OB2A 3THWA 1KZGB 2EYUA 3PUXA 2WIBA 5JSZA 3AVTA 2FJUA 3ZJYA 1I4TD 3W34A 4RSGA 2ASEA 2QN6A 2AD1A 1G7RA 3CNLA 4QBFA 4LC0A 2DPXA 8OHMA 3BK7A 1T91A 3HU2A 4C9BA 3NEJA 3KQKA 2WAXA 3CBQA 2PZFA 2QM8A 2F7SA 1NI3A 4DIDA 2JLUA 2BEJA 1RRGA 4BRUA 2VA8A 421PA 3E1SA 1UBCA 3GLHE 1ZC4A 4RZ3A 1QHGA 5DN6A 3K70D 1TEVA 2Q9AA 2PEYA 2G1KA 1VG1A 3CRRA 3WP1B 1GP2A 2O5VA 2WV9A 5JRJA 2YJTD 5KNCA 4ZO4A 4A2QA 3MUFA 2ZR9A 5FTJA 4EPRA 1E2MA 1GNQA 1E0JA 3CF2A 3Q7PA 1W4RA 2QSYA 3P1JA 4NE2A 3QBTA 2XJ4A 2W6JD 4JLNA 3SS8A 3NIBA 2IXEA 1VKJA 1Z83A 3CX8A 1O3YA 5J4YA 3CZPA 1L8QA 3K8YA 3DMDA 5JEDA 3A4MA 2VEDA 1JR3E 2R44A 5FTLA 1VG0B 1LVGA 1Q1ZA 2FZLA 4JIMA 1Z5ZA 4QNMA 2FPKA 5GJVC 4C2TA 2AKYA 2RHMA 1TQ2A 2RGAA 1MO3A 4B47A 4ZV4A 4B43A 1E2IA 2ZJZA 1TMKA 2CVHA 2AHOA 3U3OA 4JSTA 2GCOB 1NF3A 4V0KA 3MCAA 3NBXX 3SJBA 5FR1A 2HUPA 3VU9B 4YXWD 3FMIA 1Z0FA 1ZD1A 2A9KA 4RKEA 1KKLA 5FTKA 4F93B 4XVQA 3DZ8A 2QUZA 4PPNA 1E94E 1HA3A 3GLIE 4BLSA 2GTPA 4LSGA 4M8NE 2FFAA 1FTNA 4DT1A 3GLGB 4NL4H 2X8AA 2HXSA 2E87A 4TZ6A 4ZCIA 1L4UA 3M6AA 721PA 1Q1BA 2J59A 1KSHA 4G5OA 3AP1A 1FUKA 1JAHA 1QRAA 4QRHA 3VNVA 2NO0A 4HLUA 3NHAA 4EFNA 1OKKD 1DAEA 1G5PA 1XEWX 5FR2A 1W0KD 4JBYA 4GI7A 4QGGA 1W36D 1WB9A 2BKUA 1OH5A 2GCPA 2FSIA 5DGXA 4CEJB 3GJ7A 4LOAA 2NPFA 4DSOA 1NNEA 1YZNA 3C5HA 4B33A 3THXA 1E99A 1G8HA 2WWWA 4U02A 1QHHA 2JDIA 3D31A 4UXIA 3TGPA 5K8LA 4LWZA 2ZS8A 3A4LA 1U8AA 4DLSA 2HDNB 2GK7A 2V9PA 2VQSA 5FH9A 1NBMD 3CWZA 2ZRLA 1FMLA 5EP4A 2R6FA 3M1IA 2GJ8A 2KE5A 4WVFA 1WE2A 2QAGC 2IUSA 2ZQ5A 1OFHA 1NN5A 1JJ7A 1HQCA 3BFXA 3K0CC 3N2IA 4RD0A 2G0TA 3AF2A 4B3FX 5KU1A 3TIFA 2CK3A 1T4GA 1UKZA 1FQJA 2C78A 2ZSBA 4PO1A 5G40A 1KI4A 3SR0A 2OHFA 2PMKA 3LH5A 4JL8A 2GF0A 4L9WA 4CZ2A 1XD2A 4DLZA 4KITB 2BKEA 5CM9C 4FW9A 2GVZC 2WSSD 3I61A 2JIZD 5G3YA 2ZRAA 1KNXA 3S1AA 4EFLA 4E22A 5GJBA 5D3QA 3Q8XB 3AF0A 3QF7A 4M4SA 5AUOB 4TYWA 1PVOA 2J41A 4IEEA 5FBLB 3LBIA 4P0TA 1L7VC 1KI7A 5HCIA 3VKWA 1L2TA 4PZZA 1K5GA 2BBWA 5C4GB 2QG6A 4WBSA 4XD7A 4I1SA 4WZAE 3TQFA 3FFAA 4MDFA 4GP6A 2NZJA 3RNLA 2YWGA 1GNRA 2PZGA 1P9NA 2VSFA 3HU3A 2D4HA 4B34A 2RGNA 2PMDA 4EUNA 3X1YA 1E79D 2C2HA 1J70A 2E9SA 3QF4A 4LJ9A 4TYYA 4QC2A 3A6PC 5EE1A 2ZTSA 3PCRB 4RD2A 3TKLA 2NZ8A 5AJVB 3OEHD 3VX3A 4EPTA 1S8FA 2O52A 4M1OA 2BBOA 4X8MA 3OE7D 4M53A 2C9OA 5H70A 1M7BA 3EWAA 2REOA 1D2MA 1EWQA 4AG5A 4DB2A 2DWPA 2O8BB 4UNSA 2XTZA 1CKEA 2HJVA 2RGDA 2W0MA 2A30A 2C98A 1D9ZA 2PEZA 1F3OA 1E9BA 2FOLA 3FKQA 2HJGA 1FW6A 5FPHA 3KJGA 4HUQA 4XTRA 5J4KA 3SE0A 4EPWA 1HURA 3QENA 5BW8A 2RGBA 4H1VA 5BYKA 2O8CB 2CCJA 2YC4C 2IEYA 3QI2A 4F4JA 2X77A 2AL7A 4L15A 5J47A 3NHBA 3GLHB 3HYRA 4URXR 2CL0X 4OJQA 3K53A 5JJKA 3QOFA 4W5HA 1Z8FA 2F1RA 2FPMA 3OIVA 4IOJA 1J2JA 1GG2A 2CHGA 1KOFA 2XNDA 5L3QA 2L0XA 2OO7A 4NMMA 1X8JA 1AM4D 1A2BA 3KUCA 1NY5A 1GKYA 2O8FA 3Q72A 1HY3A 1UM8A 1Z0KA 3HR7A 4Q4HA 4URUR 1RW4A 2H92A 4QM7A 2MSEB 3ZLJA 5H8WA 3VKHA 2A5FA 5GJCA 3EZFA 4JVNA 1XJCA 1II8B 2NO6A 4JLBA 2VP0A 3SYLA 4HSEA 2LWIA 4UKDA 1ZCAA 5HKKD 4KBGA 1X86B 3LVQE 2W58A 3RABA 3X1WA 1VYVA 2A3RA 2VHQA 5E7IA 4QG7A 3L82B 4JMPA 3CWQA 1TX4B 4LDJA 2C99A 3NC0C 2GKSA 5EXSA 2ZS9A 1KO8A 1KSFX 1Q21A 4QFMA 4AYWA 5EJEA 3EG5A 1T9HA 1XZQA 3BC1A 4NCKA 1FOEB 2ZANA 5AR1A 3V4RA 4XSHA 1T3SA 1F5NA 1XWIA 1G3QA 1GAJA 2QP3A 2WVJA 4M1SA 1AZTA 1AZSC 2IT1A 1P6XA 2F1HA 1NP6A 5DHFA 2ZPTX 4N1AA 4R2IA 1C9KA 1OYWA 1SXJC 1FP6A 3AVOA 2XOKA 3EZ7A 3Q5EA 4L4UA 2FNAA 4FD2A 5EZ6B 5H68A 2SHKA 1ZNYA 2IF0A 1XF9A 3KKOA 5DN6D 4I4LA 1VHLA 5SZIA 1P73A 2YZ2A 2QBYB 4TL9A 4BLRA 2AWOA 3I5YA 2GJKA 1DBSA 3QBVA 2ZRGA 4FN5A 3MWYW 4ACBA 2XGJA 1KDTA 2IUTA 1U9IC 2OILA 2XITA 3R8FA 2ZSAA 1DO2A 4Q7KA 3CLVA 2V7QD 3GFTA 3JZAA 3MJHA 3GLFE 3AEZA 3VU9A 4WW0A 1NIPA 1K5DA 1N0VC 4JT2A 2AN9A 3A1SA 4Y0AA 3TE6A 5B57C 1ZD9A 4LBVA 1DS6A 4Q66C 2ORIA 3NH9A 4IXNA 2JAQA 1IXZA 3O8CA 1D9XA 1GSIA 3QEOA 2IHBA 4CT5A 4RD3A 3IKJA 4ESHA 2AWNA 2A7QA 4JT4A 4GDFA 3GLGA 3KJIA 3QXJA 1WA5A 1CR0A 1N0WA 2BBTA 2QEQA 3D8BA 1YZUA 4JBXA 2BWJA 1ZMXA 4FINA 1KO7A 1UEIA 3W9YA 4E5UA 2YHSA 1M7GA 2CLSA 2XTNA 3TBKA 3RRNA 1P62B 1G3UA 4ZDKA 2JLQA 4Q48A 4LHYA 1HUQA 1SKYB 1KMQA 3EA0A 2FEOA 4CEJA 2AX4A 3T5DA 1R0XA 2D2FA 4TL7A 3WY9A 4ERNA 3LRPA 3V9PA 1KO4A 1A5TA 4DLWA 1GKIA 1US8B 3DHWC 1NMZA 4IVPA 3E70C 5JI3E 4R9UC 2FFBA 4P4TA 4TMTA 2QGNA 3IILA 3CUEF 3B1VA 4Q4AB 4RCZA 5FPYA 3AVVA 4EJSC 4DDWA 3QKSB 2VP2A 1IN5A 1XXHE 2ZEJA 4B44A 5KSPA 4BLPA 1XEFA 3ZIAA 1VIAA 2G77B 2GRJA 4HAUA 5KUTA 4LV8B 1DAKA 2HF8A 2XXAB 2UZIR 2WOJA 3MG9A 3EIQA 2HCJB 1G8YA 2ZRBA 4LJ7A 1MR3F 5A0FA 5KDLA 2WJVA 2GILA 3DM5A 5HZKA 4BEJA 1W0JD 1OW3B 2BM0A 3WXMA 2WOOA 5LPNA 3SBDA 1SVKA 5B2ZA 2V6IA 4PZYA 1Q3HA 3T34A 1CULC 1ZNXA 3BH0A 5E7MA 4DLTA 3K0EA 4BUJA 3MMPA 5HE9A 4JLOA 4HAXA 3HP1A 1AQYA 2CK3D 4UNNA 4IDQA 1P2TA 2WIAA 2D7DA 4TMKA 1VYTA 1RPZA 1KIMA 3PUYA 3GPLA 2WJJA 4DIEA 3VR6A 3W6PA 3K9HA 1IJEA 5K8TA 3X2SA 3DDCA 4W5JA 4Q5IA 1VCOA 3FMFA 3R9IA 4LHWA 1E9RA 3EC1A 1G20E 2IC5A 4ESVA 1CEEA 1LS6A 1SXJE 5KPJA 3AB3A 1ZC3A 4H9GA 4DEYA 4JL6A 4XD7D 1D2NA 2B7CA 4I81A 2XX3A 4PHHA 2VYFA 1AIPA 1OXXK 4G1UC 1JJVA 5CJPA 2DB3A 2O8BA 1LS1A 1VYUA 3RS4A 1CJTC 4PC1A 4FI3C 3Q9LA 4BLQA 1LTQA 4O2LA 2IYUA 2R6DA 4D6PA 2WWIA 1XFAA 2A2ZA 1DAIA 5JHHB 4IW3B 1GRNA 1OSNA 2DHRA 2WZQA 3F3YA 4DWJA 1LB1B 1XCMA 4NP6A 3P4XA 2O8CA 2OFWA 3GJ8A 4QOSA 4LCBA 1FQKA 4LRWA 5TXGA 3HDTA 3I62A 4PSKA 1T8TA 2IYSA 1EXMA 4EPYA 3GLHA 5EE3A 4A8JC 3AVQA 3E5HA 3SBEA 2QAGB 3T35A 1XP8A 1P2VA 5AUQA 2WBLC 2ZE5A 1G64A 2BC9A 4V0LA 2HT6A 4ZI2A 2AXNA 4PTLA 1D6JA 2JLVA 4TQ9A 3QEJA 4EAQA 4S2EA 1OB5A 4G5GA 2Q3HA 3ICQB 1GM5A 3IEUA 4L16A 5CLLA 4F7WA 3SYKA 3BAFA 1JXMA 3C16C 4YMTA 1QG2A 1JR3A 2Z6VA 3WBKA 2BIFA 3B8HA 1XTQA 5FBVB 5GVSA 1R4AA 1UFQA 2OBLA 4M1KA 2IYQA 3HR8A 4NYMQ 5FOUA 1QHIA 2J45A 3BB4A 1NLFA 3CX7A 3I3SR 1E1RA 4FCTA 4JVMA 4NPHA 5ANRB 5FBRB 5FOTA 5FOSA 1XTJA 2WAYA 5JI2E 3BERA 4C7OB 1DADA 2CMKA 4DEXA 2ONJA 1G7CA 3O47A 5BN5A 4LI0A 5J5CA 3SZRA 1OXSC 4DDUA 2J0QA 4RZUA 1KJZA 3EWSA 2QP9X 1IOZA 2H18A 3LLUA 4KYUA 3R20A 3SI7A 4HDCA 4C0HA 5B30A 1KJWA 1BH2A 3VAAA
chains in the Genus database with same CATH superfamily
1DX9A 2J32A 5IVDA 3HZRA 1ZO8A 4KAXA 1QF9A 1TAUA 4PN3A 1T4BA 3D0RA 1N34B 2A14A 4INAA 1ZJ5A 4W63A 3KTAB 4RIFA 4Z9XA 4J0HA 1Y0BA 2NW6A 4XGIA 1XDSA 4WN9A 1XAHA 5K3CA 3V2IA 5CEFA 4L1KA 4OHVA 1EE9A 1IZ9A 1Q12A 2VXCA 1TK9A 4FSDA 2HV9A 3U3MA 4Y6PA 1KO1A 4HYTA 3BQMB 2ZU0C 5IKEA 2R5WA 1FFWA 5AM5A 4KVGA 5AKIA 1B6GA 4MH0R 4CEHA 4EARA 1VDZA 1E6EA 2XB2A 2QT1A 4TT3A 2NO1A 2N3ZA 4KE6A 1W36C 2QTWB 1L1FA 3RC9A 4CW7A 3CUSA 3GA0A 5DYGA 4OQYA 1Q50A 1X7YA 3SHWA 5G4KB 2J9XB 3RU7A 3SHFA 3VA7A 3S0JA 1H1DA 3LP8A 1HE4A 5K3EA 1NIJA 1LCIA 1BNCA 1QCZA 2P3OA 3CJQA 3IV6A 3CVJA 3U3DA 3UAYA 5KQLA 4QYTA 1S1MA 3LGXA 2J5RA 3PUZA 4RUKA 4XX0B 1ZJZA 3A04A 2GH1A 3KO8A 4K8RB 1ZOLA 2OBBA 3H99A 2OXTA 5JUWA 3MRXA 4TTTS 3CGGA 1E9SA 2FPIA 3F2IA 3UPUA 3JATB 2PBLA 2XCUA 3AT1A 4N7JA 4EL5A 3R7BA 1MVLA 2RHBA 3BB1A 5JRZA 1RQGA 4C4SA 5BSWA 2GK4A 5DTQA 2IELA 1L9XA 1RKXA 4BNXA 3QUSA 2ODWA 3CW8X 2FUEA 3Q6MA 4PY2A 4LYJA 4GU5A 5EJ2A 4UDNA 1ZUWA 3OLZA 3CF4A 4XOIA 1C1YA 1E0DA 2PUBA 3B12A 4GG1A 3KJXA 3OTWA 1U8YA 4DYHA 5FWNA 2O7SA 3PQ5A 2H06A 3DMRA 1RVV1 4NYIQ 4DVJA 2P40A 1CLEA 3D6UA 4HT3B 2GRUA 2HDHA 2HPHA 2OC4A 3AXSA 4IDHA 4KO1S 1ULZA 3KVYA 4ZI5A 2QTLA 4N49A 4I0WB 1JXQA 8ADHA 2G1JA 4Z0NA 1Z4OA 1MV8A 2HXYA 2BEUB 2P6PA 3FZEA 1OV4A 2VSOA 4Q3LA 4BKUA 1JPVA 3T8YA 2CFIA 4D8WA 4NR0A 4ND2A 3OQJA 2H5IA 3C4QA 4G63A 1AZLA 1E7MA 2W2LA 4WZAA 1FYWA 2TMDA 3M5WA 1U7UA 1J2UA 1LBQA 2XDYA 4RXTA 1KJYA 4L9RA 4NU6A 4WOKA 3MBOA 2YOFA 4M21A 3GG9A 1O4VA 4KHPB 1P1KA 2AG6A 3LIPA 4XQGA 3H7AA 1AS0A 4E1AA 2HMYB 3EULA 3NYQA 4OHOA 3TUIC 1GXSB 1U1DA 4D79A 1GQRA 1F5SA 4DANA 5JS7A 4HB3A 1EQUA 3R09A 3G0DA 3C6QA 2XXAA 1X8XA 1L4YA 3E7FA 2C2BA 4ZRNA 1U0NA 2YNMC 3TD2A 3UOAB 4PG8A 1MO5A 3G68A 5LP6C 1KK3A 3WNBA 3DO6A 5DX0A 1D1QA 3RGWS 2WAAA 4BVGA 5KINB 3H3FA 2C1ZA 3MGCA 1U99A 4ZAFA 1MX9A 1G8GA 5FNVA 3VR5A 4C30A 4ASUA 1WQ4A 4MR9B 1NJSA 3AO0B 1GNTA 7YASA 3FKSA 4FONA 4FZ3A 4I1VA 3BVPA 5EHQA 1QH8B 1P6UA 3Q9NA 4ZOEA 3H2BA 1AT1A 4YNBA 2C96A 1C3JA 4FKZA 3TXXA 3MS7A 5TEVA 1T9GS 3QEBZ 4PX5A 4G09A 3COVA 3EVFA 3LWDA 1L5GB 4CHGA 4CQMD 3WFZA 4U6NA 3NHSA 3RFUA 3L8FA 1D2HA 1GZHB 3VHQA 1QHEA 3EA4A 5AXBA 5WRFA 4E5YA 3NOOA 1AF4A 4LSZA 3WLHA 2QMOA 5JR3A 3B1ZA 1WP4A 3AW8A 1FP1D 2BD0A 2M2IA 2YV3A 1CQPA 2GZ3A 4REQB 5E6SB 2JCYA 1R0LA 1N36B 2F9MA 3WMWA 3V7FA 3NKVA 4R1SA 1F9AA 3NHMA 2NP7A 1L6RA 4PSVA 3IDSA 2DYKA 1JKXA 1IRIA 2A0UA 1QVWA 2QPTA 3GEMA 3LE8A 3O0DA 1V9SA 4WNYA 5CK5A 3CVUA 4KO8A 1YFJA 4UVIA 2VYND 2G1UA 1AUOA 2JHFA 5EZYA 3DCNA 3C6XA 4JOSA 1TECE 3WLPA 3EPKA 2QZPA 1ZXXA 5KDOA 5L7YA 4YRAA 1P1IA 4P7KA 3ZHQA 1ZCJA 4DSNA 4EFMA 2XVMA 2PWZA 3HR4A 2I4RA 5LIPA 5HPYB 3WK7A 1Q1AA 1NVDA 5F9HA 3D3QA 1JWAB 1YQWA 3HBLA 4FCWA 3IUPA 2R4QA 5LKRA 1ZLXA 1FNDA 1WDKA 1VPVA 2V7BA 1XXLA 1K2WA 4Y2QA 3IA7A 4LTNA 5LFAA 3C8MA 3LWNA 3FOZA 4QDZA 4B6OA 4O4LF 2O2ZA 4K2HA 3O91A 5LNK1 4KNWA 3ZGXA 1K6MA 3L7BA 3PFCA 5A6SB 1S4QA 3K1YA 3T7CA 4DIMA 2NZ2A 1WKCA 2A9FA 1TADA 3K0CA 4JWKA 3T9BA 3K6SB 1VHTA 4NH0A 5DTMA 2WB4A 3L40A 4X20A 1U02A 4PC2A 5K8VA 4L57A 2FN3A 1TLLA 3AUYA 2W4MA 2O0KA 3EUAA 4JGGA 3C2QA 4JY7A 2I6TA 3QW4B 3T7TA 1BWSA 1C8VB 1XKLA 1Y1QA 3KC2A 4V2UA 5TPZA 2AK3A 2P62A 2OB2A 1EINA 3NP9A 3G0GA 1UDXA 4OBXA 2XMSA 4I1IA 3KCQA 4I50A 2R84A 5I4CA 3QLUC 3MTQA 3ET4A 5DEOA 1VSVA 2Y92A 3B1YA 4PLFA 3FZGA 5G0SA 3QXGA 4XIFA 3O84A 4CF6A 5DULA 5JBIA 2ZUFA 3T3OA 4PZDA 3HVIA 4M0CA 2O5EA 2I4LA 2GZRA 2PMBA 4DLLA 1P9LA 2GUGA 5TT0A 2P9ZA 3UYKA 6AT1A 3JQFA 5EXTA 1EBBA 1WOYA 3FNQA 4DLNA 1F17A 2DHQA 5KAMA 4AKGA 4C3VA 4GKKB 1FFGA 1YZ3A 3DV9A 2WILA 3FI9A 4JI7B 1RP1A 2J6HA 1V6AA 2RHLA 4HP8A 4Q9JA 4HC4A 1T9CA 3OJLA 2NTEA 4J91A 1YMQA 3RVRA 2OPHA 2HX1A 3OTQA 3QJYA 1JHXA 1CUYA 4MR7B 1C9JA 3HB4X 5C32A 5DTEA 3SC3A 5FAKA 1K89A 1IN8A 1BHO1 3FWNA 5CX1A 1HEIA 3CKLA 3PUJA 3OIUA 1QE3A 2VG8A 4D0LB 4K9RA 2Q2QA 2J3QA 2MSNA 2IDZA 3N6RA 3O1IC 4BHTA 4OUKX 5F12A 4D57A 4DWWA 5ITZB 2Q5EA 2O8DB 1ZK1A 1FS6A 3UTDA 2F1JA 3WJ7A 1K92A 1B3BA 3HM9A 3G9QA 3VZSA 1QE5A 4F12A 3QXHA 3FETA 1XRSB 3I2KA 3ASZA 3WGOA 1PG5A 1Z6TA 1C7EA 1PX2A 5I7FA 3A1UA 1UQUA 2PYZA 1GKUB 3QKIA 1NPYA 1E5XA 2C9CA 3W6ZA 1MUUA 3UAZA 4GX0A 4TWBA 2WHYA 4JKOA 4K1XA 5U9CA 4JXJA 2HQBA 4A15A 1Q2UA 2YMMA 2EJTA 4RXMA 1C30A 5GTDA 3ERCA 2HBZA 4FQ5A 4WK4B 3TOXA 4CV0A 4LJAA 1H4QA 4C03A 4EHLA 4YRPA 2J3JA 1Z16A 4MPDA 1QH1A 1Y1RA 1HLDA 3KOZA 1BMFA 4XSGA 3WL3A 2OCIA 3CSSA 4IGEA 4Z2YA 3UMVA 1E98A 1P2FA 3ORFA 4Q24A 4W7HA 4EJ6A 3LUHA 5MHTA 3VR1A 1BSVA 4JX8A 4PINA 3W2TA 4M83A 3MD0A 1ZIPA 3SPXA 4YAJA 5TGZA 4TTQA 3OCJA 4TV9F 3HM2A 4C7VA 3S8YA 3F78A 1IN4A 3RUIA 1XXHA 3UK6A 1SVOA 4ENVA 1TGYA 3OZRA 2NOAA 5LXTA 4P34A 2BYTA 4D02A 1XZIA 3THSA 1NQTA 1ZM9A 4QUAA 3V55A 4YPOA 2B92A 2YQ5A 2RBEA 3AU9A 3PITA 4IUCS 1VJ1A 4ZHQB 2CLLB 1R5OA 1JSXA 4AULA 4J1SA 2NVOA 5AICA 3URKA 3EK2A 3MINA 4GQAA 1HBJA 1ZH4A 2ZJ8A 5CFQA 3CEHA 1F8GA 5BYBA 3WGGA 5FI0B 3P96A 5BMVF 4CF7A 5E3HA 1JZSA 3EZNA 1QWSA 4LGVA 3F7MA 3MLAA 2GM9A 2KW5A 1HLPA 3CW9A 4YJFB 3SYRA 3NT4A 3G2KA 2JBAA 2OAGA 3C1OA 3K1JA 2DWQA 3JQDA 2I9KA 1NW7A 3HJRA 3HA5A 4OLHA 3OH8A 4R5MA 1SVIA 4IXMA 1PS0A 2P4UA 4NX2A 3FFXA 4X8OA 3RS5A 3U16A 4O3MA 4W5NA 5HFAA 2VT2A 2Q1YA 5BUQA 3MMZA 2R8RA 3LKVA 1E0KA 1W6UA 3ZD6A 4HN4B 1YIOA 3HUEA 4UE3S 2F8SA 1LFAA 5J4HA 4Q02A 1XTRA 2WM9B 3OKCA 5DLQC 4IWXA 5LD2B 4EUHA 1H4TA 3LD9A 5H7XA 1NVKA 1U5BB 3BXHA 1JG2A 1THZA 1H0KA 4QLOA 3LCUA 3ROFA 1B26A 2I6UA 2WMOB 2X5XA 1NYQA 4AUNA 1L5YA 2B1JA 3NKFA 4RENA 4RO0A 2UZ1A 4MRNA 2B83A 3DF7A 4TWZA 4ZVTA 5EUMA 4ZDJA 4HYEA 3RUFA 2H2HA 2QLFA 3NUQA 3I8OA 4EYQA 5KX5A 4GR9A 2F43A 2NTYC 2OG2A 3HWSA 4V0SA 4XUDA 3VR6H 4W7IA 3FDZB 1JG4A 2P9CA 4B7XA 3GGPA 3LCJA 4N76A 4AZ0A 1MMFB 1BRTA 2WT9A 3M5PA 1U7HA 2QL9A 3FUUA 1Y8ZA 3TQSA 1CUVA 1T2CA 3H65A 2QW1A 3WTBA 1NVMB 1R10A 1T8WA 1U7XA 1ZA2A 2EYQA 3AH8A 3G2IA 3KQPA 3KWJA 3MGBA 1GL6A 2DGDA 1XNJA 4F3KA 1EP1B 1I13A 2BSAA 3PXXA 3LG2A 3AYXB 4FZVA 4QEDA 4X60A 4LE1A 3TMAA 4DMCA 3KD2A 4GC9A 2XAUA 5DRYA 4YCBA 2K7ZA 1SCIA 1E9DA 4I4TB 5KYVA 2CF6A 4QX6A 3G2QA 2RKOA 1ZH8A 1QH0A 2FEAA 1Q0RA 2CNNA 1ZL0A 2EP8A 3JWIA 3L6CA 1YVUA 1DDGA 4GLOA 3E9ZA 4XGNA 5KAPA 3BTVA 2Q2VA 2JI9A 4J0FA 3HVRA 3HDJA 3AC0A 4OQ4A 2ZYDA 1VG9B 3L9XA 2BFMA 3JS5A 4MA4A 4WHMA 1HOXA 2RDMA 3GZJA 4R2LA 4XQEA 3B13B 3R77A 2VPYA 4HR7A 4JLVA 1XR3A 4M9CA 3WKCA 3H5OA 3PF8A 4Y9RA 4JJ4A 1XA4A 3BKXA 4HXEB 4FEYA 3GLIB 1DQNA 2GPSA 5DLYA 4TQGA 3EJWA 3M5DA 4NF2A 2C7VA 3QVJA 1X7ZB 1EVYA 4FDMA 3ASUA 1TYCA 1X7XA 3W3AD 1J24A 3PF9A 4D74A 2K6GA 1QP0A 4RLFA 1U2SA 5A4MS 5GADl 2W6IA 3D0OA 1MZVA 3W8NA 4BFXA 3BF8A 2QM7A 4MS4B 5TSDA 2VBCA 3GGSA 4RHFA 1ONOA 1NRIA 5HOEA 5LNK6 5LP1A 1U9ZA 5FULA 4FEEA 4BWFB 4XVHA 3KT0A 3SDBA 3MWEB 4BDSA 5GMOA 1MEEA 1NUUA 1YQQA 2VT7A 3ONNA 2VL7A 2EFHB 1DV2A 1K0FA 3G2LA 4CEHB 3GEIA 5JH7A 3DFMA 3OT4A 4K87A 3ROZA 3E5MA 1I6KA 3HHPA 3ZHUA 4ZIRA 3FTDA 1HSZA 2P2CA 1WDMA 4M6WA 1ZIOA 4AF6A 4RDIA 1UMBA 1CW2B 1Z63A 1CY8A 4IJMA 4UM8B 2EKDA 1R6TA 1NF8A 3QFHA 1OI4A 1R8JA 3QGMA 3GLFA 1J1ZA 1N77A 3JTMA 1JP7A 3F49S 2F00A 3RFFA 1ADCA 5FPKA 2EFEB 2CJXA 2UVDA 3FPSA 3H9EO 4UMFA 3WMGA 1OLOA 4C1BA 4YJ3F 4YGYA 4DCTA 4EL0A 1WMAA 4GOJA 1DFIA 3GNSA 1POXA 1V16B 4ZT2A 1BROA 1ZUNB 3NOVA 5LU8A 5EE5B 4I6JA 4ZCLA 1Z18A 1NUQA 4I9UA 5M29A 3EOBI 3L6UA 1ISPA 4UM9D 4HAYA 2AZTA 2VP9A 1L8LA 2VC2B 3C3JA 3FYHA 2VUHB 4HAVA 1N6KA 2XCQA 1IM2A 3CRVA 3U4QB 1YNSA 2V3VA 3IBSA 2DEUA 2G70A 1E4EB 4KPUA 4H6VA 4BB5A 1LSOA 4M60A 2ZM6B 3MWJA 3FYCA 4RD6A 4Z4IA 2G40A 2WHQA 5BQ5A 3IQDB 4G0NA 4IM7A 3G0CA 3TTVA 1AXEA 2HEGA 3OT1B 3VNRA 1LRKA 1MA0A 3TSOA 2OAEA 4NZZA 3ENKA 4B7CA 1GL7A 1NU8A 4EO7A 5TMPA 4JJ6A 2QD2A 2PYIA 2J1LA 2FE4A 2Q9BA 4R7ZA 1OVMA 4YP7A 3MTGA 5TDHA 3SHVA 3VKFA 4BFTA 4HNAA 4RK7A 3FYTA 5CB4A 4K9OA 1L7XA 2PMWB 1KRWA 1LK0A 2Q5JA 3IESA 3H4MA 1JH8A 2IF2A 2ZSDA 3SC4A 4B4UA 3P52A 3QFCA 4Y67A 1RWKA 4B75A 2Z9BA 3WBBA 1Z3CA 3R0ZA 4JJGA 3EF3A 3UCFA 4GX1A 5C53B 3G8YA 1WBDA 3DFKA 1L4FA 4DUPA 3QE9Y 3I6IA 1I4LD 4EEKA 4PYJA 1VKNA 2FW8A 2PR7A 2HL6A 2CKMA 4HD8A 4I08A 4CDRA 2C4KA 3BSWA 5U1PA 2I03A 1AGYA 1WUHS 3F2VA 3OZEA 4HQNA 2R4UA 3D5EA 1DX4A 2B82A 3GDOA 1PAUA 2DBQA 1W19A 4RWZA 5G1NA 2R1TB 5EAIA 3WSTA 4EB6B 5CXXA 1M74A 4I19A 1X1DA 1BJKA 3ZWQA 3TF5A 2MMGA 3CH5A 2WT8A 4R9VA 4URYR 4DRZA 4QGSA 2QVYX 3ZDFA 4Q4CA 3VMFA 3ABIA 3BD6A 4OP2A 3UWOA 3LQ4A 1X9HA 2MHCA 4RMJA 3IMKA 4HY3A 3JPYA 3VR4H 2HH9A 3L7YA 3M4NA 3ZVLA 3RHZA 2P30A 3AY6A 1FMFA 4R6WA 3L5KA 2WIFA 3BHMA 3OX2A 3GA5A 4GMKA 3FNFA 2RKBA 1JWBB 3SVTA 2DU8A 3OLCX 4JNCA 5EP2A 4B2LA 1Y8RB 1V1MB 3NRJA 4IIBA 4DIKA 2ZRKA 3PEVA 2AZXA 3BT7A 3EZYA 5KEIA 1G0NA 1KC1A 4ZAXA 1WMFA 2A0XA 3C6ZA 4AAYA 3K0FB 2GZ1A 1DT3A 3LT4A 4J0CA 4P2GA 5JRDS 4EY4A 5CH8A 2H7XA 3AB7A 3H9CA 2J3EA 1GLNA 4O29A 1A2QA 4YHBA 3ZWMA 2CV0A 2NU8B 1J21A 1LPBB 4C89A 4I5GA 3DVQX 2Z8XA 4OYLA 3ZU6A 1N8SA 1R0YA 3UBMA 1CZKA 5ECGC 2ZCUA 4H59A 2ZYHA 2JJQA 5SZJA 4ZYVA 5IABA 4KUGA 5HF9A 3A70A 2NVUB 1WCXA 3DKKA 4V0QA 4UTRA 2W6CX 5ENVA 1NJGA 1ECFA 4DKXA 3T7IA 4NFSA 2Y6UA 4EGFA 3W3ZB 4XYLA 5HEKA 1DDIA 4XIYA 4EF6A 1X77A 3FMPB 1ZUHA 3D3NA 4QSMA 5ED4A 4RTLA 5KS2A 1XRQA 3PHLA 5EEHA 3EF0A 3SQLA 1QGZA 3HB7A 1I5EA 4GBMA 2BFPA 5DI3B 4ZCRA 3S8EA 4TL8A 4J4TA 3Q8LA 5DLEA 4C3OB 2Z6QA 2OYSA 1HKUA 2GN4A 3GUYA 2CCGA 3P9CA 1CF2O 1P9RA 1N78A 1MC1A 1I1QB 1ISRA 2H4FA 2MYUA 3AEQB 3C5EA 2JGMA 2NACA 3BFJA 2YS7A 3ECCA 4G1FA 4MKIA 4BS9A 1BDHA 5BY2A 2J7PD 2X14A 4R40A 3ZR4B 4BECA 1GQYA 3ETHA 4L5YA 3HMKA 3ENNA 3F8WA 4JBLA 1E20A 3K9GA 3QPCA 4HVLA 5B4TA 2WKQA 1JDTA 2EFJA 1J39A 1EX1A 2W6ZA 3SHQA 2JD2A 2WD8A 4UARA 2QVCA 1O9GA 3ZJTA 3E3NA 3O3CA 4DLUA 1KFEB 2YXNA 1K97A 3OUZA 4TN1A 3LAWA 3H87A 3K2BA 3DCIA 1ZPDA 4GOMD 5ALZA 3OF3A 1I7NA 4NJMA 2V6MA 1JSZA 1SUFA 3EZGA 2JZCA 4C78A 5E8JA 4MS3A 1ZNWA 2BUAA 3ZCXA 3CH7A 2C7PA 2AZMA 2OXFA 2I2XB 2B4YA 2OXCA 1YVRA 2A67A 3KXLA 4WOCA 3UG6A 4BE7B 1QC5A 3V1NA 4NCXA 2C0QA 3E9NA 2E4UA 3EVEA 1JG1A 1ECBA 1K06A 1Q1EA 1VI2A 1N6PA 3AG5A 3MBIA 4INPA 1JA1A 1Q77A 2VPQA 3WL8A 4BN0A 1Y6ZA 1HFJA 1PLKA 3DKPA 1KYTA 1QHNA 2P0YA 4RESA 4XRGA 4RVNA 5CGZA 2PH1A 5JCJA 1WEKA 1FUUA 1W4LA 3GR6A 5UKDA 4F4IA 1V96A 1YC2A 1N75A 2YCLA 1XTVA 4ISCA 4MKFA 1KF0A 4TL6A 4HWKA 3IS3A 1Y81A 2ZJYA 1JFRA 3BRQA 3IJPA 2GEUA 3L7IA 4QJIA 1H2ZA 3HBJA 4KAAA 5ALUA 3FSRA 5JCOA 3ZX5A 1NI5A 1UMKA 5KSZA 4XDHA 2PMCA 1XKXA 2WJ6A 3GI1A 3K5WA 4N9QA 4HSGA 2HSGA 2YFQA 4QXRA 3WQBA 1T15A 3IAS1 1HEYA 3B9PA 1KEPA 2WP0A 3R6WA 4FWIB 4IEIA 3QKWA 4ZO8A 3AETB 5F1PA 4GYWA 4P82A 4U7HA 3SF0A 5DYNA 3K0BA 4CTNA 1VDMA 3MCZA 1KARA 2XZOA 2H07A 3DSRA 2YJZA 3NAGA 1OCEA 4OU5A 5BSEA 4S12A 5A9TA 2KX7A 3TCXB 2Z5GA 4O5AA 1M5UA 1UBOS 4E11A 4GECA 5J43A 3OO1A 1RQ7A 4JROA 3OHSX 4XFKA 4KN8A 3PDHA 4O2AF 1GUDA 3E58A 5P21A 4E15A 2UVPA 1ODIA 1S89A 1UL1X 2XD9A 3FHOA 4MDYA 5IUKC 1K8QA 2C3OA 3UAOA 3MVEA 3ZZNA 5BNIA 4GVPA 2GBFA 3P0EA 4IPTA 4A7PA 4GD3Q 4GPTA 4H60A 1XK6A 1BAPA 1F4PA 4AKTA 4KFRA 1UDCA 3DOHA 3MWDB 3RKSA 1ZN7A 2DFNA 4MIEA 3BXPA 1MQAA 3N7TA 2AR7A 1W73A 3LFUA 1F6DA 2QAJA 2XOKD 3KBOA 2EQ5A 4XDZA 4II7A 5LMUB 4FFRA 3T54A 5BN3B 2XKKA 3EOZA 1MU0A 2A5LA 2BKVA 1CLUA 2J8ZA 2Y1FA 4GQBA 1QV6A 3ID6C 1IY1A 3LZCA 3PQ8A 3PR2B 3PPVA 4JOCA 1FDSA 1NJ8A 2QD5A 5SY6A 4YR9A 2JI8A 4ZAVA 1K7EB 1TA9A 2BFDA 1NY6A 2C1EA 4B0PA 1P74A 6YASA 4YCNA 4MUKA 2ZUUA 3OEHA 4Q4JA 1CDDA 2GK3A 1IAQA 5BSTA 1I32A 4HGRA 3RLFA 5LKAA 4GE3A 4PLYA 2WYHA 1W5BA 3C39A 3TIXB 1JN0A 3ZV4A 1AKVA 1G17A 2E4VA 3LPLA 4RV9A 3OBIA 2A9PA 2FEMA 1GAEO 2YDYA 3JAWA 4NCNA 5EWLA 5HIIA 3TX6A 3LI2A 4C4TA 4EJ2A 1U0FA 5THQA 4HZUB 1KKMA 3DBRB 1KZ4A 2D0PB 3L8MA 3AOGA 4EPVA 2WYIA 2A7XA 4ATNA 1DPFA 4OHYA 4G5FA 4KSCA 4LKRA 3AUSA 3RDPA 3P2EA 3A32A 1Y3FE 1H6DA 1LTHR 1QIDA 1U2GC 3LFTA 3OFSA 5DM0A 4XWGA 3GBSA 3X43A 4DQUA 3MK31 2PZKA 3QV2A 2R4TA 2AOTA 2XPCA 3KKMA 4YP6A 1JL3A 4MQ6A 4D4IA 3K0KA 4Q1DA 5BOSA 1U94A 2FWBA 1V2GA 2G25A 1Y89A 5EI5A 1FXUA 3GFOA 1PYOA 5EZ5A 3O95A 3BL8A 3AHJA 4JODA 3LBYA 1EDEA 3JYHA 1VMAA 2I62A 4BQNA 2BR4A 2FW7A 5AKEA 1QX4A 3B5JA 4Q9IA 1JIXA 1U1GA 3AERA 2IYVA 3KPVA 5F4BA 2QVLA 4L8LA 4AZ0B 4ALIA 1R0SA 3J81k 5ARCA 3AM1A 5A2GA 1Y8QB 3SWWA 3HEBA 5JXIA 4N41A 3WHPA 5A3VA 5IDQA 2SKEA 1FLNA 4YGXB 3RAGA 2HQOA 1E1LA 4NFYA 3UMYA 1KGDA 5CVJA 3KJHA 3Q4GA 4OJTA 5EMMA 1EK0A 1P3Y1 1QMPA 2H08A 3UUFA 2X1HA 2V59A 4YJGA 5CVUA 1UXKA 2QTNA 3ZBPA 3H9QA 5IJZA 1PR0A 2AN4A 1IBCA 2I7VA 4WCFC 4TKLA 3FWZA 1YUNA 4Y30A 3A4IA 3VO1A 4AZTA 1FEZA 5C1IA 2JS7A 2D7CA 2NU7B 2XUZA 3L6RA 4M54A 5EWJB 2ECOA 3I2IA 3D59A 4ZVRA 3TZHA 4CI0B 1DOAA 3TW4A 3T3NA 1WDTA 2WD9A 2Y1XA 5FADA 5CXQA 1JPNA 2VIIA 3CE9A 3FSEA 2OQVA 1W87A 1YE8A 1N9KA 2A35A 3VZBA 4MULA 5CLJA 3SZUA 1SQGA 3I73A 4HNQA 4BQPA 1NUPA 2JD1A 2ZATA 1S2LA 4B8ZA 5I3ZA 3JAMA 1G38A 4B2YA 2ID9A 2EF1A 1EZZA 3DTVB 4ITRC 4CLRB 4EPWA 2FSGA 3SKVA 3O8LA 1G2QA 3CG4A 3M6LA 2FG5A 3V8NA 1KI2A 3I8XA 4NV1A 5MFPA 3W5AA 4IJQA 1QRTA 2CB0A 4GP7A 2CNWD 4HH0A 5ULLA 1R0ZA 2GPBA 2PT9A 3K71B 2QX9A 1FVFA 1N6IA 1TM5E 1Z6ZA 2WUFA 3V32A 2DCUA 4LE2A 4WLNA 4PO9A 4NCIA 1XNQB 3O8OB 3KKPA 2VVTA 2VCHA 2RCNA 1JDUA 3B1WA 4KVAA 5J23A 1MIOB 2QZJA 2YMLA 1K9SA 3BAZA 3N3BC 4WKNA 5CTAA 4JBNA 5JDCC 3TBFA 4A0SA 4K9LA 3BG5A 3DEAA 2ZE6A 4N01A 4KRGA 1DKQA 3H0CA 1G8KA 1GZ6A 4FOOA 4IJKA 3TSCA 3V8RA 1UP6A 4TXMA 1MX1A 1FTYA 3FPGA 1IUNA 1MP0A 3K6JA 3D3WA 3HV2A 1ZHHA 4GXRA 1NFQA 2FKAA 2V7QA 2MIIA 3OZXA 2ZM5A 2RAPA 2WZDA 5CB8A 5J40A 4MQLA 1JYFA 3GDWA 1H8ED 4MUJA 2BEWA 1N0UA 5J2UA 1K6XA 5EQTA 4ESEA 1E6LA 3MMNA 9ATCA 2ZJ6A 1NBME 4ZYWA 3WQSB 3I04M 1USIA 1M76A 1MA3A 4MUIA 1FVHA 3RU9A 3RT9A 1J8FA 2C1XA 4WUVA 3ZCRA 1P7CA 3DUFA 4QVKA 1QHYA 4DWVA 4ZAYA 3SFVA 3VHXB 4MQBA 2X4IA 3HFGA 1QF6A 1E3QA 4MGYR 4GAEA 1DC7A 5D8DA 3U60B 4MUFA 4WL0A 2X9GA 1P7YA 2PH3A 2A92A 3QPVA 4RVUA 1NKTA 4KPUB 1PT5A 1WQ1R 2Y9MB 4PANA 4QOHA 4JJIA 4UU0A 3VPSA 3TTUA 1BCRB 1PYDA 4NNJA 1QFJA 3NMUF 3V8EA 4V0OA 3N58A 4QQ8A 1ZGBA 1I3NA 3FM9A 3N3AC 1C7RA 3IAS6 1AHHA 4ZDWA 3NJ4A 5A3RA 3FDXA 2ZRIA 1OJ7A 3B82A 3MXTA 5EIEA 2YRXA 4EW3A 2OSVA 1RMTA 3LS2A 1X3LA 1A2OA 1XYVA 5EFZA 4XVCA 3D6FA 3V8BA 2ODPA 1Z35A 4JLPA 1RRPA 3FWYA 5LQDA 2PZJA 2WIGA 1RC1A 4PFKA 2QX8A 3V4OA 3WLJA 4JSRA 5BVHA 4GLFA 3TLZA 2WYWA 2DH5A 1U2PA 3DPIA 3FCYA 4R2KA 2NU6A 1CTQA 4AWXA 1VHQA 4KQIA 2O59A 2YFKA 4Q1VA 2Z2ZA 4UE2A 3L7CA 4QIHA 1DL5A 3CBGA 3HYCA 3STWA 2QTGA 4WBNF 4H7HA 4MVXA 2WTAA 1M6VA 2ISCA 4PM4A 4US2R 2YRFA 1U8UA 1VIDA 2WG0A 2AQ8A 3F3SA 4B3XA 5JZSA 4I55F 4D4GA 1A5ZA 1A9RA 1FYXA 1Q22A 3MWLA 3RVPA 4AU1A 2JCSA 1T3LA 3KOWA 3DHEA 3SJAA 5TVKA 3WGIA 3B1KA 1CJCA 1X3SA 1N0IA 4LQLA 3SS9X 5IK2D 1KQPA 3BWYA 1TGVA 4XWOA 1ZRNA 1P1CA 5EJMA 4G5YA 1C9NA 2NU9B 4DA9A 1WBJB 3I28A 1TYAE 2VQDA 1N3YA 4H1HA 3HZHA 4L9AA 3W2EA 3KSBC 3V9AA 1HZZC 2XNSA 2JLBA 3EE6A 1VJ5A 2DFLA 3OQIA 3UC9A 4YDSA 3QWHA 1IXRC 2YOHA 4HNRA 3ZJUA 3DHNA 4IHJA 3JYQA 1H8HA 2VWHA 3A11A 4R6XA 3U9LA 4MICA 3TSWA 4D9CA 1CX9B 3CU5A 4IRXA 4QVGA 1N8KA 4IMPA 5I9IA 3ZWCA 3DNFA 3LY7A 2B9EA 4J16A 2QMQA 2WJPA 5KTNA 4KXQA 5FA5A 3DAYA 1QAQA 2BCJQ 4X44A 5EKTA 4L0MA 1AQUA 4ZI7F 3SQWA 2WAMA 1CRWG 2LNDA 1R2QA 3BMNA 4IICA 4QBIA 3FVQA 3F5MA 4J0KA 1KJJA 3DB1A 3BHNA 2D5IA 3HO6A 4YONB 3SFZA 1E3JA 1SKYE 2X41A 3OZFA 2XCOA 3PRHA 3OP4A 2V8BA 3MTAA 1NJ5A 1NUHA 2O4CA 1YR6A 3A2KA 2IYZA 3T5TA 2BE9A 1ZICA 1S9DA 4TLDA 3PGLA 1RBZA 4BVBA 5DN6D 2YL2A 2G9ZA 8AT1A 1T5HX 3DEHA 1YR7A 4GKVA 4RCYA 3VPBA 4I99A 5JATA 2WTNA 3QTBA 2LV8A 4LECA 4D9JA 1F8XA 4CKWB 3BCSA 4DRXA 1JV2B 1EP9A 1NE2A 16PKA 2YWFA 4X85A 2O3TA 4E4TA 4RA6A 2HCRA 1EK2A 2CB9A 1HDZA 4KNVA 4DLXA 1B23P 2BJVA 1E9FA 4MRRA 3FLAA 1UADA 4JAVC 2IW3A 6Q21A 4YRZA 1L8XA 4RTMA 1SOAA 4JBWA 3L8YA 1CIPA 5ADVA 4NPCA 3LECA 4QQKA 4OHZA 1RWWA 2UUPA 4YRIA 3OQMA 4KNYA 7MHTA 3CNQS 4TSRA 1QUFA 3W05A 4BUZA 3NI2A 1XLUA 4KPFC 4F5YA 5LYYA 3EA5A 4JUCA 2QGZA 1U28A 1UDRA 2Z57A 3CM0A 1X19A 3ISJA 1PQ4A 3C8DA 1GTMA 4J76A 5K8UA 5MFZA 3RFTA 3GCGA 1EKXA 4CNQA 2ZBEA 2QQEA 3EQ9A 4AX4A 1A8SA 3OZ7A 4J4HA 1G291 4GIBA 4QYIA 4C04A 3WB0A 3LP5A 4QPPA 4C1NA 1XVIA 1SXJA 3OIYA 1DHTA 4F04A 3PLAE 2IHUA 3EVAA 5DGHA 1NG9A 1CVLA 2D1RA 3LPCA 4YRSA 1QG4A 3FA2A 4UZEA 4F5WA 3S2GA 1J8YF 3GNQA 2PKWA 1OBFO 3NBFA 3IUYA 1YHYA 4MEJA 4UEKA 3DL0A 1Q44A 4KXXA 4IX1A 1UKBA 3QKRA 3TNJA 1C0PA 1YIDA 2FP3A 2FQYA 3CR3C 3LBNA 3PZBA 2X0EA 3TLGA 2AIRA 2G36A 4C87A 2VPPA 3LDGA 5CFOA 2OV4A 3TOSA 1J99A 3G0OA 3A6DA 3J81A 2P8JA 1BW9B 3HJNA 4YEDA 3TYXA 3KG2A 3WRWA 1NPTO 2C5LA 5KJFA 2YYYA 8GPBA 1P44A 4F06A 4KLZA 4NSNA 3TPFA 1GGVA 2WU0A 1AGXA 5A04A 3BRWA 2AMFA 3JQGA 1ZUIA 3HSKA 1MB2A 3L7JA 1FX0A 2KWIA 1RXEA 3K9FC 3FOFC 4JK3A 4MWZA 1V35A 1KE2A 1Z0SA 2RAVA 3JQEA 3OSUA 5LZ4A 1QOQB 3BIXA 1RWMA 3V42A 4M8SA 5KQPA 2VCEA 5IRCD 3GFSA 4BNJA 3FVVA 4YUVA 3VPDA 2XZTA 1NTRA 1C9DB 3IUMA 4QBTA 3QIVA 2VUUA 5TMBA 2QXUA 5T57A 4D4LA 4C2UA 4EFDA 1KQGA 1DOHA 1J6UA 2NP6A 4MITA 4MV9A 3AR9A 1GA1A 5JMTA 4HDNB 2G83A 3GOQA 3HKDA 3DL2A 4IHKA 4E03A 4E7PA 1JFSA 4FT4A 1ZD2P 3PFNA 4JD5A 5EHZA 2IA5A 2NIPA 2FDXA 1T9ZA 4D81A 4WXRA 2WD7B 5ILGA 1WCWA 1OLXB 1P5JA 4QKQA 3KR0A 3AHEA 4GYJA 1VBMA 3PNKA 4M89A 3WYNA 2VF7A 4CGYA 4ROSA 2OBMA 1M1XB 4RTOA 2TRSB 3A26A 3VI4B 2VAWA 4FMBB 1N2HA 2FX3A 4G89A 4J4BA 1U0SY 2EZ4A 2HRCA 2R8XA 4NOLA 3C3DA 1KZHA 3VZRA 3JQ8A 1VMEA 1WOMA 3FAZA 3KQLA 1E2EA 4KUHA 1R6BX 1WSWA 2YHBA 1DT5A 3TRJA 4TV8B 4RSMA 3UC5A 2V74B 2C07A 3C6BA 3E03A 4EIWA 2Z1DA 4IWNA 3R3XA 3F47A 3LUBA 1DRJA 4F45A 2D5AA 1FDVA 4NG5A 1BCSA 2Q1UA 1WKBA 3A1DA 3ZK7A 4AFNA 5LMZA 4IH9A 3DLHA 3IVRA 1IZ8A 1IHYA 2IZ5A 3BB3A 1AC5A 1VL2A 2OORC 2QQ0A 3TZ6A 5I3CA 1OWMA 1X6VA 5K45A 4B4KA 3BCHA 2ZJ1A 3UJ3X 4KMMA 4Z53A 4RPKA 2R1ZA 1RXUA 1TO6A 2HF7A 3CEPB 1GWNA 5HYVA 2FQWA 4H7EA 2QPOA 4HX5A 4KFUA 1UPAA 5I7VA 3RWBA 4N5NA 4AG6A 4GKJB 4PZAA 4KV9A 3ZWWA 4ID9A 1XZKA 2GCIA 4JJFA 5AI4A 5B58T 1PBNA 2JKZA 2ZUDA 1E1YA 5JNUA 1RCFA 2ONKA 1M6WA 2V5AA 1HDRA 1BQ4A 4WCFB 5AHXA 5I8ZA 4ZCTA 4JI1B 4F21A 1S2GA 4LZLA 4HGOA 2C8JA 2QDXA 4U2DA 3VOAA 1RYNA 4ICIA 4AVYA 5AKKA 2Y6VA 1WDWB 3GZTB 1U1EA 3D0QA 1R0WA 3AY7A 4Q18A 2QRJA 2QTBA 2WICA 1RQPA 1B43A 2Q3BA 5HE8A 3B1JA 3RRYA 1W59A 5H4GA 1KNQA 1E0SA 4DDKA 3DKVA 4YT4A 1QU3A 3IC5A 3PDUA 1SG9A