2IYZA

Shikimate kinase from mycobacterium tuberculosis in complex with shikimate-3-phosphate and adp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
169
structure length
168
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRNPGAVVRHILSRLQVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords SHIKIMATE KINASE
total genus 60
structure length 168
sequence length 169
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iyzA00
4EPRA 1A5TA 2AX4A 3FE2A 5HE9A 4C3ZA 1PLJA 3KUCA 2MSDB 1E2PA 2XTZA 3KXLA 1KI6A 3WNDA 2Z5FA 2ZRDA 2ZS9A 4DRZA 5DI3A 2OILA 4BFVA 5DHAA 2PLFA 5BN3A 3TW4A 2ZITA 1L4YA 3KXKA 1ZAKA 4HATA 1SQ5A 4RCZA 2HV8A 2P3SA 3BIFA 2QMEA 5A0FA 4BRWA 4MRVA 3P4YA 4GOXA 4B43A 4IDNA 5JFGA 3R9WA 1US8B 4ON9A 2OV2A 4EIWA 2NPFA 2IYQA 2RGBA 3CO5A 4H1UA 2HF9A 3QKSA 5DN6D 1EWRA 4DSTA 1KOFA 3A4MA 3SE0A 1ZU5A 1EFHA 3I1FA 1E9BA 2YOGA 1VG1A 3AVOA 5FH9A 4AI6A 2A30A 2QROA 1E94E 1TEVA 4JLMA 2F1IA 2HT1A 1XX6A 4PSKA 1DELA 4C9BA 3EX7C 1IY1A 1ZM2A 3UK6A 4EQ6B 1COWA 2G6BA 4UNPA 2ZXUA 1RJ9B 4WBSA 4HAUA 1TQDA 1XCMA 4CW7A 1EFRD 1DARA 4RZ2A 2QGZA 4V0OA 2C78A 2JASA 1N6RA 3V00A 1YR9A 4OJKA 2RGGA 2GCOA 4BEBA 3GLFE 2GETA 3WBKA 3Q72A 4ZDIA 3X1DA 4CGZA 2RGAA 2XJ9A 1Z6YA 5DIFA 3GJ4A 4YXWA 1G16A 3SNHA 3BGWA 1E99A 1LTQA 1KK1A 2YYZA 3K70B 3PEYA 3C8UA 3RS4A 1LVGA 2QTFA 2IS1A 1OV4A 3QENA 2JLWA 1CXZA 3A4NA 4GP6A 4PSAA 3A6PC 1XU4A 1N25A 2BCJQ 1J70A 4DLSA 4NE2A 3LX5A 5TMPA 1Q1QA 3B1VA 2D2EA 4N3NA 4Q66C 3IKJA 3UWOA 1C4OA 4KJZA 4KLNA 1D2NA 4GT1A 3THXB 2PT7A 4F93B 2IX3A 4NCNA 2A7QA 1WXQA 5A4JA 3EG5A 3TSOA 2X2FA 3U3KA 2QQ0A 3THYB 1KMQA 4KYUA 2ZR9A 4QM7A 1U2RA 2C5LA 3HPQA 2CMKA 1KO8A 4R9UC 3KJIA 3PEUA 3GLHA 3W3AA 3W9YA 4TMKA 4EKDA 2JJ8A 3ICQB 3F8TA 4M1YA 1XMVA 4JLJA 1Q22A 1R4AA 1B0UA 4UJ3A 2ZAMA 5CITA 1OYYA 3NDPA 4PC6A 2R6CA 1R5NA 2NO1A 1S1MA 1BYIA 2H7VA 4M21A 3IDQA 2PEZA 3SYLA 1SHKA 2WM9B 2QAGA 4V0LA 4BECA 1Z8FA 1SKYB 4JKIA 4DSNA 3LW8A 3PUYA 4OHXA 3ZVRA 4Q9JA 2IYXA 2AWNA 4HDQB 3CX8A 1N5JA 1QF9A 4WXPA 4XVRA 4IRUB 3IHLA 1DAHA 3QKRB 4FMCF 1IY0A 1MOZA 4AURA 8OHMA 1TF7A 2JJ2A 2RB4A 1II8A 1EX7A 5UKDA 5LB4A 1HQCA 4DDVA 3ZVMA 1AJEA 2V6IA 5E4FA 4I1OA 4TMXA 2YKGA 1AGRA 1Z2AA 3AP1A 1XMIA 3WYAA 2N42A 3H2YA 4KFUA 4JYBA 3KTAB 3UATA 1U94A 1RRGA 2JDIA 1J2JA 3PVSA 1Y3AA 3NG1A 3SYNA 3RS2A 3EWSA 1ZNZA 221PA 1FL9A 1UKYA 2ZYTX 4D2IA 3EC1A 2F1HA 2WHXA 1ZIPA 2NO6A 2J0UB 3GMTA 3LRPA 4OI0A 3Q7PA 1D9XA 1WBDA 3PR1A 3X1XA 4LYFA 2IYLD 2AD1A 2FZLA 3A8TA 1W46A 3RSLA 3TLXA 4FD2A 3X1WA 4DB4A 5DGXA 5KNCA 2DCUA 5SZIA 2NO0A 4I1SA 4HI0E 2OFWA 2ZRIA 3LVRE 4W9MC 1ZD1A 4QJ4A 3RRNA 5JS8A 1UKZA 2VP5A 1RYFA 1VYTA 2IA5A 2NOAA 2YNMA 1P2TA 3B2EA 3CPJB 3RSOA 2WKPA 3NC0C 3UANA 2ZRLA 1IOZA 4HAYA 1YR8A 1DADA 4D4LA 2DFKB 3CZPA 2HYDA 2JA1A 5KDDA 5GJBA 3NH9A 1M6NA 5FUVA 2JLQA 2O0JA 2B8TA 2PX3A 3K0EA 4LCBA 4NCKA 1BOFA 4A2PA 1VG9B 2BBWA 1ZCAA 2Z4SA 3H0KA 1IY2A 4FMCB 4OI1A 3SBEA 1UBEA 2GJKA 4ZPXA 3WYFA 4L9WA 721PA 3SDZA 3ZLJA 3NDBB 3HPRA 4DHEA 2J59A 4Q4JB 2OLKA 2YC2C 3SU8A 2A3RA 4MRSA 1N2CE 1Z2CA 4YMVA 4OI4A 1KDPA 5LDDC 1EFRA 5BYJA 2V3CC 2OAP1 1XTIA 4MITA 5CM8B 1JI0A 1KY3A 2C04A 2O8BA 1M34E 2P65A 4KBFA 2IYUA 1FX0B 3LH5A 1QHGA 4EJSB 1P6XA 1OH5A 2F43B 4NYJR 4BLPA 3DKVA 3ECCA 3PEWA 1GFIA 5FTNA 2OEPA 4UXJA 1I2DA 1S9DA 1P61B 1EK0A 4RZUA 2QM7A 2PH1A 4AYWA 2P6RA 3VR3A 4OHZA 3TUJC 3RWMB 1QHSA 1UBCA 1T5IA 3OE7D 3U7HB 3BFVA 4DB2A 3T06B 3DHWC 3Q3JB 1E2JA 1E9EA 2XNSA 3GLHB 1U9IC 5C2JB 3RABA 3K9GA 2I4IA 4LHVA 1E2LA 1NVXQ 3T1TA 2W00A 1CR2A 2BMDA 2J1LA 4JVMA 3VNUA 2ZI7A 5A5GA 4E03A 4B75A 3KL4A 3DMNA 2PZEA 3A1WA 3IHWA 4IEEA 3REGA 1NBMA 1MH1A 2HCBA 2WIBA 4V03A 4JL8A 1Z06A 3QXCA 3W90A 2EVWX 5EQTA 1G8YA 1N6PA 3O8CA 3I4LA 4B76A 3HWSA 1XEWX 3AV0B 1D2EA 1T3LA 2ZE6A 3Q5EA 3PUZA 3ZJYA 3OHMA 1G6HA 2NGRA 1P9WA 4AK9A 2D7CA 4OJQA 3THWB 1R0WA 2CE2X 2WKRA 4G0NA 2O8FA 1N5IA 4TLBA 3V9PA 2KB0A 2GZDA 2DFTA 3EW9A 4TZ0A 4GMXA 2LWIA 4RVCA 4JT4A 3ZGXA 1OFUX 3NTUA 1VYVA 2R6FA 2R2AA 3PEVA 4Q7JB 1Z0AA 3U6BA 3C4JA 4R71A 621PA 1U0JA 2YOHA 2WWWA 4PXAA 5EE1A 4GZLA 1FNMA 5EE3A 3TSZA 2I3BA 5BW8A 2IYTA 3ZZ0A 3CRQA 1R8QA 3F0TA 2CE7A 1G17A 4XJXA 2O8CA 1DEKA 1Z47A 1KDTA 4F4JA 3R20A 4Y0AA 2N1BA 1IJFA 2WZQA 4ZCLA 2VSXA 1OF1A 1SVLA 3LY5A 2DWPA 4LJ6A 1A4RA 4LC1A 4QGHA 4JT2A 1KJZA 1B23P 3D6TB 4P4UA 4PC1A 4A0HA 1RW4A 3IO5A 1OH8A 2CK3D 4LC0A 2DPXA 5TV2A 5JRZA 5FBWB 2QAGC 4TL8A 2FSFA 1GNPA 3T5DA 2Q3HA 2CHVA 2FSGA 3FGNA 4FMDB 5EE9A 1M74A 2YC4C 3W5IA 1RFLA 2VHQA 3WNCA 3FFBA 1R8SA 1A2BA 2GF9A 2QMHA 2VL7A 3NEJA 3Q7QA 1G3RA 5CIQA 2ODWA 4F38A 1YZNA 1A1VA 3R9XA 1U0LA 4EJSC 2B21A 2HJVA 3AF2A 1YQTA 4BQSA 4F4CA 3GLIB 4LGMA 2ERYA 1IN6A 1Q21A 1WE2A 5E3HA 1G20E 4MKIA 3VTKA 3D31A 4HLCA 1GVNB 4R2IA 4LJ4A 4V0ME 5TVKA 4TYYA 1XZPA 1LV7A 1G7TA 3VHXA 2VEDA 1TQ4A 3QVUA 3BAFA 3RLFA 2UKDA 3VX4A 2VTKA 1WCV1 1S1CA 2OFOA 5F2EA 4URZR 4PHHA 3S1AA 2KBFA 4CEIB 1GP2A 1R0XA 2WPDA 4KVAA 1RRPA 1YVDA 3MFYA 2PCJA 3AEZA 3CRRA 4U02A 4P4TA 2O8DA 1T3HA 4IVRA 2BCGY 1AS3A 1DAKA 2VA8A 2VSOA 2W6JA 4L16A 1PZNA 2CVFA 1H8ED 4ITRC 4I4LA 4LHWA 5JEEA 3OZXA 5LPNA 1D5CA 1X6VA 4FCTA 2REXB 4QGGA 1NKTA 4PAOA 5EP3A 1IXSB 4CIDA 2V4ZA 5KNDA 3B6EA 4ESVA 4EPWA 1HYQA 2G9NA 4TTPA 1OPXA 4IHQA 1GNRA 1XP8A 2Z0MA 3PUVA 4G5SA 4NZYA 4RD6A 3TK1A 3ZS9A 3FVQA 4A36A 4LYAA 2QBYA 3IO3A 2WJHA 4URVR 3WHLA 1NBMD 5J4LA 4JL6A 4LWZA 4CT4B 3WMFA 4HDCA 1CJVC 5FL3A 1DO2A 1FW6A 3PCRB 1ZRHA 2RHMA 4FIDA 4MUAA 2SHKA 2RGDA 3FMIA 5KOYA 1N0UA 4ERNA 4NYIR 2YVUA 1EWQA 2HLDD 2XOKA 2YWFA 3T12A 4UNRA 2CVHA 3PENA 2ZS7A 3K70D 1P9RA 3K09C 2GDJA 3DZDA 3OE7A 4XTCS 1YKSA 2RAPA 3LX8A 1OHHA 1KHTA 1N5LA 3QOFA 2WSSD 3DM5A 3TR0A 3NEYA 3SS8A 3QKRA 3KQKA 2FFBA 3C5HA 1MT0A 1RYHA 1T0JB 4XWKA 2H8KA 4LV6A 3RC8A 1Q0UA 4B48A 4QM6A 4JLVA 1OXTA 3BC1A 3AUXA 4US1R 5FTKA 3T15A 5C1BA 1WBBA 2I1VB 5CIWA 1UEIA 1KY2A 121PA 1XXHA 4AG5A 3G82C 4Q7LA 1Z6TA 1HE1C 5JRJA 1XEFA 1AIPA 1M8PA 2IYYA 3GFTA 3TAHA 3CF0A 4A6XA 3ZZTA 3BJIC 3SQWA 3IEVA 5KSZA 2ZRMA 4AC9A 2FSHA 1US8A 2WJYA 1PV4A 1X1RA 4M9XA 2ZRNA 3AF4A 3QBVA 5AK0A 4MYHA 3WY9A 2J41A 4A2QA 1CR1A 3VHLB 2IEZA 1ZD8A 1Z63A 2YV5A 1E3MA 2D4HA 4MH0R 1JEEA 3RHFA 3GLFA 1G5PA 3PG5A 1N6OA 4UJ5A 4URUR 2RGEA 3HYTA 5CLLA 3I72A 1UKEA 4HSEA 5AJYA 4Z54A 2LCFA 2OESA 1DTSA 3CNLA 3OEEA 2GXAA 1DPFA 1GL7A 4RKFA 1HV8A 1JXMA 1TADA 3M1IA 4PHGA 1MABA 3K53A 2GRJA 2Q9CA 1LW7A 4QJ5A 2O52A 5ELXA 2ECKA 4D0NA 1D2MA 1FPMA 1GKYA 2WMNB 2ZRAA 3LO5A 4JLKA 1S8FA 3V4FA 4B6FA 4DLRA 3IQXA 1U0HC 1NN1A 1CU1A 4Q01A 1T91A 2BM1A 3JVUA 1WQ1R 1FUKA 1NI3A 3H86A 1XJ0A 2X1VA 1AM4D 4D82A 3AVUA 3MJRA 1NJFA 2JJ2D 3MGCA 2WTUA 2ERXA 1Z0DA 4TQUS 2QN6A 2AXPA 4GBMA 4K81B 4XD7A 4KFRA 1AS2A 3QEOA 3TQCA 1BMFA 5DSZA 2HF8A 2QP3A 4GP7A 1P62B 1TPZA 5C46F 2ZREA 5KNBA 4IJMA 3MD0A 2QBYB 4DDUA 2KBEA 4L15A 3QJYA 4YDHB 1OH6A 5BQ5A 4BFZA 4G5OA 5B2ZA 2UZ3A 4QHYA 1HE8B 1KO1A 2Q9BA 1MO5A 3SYKA 4M1SA 4B3GA 1E2EA 3LWNA 2CL6X 2V6JA 3I8XA 3KKNA 3KKQA 5FI1B 3OIWA 1G5RA 1XJCA 2V8OA 5DE3A 3L8ZA 3B85A 4A2WA 1GITA 1ZW6A 4IW3B 3RRYA 1N6KA 1U98A 2RKOA 1G7SA 3KJGA 1QHNA 2W6ID 1VHLA 2C9CA 3EZ7A 1Z0FA 4C0KA 1S3SA 2ZUDA 2G1JA 2LKDA 2B8WA 2F3RA 1KSHA 1NNEA 4F7WA 2AN9A 1CEEA 3FMPB 3C41J 1VKJA 4I1UA 3R8CA 1UDXA 5GJCA 2G0TA 3BB3A 2ZUCA 5GADl 2ZI9A 3B8HA 4D6PA 2ZRPA 4P3YA 5EP1A 2QMUA 4ZIRA 3B1ZA 4E09A 1MO3A 4YMSA 1G3QA 2F7SA 2A9KA 5F98A 5CJPA 2NZJA 4FINA 2FOLA 5HCIA 1NVUQ 3PFIA 4LV8B 4A1FA 5IHPA 3TUZC 2IYWA 4LZZA 4KSBA 4FWIB 1T5LA 2HEIA 4XOIA 3ZQJA 2ZR0A 1RRCA 2CJWB 5LD2B 2XTMA 1JQJC 1HQYE 2VIIA 2AL7A 4DLWA 2Z4RA 3B1XA 2ZSFA 1VECA 1G291 2RCNA 3P27A 2IS4A 2W83A 4M53A 4YONB 3ND9A 5GJVC 1E2HA 4OK3A 2OCYC 1F3OA 5AUQA 4XWOA 1W1WA 4PQFA 3T1OA 3NBYC 4O2LA 4ACAA 4D81A 2ORIA 1COWD 3QUSA 5EE0A 1CBUA 2WV9A 3GQBA 4CRWB 4BZQA 5J4VA 4K8OA 4X8OA 4G3XA 4ASUD 4PQRA 3MSXA 4JYCA 4HUQA 1JQLB 1JPJA 4PC2A 3WMEA 2DFLA 4LJ9A 1P2VA 5FR1A 5AUNB 3GJ3A 2P5TB 5DN6A 1U99A 2VP6A 3UG6A 5KSYA 2ODBA 4NCIA 3F5FA 1ZM7A 1MO6A 1NIJA 2VHCA 2ZJ2A 4Q4HB 3AH8A 3EC2A 5G41A 3O47A 4Q9LA 3CRMA 1VTKA 3PV0A 5HKKA 5JECA 3W6NA 4PPFA 5HZHA 3IEUA 5CDFA 3I8SA 5IF9A 1KNXA 5JMTA 2O8CB 4N1AA 2O8BB 2HXYA 4EQ6A 1GILA 3DMDA 3VKWA 1P73A 1QBKC 4OHWA 4PO8A 1XDBA 3EWAA 3TE6A 3A58B 3ZD7A 2AHOA 3QIAA 4ILEA 3LDAA 3U3OA 2XAUA 1GG2A 3BH0A 4TQAA 2ZRFA 2VF7A 4BZXA 4CT5A 3LBHA 2XGJA 2J0VA 3QPWA 2ZI5A 3CH5A 4II7A 1TNDA 2WJVA 4B44A 1W4CA 2VBCA 4RZXA 5J4KA 3HYRA 2WWHA 2JJ1D 4M1KA 4DXAA 3DDCA 4QFMA 5JSZB 3JZMA 2DWQA 4Q21A 3BORA 2WKQA 4JLOA 2W2VA 3GPLA 1XMJA 4YC7A 4QRHA 4BWYA 4KAXA 4XSGA 2JDID 1V5WA 4EUNA 2BVNA 1XWIA 3RRZA 3CONA 2VHTA 3LBNA 4URYR 2RMKA 4X8HA 3DVLA 1YRBA 4QNMA 1E2DA 1UAAA 1ZCBA 3K1JA 5L3SB 2QNRA 4LOAA 3TBKA 1YZTA 4NMMA 3THYA 2QPOA 3ONWA 2RGNC 2IBMA 3I73A 4TL6A 2ZSDA 3QY0A 3KTAA 4ZDWA 3PIRA 4QBIA 1DG3A 5HE8A 1G8PA 4RD4A 4OHYA 2QG6A 2FGJA 2NPIA 3EARA 4V0MA 3KKMA 2ZU6A 1S3GA 1U90A 2BMJA 2DY1A 3LD9A 5JCPA 1S9HA 4WA7A 1E2KA 1G41A 5TY0A 2YWHA 1QRAA 1GTVA 2XB2A 3AVYA 4FMDF 4P0TA 1T8TA 2QORA 1KSJA 1Z6GA 3K70C 4NPHA 3DPUA 4PAMA 1Z3IX 4JMPA 1E4VA 1UKVY 2VSFA 4YDSA 2JJ1A 2LKCA 2ZU0C 6Q21A 4ACBA 1BH2A 3ZVNA 4M4SA 1OT3A 4URXR 1E79A 3AGPA 2R9VA 3KX2A 1NL3A 1N3BA 2J0SA 2J9RA 1O3YA 2X8AA 4D4MA 2GNOA 2GCNA 4B35A 3MCAA 5DNYB 1D9ZA 1RKBA 1NKSA 4L9SA 4MDEA 1OJLA 4OBEA 2IF2A 1VMAA 2VHUA 3IPYA 4ZO4A 3KB1A 1ZD9A 1XTRA 1NLZA 4A8JC 4DLYA 2W6JD 2ODEA 4IOMA 4OKSA 4PC3A 5FR2A 1NSTA 3B5JA 2C03A 4KODA 3PUWA 2ZUBA 3U7FB 5AJWA 3GEHA 1HEIA 2WVJA 4TLCA 2F3TA 4GOJA 4TYNA 1HA3A 2JIZA 2O0HA 1JPNA 4LBWA 2XXAA 3NHAA 1OH7A 3NBXX 1I2MA 2GEDA 2QAGB 5AJVB 2OFXA 4FI3C 4MGZR 4IOJA 2EYUA 5D3MB 4B34A 4KCGA 5L3RA 3KQUA 2OXCA 3FDIA 4NHOA 4J0QA 5TXGA 3GD7A 1KNQA 5JBQA 1JAIA 5DI3B 4IOKA 4TL7A 3C5CA 3GLHE 4LRWA 4O0MA 3EZ2A 1H65A 3THWA 2BJWA 2CCGA 2YINC 1EFCA 1U9IA 1JAHA 1XXHB 2E1RA 3HU1A 3CM0A 1XTKA 2P6UA 4DT1B 5EUMA 3R8FA 1IN8A 1XB2A 1LFDB 3BOSA 2ZJZA 1KK2A 3UXMA 4TSFA 3FB4A 1CP2A 3N5CA 2XZLA 3DEFA 2Q21A 4OQMA 4XIGS 4D80A 4IVQA 3OEHD 3HU3A 4D4KA 1TX4B 3BK7A 2HCJB 1N0WA 1ZUNB 3IGFA 2G83A 5DYIA 4EPYA 3E70C 1RC8A 2VP0A 3SQXA 5FOWA 2D74A 1JEDA 1M7HA 3FKSA 2ZPTX 4IKEA 3T1QA 4XH9B 3GLIE 2ZI6A 3KXIA 4PX9A 2GF0A 2ZRBA 2XZPA 4EJSA 1VIAA 4HLUC 1MV5A 4NCJA 5FTLA 2GEVA 4IDPA 3UKDA 1MRSA 3BBPA 5H1YA 3R7WB 2KSQA 2FEOA 2BKEA 2QTVB 4Q1DA 2D3WA 2QQEA 2VF8A 1RZ3A 2B7BA 5EP2A 5JZVA 3TJZA 1HURA 1P7CA 4Q5IA 3DM9B 4B6EA 1OW3B 1OSNA 4RD3A 4B2IA 4BLQA 4JVSB 1X3SA 4EFMA 1G9XA 4TTRA 1V43A 1F2TB 1JB1A 1OXVA 4POAA 1XPUA 2IHBA 5KSOA 3D3QA 4PQYA 4WXRA 3K0SA 2YOFA 1ZU4A 3WYGA 5CB8A 5L3VA 5FUWA 2WOOA 1NMZA 2V54A 1NP6A 1CF4A 4W7SA 2VYFA 3RDPA 2QZ4A 2H17A 2BMFA 2A2ZA 4MRPA 1UBFA 2OLJA 3U5ZB 1AQUA 1RJ9A 3W6PA 1H8HA 4AKHA 3I3SR 4C0JA 3CX7A 4JKYA 2OAQ1 2QP4A 2WJIA 4TT3D 3FHTA 5JWHA 1XF9A 4DT1A 1JR3D 3MLEA 4XD7D 2ONKA 1N6LA 3QPUA 4GOKA 1QHIA 3M0EA 3A1VA 3SJBA 1SXJD 2FGKA 2HUPA 4P4SB 1JJ7A 4ZDKA 2C98A 1Q12A 3QKSB 1E0KA 2C8VA 2ORVA 2R6DA 2BEJA 4O2RA 5LB2A 4XSHA 3HDTA 4BGDA 2QA5A 5FOSA 1E9CA 1RIFA 3RNLA 3J81k 2FJUA 5AWFC 4QGFA 2BC9A 3TNFA 4C30A 3KQHA 1W0JD 4DLTA 5GJWC 1R6BX 3GP8A 4MA4A 4ZI3A 2GXSA 1NVVR 1FQJA 1LF5A 2PMDA 1QVAA 2B7CA 2IXEA 1N0VC 3FMOB 1XCGB 3NC1C 4G01B 4AYTA 4X8LA 1P2SA 3C16C 2IS6A 3GJ5A 2C99A 4NCHA 3L0SA 4ARZB 2NTYC 4DIEA 1T4GA 1CRQA 3P4XA 3SJZA 4HAVA 2WOJA 3CZQA 2C2HA 2IYZA 2NO7A 5IK2D 5J5CA 2H16A 4WZ6A 1PVOA 4KSCA 4KFSA 2BKUA 2ZYUX 4OK6A 2QAJA 4HB3A 5FTJA 2JGNA 4TYWA 1FFHA 4LYHA 2OHFA 4R7ZA 4XVUA 2YWGA 2QU8A 5CYPA 4NL4H 4DC9A 2GWHA 2BV3A 3LXXA 1JECA 3NBZC 3CR8A 1AK2A 1XEXB 3SBDA 4NYJQ 4MYTA 1G64A 1M7BA 1KI8A 3GCGA 1VCIA 2ZROA 3N2IA 2CXXA 5EZ5A 4JVLA 1NG1A 2A78A 2V55B 2WWGA 2OUKA 2Y8EA 4IFEA 1EFUA 4DCTA 3TMKA 2IC5A 2ANBA 2WMOB 1Q3HA 2GCOB 1CJMA 2OBLA 4LY6A 5BN5A 1E9SA 2EFCB 2FFQA 1G1MA 4P4SA 1QHHA 4HDOB 5B30A 3CRVA 2KE5A 5G53C 1YJ5A 3K9HA 1GM5A 3ADKA 3GLGA 1SVSA 3U3JA 3QE0A 1NY5A 4DKXA 4LX0A 4A9AA 4FXPA 3NWJA 2G88A 3CB4A 2XSZA 3ZIAD 4B3XA 5H8WA 2A5GA 2OG2A 5FTMA 2E9SA 4WVFA 4DLVA 2AKAB 3ZH9B 2F55A 2CDNA 5AR1A 1KI6B 4B73A 1W2HA 4NU0A 1ZUIA 3B1WA 2MMCA 2ZR7A 4M1MA 5JCZA 5AJXA 2GK6A 2CEAA 2IEYA 1Z83A 2AR7A 3AVPA 5BWMA 5KPDA 1S4QA 5FFMA 1CJUC 4RJLA 2ODNA 2ZJ5A 3ASYA 2C9YA 1KJYA 4S2EA 1GRQA 1XPRA 4RD2A 1Z6XA 2ZRHA 3K0FA 5DISB 1CR0A 1H8EA 1GIAA 1GKUB 3S1AB 2EFDB 2JLZA 3EPKA 4I1VA 4YLGA 4LJ5A 3VAAA 3Q9LA 1SVKA 3LNCA 4TWZA 3SZRA 1P5ZB 3AKDA 1OIXA 1NVWQ 3KFXA 3ZDQA 1XNJA 1EX6A 2CL0X 4TLEA 2QL6A 1ZC3A 3EA0A 2FF7A 3QXXA 5EXPA 4NDZA 3TUIC 1IBRA 4FMBB 1R0ZA 2IUTA 1CJKC 2MMGA 1Q3TA 1EG7A 1A2KC 4YMUA 2BJVA 1OYWA 2QI9C 1C9KA 3EA5A 5BYKA 4A0FA 2ZRKA 3EZ9A 1F5NA 1IN5A 1KAOA 2G0NA 3TRFA 3A4LA 2J7KA 2QY9A 1DAIA 4D0LB 2CCJA 1MABB 2BHRA 5CK5A 5J4YA 4CEHA 1TL7C 3BB4A 1YZUA 3HR7A 2BM0A 2EW1A 1YRAA 1KZGB 3K09A 4DIDA 3W8RA 1F60A 5EXSA 1EFTA 4DCNA 5HKKD 5DO9A 2XJ4A 3FKSD 3VR5A 2AKYA 2D62A 3IQWA 3X1YA 1VCMA 1FTSA 1UM8A 2V9PA 4OQNA 2Z43A 1IQPA 4D4JA 1AKEA 1T8UA 2C77A 3BH7A 4P32A 1HY3A 4US2R 5F3WB 1SVMA 3OESA 3MG9A 2DFNA 4Q7MB 2AK2A 4QHSA 4DUGD 3ZS8A 3TAUA 3FYHA 2BDTA 2VPPA 3K0CC 1DVRA 1HUQA 4DVGA 3ZZUA 1SVWA 1F48A 4V0NA 3AB3A 5L8VA 2OO7A 1E9DA 2EYQA 3THXA 4PFSA 4MQBA 5FPKA 3CF2A 3DKPA 5FL7D 1CJTC 4M1TA 4O3MA 3K0AB 4A92A 1Q57A 2C96A 3E2IA 4KYIB 4RFVA 3IIMA 3QNUA 5L3QA 4KV9A 1G4UR 2W0SA 1RPZA 1I4LD 4Q1AA 1KMHA 4CEJB 2BBSA 1W49A 5LBIA 1FMLA 4S35A 2QPTA 3AKYA 4Q00A 5EE5B 4EPVA 4ARZA 4AKGA 1JNYA 1GWNA 1L2TA 2ZSAA 1E4YA 3MWLA 5KDLA 1CKEA 2GVDC 4A0GA 2RHDA 1X8LA 2VP2A 4KVGA 3VFDA 4B2PA 3L0PA 1QDEA 4V0KA 4PTLA 3AKEA 1E2NA 4LBYA 2NQ2C 3L0OA 4LPKA 5F9FA 3GLFB 3SC3A 1AS0A 5K8UA 2HXSA 4DJTA 2FG5A 3I32A 2ZJ8A 4MYUA 4V02A 3EASA 5E7MA 2DWOA 2OCAA 5L3QB 4HAXA 2CLDX 1F6BA 3R7WA 4Z8YA 4DWJA 4JLAA 5L3SA 1VG8A 2JLUA 4BUJA 1Y63A 2BIFA 3GFPA 1YE8A 1YR6A 2DHRA 4JIMA 2BBOA 1U8YA 1ZM4A 4HB2A 4MGYR 3FTQA 2C95A 2WJJA 4LUCA 4LV5B 1S96A 3D8BA 2J3EA 2VO1A 3FOZA 1GZSA 1SXJC 2H1LA 1KO4A 1XZQA 2XITA 5J40A 5TB5A 2V1XA 4GL2A 3O8BA 3BRWD 4MGKR 4Y0VA 1XEWY 1NSFA 4M9QA 2NMVA 1TAGA 3IIKA 3CH4B 2TMKA 2OBMA 3T34A 4JSYA 2EFHB 1JALA 2ZAOA 3MRSA 3RAPR 3VR4A 4Z51A 1FTNA 3AVQA 1ESNA 3QEJA 1G3IA 1ZBDA 1SVIA 3NH6A 1E1QA 1OE0A 5AUPB 2BWJA 5BN4A 3CWZA 4MYCA 4U7DA 5HTKA 1AQYA 1KO7A 3G5UA 3QSYA 4C7OA 4TMVA 1T0HB 3GJ8A 3QBTA 4M0LA 4PO1A 1XTSA 5FOTA 4CEHB 1PUJA 2ZVPX 2IYSA 1KI9A 1FOEB 3BWDD 2G77B 2F1RA 3ZIAA 3WRXC 2ZETA 1A82A 1L4UA 3TGPA 1Q1BA 2GAAA 2IXGA 1IN7A 5G3YA 3RS7A 4XTRA 3K8YA 4DUGA 2FPLA 4PZYA 2O0KA 1NN0A 5HPYB 4FN5A 3A1TA 3EIQA 4Q4JA 3AP3A 1KK0A 1OFHA 2W0MA 2QMOA 4LHXA 4C2UA 1G21E 4TYQA 4UXHA 5JS7A 3Q8XB 3FWYA 1SGWA 4ZKDA 2FPMA 5F9HA 2A5YB 4QNRA 4GSYA 3OAAD 1D6JA 1X8KA 1W5SA 4JBYA 1KI4A 4HLDA 4FCVA 2F9LA 4ZI2A 3KKPA 1CLUA 3GEEA 4TYPA 3U60B 4US0R 4C4PA 4C7OB 2GZHA 1L8QA 2HJGA 1MRNA 5G40A 2PBRA 3HR8A 4NKRA 3FHCB 4HUQB 4LJ7A 4IXNA 3AP2A 1JBKA 3H84A 1J90A 1Z28A 5KO2A 4QHTA 3VX3A 5FOVA 2E87A 2QT0A 3H4MA 1CTQA 2QRZA 4D26A 2L0XA 4U00A 3VMFA 4M9ZA 2C9OA 1P2UA 3IPXA 5CJ2A 1K8RA 2YHSA 3CR7A 3OIYA 4HB0A 4B47A 1E96A 4LBVA 2W2TA 3LW7A 1DG1G 1N6NA 4P33A 1ZNWA 5FBQB 1TMKA 4QGAA 5P21A 1Z07A 1SVOA 4QL3A 5DYGA 4CVNA 1W36D 4LJYA 2BMEA 3QKUA 1NMXA 1ZINA 1J8MF 5TARA 3TW8B 4B71A 3AQ4A 3WXMA 1E2GA 4HB4A 1DAMA 5EJEA 3SJCA 1W7AA 1W0KA 3WNBA 3UMSA 1ZC4A 4PHFA 4Q03A 2Z6VA 4C0QC 1SKQA 2DBYA 1IN4A 1U8ZA 5CDFE 5FUYA 4NP6A 1XMSA 2JLRA 2WSSA 1ANKA 4HLUA 3BXZA 4RFSA 2BBTA 1JR3E 1VG0B 5JEDA 821PA 3W3ZB 3BS4A 4B33A 1LB1B 3D7MA 1OLOA 2IL1A 4JL5A 3PXGA 2GBLC 4KU4A 2PMKA 3LQRA 3RC3A 3ASZA 1OFIA 3MMPA 4G5RA 3NKVA 2YJTD 3TH5A 4C2TA 3KJEA 4AY2A 1S0UA 2QRNA 1KTVA 1NLFA 1XD8A 2ZIAA 1R7RA 3B1YA 2ZS8A 3B9PA 5IDVA 1JR3A 3NVAA 4WZAE 1KO5A 1QVRA 1F2UA 3QXSA 1ZYUA 4NYMR 5GVSA 3TIFA 1TF2A 1ZNYA 2ZE8A 2WBLC 1KGDA 3BE4A 1RVDA 2O8EA 4IOLA 3UMFA 4OI2A 1W0KD 1YZLA 1P9NA 4BFTA 2EWVA 5LD2C 2IT1A 2PZFA 1TU3A 2MSCB 2G1KA 4GDFA 1LS6A 1QG4A 2ASEA 4H1VA 1YR7A 2ZYVX 1VDZA 3M4YA 5HR5A 4MDFA 5ANRB 4GRAA 4DDTA 1OKKA 1YHNA 1L7VC 3RYTC 4BLSA 3EPJA 2GJAA 5FPTA 3I62A 4M1WA 4A15A 4UXIA 2YWEA 2W6IA 2FX3A 4TMZA 2J87A 3QPVA 1GRNA 1OFTA 3ND8A 3SN6A 5KU1A 1Z0KA 2XNDD 1SZPA 2AXNA 4G1UC 4ZKEA 1KYIA 5FOXA 1WRBA 1KZ7B 1TF5A 1SXJE 3C15C 1WP9A 2DYKA 4GZMA 4WW0A 2ZM5A 2WWYA 2MSEB 4MUBA 4KO8A 4O25A 2QE7D 3AM1A 2JATA 4YQFA 1NF3A 4QBHA 3Q5DA 4AG6A 1XEXA 3ADCA 2VLIA 2ZI3A 4W5HA 1II9A 1DAGA 1E2MA 1TU4A 1YZKA 1Z08A 5K8IA 4JJKA 3VR1A 2JLVA 1II0A 1UEJA 1NRJB 2CNWD 2A5FA 3EAQA 2J7PA 3OEHA 3RVBA 1CIPA 4Q7KA 2Z83A 3QVVA 3KKOA 2FEMA 3I5XA 1KSFX 4TSFD 3CX6A 3GLGE 2JEOA 3I61A 1J7KA 4JVNA 3GLGB 2JLYA 1G8FA 4DDWA 1RE0A 2IS2A 1SXJA 2VQSA 4JLBA 1BIFA 1W4RA 2J7PD 2GESA 3QXHA 4LBZA 5FBLB 4A6PA 4DSOA 2RGXA 5KYKA 1EESA 3AGQA 4BRUA 2OBNA 5JHHB 3EPHA 1NN5A 2CNWA 3LQQA 4C0HA 2O8EB 4PZLA 4JBXA 1X86B 3ZVLA 5KSPA 1IHUA 2UVQA 2ZSEA 4CZ2A 1PJRA 2VH5R 1WF3A 2FDCA 2CLSA 3TQFA 2ZRJA 3K0AA 1FP6A 3KQLA 3LAWA 4GNKA 4PPQA 1W2GA 1BYUA 2FV8A 2FZ4A 1PUIA 3OEED 5HCNA 1ONBA 4LDJA 1HT1E 1XBTA 3CPEA 2O8FB 1Z22A 1Z0JA 3U2QA 4JLPA 5JI2E 1QG2A 3GJ0A 2YZ2A 4QOSA 3B13B 4U5XA 4CEIA 1AKYA 2ZANA 1GDDA 2ZJAA 2GXUA 4M9SA 5KTYA 3PJRA 4HZIA 1LF0A 2XNDA 1QHHB 1LS1A 1E9RA 4Q9IA 1TTTA 2IUSA 4EPXA 1DOAA 1G3MA 1CULC 5CK4A 3WRYC 3QF7A 4HLQB 2GTPA 1W44A 2RH5A 2DR3A 4HUTA 1Q1EA 1ZNXA 3U4QA 1XPOA 1E0SA 2HYIC 3SHWA 1XJQA 3B82A 1KSGA 1BKDR 1YZQA 2IWRA 2VP4A 2X19A 4MRNA 2AFHE 2AD5A 4TL9A 3W34A 4C0LA 4ZCMA 2WAXA 4PAQA 3RRMA 1I4TD 1TUEA 2NIPA 4X8MA 4AIIA 1E79D 1G3UA 3REFA 4DCUA 5JJIA 2R8RA 2IHYA 3OFND 1UBGA 4EFLA 3AUYA 1G8HA 1E98A 3WP0A 1P4SA 2WAYA 3AF0A 4IEIA 5FUXA 3IBYA 4DLXA 3ICEA 1NBME 2R62A 1E69A 1OHHD 2GEUA 4LPSA 3UMRA 5B58C 4Q4AA 1I4DD 1NMYA 3U7GA 1ZVQA 2CJWA 1D8TA 4Q48A 2O8DB 5M04A 4BLTA 2H18A 4DSUA 2ZTSA 4C0BA 4RD0A 4R2HA 2CCKA 3ZYCA 2EFEB 2FA9A 2PJZA 2XOKD 3DL0A 4L4UA 4HZUB 1T9HA 2B6HA 2XTNA 5FL7A 1AA9A 1DBSA 3SI7A 1GKIA 2CBZA 1DAFA 3GJ6A 5E7JA 2ANCA 2ZE7A 1SKYE 4FCWA 1Q20A 2F43A 1CRPA 4RCYA 4IXMA 4IDQA 4B3BA 1K5GA 1JXOA 5G3ZA 2AK3A 2BOVA 4HZUA 4K46A 2KJQA 4PZZA 5B64A 4OL0A 1BO6A 4PHTA 2FMXA 4RSGA 1GOTA 1BS1A 4B3DA 2HT6A 3MWJA 3QKTA 2GA8A 4CEJA 3U6KA 1P72A 1XD9A 2CHGA 5FOUA 4ESHA 2RGNA 1W48A 4FW9A 1O87A 3CUEF 3BH6A 3F3YA 1ZM9A 2OXRA 4MKFA 3PQCA 1ZM3A 3NHBA 2H57A 4CDGA 4DZZA 2V7QA 4QBGB 3PITA 5H70A 5DH9A 1KKLA 1IONA 3O8DA 5EXTA 4D0GA 2JIZD 1XFAA 2K5UA 2NZ8A 2ZI4A 4N0EA 4Q1CA 3U44A 3OF5A 1W36C 4AD8A 4BFYA 4BZPA 2IWHA 2ZJBA 1Z6AA 5IRCD 3MWKA 1DS6A 2XX3A 421PA 2QSZA 2N46A 3C7KA 4TMWA 4F4IA 5JWRA 4NONA 2P5SA 1G5TA 2WSMA 3QXJA 4ABYA 1KKMA 1E9AA 4JSTA 2Q3FA 3WP1B 2Q0HA 1XTJA 3B7GA 4A4DA 2ATXA 3QI2A 3AVWA 4I81A 2CLCX 3T5GA 4M2LA 1RRFA 4B3FX 1MKYA 2EWWA 2P67A 4L8GA 2GK7A 3HP1A 1ZIOA 2FE4A 3OAAA 1WMSA 1XD2B 2B92A 1NJGA 2AFIE 2GZAA 2QGNA 2NO9A 1N5KA 1DAEA 3LVQE 4KBGA 3K9NA 4PR0A 1K6MA 2IYRA 3TVTA 2V7QD 2ZSBA 4WIAA 1OB5A 1GRRA 4LHZA 4M1OA 3EIHA 3QG1A 2PT5A 2QT1A 2IYVA 3IBGA 4UNSA 1C1YA 1UPTA 3NIBA 4EFNA 1G7RA 5C18A 3RWOA 5CB6A 2RGCA 2P2LA 4ASUA 3L2OB 3L0IB 3W5JA 1Z5ZA 2GAOA 1WDTA 1E0AA 3SOPA 5FPYA 1E2IA 1FMJA 2ZJOA 2ZVQX 4TTQA 1KI1A 4Q1FA 5GVRA 1ETUA 2VRWA 4JJZA 4OHVA 2XSZD 2GCPA 5SZJA 3UG7A 4BASA 3TSWA 5JWOA 1VCOA 3DO6A 1FNNA 3UWKA 1E1QD 4B3CA 4DEXA 3UPUA 521PA 3GEIA 4A0RA 3I92A 1NG9A 5AJZA 4TMTA 4BLOA 2F6RA 3LFUA 3KB2A 3U3RA 4Z1MD 2J0QA 4TQ9A 2GBLA 2VP9A 4Q47A 1OIWA 5FI0B 4BFXA 2PZGA 4BEJA 5E7IA 3KUDA 2Q6TA 5J4HA 4YMWA 3P20A 2XZOA 1GAJA 1NIPA 1QHYA 2IUUA 2D7DA 3BERA 2FWRA 2KWIA 2R6GA 3OFNA 4H9GA 4AKIA 1NVVQ 2ZEJA 1E0JA 3SFVA 2R44A 3Q85A 3P1JA 1XRJA 2OT3B 1KI7A 3AF3A 4A82A 1CR4A 3NBFA 1WB9A 4MKHA 2IK8A 2REOA 2REBA 4RD1A 3HU2A 3CNOA 2JLSA 2QENA 4IDOA 2OSBA 1R5OA 1Z0IA 2GKSA 2ZRGA 2R6AA 1FZQA 2FSIA 1KMHB 2G3YA 4XWAA 1YZGA 4Q19A 1FUUA 2J5XA 3LXRA 4Q02A 5KPJA 1QZXA 2W58A 2FN4A 4ZV4A 4BFUA 3CWQA 1F2TA 1AZSC 3L82B 3CW2A 4QG7A 4R98A 5TDHA 3EZ6A 3QQ5A 5FBVB 4KLZA 4JLNA 5KHOC 2WWIA 5K8LA 1DE0A 3IILA 3L43A 4LYJA 2EU8A 4PO9A 3RS0A 3RS5A 3GJ7A 5B57C 1IXZA 1XXHE 4QJ3A 5EXXA 1NLYA 1F2UB 3MJHA 2R65A 1OB2A 4C0AC 3VQTA 3A36A 1R0YA 1J8YF 4DLUA 1TQ6A 3WBJA 3CNNA 2QUZA 4RKEA 2WWFA 1W0JA 2F1JA 3MWYW 5SZKB 4LK2A 1NY6A 1M1YE 4F91B 5KDOA 5JJKA 2D2FA 4EAQA 4TLAA 4QC2A 4B74A 1ELOA 4KFTA 3W8NA 4DLZA 4MGIR 3TR5A 4OQFA 5EUQB 1SHZA 1XD2A 5JJLA 3LBIA 2DB3A 3KDSE 1ZP6A 4LJAA 3K0FB 5C4GB 2FNAA 3KJHA 4NYMQ 2ZQ5A 4KHZA 5D3QA 3X1ZA 3H1TA 3LA6A 2J0UA 3BFXA 3CBQA 2IXFA 3BD9A 4MRRA 1TQ2A 1UF9A 1VIYA 4NH0A 2D06A 4WZBE 4KXFB 4UKDA 1H8HD 2AWOA 1Z29A 4PANA 1KK3A 3T35A 2KI5A 4UNQA 3CRW1 2IF0A 4OQXA 2XEXA 3U61B 2QE7A 3W6OA 4EDHA 1OXXK 3CLVA 1U8AA 4EPTA 1UFQA 4WOPA 4HEJA 3WHKA 1W4BA 1FP7A 2OCPA 3DZ8A 2QSYA 3OIVA 4UQOA 3KFVA 3G0HA 3E1SA 1QHXA 4CYMA 2GJ9A 4IFBA 2EQBA 2JLXA 3LLMA 3CKLA 4A8JA 2ZJYA 3AVVA 4BE7B 1Q44A 2CL7X 4AWXA 1CS4C 2X2EA 3FKQA 1IXRC 3QF4A 2Q3MA 1OKKD 4WAUA 5KUTA 1E2QA 4GPTA 3SJAA 3T61A 1KAGA 1YU9A 2FH5B 4GFDA 2A5JA 2FFAA 4E07A 3ZQ6A 2WICA 4Z1MA 5DLQC 2ORWA 1X8JA 2IW3A 4LI0A 4JLDA 3VKHA 2PCLA 3TKLA 2JCSA 2CHQA 4Q18A 3AF1A 1FX0A 4QXAA 3GLIA 4C0SA 2GILA 2P0EA 2OM2A 4XVQA 1R10A 1X1SA 3C14C 1AZTA 3EZFA 3AKCA 1II8B 1M2OB 2P6NA 1BMFD 2PJRA 2W2XA 2V1UA 3AVXA 2BEKA 4JZKA 1W36B 1KJWA 2QTHA 4W5WA 5DHFA 3THOA 1WA5A 3RANA 4HAZA 2FPKA 2PL3A 5FBRB 3VU9A 1R5BA 3UIEA 1OIVA 1IAQA 2H5EA 3ADBA 5JHGB 1ZJ6A 3EIEA 3IUYA 2QEQA 3CF6R 1UJ2A 4Q4AB 2HLDA 5E95A 4Q9KA 3CIOA 3A1UA 4Q4HA 1ODFA 4M22A 4TLDA 3SFZA 1PLKA 5CM9C 4PPNA 4DCVA 2UZIR 1G19A 1OXSC 2GJSA 4LHYA 1VCNA 5C4MA 4QBFA 1GL6A 1G7CA 4PC7A 3SR0A 3ZD6A 3U4QB 5FPHA 3GJXC 4OQLA 3SEAA 1T6NA 1IM2A 1G4AE 3GFOA 4L5BA 3T1VA 3SHFA 3I5YA 4LJ8A 2X77A 5J47A 2Q9AA 1HT2E 1A7JA 3BFKA 4OK5A 4BFWA 3O8RA 3HJNA 3FFAA 3K0CA 4W5JA 5DI9A 4AKEA 1IJEA 5H68A 1HTWA 1AN0A 2J46A 1R2QA 2WWXA 4RFSB 1E9FA 1EXMA 2GVZC 3B78A 4PPGA 1W47A 1ZUHA 2ZRCA 2OCBA 3CPHA 2FU5C 4ZDJA 2H92A 4M8NE 1GNQA 4A8JB 2ZYWX 2QP9X 1JJVA 1J99A 1E6CA 4MKGA 1E1RD 3VR2A 3V4RA 2PX0A 1Q1ZA 1DO0A 3P26A 5CYOA 5BXQC 4PSVA 1N6HA 4NYIQ 4ZCIA 4B2LA 2WIAA 4KI0A 1E1RA 1TUIA 4Z8XA 2O5VA 4KITB 3FMFA 5IK2A 5JSZA 2OZEA 1E32A 1GL9B 3LV8A 1KIMA 3U7EB 4Q9HA 4DCSA 2I1QA 4F92B 4CF7A 4YXWD 1P75A 3K9LA 4AYXA 3BB1A 2HDNB 4LSGA 1SXJB 1W5TA 4BLRA 1EGAA 2FFHA 4OYHA 1G8GA 3TVDA 4JS0A 4FWTA 3JVVA 3U3MA 1MO4A 3EXAA 3EPLA 4GMDA 1W4AA 1XCPA 1T3SA 4DEYA 3PUXA 2ONJA 1TEXA 4G5QA 1ESMA 2OE2A 4BPBA 3ADDA 3A37A 1LNZA 4G5GA 4Q1EA 3RS3A 5JLJA 3VR6A 4N0DA 4YMTA 1SULA 3WMGA 5K8TA 1E2FA 4DBLC 4ZIRB 4P31A 1VYUA 2GHIA 1JR6A 5FPSA 3B60A 1VPLA 4Q4LA 3M6AA 4BFSA 4TZ6A 1GSIA 5EZ6B 2ZE5A 2PEYA 3NXSA 3N70A 2QPAA 3FHOA 1M7GA 1U81A 3B9QA 3L8YA 3QG5A 4RY2A 1G6OA 3FPAA 4HAWA 2ATVA 1KDOA 3MUFA 4JBWA 1KI3A 1K5DA 4GI7A 3KQNA 2XXAB 3VKGA 4QKQA 4RZ3A 1FQKA 1KDRA 4E5UA 2CK3A 3P32A 1XTQA 2EFGA 3LLUA 4URWR 4Q1BA 2F9MA 1N6IA 3OIUA 1AGPA 3E5HA 5CLQA 2GJ8A 1MR3F 4NTZA 3AVTA 1P60A 1HH4A 1UDWA 4TT3A 2GXQA 5HZKA 3VNVA 1ZMXA 3R9IA 2JAQA 5SZHB 2PLRA 3MAAC 2XB4A 2QM8A 5IT5A 2A5DA 5EP4A 1UADA 3X2SA 3JZAA 1VHTA 3KZ1E 1LY1A 4HYYA 1OXUA 4IVPA 3DOEA 3VU9B 4E22A 1GUAA 2J45A 1KI2A 3N2EA 5AUOB 4NBSA 2NG1A 1P3JA 3QF4B 3DOFA 5JI3E 3IIJA 4IDHA 4I99A 3A1SA 4D25A 1G18A 1S2MA 2WPDD 4TN1A 3U44B 4UNNA 2WJGA 1NN3A 3ETLA 4B32A 5D3MA 2VHJA 1PLLA
chains in the Genus database with same CATH superfamily
5HVNA 3ZBQA 1A5TA 2QM0A 5HE9A 1T0PA 4LE1A 1NU8A 5FLYA 1FLAA 3FDJA 2MSDB 3KUCA 3KEOA 3KG2A 2XTZA 4D46A 1KI6A 1LDEA 3EGXB 4PYRA 4FC7A 3ELBA 4HAIA 1EHCA 2O4UX 4LXHA 3QEAZ 3UVEA 4Q12A 1FS5A 4BMDA 1JHDA 2ZITA 3KXKA 4LDRA 2HB6A 3ABSB 1U8UA 1OWOA 3MPUA 5D1HA 5F73A 4EHKA 4NQRA 5KTTA 1Z4KA 3W4JA 1NYLA 5BSKA 2P3SA 3BIFA 5A0FA 3H8JA 3JPYA 5T8KC 3AC0A 1I2BA 4J4BA 2A58A 5KYWB 4EHFA 3AKZA 1BCSA 3QV1A 5IM4F 4YQYA 2ZCJA 2Q7XA 1QRSA 2NPFA 1BOOA 2IYQA 5KBYA 1KEEB 1PD1A 3CO5A 4H1UA 1T1IA 4WUVA 2EG9A 1HT3A 4R16A 3OOSA 4DSTA 5F7JA 1ZU5A 4EHIA 5JZSA 3I1FA 4KE9A 2FEKA 4MUIA 4ZCQA 1ND5A 3AVOA 5EGNA 2A30A 2GERA 2QROA 1CUVA 1TEVA 3VJRA 1XX6A 4ZOLF 1DELA 4M7WA 1TUBA 3KYDA 1UK6A 4FWBA 3FAZA 3U4DA 3A05A 1T9BA 3W5UA 3EX7C 4EQ6B 1COWA 3AJEA 1RJ9B 2QIPA 3PX7A 3CUYA 4ZQGA 4FJ1A 4D97A 4IWXA 1EFRD 3GGCA 1VE9A 2DUWA 3RUPA 4G0WA 1TI7A 3CVUA 5KYGA 1FDSA 3CJTA 3KVOA 2ZAIA 5BW6B 3GRYA 3T7TA 3QIVA 1YR9A 3EPRA 3GEBA 1P1KA 4W1PA 1JWLA 5BN5B 4BEBA 1PTKA 3D8NA 1WZIA 3ISJA 1U8FO 1Q0QA 1ZICA 2D5BA 2R1TB 4ZDIA 2VJBA 1BFDA 4G09A 4JVOA 4CGZA 2PGLA 1VJDA 4U9HS 4QTZA 5DIFA 5CG1A 3GROA 3SLKA 4D3YA 3SNHA 2OC9A 3ZWVA 3AR4A 4YJ3A 2NO4A 4N47A 3OZRA 1BN7A 5CH8A 1LVGA 4DNOA 4AW9A 2P77A 1OV4A 3TOVA 3GC6A 2JLWA 1R6XA 1AGYA 4PSAA 1PT9A 4KXQA 5KC9A 4TS9A 4F3RA 1F06A 3V1KA 2BCJQ 1J70A 4D5EA 4GKJB 4JITA 5EFOA 4DLSA 3CSUA 2X3UA 3ANLA 2G5TA 4N3NA 4ODIA 4RC9A 5JC1A 2RIRA 3IKJA 4Q66C 1T3GA 1FFYA 2AFHA 3UWOA 4WBXC 4KJZA 4RXMA 2E55A 4KXMA 3NYQA 4JJEA 2IX3A 1ND6A 2BPOA 2X5OA 5JXJA 3QFHA 2A7QA 1WXQA 5A4JA 2PH7A 3TSOA 1IQ0A 2I2AA 4TS1A 4HNUA 2A0XA 2QD1A 1X1EA 2OD9A 2ZJFA 1D2GA 4AG3A 3EVTA 3H4VA 4QM7A 4U8GA 4EGAA 1KO8A 3T52A 3KJIA 3PEUA 1ENOA 3GLHA 3RHSA 5DNUA 1IHOA 4TMKA 4WJLA 2FYTA 1SBCA 3FHJA 1S2NA 4BYGA 4JLJA 1P3DA 1Q22A 1XIVA 4KDFA 3RUAA 2PLNA 1Y1SA 2QN9A 3QFCA 4F9TA 3NDPA 2ZBDA 3V8MA 2QOEA 3NB0A 1A8IA 2EJBA 3GPIA 1NNI1 1BYIA 3D7SA 4M21A 2AEMA 2C1EA 4TXJA 3SXPA 4E3ZA 4EG1A 2HLPA 3ETCA 2MR5A 2WM9B 3NONA 4BECA 3MJDA 1OVGA 4QREA 1RWVA 1VSUA 4UU1A 5KCZA 1GQFA 3LW8A 3QLTA 1L5WA 2APJA 1WKBA 1E7SA 1N5JA 3CX8A 4WXPA 3B20A 3K2QA 2HA2A 3FNBA 3DDWA 3GY0A 4L57A 3RBVA 1K4MA 3UHJA 5C7IO 1TF7A 3K92A 2QLFA 3C6BA 3K1ZA 1CZNA 1QGUA 5LB4A 1HQCA 3TTWA 3B1JA 4DSZA 3ZVMA 2Q6LA 3B1FA 4I1OA 4TMXA 3SVZA 2YKGA 1JLKA 1JHUA 4LQ4A 4U6QA 4Y1RB 5CBKA 10MHA 2BDUA 4KFUA 5AVJA 4HNQA 4K9MA 4RZQA 1M8JA 3Q11A 1OAOC 1JJAA 2JDIA 4PLZA 4Y1GA 4B3JA 2PZAA 5F7OA 3IAHA 1Y3AA 4P3OA 2WYVA 3RS2A 3PQDA 2QMQA 1UKYA 3SQNA 1XK7A 4DNPA 2F1HA 2VN8A 1ZIPA 3GMTA 3ZWBA 1GV0A 1RMTA 4H0NA 4XLZA 1JAZA 1E7RA 1MU0A 5LUBA 3D59A 3A14A 4LYFA 4M89A 4OQ4A 4QAQA 2CMDA 3OOYA 2GZRA 1KP3A 1MC1A 4HQKA 1YDHA 5IPFA 3C43A 2GBGA 2QWXA 1RBYA 1O03A 1JS1X 2NO0A 2VG8A 3L06A 5SZIA 1XFDA 4I1SA 4HI0E 4PVCA 3VR5H 4DQUA 5JQGB 1AQLA 4GAEA 5J9FA 4BN0A 3A04A 3NBUA 4WK0B 4W9MC 5K4GA 1NVDA 1ZD1A 4QJ4A 1VJTA 2HA5A 2PKXA 2X8JB 3CHYA 3RRNA 1GTZA 1X9IA 2X2OA 3GD5A 4XASA 4A23A 2W6OA 2YNMA 3ZXSA 3DVRX 3SP1A 2OPBA 3B2EA 3CPJB 2NUPB 2NZ2A 4LYGA 3UANA 1RDFA 2COEA 2EDAA 1QP4A 2E5FA 1IOZA 1KAEA 5L4SA 1DADA 1AKRA 1L5VA 1FYXA 4HTFA 2IV2X 3L0DA 1GPYA 1I6WA 3ESDA 2JLQA 1KFJB 4X65B 1UM9B 5LLTA 4KLAA 3I2YX 2XGMA 2O7RA 1C9MA 2F3PA 4ENWA 2BBWA 5LJLA 1K1EA 3WLNA 1IY2A 1FXWF 3WDLA 4ZPXA 2GNPA 1RXYA 5AVVA 4DHEA 2J59A 3FUTA 3RJ5A 4J2HA 1IYZA 4N7BA 4Q4JB 5I7WA 2A3RA 2WU0A 4N9WA 4GQBA 4MRSA 1J5XA 4F1JA 3OY7A 3PFBA 2G36A 1XRNA 4UEOA 4Z99A 4EYOA 3V33A 1L7RA 3LSYA 3ZWAA 4DABA 3NHZA 5BYJA 3L7MA 3UNXA 3EB9A 3MT7A 1XTIA 1UMDA 3TTTA 5ICEA 1IIBA 4QECA 1Q1NA 1M34E 2K7ZA 2P65A 2IKQA 3H1BA 2QTNA 2IYUA 5E0OA 1QRRA 3FOEC 4IPTA 4EJSB 4CG3A 3M5WA 3IT3A 3UUGA 4NYJR 4BLPA 5JYEA 1D8AA 2IOFK 2X0JA 3ECCA 3GGSA 1GFIA 2A1IA 3RYFA 4DCPA 2OEPA 3VPDA 1I2DA 2JK1A 2WUVA 3P9ZA 1SQFA 4DRXA 5BMOA 1FUYB 3KR9A 3NBQA 2P9TA 3N75A 2ID7A 1UINA 4P58A 3BFVA 4DB2A 1HSZA 1QOPB 3PFGA 3T06B 1A98A 4NULA 1E2JA 5FWXB 1E9EA 3GLHB 1JQEA 1TVKB 1L7AA 1ZCJA 4IXTA 3WLFA 1ZSVA 2QUJA 1E2LA 3F8SA 2BMDA 5K9ZA 2B9VA 1X1AA 3KL4A 1JHOA 5ELMA 4B75A 3QOYA 4KNVA 4MUMA 1GGVA 1HE5A 3GLFA 3R7AA 2J32A 1XWFA 4PONA 2WIBA 4JL8A 3RUFA 1Z06A 3G2OA 3K0BA 3P9QA 2EVWX 1GFSA 1CLEA 3H2BA 3T3EA 4KRFA 1N7JA 3QFFA 2DR0A 3AEQB 2AMVA 3WHPA 1G8YA 2Q1WA 4Q15A 3TTUA 2ZAYA 1O96B 1SBYA 1HZZC 2PQ0A 2XE4A 1S2IA 3AV0B 1WSBA 1NMEA 1VLVA 1D2EA 2GM9A 3PUZA 4KE6A 1QLWA 2WABA 3TYXA 3KAKA 5FI3A 3W0LB 3ZY4A 4WNYA 4XUGB 5ENVA 5KYVA 2CL5A 1QZZA 1KZYC 2IY9A 3ZCTA 1KAHA 1U7TA 2IU6A 2XYVA 3OPYI 1CY6A 2AEJA 4OJQA 2PSDA 4OHMA 1GCOA 4BN4A 2CWDA 5M3BA 2CE2X 2PXCA 4AY6A 3HUDA 3FDFA 3V9PA 5DMHA 3JYOA 3EW9A 2DFTA 2Z2XA 5DGCA 2C31A 4RA9A 2ILTA 4XIIA 4UU0A 4P82A 4RFLA 1H66A 4FXOA 5ALZA 5ALLA 3WTBA 3ZGXA 3MCVA 3N0VA 3QVWA 3JALA 2SICE 3CZCA 4N7RA 4Q7JB 3V9AA 1IH8A 3I9OA 5IHXA 1CUWA 5CFOA 4F8JA 621PA 1NVMB 1PJSA 4PXAA 5HKAA 2M2IA 4RK0A 1FNMA 2JANA 2PKCA 2KMLA 5EE1A 3F0TA 1R8QA 3DBIA 3V1LA 1L1RA 1T4MA 2O8CA 4P4NA 5KJCA 2B69A 3BD6A 3S2IA 4GMHA 2BFBA 2JGKA 5BO5A 2N1BA 2WZQA 3R74A 3ZLUA 1UWLA 4X7PA 1OF1A 1TCBA 3LY5A 4HQNA 5FAKA 1A4RA 4QZVA 5IU6A 1NXQA 4GMKA 2JCVA 5AXDA 4BNVA 3GVPA 5AQEA 1T6BY 2PO5A 3C1TA 2XWPA 4JHXA 4YJKA 1B23P 3IO5A 5JAZA 4R1MA 4YRMA 2DPXA 3Q3VA 3A7DA 3DMFA 1SU7A 3TQRA 2JGAA 5KYWA 4LE2A 4EYKA 1F0NA 2BFDA 5EE9A 5F4ZA 1B0ZA 3ZW9A 1WBJB 1ZD2P 1VPWA 2YC4C 3GBPA 1RFLA 3IJ5A 3PXEA 5EWLA 1O4WA 5ERGB 2VHQA 4H3VA 2FFJA 5A71A 2DKNA 2VSQA 3LY9A 1R4MA 3Q7QA 3QWFA 1C0EA 4RPKA 3D3EA 1VQ1A 4NDNE 2D6FA 1WLSA 4YRLA 3F3MA 4JC5A 1DQYA 3RVDA 4F38A 2FUNB 1A1VA 4I2NA 2BEUB 1U8TA 4GWGA 1JWAB 4X84A 2X9GA 4CF6A 3AF2A 5A1JA 5K01A 2BTEA 4NFLA 4DF3A 1KEPA 3SKXA 4YYEA 1BJTA 1Q21A 1CNFA 1G20E 1T4BA 3KEGA 3EPPA 3JAMA 3VTKA 3IBSA 4MPPA 2OMKA 1GVNB 4R2IA 4AF6A 4TYYA 1QORA 4GLLA 2PSFA 2BSQA 1ML3A 2P8JA 2YIVX 2Q7DA 2UUBB 4CQJA 5DOVA 3RLFA 3ADOA 3BHJA 2VTKA 5EHZA 4U9UA 1S1CA 3ELDA 2RH8A 4FCCA 5FF9A 2WU8A 4K6OA 2PRJA 4KXUA 4URZR 3G79A 3S1AA 1ESZA 1H5UA 3M4XA 3OKFA 1A50B 4RORA 2DGDA 4IM7A 4IF6A 4J94A 1RRPA 4BO2A 2O2IA 5HEKA 1FLVA 1TTPB 2WG0A 2PCJA 2R0QC 4K0RA 3NC4A 1CWUA 3H5NA 3CZ4A 1N9ZA 1OBVA 3C3DA 5IJWA 4I6JA 2AMYA 3SOZA 5JO9A 4GR5A 1JWBB 3KPUA 1SQ0A 5DYNA 4CODB 2BCGY 4HMQA 1DAKA 4HHEA 4MRAA 1UWKA 3NIDB 4WVLA 2Y1LA 1TM1E 2FAXA 2GKGA 2CVFA 2B25A 4LHWA 4I4LA 3OPNA 3OZXA 1M8KA 1NJSA 3I28A 3KR0A 4PAOA 5JCJA 3QZUA 1ENZA 2V4ZA 1DEOA 4DEVA 3C3YA 3B6EA 3GN2A 3PQ4A 4MV7A 4LISA 3IIIA 1HYQA 2HCFA 5LZ5A 1MIOB 3ND7A 5KTSA 5EAIA 4MMYB 5ICSA 1THZA 1XP8A 1SMKA 4G5SA 4NZYA 4JP8A 3AU8A 4NNOA 3ZS9A 4EHAA 5HZMA 4GKBA 4K6GA 2QL9A 5F76A 4CDNA 4WZBA 2QBYA 2X5JO 3KEMA 4URVR 1EVYA 4MW2A 2C97A 3GRVA 1RKQA 1K8ZB 1T34A 1ZA2A 2PUJA 4JL6A 3VVCA 5FL3A 4Z4CA 4NCXA 5LPNA 2H4WA 2SHKA 1U2ZA 2E4VA 2Q7OE 1X70A 3T4EA 4ERNA 1W94A 5KOYA 2NAPA 1IHXA 1O95D 3KU1A 1G8AA 3QE3A 4ZGGA 2A9VA 3WB0A 2CVHA 7MHTA 4HWKA 4OMCA 4P6VF 3MGKA 3K70D 1YUMA 5AM4A 5CT5A 3DZDA 1C7EA 3PC6A 5LP6B 4XIFA 1QYCA 1UC4B 1H05A 1YASA 3EY9A 1R6VA 2HQ1A 2RAPA 3RFXA 4F6CA 2O19A 4P0QB 2FVYA 1KHTA 1QOZA 2FWIA 3JS5A 1BJKA 4PNHA 2DBZA 1RQ2A 3G5LA 1ZI9A 2OD7A 3QOFA 2WV7A 3R6DA 4G5FA 1JIIA 4IDAA 3QKRA 3KQKA 2FFBA 3GUHA 4OHKA 2LCQA 4EY8A 1EP9A 2NXCA 4B48A 5B4UA 4JLVA 1IMOA 3TNYA 1NAHA 2E5WA 4W6ZA 3BCSA 3BXGA 1SUEA 2VNAA 5GTDA 5C1BA 2XNKA 2FR8C 4RUKA 1KY2A 3FWKA 3PC4A 121PA 4C5CA 3WAGA 3KYJB 1ZGAA 2DPHA 4DILA 1Z6TA 1CF2O 1XEFA 5AK5A 1WXIA 3WYEA 3ZZTA 2HSEA 3GFTA 3SQWA 1J4AA 1M1ZA 3LLVA 4O0LA 4BB9A 2I91A 1R0BA 3I53A 2ZRMA 2QXTA 3LBAA 2OQVA 1RP1A 4G0YA 4KO4S 1TM4E 4B4VA 1X1RA 4JJ7A 2JHCA 4M9XA 4YRQA 5DKFA 3UF0A 3QBVA 1U7UA 2WHYA 1GAEO 3TB4A 4MYHA 1EAYA 4F3KA 2Z6QA 3JY6A 4A2QA 2AFIA 1J1IA 4N5LA 3WWEA 2IEZA 1U6IA 1RE1A 1F1JA 1ZD8A 1CUEA 3KLOA 2YJ5A 1V71A 3F78A 5AIAA 2E4YA 4KIUA 4EEZA 1KZ4A 1HNZB 3V4LA 4FEYA 1JEEA 4OXXA 1NAIA 4V0SA 4DY6A 3EDRA 5M29A 3IVRA 3PG5A 2HZ7A 3LMKA 4Q3KA 2IP2A 4UJ5A 8LDHA 1JLSA 5BYKA 4I46A 4HWGA 5DM70 1P1FA 1SM4A 5ARDA 4DA9A 5K4AA 1J6UA 2LCFA 5HS4A 1Y89A 3MVEA 2YXNA 3H87A 1UJBA 4D57A 4IHJB 4RKFA 5ADHA 1KMNA 1TADA 2X15A 3M1IA 1G8MA 1NU6A 4PHGA 1XO1A 3AMVA 3MBKA 3T1NA 3VZBA 1PQWA 5AHOA 4E46A 2O57A 2NTVA 1LW7A 2VPZA 5DM60 3HVUA 4W5NA 3N05A 1JGTA 2O52A 1S3IA 1QP7A 2V7GA 4D0NA 4Y9SA 5BOSA 4I55F 4JLKA 3PDIB 3V4OA 1G8JA 2EFYA 2VPWA 3V4FA 4B6FA 5EN4A 5K0EA 4N8DA 1ZJWA 3HHPA 1QIGA 3MLBA 3PLAE 4N3BA 4R84A 2ZT5A 2W90A 1I4WA 1KYVA 3VKFA 4BS9A 3ONVA 3JVUA 1F8UA 4AJ9A 3EG9B 3RWBA 1FUKA 1JPUA 2HIMA 3AR7A 1XJ0A 4G67A 1AM4D 2I80A 4RW0A 5AMXA 3AVUA 3JQBA 2C5GA 2D1TA 2QLMA 3MJRA 5E1BA 4ZT4A 2JJ2D 2ZSUA 4RH3A 3HBMA 4R69A 2ERXA 2PU7A 4GBMA 1RPNA 4NOKA 4KFRA 2JGMA 1UBLS 4U7TB 3GWZA 1BMFA 2MSWA 3IOMA 2QX4A 2HF8A 3D1VA 5FLKA 1Z5UA 4GP7A 1Y7LA 1ZOPA 1NHWA 2A0UA 2BN4A 2H4HA 1TPZA 3F9CA 1M1UA 3VHRA 1YSCA 4CIAA 2R1ZA 2C8LA 1EZZA 4IJMA 4XRGA 4QXQA 1UXGA 1DIOB 3QJYA 4YDHB 3AJRA 5FNVB 1CQIB 4UMVA 4F97A 1OH6A 4G5OA 4F4HA 2QDKA 1SOUA 3AF5A 3OWOA 4TV9F 2PR2A 3BD7A 1JDBC 1YOBA 2HRRA 3TD6A 3U31A 3X2EA 1E2EA 2GRAA 2G8LA 2CL6X 2V6JA 1M72A 3G49A 3KKNA 1VMKA 3KKQA 4JI2B 5FI1B 1KEKA 4QUGA 1G5RA 1WMBA 2XUZA 4J0FA 3WGKA 3OF2A 1BCRA 1U98A 2PUTA 2RKOA 2ZB8A 4KN9S 3UKOA 4BTEA 4EATA 2W6ID 4YAGA 1K97A 1Z4IA 3UJHA 1J97A 1Z0FA 3IBTA 2ZUDA 4KO3S 2PFGA 1SBNE 4RS3A 2IELA 1VJ5A 2LKDA 2CLKB 5BURA 4PBSA 1OASA 4YJGB 3TX6A 2F3RA 2EX0A 2XNHA 2IIBA 5EL0A 4XFJA 1NNEA 1JKMA 4RIEA 3D0QA 3QX3A 3TLKA 3WGUA 3QYFA 2QNIA 4NJMB 4I1UA 3R8CA 1UDXA 2G0TA 1V26A 2CDAA 4GSLA 2V6FA 1Q16A 3F6RA 3L4SO 4K2AA 4LXIA 1U4OA 3ZNOA 4DGSA 1JHAA 4D6PA 4CTNA 1SKMA 3HLKA 3AF6A 4FKMA 4R01A 4DMMA 3B1ZA 1DFIA 1U0GA 1MO3A 2ZLBA 1M2FA 2Y1WA 1DQNA 3NDIA 4J7CA 4E09A 4OB7A 2PFKA 3ESQA 3L4KA 4CV2A 4TTJA 2A9KA 3DO5A 2P0YA 4XGIA 4FINA 5F98A 1IB0A 2FOLA 2DPLA 1QIHA 2CXPA 4A1FA 1E3TA 1X1QA 4Z7NB 4F2PA 2YDXA 4WPGA 4EKGA 1EM6A 4FWIB 3DZHA 2AS0A 2ZR0A 2PXAA 4RZSA 3L6EA 4BZWA 4U39A 3N2KA 1WPGA 1JQJC 3BRQA 2AL7A 4U7FA 1VB5A 2ID9A 3B1XA 3UB2A 4O5AA 2WJPA 1G291 4UUOA 2OUIA 5CCXA 4KXWA 1BW9B 2PDAA 2W83A 4YONB 5B12A 4XM1A 5ETJA 3F97A 5GJVC 4ZXFA 3W2IA 4OK3A 3PFCA 1UWVA 4YAFA 4PQFA 3T1OA 3NBYC 1L7EA 2QAIA 1UMDB 3PCXA 4II3A 2HSGA 1CBUA 2WV9A 2WQ7A 1LUAA 3A1CA 3NASA 3OJLA 5KU7A 2FPPA 4BZQA 5J4VA 2R5NA 2X2PA 4IIGA 2F3UA 1Y5NA 3LPNA 4L6CA 2FI1A 2VFAA 1SXPA 4JUIA 1NW8A 1U80A 1ZL2A 2PD6A 3LC1O 3WIEA 1JYSA 2P4HX 3EEBA 1PHPA 4CQMD 2DFLA 4FGUA 5IFLA 4V39A 4RABA 2ZBEA 3HACA 4XAQA 1S7GA 1T0IA 5F5XA 1YFKA 1Q7EA 1U0BB 4ND1A 1U99A 4EYEA 1H0SA 2C7VA 3S2EA 4C2BA 5C51B 1HXHA 2VHWA 2O2SA 3WRVA 1IM8A 1MO6A 1RLIA 4Q4HB 5H7XA 2PS0A 3AH8A 3CNBA 3EC2A 3M70A 3WQSB 5G41A 3SIWA 3IESA 3O47A 5F78A 1ILEA 4D6YA 4GWKA 3OWHA 4Q9LA 4P81A 2SNIE 4IG9A 5IDYA 1VTKA 1P9OA 3DFFA 3W6NA 5HZHA 4IMRA 2QYHA 1RQPA 2AJBA 1FNCA 5TS3A 2W98A 1GQRA 2F3SA 3I8SA 5IF9A 1EIWA 4BVAA 2EJTA 3F7NA 5T8KA 1KF0A 3DV9A 3VO1A 2O8BB 1YD7A 2WSBA 2BRUC 2DQ4A 1P73A 4UD2A 5I9SA 1U3FA 4BFCA 2LIPA 1L3BA 3IP6A 3EWAA 5DEOA 1A8UA 3A58B 4J91A 3U80A 3UJ7A 4ECEA 2YMLA 2UZ0A 3E9YA 3UICA 3QIAA 5HMMA 3V8QA 3U3OA 4AJHA 3VVLA 3FZNA 4WCVA 4RX1A 2PKWA 2ZRFA 2FZGA 2VF7A 4BZXA 1C9EA 4WI1A 5CEEA 3QPWA 3M5CA 2YMPA 5LP6C 3OU7A 3WK6A 1AQIA 1W4CA 2SCUA 2D4AA 2WWHA 4NJOA 4H1WA 1FZTA 1C3JA 2SBTA 3BMCA 5JSZB 2J5RA 3TRDA 3IV7A 5LA6A 5TMEA 3B6ZA 1E2BA 1QFJA 3D3JA 4QDXA 2WG2A 2C83A 3NVMB 4YA6A 1LKZA 2Q6IA 4Y2TA 1XMJA 3LY7A 1DJNA 3ZDXB 4ZGBA 7YASA 5E6UB 1QH9A 1IJKA 1OI7A 4BYMA 1RM5A 2X1MA 4EUNA 5CFQA 3QPCA 3RRZA 5CYFA 3RF7A 4J3JA 1DX9A 3TLAA 1AKNA 4ND8B 4X8HA 4HNAA 3BWMA 2B78A 3LLCA 1CZOA 2FMFA 3MMXA 5B7NA 4I50B 4UDXX 2IPXA 3WB2A 3K1JA 1L1FA 2QNRA 2NLOA 1TJ4A 2Z2ZA 4D96A 3IB3A 3RUEA 2QPOA 5CXQA 2ZVJA 3ONWA 1O5OA 3DL4A 4KX3A 4TL6A 4ZAYA 4G8DA 4IWNA 5GZ6A 1QZTA 5HHTA 1SCQA 2QG6A 3O7WA 3PX3A 4Y2XA 3CT6A 4KH1A 4MGEA 1U3TA 3JQCA 3H5WA 3VYSB 4HGOA 1P6QA 1SU6A 1S3GA 2BONA 5JCPA 2J3MA 2P2NA 3LXMA 1G41A 3VSBA 1GTVA 3DTVB 3T8YA 1Z4MA 2QORA 1HX7A 4WLNA 1KSJA 2OCLA 1MQAA 3VH2A 3UYLA 1TYEB 4P22A 3WAJA 4ACBA 4CG2A 1ACMA 4HNTA 1EI9A 3ZVNA 4M4SA 3JYNA 1HDIA 2ASVA 4JOQA 2ZWVA 2R9VA 4ZGWA 1L6RA 1NL3A 4DXDA 1Q0TA 4C7MA 2IOFA 4D4MA 4NVRA 4IX9A 5KNDD 4MIKA 3D3WB 5DNYB 4GPZA 4H7PA 4P7GA 1D9ZA 2YYAA 2ODPA 3OETA 2IF2A 1VMAA 5AXAA 4GQAA 3RYFB 3NIGB 5IANA 1ZD9A 3TTSA 3THSA 4D5GA 1XTRA 4PX5A 1NLZA 2W6JD 3DWIA 3CEPB 1IPEA 2C2BA 4BP9A 4Y1RA 2QTVA 1EPUA 1JEJA 1C14A 2EKPA 1JDTA 2QK4A 2X14A 4OU5A 2BTQB 4GU5A 4PC3A 4PGFA 4UUNA 1G0OA 5FR2A 3ZEAA 4KPYA 1RWBA 2C2WA 2CNBA 5LQMA 4KODA 3B5JA 2C03A 4ISBA 3PUWA 1V7CA 2VJNA 1W29A 3GO4A 4GOJA 4C6TB 3RTGA 4CKCB 5HQTA 3AJ9A 5D7BA 5BT8A 2XXAA 4LSMA 1OH7A 1V25A 3NBXX 4WCFC 4HPWA 3M4ZA 1R16A 1C1HA 3EEQA 2OFXA 4ZT6A 1R6TA 1V8DA 1M1YB 4L4ZA 3SQLA 1H1DA 2WB4A 1PFYA 2VKQA 1IK6A 2OFPA 3TQQA 3KQUA 1W1IA 3FYSA 4KTTE 2B4TO 2OXCA 3D3WA 2O2DA 3FDIA 4NHOA 1EVIA 1KNQA 5TXGA 1JAIA 5CHYA 3RW9A 4D99A 1IEXA 4R6WA 3JYHA 5DI3B 1D4FA 1DBQA 5K6AC 2C92A 4GZ6A 4C4TA 2VUIB 1H65A 2D0PB 2GLXA 3F4LA 4CCWA 3LPMA 3FZGA 4EO9A 5CTAA 4UTVA 4BJ6A 1U9IA 1JAHA 4BQNA 4BWGA 5JSFA 3MXTA 3HU1A 4RZIA 1XTKA 4G9EA 4DT1B 3CEAA 4MO9A 5IUJC 1IN8A 4CLRB 5EEHA 1KK2A 4CTMA 5M34A 1CP2A 3HKEB 3M5PA 4IZOA 4CMEC 4YXFA 5EIWA 2Q21A 2Q5FA 4TTAA 1RAIA 2EJVA 4I5IA 4BE9A 4XB1A 4OATA 3G2QA 2OM6A 3IVGA 3NM4A 1PR0A 3OEHD 3OTQA 4Y9UA 1NQ5A 3PNLA 1A8PA 3WGOA 1N0WA 3IGFA 3UZUA 4IYJA 2G83A 4EPYA 1XTVA 3O83A 5REQB 5KVQA 1Z38A 2FSUA 2Q4OA 1MXHA 4R0MA 4PCAA 1T9GS 2FPIB 1QTIA 4E1BA 8GPBA 2DU8A 1RC8A 3DNMA 3QVGA 4CTJA 2XBLA 4L8WB 5DIZA 4HVLA 1TYBE 1JEDA 1L8XA 1U63A 4JP2A 3BJEA 4X95A 1VM6A 2HKIA 3A6HA 2AJDA 4H15A 4NU6A 2Q5JA 4UM9B 3HLYA 2ZRBA 3J7AC 2IGBA 1NDQA 4EJSA 1UZAA 1XZBA 2RHGB 4GXNA 1FIUA 1EQAA 3S8EA 4LXYA 1MRSA 3BBPA 2OYCA 3KU4A 1RWKA 4BY9E 4TLMB 4Q1DA 4BBZA 2D3WA 3R3HA 1GNTA 4HQFA 4RTOA 2PVCA 3CNQS 3KOWA 3F5QA 4LI3X 4B6EA 3WBBA 2ZUUA 1QB8A 2B98A 2RCYA 3D5QA 2GBCA 3F9RA 3NHLA 3ZWKA 4EBBA 5KOJB 1TIBA 3AHJA 3AFGA 4NOMA 4QEDA 4WN9A 4XM0A 4KK4A 3PGKA 4BKPA 5M2QA 4YRJA 4U8HA 3P5BA 4WXRA 4G0XA 5ISMA 1M9NA 1DRKA 2YOFA 3AHEA 1ADGA 1F8XA 2E49A 1PRYA 5CB8A 5HNKA 1ULZA 5AW5A 4PQEA 4CV3A 3B70A 4BVKA 3RBZA 4ZZIA 4KI7A 2C9DA 2V98A 2V54A 2Q3LA 1NP6A 3QU9A 4U2KA 4HZGA 3LNTA 4DUPA 1MDFA 3IP8A 4YJDA 4HPXB 3MC1A 1EVJA 3PHCA 3P9SA 3TXAA 4AJOA 4D74A 2IBSA 4BVEA 2ADMA 3ZCUA 1AKWA 2OHXA 1TCUA 4H7HA 2OLJA 4MRPA 1N78A 3CVYA 1SU8A 2DECA 3PQEA 1RLOA 4C0JA 2GHRA 2HK9A 3DFIA 4JKYA 4RMNA 3N7UA 1XP5A 3N5KA 3QMWA 1KQGA 1W59A 1YULA 4OUDA 1JSZA 1F9AA 4DT1A 3AONB 2J3DA 3MLEA 1ISJA 1YUBA 4FQ5A 1BDJA 1WDLA 4Z9FA 4X6YA 4GOKA 4D8YA 5FUBA 4M8LA 1N1GA 5CPBA 4G26A 2RHLA 1SXJD 3PBKA 4P5DA 3GRFA 4RH0A 5AVXA 3MHTA 5DBGA 1G6Q1 4ND3A 4ZDKA 4N39A 3CJRA 5FKJA 2C98A 4GS5A 1H85A 1VLLA 1HG1A 1NPYA 2R6DA 2BEJA 4O2RA 3HBAA 3C6MA 5CH3A 4I08A 4BGDA 1FSZA 4HD8A 1KYQA 3H5VA 1RIFA 3RNLA 4Q16A 4B87A 4D9FA 5A3QA 4C30A 2H1IA 2V8BA 1W0JD 2QLTA 1EEXB 2WMYA 4DLTA 1UH5A 2XUGA 3D7NA 4KOEC 3HDQA 1L0BA 1C81A 2WAOA 3EVFA 2RE8A 4XYMA 3GP8A 3LF1A 4FGKA 1YE3A 1PQUA 3K6RA 1Y0BA 1KMIY 2G40A 2WM8A 2JI6A 4ARBA 1QVAA 2Y68A 1T9GR 1B76A 5TGTA 1LDYA 3TEFA 3NC1C 1K6EA 1XCGB 2ATIA 2LVBA 3O9MA 1U9CA 3F47A 4NY1A 4X8LA 5CLHA 1ILWA 4OHFA 3UJPA 4EX7A 4ARZB 1QYWA 3L0SA 4DCJA 2XE6A 3ETNA 4F5ZA 2O2ZA 2OLEA 4I5DA 3MMZA 4B79A 4DIEA 4JEIA 4AQDA 3B53X 3CZQA 2OZLB 2K87A 2IYZA 2NO7A 3A6DA 4LAFA 5HWSA 3M4NA 3K96A 1PVOA 1DJOA 2VYCA 4OP1A 4RENA 4X3CA 4KFSA 1GRCA 5CNIA 1DCTA 5REQA 3N59A 1JU4A 1E3QA 2JIRA 4HOYA 3CN9A 3R5JA 4OK6A 1XCBA 2P9QA 4HDNA 4Y98A 5L95A 3KHTA 5FTJA 2GYUA 4KYVA 3TQIA 2W71A 3LXXA 3D7LA 3D8UA 1JECA 1QO0A 2PA0A 1WLYA 5JJBA 2CJFA 3OICA 3ST7A 4GXTA 4UPEA 1AV6A 3CTMA 3L0YA 4AROA 2OUKA 5B7QA 1ZOSA 2NYVA 3UCEA 4JN6B 3ZJ5A 7REQB 1GQYA 3EQ6A 3TMKA 2IC5A 2AG0A 1CHNA 2ANBA 2Y6UA 4ZP1A 3HBNA 4L74A 1E9SA 2FFQA 2Z98A 4JODA 3M6IA 1WDMA 4MWTA 1G1MA 3PA8A 3H2SA 1Q1GA 3JSXA 4NNPA 1IUKA 2Y2VA 1SUBA 3WL5A 2C0CA 4DYVA 1K27A 4WE3A 4MV8A 1U2TA 2WFZA 3TINA 1KFCB 4LX0A 3R5XA 4A9AA 4FXPA 2Q1TA 2ZZNA 2C3MA 3NWJA 1I33A 1KIAA 2XSZA 3Q3HA 5E6UA 4M0KA 4B3XA 4DJFC 4C03A 3BK2A 4DR6B 4CL8A 5JXIA 2OGZA 2X40A 1W2HA 4A3SA 2HNAA 3E0QA 3F1KA 2I7VA 3RAEC 1TJYA 4Z9BA 2GFQA 1L5GB 4RF2A 2IEYA 2J9YB 1EUYA 4UZEA 4DTCA 2PVPA 4RK5A 3NHJA 1W88B 1XNHA 4W7HA 1JZQA 2YWXA 4M0EA 4U6NA 3A6KA 3TBFA 4D41A 4DPMA 1WX1A 4RMHA 4D8UA 2C9YA 1REQA 4S2EA 4DLLA 4EECA 1JQBA 3UAYA 1AG9A 1PL7A 3ILSA 1CR0A 3F9IA 1H8EA 2ZYHA 4H6PA 1EK1A 3QA9A 5ITZA 5D2CA 1FFCA 2AC7A 2YHUA 4ZPJA 4NEQA 4RTJA 4ZYWA 4UMEA 1HC7A 4LJ5A 3Q9LA 4O4LF 4W4TA 4TWZA 3HA7A 4M0CA 4NFSA 1SG0A 1DZ3A 1NVWQ 3KFXA 4MHOA 2ZBVA 4TLEA 3VVMA 3PB3A 4ETMA 4CIWA 2OXEA 1Y3BE 3TUIC 4DLPA 5IYZA 5LWQA 2IUTA 3NU1A 1I3OA 2Q45A 1ADBA 5GOTA 2CYAA 3VH1A 1A2KC 4LRQA 4YMUA 1P2GA 1RPAA 4MUFA 2GEFA 1UJ4A 2JAWA 4MW1A 5ALSA 2ZRKA 3EZ9A 4RS4A 1A7KA 3TTYA 3UT6A 4NJEA 1N2CA 1X2EA 1LTHR 1X7HA 2KQUA 4YT4A 3QVJA 1IN5A 4HRXA 4MS1B 1H9CA 1DAIA 4OA8A 4RGVA 1MABB 4QWMA 4CEHA 4JXJA 4I9NA 1YZUA 4C4XA 4WY5A 6ADHA 2D5IA 1SELA 1YRAA 3VC2A 3H2IA 3BILA 3K09A 1PK9A 4QO7A 3I01M 1F60A 4DCNA 1EFTA 1Q77A 1KRHA 3SFTA 2XJ4A 2GK3A 3IQWA 3F8WA 5A3VA 3WI7A 1ESEA 4DDMA 5B2EA 2VBFA 3OE5A 4IWYA 2P8SA 1IQPA 2DUJA 4XQEA 3T7SA 4C05A 2AR9A 5EHXA 5IT0A 3ZWMA 3CC8A 2VPQA 4CMIB 3BH7A 1W73A 4P32A 4US2R 5I8PA 4C6HA 1C3OB 4KQFA 2VR1A 1B6GA 4QHSA 2HBYA 3OZDA 4KQXA 4P08A 5D84A 5F1OA 4HQ6A 5J59A 2BDTA 3TDKA 2VPPA 2I03A 2CBXA 4TWRA 1Z4OA 2VRNA 1UZNA 3B6IA 5AJUA 5A4FS 4QYMA 4BB6A 3H83A 4HNHA 4Y6GB 3Q8KA 4B3TB 1VMDA 2OKCA 1DFHA 3ZDDA 1E9DA 1CZUA 2IHNA 2CNLA 2WUGA 2WMDA 3DKPA 3FBGA 2OQRA 2POQX 3ZXYA 2O2HA 5LYJF 5EMNA 2UVPA 1Q57A 3GU3A 1AA6A 4H1HA 5L3QA 3ETEA 3B89A 3QNUA 1ZHOA 1PV2A 2R7MA 3Q3GE 2CLEB 1G4UR 2W0SA 4FK8A 4KR0A 4PLHA 4Q1AA 1KMHA 5LNK6 2BBSA 1T1SA 1MXFA 2EKDA 2UUPA 1W49A 4XYBA 1FQOA 4J16C 4AO8A 1ID1A 3TZBA 5I9BA 3AKYA 3QLEA 1SJ9A 4L9RA 1ETHA 4UHBA 5BRJA 4FPXA 3HI6A 1R3UA 1ZFNA 2XUJA 1ONOA 2GARA 3MWLA 3FCOA 3V6MA 5AVSA 1CKEA 1WHTB 3S7TA 4R2KA 5AKLA 3VFDA 4OH1A 3N87A 1SCBA 1XI2A 2ZB2A 3WWYA 5IYZB 1QDEA 1QRDA 2R8XA 5BWNA 1QUFA 4DWOA 4OTZA 2TMYA 4R4JA 4LPKA 5F9FA 3GLFB 3DBLB 2FG5A 2EJUA 3I32A 3WGJA 1QVZA