2IYZA

Shikimate kinase from mycobacterium tuberculosis in complex with shikimate-3-phosphate and adp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
169
structure length
168
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRNPGAVVRHILSRLQVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
pubmed doi rcsb
molecule keywords SHIKIMATE KINASE
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 60
structure length 168
sequence length 169
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iyzA00
5FUWA 2ZSFA 1YZQA 3SC3A 3EW9A 1TQDA 1XRJA 3I8XA 4MRPA 2O8CB 5FH9A 5DHAA 5C18A 2ZI9A 2FH5B 2WSSD 3ZYCA 1CXZA 4KITB 3RS0A 2NPFA 3BWDD 4DCVA 1ZUNB 1GILA 1XXHA 2E1RA 4F91B 3O8RA 1TL7C 1UEJA 2XEXA 2YJTD 3AKDA 1KI6A 5DI3A 4EPXA 4DWJA 1GG2A 4V0MA 4FMDB 3A1VA 1GRQA 1R10A 4DLSA 2O0HA 1LF5A 3CNOA 2RCNA 5L8VA 3PUVA 1M7HA 3BK7A 4IVRA 3RS4A 2WIAA 2W0MA 4DLUA 2F1JA 3FOZA 2OXRA 5C4GB 4DBLC 2QAGC 4JLOA 4DB4A 3WY9A 1SGWA 2F1RA 1SVSA 3NBZC 4HEJA 3L8YA 3IBGA 2PX3A 2QMOA 1NF3A 2PBRA 1JPNA 2ORWA 4LYAA 4XTCS 4HAZA 3U3KA 4QC2A 5H1YA 1UDXA 3BFXA 3QXCA 4V0NA 1E0KA 1L4YA 3H1TA 2ODNA 3JZAA 3A4NA 4FWIB 2D4HA 4B2IA 3UWOA 5G3ZA 1GKUB 4YXWD 4Q7MB 2O5VA 5IHPA 4US0R 1QHXA 2A3RA 3SYLA 4MGKR 1AGPA 2ANBA 1GRNA 3P27A 1G4AE 2C5LA 3CPEA 3CZQA 4RY2A 1DAHA 4UQOA 2UKDA 2GA8A 2IHBA 3RWMB 4OQFA 4BLOA 4PX9A 3B1WA 3UIEA 3VTKA 1M74A 2IC5A 2ZSDA 3GLFA 4PC2A 2ZETA 3WNBA 3AVYA 2J1LA 5JBQA 5DH9A 1E1RD 5FI0B 1SKYB 1E0SA 2G6BA 1ZAKA 2NIPA 2ERXA 2J59A 5AWFC 3MSXA 1CIPA 1NMXA 1S1MA 1W2HA 4OHVA 3EA0A 1X8LA 5SZJA 4ESHA 1KDRA 3AF3A 4XWKA 1PJRA 4ARZB 3GLIA 3QKRB 4YLGA 2ECKA 3TUIC 2ZR0A 3WBKA 2ZYUX 2J0QA 4JLPA 1AA9A 4M8NE 4HAUA 2GKSA 3PIRA 2O8DB 2IYXA 2V1UA 3FMFA 3K8YA 1CKEA 2W0SA 1RRGA 2J7PA 1AZSC 3FDIA 5GVSA 1OJLA 5GJBA 3VKWA 2RGDA 4LYFA 4W5JA 1H65A 2FGJA 1GKIA 2GZDA 4D2IA 1ZNZA 4P4SB 1E9FA 3LW8A 4B76A 1JAIA 4CF7A 2GEVA 1WDTA 1DG1G 2GETA 1JI0A 2DY1A 2WWWA 4LYJA 2YC2C 1TAGA 3K0AB 1OPXA 4US2R 4Q4HA 5F98A 2JJ1A 2JLVA 1LV7A 3AVOA 1SHZA 4RD2A 2L0XA 2JJ2D 4ZDWA 4B43A 2C9OA 3AP3A 1N6PA 3CW2A 4IOKA 3KL4A 4B71A 3TIFA 1MABA 5BWMA 4UNPA 2DBYA 4CZ2A 4OKSA 4O2RA 1E2FA 4OK3A 2IYLD 3GJ4A 1N6KA 5K8LA 2JIZA 1W2GA 2C8VA 2NG1A 2I4IA 4JMPA 4R2HA 3TQCA 3VU9B 3W5JA 3LX8A 4BASA 3ADDA 1T3LA 4BLSA 1P9RA 2OE2A 1CLUA 4Q4LA 1FTNA 1R0ZA 2BOVA 2FFQA 3BH7A 3IQXA 2X77A 2ZUCA 5AJYA 2IYRA 1DAGA 3GEIA 1AKYA 1OH7A 5JEDA 2WJIA 3PEUA 1SVKA 4FINA 4ASUA 1G5RA 1TTTA 4YXWA 4PTLA 421PA 1NBME 4A6PA 1EWQA 4AC9A 4OHZA 2KWIA 4CEIB 3EPJA 2CXXA 4A0GA 2PLRA 4UXJA 1T5LA 1GM5A 2HCJB 2OLJA 2C95A 2ZANA 3W34A 3QKTA 4NMMA 1J99A 4E07A 2WM9B 1G64A 4KYIB 4UNQA 2F6RA 2QBYB 2ZS7A 3LD9A 2O8BB 3CRQA 1ZC4A 3CONA 1DVRA 1E1RA 3L0OA 4Z8YA 5GJCA 4Q48A 1P7CA 5CM8B 1MOZA 3CRW1 3IDQA 3LVRE 3UMSA 3PITA 4AURA 2X19A 1W36B 3C41J 1KO7A 3GFTA 2O0JA 3E2IA 1D5CA 3QE0A 1W5SA 2WZQA 2BEKA 3FMOB 3LWNA 2OV2A 2AR7A 4DIEA 1R0YA 2N46A 4Q5IA 3W6NA 2ODBA 1XXHB 4K8OA 4QXAA 3A37A 2GZHA 3BB1A 1IY1A 4D82A 1K6MA 1PLJA 1KI6B 5DI3B 4E09A 2JAQA 1G7TA 1US8A 5FTMA 1R0XA 4C0JA 3AVPA 3RSLA 2QE7D 2GJ9A 4R7ZA 3AV0B 3Q9LA 2D7DA 5CIQA 4U02A 3T5DA 1MO4A 1V43A 3ADKA 4HLUA 2QEQA 1E2IA 5LB2A 2ONKA 2PX0A 2QPOA 3EZ7A 1MT0A 2R6AA 2RGCA 3WHLA 2ZU0C 3A1UA 3O8CA 1IAQA 3IO3A 1JR6A 4QRHA 5C46F 4MDEA 5KSYA 1RJ9B 5EP1A 5B30A 2DWOA 1UBGA 1HA3A 4PPFA 3L82B 4D6PA 4DEYA 4C7OA 4BLPA 5JJLA 1JEDA 2CK3D 2QM7A 1ZIOA 2Z83A 4QFMA 1XCGB 1ZYUA 2C03A 3DPUA 3QPVA 5E95A 3PEVA 5FBRB 1U8ZA 3BC1A 2ONJA 3GLGE 2GTPA 5FOVA 2VO1A 3T15A 4L9WA 1OE0A 4IDOA 2C77A 1KTVA 3SR0A 1FQJA 5A0FA 4DSNA 1QHNA 5KNDA 5E7MA 2CCKA 2OCAA 1OXTA 2GEDA 3B1ZA 3PCRB 1Z0AA 3B5JA 4PZYA 1JXMA 3MWLA 1N5LA 1X86B 3LXXA 5AJZA 4JBYA 4AKEA 1KY2A 2ZRHA 1XEWY 3IEUA 3QXXA 4RZXA 3GLFB 2FSHA 1KI2A 3FFAA 2HYDA 3VR6A 5FBLB 2EQBA 3KUCA 3ONWA 4Q18A 1E2PA 2IYQA 3GCGA 3R7WB 3EPKA 2CNWD 1YZUA 3FYHA 4G1UC 3TLXA 3U3RA 3Q5EA 2VH5R 3CX8A 2REOA 2AWNA 2OESA 4YDSA 1XBTA 5HE8A 3TE6A 1VG9B 3NKVA 3KKMA 4BLRA 1G8FA 5J4KA 3UMFA 2Z4RA 3W8RA 3ZLJA 4URWR 3OESA 1EX7A 1OH8A 4D4JA 2X2FA 2V7QD 3CH4B 4NCJA 4IDPA 1WRBA 2E87A 1P9NA 2QGNA 2F55A 3P1JA 4PZZA 5B2ZA 3M1IA 5DO9A 4TWZA 4N0EA 3NVAA 1D2EA 1EX6A 1U99A 1GKYA 4MKGA 5FI1B 1U9IA 4DT1A 3UPUA 5FBWB 5EP3A 5HKKD 4UNNA 1UDWA 5LD2B 4FW9A 4ZDJA 1AQUA 5FOXA 1XMSA 4Q4HB 1CTQA 2IWHA 2XNSA 4OK6A 3ZZ0A 5TMPA 3QY0A 2QE7A 2KB0A 4O2LA 1A5TA 3RHFA 1GVNB 2F7SA 4F4IA 3OE7D 1D2MA 3GJ3A 1CS4C 2AX4A 3S1AA 1QDEA 5DYIA 1LS1A 3VX4A 1MABB 5KHOC 4HDOB 3GP8A 1G6HA 2V1XA 2C2HA 2BCGY 2QQEA 4NTZA 1BYUA 5JWRA 1KI8A 1TF5A 2CHQA 5EXTA 4ZDIA 4B35A 5L3SA 2XGJA 2MSDB 4KVGA 2W6ID 3AKEA 4DLRA 1GTVA 4PR0A 2FEMA 1WP9A 1Q1BA 3NHAA 5CB6A 3AVTA 3TH5A 3AVQA 2CK3A 1NJGA 3LH5A 1N6LA 5DN6D 2XAUA 4CVNA 4Z51A 2ZR9A 4A0HA 2AL7A 3FKSD 1C1YA 1VKJA 2AHOA 4LBVA 1RVDA 5FOSA 2XXAB 1YRBA 2ZRMA 2FF7A 4TMTA 3ZD6A 2VHUA 1N0VC 5J47A 1N0WA 1RYHA 4XVQA 4QGAA 1YU9A 1CRQA 2KBFA 2WOOA 3NH9A 2IUUA 2NO6A 2IYUA 3LFUA 3U7EB 5CYOA 5BYKA 1TF2A 4R9UC 4G01B 5CYPA 1P2VA 4ZO4A 1GITA 1PUIA 3ZQJA 4MQBA 4ITRC 4TSFD 4IOLA 4JLJA 3L8ZA 4L15A 3TKLA 3O47A 4GPTA 4XH9B 2VTKA 1NG1A 3N5CA 5IK2A 5AJVB 2ZIAA 2WBLC 4JJKA 2CNWA 4L16A 1RRCA 2GEUA 5TDHA 1HV8A 2AK2A 3C4JA 1KO5A 1JALA 2B7BA 2P6UA 2R6FA 4MUAA 2F1HA 3WMGA 721PA 4X8LA 3Q3JB 2RGEA 3A1SA 1DAFA 3GEHA 4LPSA 5KOYA 3IQWA 2IHYA 2ZRPA 3EC2A 4C0BA 2V7QA 1Z07A 2QROA 1U98A 1FX0A 2YOFA 4JLDA 5FR1A 4F4JA 1US8B 3RS2A 1KO4A 1FUKA 4AD8A 6Q21A 2RB4A 1HTWA 1KK3A 2RKOA 3D8BA 3P4YA 4IDNA 4BFWA 3EXAA 1Z22A 3N70A 1O87A 3I92A 2IXEA 3KUDA 5FBVB 2QM8A 3AB3A 5AJWA 3I61A 1Z6AA 5HKKA 2VLIA 2YHSA 4DDWA 2OBLA 8OHMA 5EZ6B 1GOTA 1OFHA 1R2QA 1FZQA 3CUEF 1S2MA 2AN9A 2PL3A 3AGQA 3HYTA 4BWYA 5JCZA 2Z4SA 2QI9C 3CRVA 1AM4D 2A5DA 3BOSA 3P4XA 3RC3A 3RC8A 4TZ0A 2ZRIA 3FHTA 1SVOA 2LKDA 4KLNA 2I1QA 2HYIC 2VSXA 3V00A 2ZS9A 3BERA 2J46A 3A1WA 1UEIA 4C7OB 3F3YA 3ZVNA 3QIAA 2BM1A 2VP6A 1M6NA 3B1VA 1T91A 4NP6A 4A92A 1Q22A 1UBFA 1NMZA 1KZGB 2JJ8A 2W6IA 4XSGA 2ZRJA 3A58B 3TNFA 2Z43A 2QNRA 1NJFA 5C1BA 3Q72A 5FTKA 5P21A 621PA 1CR1A 3IIKA 5HPYB 4I99A 1QZXA 5DN6A 2PEYA 1Z6XA 2GZAA 1OFTA 4JLNA 4A4DA 1MO5A 4TYYA 2QAGA 4A82A 4RD3A 4LC1A 1QVRA 2G3YA 5C4MA 3NC0C 2NGRA 3GLHE 2ZXUA 4PAMA 2UZIR 2P67A 3D3QA 5AUNB 5AUOB 2FX3A 3BJIC 1G3QA 4P33A 4EAQA 3I72A 2NZJA 4TMZA 3KB1A 1KI7A 5EUMA 3Q85A 2ZE6A 2YWGA 3AVUA 5DYGA 2PT5A 4DLYA 1P60A 1VCNA 3CM0A 4N0DA 3RNLA 2V8OA 4TSFA 4W5WA 3R9XA 1P5ZB 2IF2A 2QN6A 1ZP6A 1T0JB 4M9ZA 5L3QA 4LRWA 2XZOA 1KJYA 3W6OA 4DSUA 4U00A 3PUYA 4NU0A 1W36D 3AUYA 1OYWA 2WWGA 5EP4A 3HDTA 3FHOA 1V5WA 4BLTA 1UKZA 4KCGA 4CW7A 1DELA 1KOFA 2BJWA 2PJZA 4JYBA 3ECCA 3QKRA 4JL5A 2ZJZA 2IT1A 1XPRA 2JLUA 4F4CA 4Q9LA 1WE2A 2CHGA 3DMDA 3Q8XB 1Q0UA 1TUIA 2QT1A 2O8DA 4F92B 1N5KA 5J4LA 1F5NA 4I1SA 4EPVA 2VP9A 3SBEA 2H7VA 2ZAMA 3TUZC 4Q03A 1ZW6A 2JLXA 4WVFA 1JR3E 4LPKA 2QG6A 3C8UA 2DFKB 2ZVPX 1NLFA 2AK3A 1BMFD 3OIVA 3S1AB 3MG9A 4NKRA 1E69A 3NG1A 5BN3A 1A2BA 3A1TA 2MSCB 5GADl 1UADA 4LV8B 1G3MA 2WWYA 1XEFA 5L3SB 1WB9A 3RAPR 2ZSAA 1XCPA 3T12A 1D9XA 1N6RA 2GBLC 2OFWA 4QBHA 1KKLA 2JLYA 1ZD8A 2GRJA 1RC8A 1W48A 4ZPXA 5BN5A 4OQNA 1VECA 2J0VA 1ESMA 2EFCB 3NH6A 1E79D 4FMCF 2QY9A 1NSFA 3RRZA 2N42A 3IIJA 3R8FA 1DOAA 1XPOA 1NY6A 4DDUA 1EFCA 4L9SA 3OAAD 2SHKA 2XTMA 3QEOA 3HU3A 1JB1A 3CNNA 4HDQB 2ZU6A 3RYTC 1OXSC 2FZ4A 3KJGA 4IOJA 1MH1A 5FOTA 4F93B 4B2LA 1DEKA 2XTNA 3U60B 4M1KA 4WIAA 2GWHA 3HU2A 2QRNA 1FFHA 2WTUA 2R9VA 4YMWA 3O8BA 3DKVA 1OXVA 1R5NA 5HCIA 3IO5A 1M7GA 4XD7A 2OZEA 4MYTA 3E5HA 4CEIA 4PPQA 4LJ5A 4UXIA 3ETLA 1BYIA 2EFEB 3KDSE 4R71A 1S1CA 2ZYWX 4DLTA 3U3JA 3B13B 4V03A 1IXRC 1RRPA 4NCHA 4UKDA 3UG7A 4EJSA 4EPYA 3K70C 2QORA 5G40A 5HCNA 5DNYB 4MGYR 4H9GA 4NYJQ 2QBYA 1IY2A 2ODWA 3GJ0A 4QKQA 3B7GA 3I5XA 1VG0B 4LX0A 1F6BA 4GBMA 2J87A 2QTVB 5E3HA 4DLWA 2IS6A 3C14C 3SYNA 4ZCMA 1P6XA 2R44A 1FX0B 2HDNB 5F2EA 4Q7LA 121PA 2J7PD 1GIAA 3IUYA 3FMIA 5FOUA 1M34E 4G5SA 4MRRA 3VQTA 3U44A 1XF9A 2B6HA 4PHFA 3UATA 1E9BA 3C15C 3B8HA 3AP2A 3NEYA 1K5DA 5IRCD 4UJ5A 4Q9KA 2XTZA 2JJ1D 4MYHA 4WZAE 1W49A 1Y3AA 2RGGA 3FMPB 2WWHA 2GCOA 3ICEA 1HE8B 4PC7A 3RRMA 1E2LA 5J4YA 2ZJ2A 4KBFA 5EE1A 3TBKA 1E98A 2CE2X 1BMFA 3TVDA 4DB2A 3C7KA 3I73A 5CDFA 3VFDA 3KQNA 3U7FB 1XB2A 1NSTA 4MRVA 1N2CE 4EFMA 3FPAA 2ZJ5A 2QUZA 1Q12A 2VF7A 2JIZD 2DPXA 1AKEA 1VYUA 4GOXA 4BZPA 4LC0A 5G3YA 5FPTA 1ZUIA 1QG2A 5KUTA 5A4JA 4Q9IA 3PEYA 1RJ9A 1IJEA 2FJUA 2RGNA 4F38A 3GLGB 4HAXA 1E79A 2A5FA 2XJ4A 2OBNA 2QAGB 3QSYA 4ASUD 3FE2A 1XX6A 1H8HD 1YHNA 3IIMA 5L3RA 3OAAA 4O3MA 1E99A 1AS2A 1G4UR 4KO8A 2Q9CA 4LYHA 5D3MA 1OW3B 2FPMA 4KHZA 3GJ7A 1PV4A 3SJAA 5CK5A 2V6IA 2PJRA 1DARA 1E9SA 1JAHA 1T9HA 3QBTA 4UJ3A 3GJXC 2QENA 2AD5A 2CJWA 2WJHA 1XD9A 3WRYC 5CB8A 3I62A 1AGRA 3W3ZB 1N5IA 1QF9A 2GAOA 2BHRA 4BFZA 4JVNA 2FMXA 3CKLA 5L3QB 2RMKA 5BW8A 3CNLA 4C0KA 5F9HA 2J41A 4QM7A 1OXXK 3HU1A 4D4KA 3R7WA 5KPDA 1N3BA 2NMVA 1MRSA 2DHRA 2JGNA 2OUKA 3THWA 4TMKA 1VG1A 3SE0A 3X2SA 2WVJA 1WMSA 2I1VB 3NDPA 1U0LA 5BYJA 1OFUX 5IT5A 4B33A 4IHQA 1LW7A 2BWJA 4LHYA 4B6EA 4YC7A 3SBDA 4OQLA 1GP2A 1T8UA 2XNDD 5KSPA 5FUYA 3SDZA 3H86A 4BFXA 4Q4AA 1E4YA 5IF9A 1XMJA 3WYGA 3NEJA 4WZ6A 4ZIRB 4JLMA 4G3XA 3AGPA 1KK1A 2G9NA 4Z8XA 3VNVA 3EZ2A 4Z1MD 3BXZA 2G88A 4DEXA 1U8YA 2HF9A 2ATXA 3CWZA 1G7SA 4NPHA 3G0HA 1WQ1R 4MYCA 1YRAA 3CRMA 4BPBA 1AK2A 1QVAA 1XD8A 1EGAA 1KKMA 2CCJA 1TU4A 1DG3A 2C9YA 5KDLA 3VR3A 3MWYW 3J81k 5EXXA 3BH0A 4CEJA 1ODFA 1G1MA 2FFAA 1R6BX 2A30A 4M53A 2D2FA 1KMQA 4TMXA 2H5EA 1HQYE 1N0UA 1Q1QA 1T5IA 3ND9A 3ZVLA 4M0LA 2IS2A 1T0HB 3FB4A 2QRZA 1D2NA 4TQUS 1Z0IA 3RLFA 1NY5A 4GMXA 1KNQA 3E70C 2DWQA 4MGZR 2VHCA 1SXJE 2KE5A 3PUWA 1HURA 2P5TB 3K1JA 3DOFA 1ESNA 1KIMA 3LLMA 3QVVA 3HP1A 5H8WA 1FMLA 4X8HA 1SULA 1TQ6A 2PCJA 3QG1A 4PSKA 1E2JA 1H8HA 5JI3E 2XXAA 2HV8A 4LJ6A 1G21E 3BIFA 1W4CA 4BRWA 1UKYA 1E3MA 2Q9BA 2IWRA 1R4AA 5KSOA 1A2KC 4D0NA 2OG2A 3SQWA 4A8JC 4EJSB 2FV8A 2QU8A 2FWRA 1MO3A 1SKQA 2QL6A 4HB0A 2B8TA 3I1FA 3U3MA 3P32A 4LV5B 2WWFA 2JATA 1TADA 2IA5A 3MLEA 3VAAA 3WRXC 3CLVA 2OFOA 3EIHA 3GJ6A 1ZM7A 4M4SA 2QTFA 4NYMQ 3D6TB 4B34A 4KSCA 5FPHA 1XTJA 3FTQA 1IM2A 2NO9A 5EE0A 1N6OA 5DLQC 1FNNA 1E2MA 2J3EA 3REGA 4PHGA 2LCFA 2AKAB 2GJAA 1TEXA 3A4MA 3DVLA 1E9RA 3ZIAD 1TF7A 3MMPA 3U44B 2W83A 3T5GA 4OI0A 1PZNA 5FUXA 3SJBA 4FCVA 2D62A 2XNDA 4I1VA 4PANA 1UM8A 2BBSA 4LV6A 3LLUA 3CPJB 2G77B 4W7SA 3AKCA 3ZVMA 2GCOB 2VBCA 2HT6A 1DO2A 4QJ3A 2PH1A 1JNYA 1E2QA 1KO8A 2X1VA 2ZS8A 5CM9C 4DXAA 3FKQA 4HYYA 4Z1MA 1VYVA 1W0KD 3TUJC 3KTAA 4AG6A 2VP4A 3R20A 5LPNA 5J5CA 2VRWA 3AKYA 3WBJA 2OFXA 5FOWA 3LV8A 1TMKA 3MJRA 1GNPA 1FNMA 4LWZA 1UBEA 1Q20A 4AYXA 4QL3A 2CCGA 2XB4A 3K0CA 4AKGA 2IUSA 2B92A 5FR2A 3TVTA 4D4LA 1QHGA 4WXRA 1XD2A 2AFIE 4LSGA 4C0QC 1YJ5A 3LBIA 1HH4A 3EWAA 1N6NA 2D2EA 5D3MB 2VP5A 2GILA 2G1KA 2BMFA 3ZVRA 1Z29A 3M4YA 4PAQA 2MMGA 2R62A 4M1SA 1FTSA 1KGDA 2B7CA 2XSZD 4HLQB 5EXPA 5BQ5A 5LB4A 3W90A 2WJVA 3UKDA 4MRSA 1Z3IX 3KQHA 4Y0AA 4DLXA 2IX3A 4PQYA 2CJWB 2MMCA 3NXSA 2AWOA 2GXAA 3OIUA 2EWVA 3KFXA 2ZRDA 4DCUA 1E9AA 1G8PA 4TL9A 2ORVA 2IXFA 4LK2A 4US1R 4S35A 1DAMA 1E2KA 5TARA 4PQRA 1S9DA 1O3YA 3SNHA 3X1XA 3ZD7A 5IK2D 4EIWA 3MUFA 1OH5A 1Z8FA 5SZKB 3QXHA 4LBWA 1YR9A 1T4GA 2ZITA 3THWB 3NWJA 4B3BA 2FA9A 3SJCA 4M22A 4TYPA 5JSZA 4QOSA 5B58C 4NL4H 3QXJA 1SVMA 4HAWA 1MKYA 1XU4A 4DDVA 2F43A 5SZIA 4RJLA 5JWOA 3NBYC 4TYQA 4ZCLA 4Q00A 3TSZA 4EQ6B 2EFDB 4BFVA 4Q4AB 1P62B 3LBHA 4P3YA 1NRJB 4IFBA 4BE7B 2JLWA 4DVGA 3ZIAA 2WKQA 4JZKA 5KNCA 1IXZA 2Z6VA 1SKYE 2EFGA 3HPQA 1ZRHA 2LKCA 4HLCA 2HF8A 1A7JA 1VHLA 1DADA 3A8TA 3OZXA 3RWOA 1YZLA 4OYHA 3QUSA 3L43A 2QSYA 1J2JA 4KLZA 2ERYA 2R2AA 3ASZA 4QJ5A 3VKHA 2ZM5A 1KSFX 2P65A 3RABA 1TQ2A 3SEAA 1NVUQ 1WBBA 1AS0A 4RSGA 4JKIA 1A82A 4NE2A 1ZNWA 3PUXA 4QBFA 2Q3HA 4RD4A 1MRNA 2XITA 2RH5A 1NVVQ 1W0KA 3CR8A 3I4LA 4ZDKA 2IEZA 1I4DD 4L8GA 5GJVC 1E2DA 4Q19A 4JBWA 4HATA 3GJ8A 3U5ZB 3E1SA 3QF7A 4EUNA 4MITA 4AI6A 2ATVA 2O52A 3VHXA 2X8AA 3LRPA 4PO1A 4P4TA 3LY5A 4XWOA 5K8IA 3TQFA 2H18A 3QI2A 4WOPA 4ZI3A 4JT2A 4BZQA 3T06B 2QPTA 2H57A 3GEEA 3QOFA 4JLBA 4A2WA 2O8EA 4Q4JA 1RYFA 4MKHA 5FFMA 4C2TA 3VKGA 2D74A 4CT4B 3KKNA 4B44A 3KKPA 2WAYA 5CJ2A 4TLBA 1HYQA 1KO1A 2EYQA 2W2TA 4XVRA 4GP7A 3ZS9A 1E0JA 3KKQA 3L0PA 3ZJYA 2BVNA 2IYSA 3TSWA 2GXSA 4URXR 1KSHA 2XSZA 1BS1A 1NBMA 4PSAA 2C96A 4HZIA 5GVRA 5FBQB 4BFTA 1GFIA 1Z5ZA 5F9FA 3R9WA 1E4VA 1Z0FA 2OLKA 3CR7A 2FGKA 3B85A 3A6PC 1G3IA 2O0KA 4M1WA 3W6PA 1G6OA 3EPLA 3K9LA 4KSBA 3SFVA 3W9YA 1Q3HA 3OEHA 1T8TA 3KKOA 3CWQA 2AXPA 3IPYA 1G19A 3CO5A 3PFIA 1ETUA 1R5BA 1G9XA 1ZD1A 2QTHA 1HEIA 2YV5A 1XMVA 5KPJA 4YQFA 3UANA 1R0WA 2YC4C 2JLQA 1Q44A 4NYJR 1EK0A 4ABYA 1NN5A 4IXNA 1MR3F 1J8MF 4POAA 1U90A 1XJQA 3BAFA 5EQTA 5EE3A 4QGFA 4QNMA 3QJYA 3TW8B 1FPMA 2RHDA 1QHHA 4A15A 1A4RA 5LBIA 3KQKA 4G5OA 4QHYA 4LJ8A 2QA5A 2WJGA 4R2IA 3GD7A 2WJYA 4FMCB 2PMDA 4NONA 1KJZA 2IYWA 5EE5B 3ZGXA 2HUPA 1KSJA 3H2YA 2OBMA 1U94A 2FN4A 2YKGA 1BOFA 4MDFA 2PEZA 2C78A 1EFUA 3KTAB 4MUBA 4UXHA 1NG9A 4HLUC 1J70A 2IW3A 3FVQA 5EUQB 1C4OA 3A4LA 1UF9A 3ADBA 1KAOA 1YZTA 4ON9A 3NTUA 2OSBA 4HZUB 3FHCB 4X8OA 1CULC 2H8KA 1K8RA 3TAHA 4FCTA 1XXHE 1E9EA 2ZI4A 1IN7A 1KK0A 1J7KA 4RZUA 3SN6A 1CRPA 1XD2B 4DJTA 4IFEA 1EG7A 2Q0HA 3EA5A 1KSGA 1U8AA 1Z0KA 2FPLA 4P32A 1R8QA 4ZKDA 1J8YF 4V0ME 4DSOA 5J40A 1S3SA 4EPRA 221PA 2B21A 1CP2A 1E6CA 3IKJA 1JBKA 4Q01A 4II7A 1Y63A 2V9PA 5L3VA 2O8FA 2C9CA 4GI7A 1I2DA 1UPTA 1E94E 1X8KA 4B2PA 3GLGA 1T3HA 4B3CA 3IHWA 5K8TA 1GL9B 1Z6YA 821PA 4A0FA 4LCBA 1Z28A 2F3RA 1DPFA 1Z63A 4ACAA 4OBEA 1KZ7B 1CJMA 4RCZA 1M8PA 4KI0A 4V02A 4PO9A 3PXGA 1OB2A 1G7RA 4XD7D 2AKYA 3DDCA 3VX3A 1AN0A 1IBRA 4URVR 1DE0A 3VR5A 2QGZA 2EFHB 2DFTA 1SQ5A 2ORIA 1QHIA 4HB3A 1JJVA 1FMJA 4XJXA 5KU1A 4P31A 3SFZA 4C0AC 4DDTA 4B74A 3LBNA 3OIWA 5IDVA 3CZPA 5JSZB 2IXGA 2VL7A 1OHHA 3QG5A 3BH6A 4OHWA 1SVLA 1OF1A 1AZTA 1UFQA 3KZ1E 3W3AA 4J0QA 2F43B 2V54A 3QQ5A 1KDPA 4OHXA 4BFUA 4ZCIA 4JLVA 4A2PA 1XEWX 2ZE8A 3PJRA 1JEEA 4IRUB 3ZDQA 5EP2A 2K5UA 3GLFE 2GCPA 4JIMA 4CIDA 1KJWA 4Q1FA 1ONBA 2ZRLA 3P20A 2ZPTX 4GDFA 3WYAA 5E7IA 2V6JA 3K0EA 1TUEA 5EE9A 2XB2A 1YQTA 3V9PA 3PENA 3ZZTA 3IILA 2PZFA 1ZM2A 1WA5A 2VEDA 4C4PA 4PO8A 3IHLA 4YDHB 3T1QA 3GLIE 3D7MA 3SYKA 3O8DA 2HLDA 2R65A 3L2OB 4U7DA 2J5XA 1G8HA 4QJ4A 1D6JA 4CEJB 1NL3A 4L4UA 1T3SA 5D3QA 4CRWB 2ZUDA 2J0UB 3T34A 4ZIRA 4CGZA 4X8MA 3GMTA 1HT1E 1XCMA 1H8EA 1VCOA 2QAJA 1X1RA 3DZ8A 5M04A 3EPHA 1P75A 5AR1A 1Q3TA 4KBGA 1AQYA 2E9SA 1IQPA 2J9RA 3T1TA 2ZI6A 1Z06A 1VDZA 4DHEA 3U61B 1QRAA 1SXJC 2BMDA 3IGFA 3NBXX 3AM1A 4HSEA 2ZI3A 3AF4A 2QMUA 1KI1A 3EZFA 3EG5A 4JS0A 4ESVA 2O8EB 2P5SA 2HT1A 4RKFA 4Q4JB 1IN6A 2V55B 2YINC 1RRFA 3DO6A 1NI3A 3KXKA 4I81A 3QVUA 4M1YA 3PEWA 3AF2A 3PUZA 5EJEA 4D25A 3OF5A 1VIYA 2BC9A 3G82C 1CR2A 2J0SA 2IYZA 2WWXA 4OL0A 3GPLA 1DS6A 1GRRA 1GDDA 4JVLA 2HXSA 2GHIA 1E1QA 2QQ0A 2FPKA 4LGMA 2JLRA 4FMBB 3BB4A 3EZ6A 2C98A 3B82A 1KYIA 4EDHA 1N6HA 3CPHA 4TL7A 2OCPA 1KMHA 4WZBE 4ILEA 2ZRCA 2KBEA 4PC3A 3EC1A 4E5UA 3C16C 1ZM3A 2XOKA 4IDQA 2GF9A 4UNRA 3EX7C 3EZ9A 4TQAA 2Y8EA 4DCNA 2CDNA 3F8TA 4PPGA 1G7CA 3U3OA 1QBKC 3RRNA 1F2UA 4JLKA 4MA4A 4B3GA 3AQ4A 2NOAA 5B64A 4XWAA 4C2UA 4XIGS 1VIAA 2BBOA 2A9KA 2FOLA 4XTRA 3DL0A 3F5FA 4TTQA 1GL6A 4BFSA 4DCTA 4IEIA 4NYMR 3B1XA 3OEEA 1II8A 2OCBA 2A5YB 1QHHB 4GP6A 4A8JA 4M2LA 2YZ2A 3ADCA 3K70B 5JJIA 2IS1A 1X8JA 3K9NA 1GUAA 3DMNA 3T1VA 3BS4A 3B60A 1CBUA 2ZI7A 3H84A 2A5JA 4Q02A 1NN1A 5JCPA 1KDOA 1KK2A 4BGDA 1OXUA 4BQSA 2BV3A 4KJZA 1FL9A 1M2OB 3B9PA 4MH0R 1ZNXA 3OFND 4D0GA 4DIDA 1OKKA 2JLZA 1JR3D 1I2MA 1G5PA 2ZJAA 3BFKA 1Z47A 1DBSA 4OJKA 1ZM4A 4RCYA 3SS8A 2QMHA 3QPWA 4Q47A 3LO5A 1CJUC 5H68A 1KNXA 4RKEA 1CEEA 3PR1A 3RS3A 1FP6A 3EASA 3LQRA 4Q9HA 1X3SA 4P4UA 3OHMA 4YMTA 2BKEA 1NLZA 1LNZA 5CIWA 3KJIA 4NHOA 1P2UA 4GZMA 1R5OA 3RVBA 2W2XA 1OB5A 3EIQA 2ZRFA 1XZQA 1KI3A 4M9QA 2EU8A 3DM9B 2OILA 1ZCBA 3V4FA 1B23P 2QP9X 1SHKA 5AJXA 5KO2A 2I3BA 4EFLA 5F3WB 1SZPA 1TX4B 3DEFA 3CIOA 4KV9A 2O8FB 3KJHA 2VHTA 4JSTA 3I3SR 1COWA 1DO0A 4XSHA 5FPYA 5J4VA 3REFA 3RDPA 2RHMA 3L0IB 4LBZA 1NVXQ 4ERNA 1VMAA 2JEOA 2HXYA 2R8RA 4HI0E 2TMKA 4AG5A 1R8SA 4C30A 4CDGA 2ZJOA 2OEPA 3AUXA 4PXAA 1ZJ6A 1TPZA 1XDBA 2GF0A 3OIYA 4M21A 3KQLA 3P26A 3GLHA 3K09C 2BCJQ 4I1UA 4JKYA 3UG6A 3QKSB 2OAP1 1LFDB 4YONB 1KI9A 2KI5A 1LVGA 1G18A 1AIPA 2ASEA 3CRRA 4PC1A 1ZD9A 3CBQA 4Q1DA 1J90A 1Z0JA 1X6VA 2WMOB 4JL6A 4GFDA 1JPJA 1Z6TA 1E0AA 3U6BA 1GSIA 2BDTA 1EFTA 2P6NA 5KDOA 5JEEA 2ZJ8A 3BBPA 3R8CA 5HR5A 1TQ4A 1UJ2A 3BFVA 3T35A 1PUJA 5DISB 2WJJA 1JJ7A 2ZAOA 2WICA 1AS3A 3BE4A 4FCWA 1RPZA 1P72A 3HPRA 3DM5A 1ZMXA 4IKEA 2G1JA 2DCUA 1OFIA 3K9GA 3PVSA 1DAIA 1ZCAA 5FTJA 3MWKA 4B48A 4EQ6A 5HZKA 1EESA 1Q21A 2ODEA 3CF0A 2CL0X 4XVUA 1W0JD 4N3NA 1NMYA 4GZLA 2W00A 2WKRA 2WWIA 2FG5A 4PC6A 2VP0A 3LXRA 5CLQA 2DFLA 2EVWX 4TQ9A 3VNUA 1S0UA 4H1UA 4NYIQ 4HAYA 3WYFA 1Z83A 4LBYA 3OFNA 1W47A 3LNCA 3Q5DA 1I4LD 1JR3A 4XOIA 4NCIA 3ND8A 2RGAA 4QHSA 2GK7A 3WXMA 1UKEA 2GXUA 1W46A 1G3RA 2LWIA 4DLVA 2QPAA 1IN8A 4V0LA 3SHWA 4URZR 4YMUA 1L4UA 2NQ2C 4F7WA 2Z5FA 2FFBA 4AYTA 2GNOA 3TJZA 4LJYA 4BEBA 2D3WA 5B57C 1E2NA 2G83A 1NVVR 1GNQA 2WSSA 4N1AA 5JMTA 1HUQA 2D06A 1VYTA 3KB2A 1E96A 4D26A 1P3JA 4V0OA 3QBVA 1P73A 2OHFA 2H16A 1X1SA 3IBYA 4C0SA 1NNEA 3K0FA 2CEAA 1OIVA 4LI0A 2J45A 4WW0A 1LB1B 4JLAA 3I5YA 2CE7A 4D80A 3LVQE 1KMHB 1ZU4A 3K0SA 4C3ZA 1SVWA 2ZSBA 2C04A 1FQKA 2PZEA 2YWFA 4GMDA 3L0SA 4RZ3A 2DB3A 1CF4A 1XP8A 3AH8A 2WKPA 1W5TA 4M1OA 2WOJA 2ZR7A 3HR7A 2DYKA 4WBSA 1ELOA 2PLFA 3SHFA 4DC9A 1T6NA 4AKHA 3WMEA 5JFGA 1L7VC 4OI1A 4D0LB 1M7BA 4O25A 1F48A 4AKIA 1ZNYA 2ZRNA 1F2UB 1U0JA 1S4QA 1HT2E 3JVUA 4CEHA 4Y0VA 4B3DA 4JYCA 3VR1A 2YWHA 2V4ZA 3TK1A 4EJSC 2R6GA 4HB2A 4FMDF 4LY6A 1ZU5A 3BRWD 4TT3D 1ZM9A 4Q66C 2JLSA 4JVSB 4LJ4A 3MFYA 4MKIA 1II8B 2ZQ5A 1G17A 2IYTA 4NDZA 1I4TD 4A8JB 3THYA 2GJKA 2REBA 3UWKA 1IOZA 1OYYA 1WCV1 2RAPA 3VR2A 2OT3B 4AY2A 5CITA 1XMIA 3TRFA 1W36C 2JDID 3ZS8A 4OHYA 3HWSA 2JCSA 4QHTA 3U4QB 5EXSA 5FTNA 2EW1A 4M1MA 5A5GA 1PVOA 4RFVA 2GVDC 2CHVA 2BM0A 1NN3A 2BJVA 1LS6A 1R7RA 4IJMA 1D9ZA 4TTPA 1S9HA 1B0UA 4QGGA 1BIFA 4JVMA 4PAOA 2A7QA 3G5UA 2GESA 3LDAA 2HEIA 2YOHA 4Q1BA 1W0JA 3CH5A 1YR6A 3A36A 1YVDA 2QSZA 4OK5A 4BRUA 1OH6A 4B3FX 1RFLA 4KFSA 4Q7JB 4JL8A 4DUGD 1XNJA 3GFOA 3IPXA 4BZXA 1CR0A 1E2GA 1E32A 2CLCX 4RFSA 5JECA 1FW6A 1WF3A 3SI7A 1NKSA 3WNCA 4TMWA 1W1WA 1XTKA 3TSOA 3CX6A 3SQXA 4BUJA 2HJVA 1S96A 3N2IA 4EFNA 4DLZA 1UKVY 5DGXA 2NTYC 4KYUA 2P2LA 2ZREA 2XX3A 3LAWA 1QG4A 2IUTA 4HZUA 4PZLA 2OCYC 1FP7A 4LDJA 1XTRA 3X1DA 5BN4A 4IDHA 2VQSA 1JQJC 4AWXA 1RE0A 5DSZA 1TU3A 2ZJBA 5DIFA 4OI4A 2RGNC 1NIPA 2FSGA 1QHSA 3AP1A 1HQCA 2RGXA 4FIDA 2PZGA 2QP4A 4FD2A 1SXJD 1KAGA 4Q1AA 4Q7KA 2FFHA 3R9IA 2REXB 5TY0A 2AXNA 5FL3A 2H17A 4QBGB 1NBMD 1OSNA 1CJTC 2JJ2A 1MO6A 2GVZC 4Q1EA 3GLHB 2R6DA 1TNDA 2BMJA 1DAEA 5HE9A 3LX5A 3X1WA 4QNRA 3FGNA 2OO7A 4LHWA 4TZ6A 4M9SA 3FFBA 3MAAC 5DI9A 5TXGA 1S3GA 3OEHD 4A1FA 5JRJA 2WAXA 3PV0A 4ACBA 5JZVA 4IVPA 4UNSA 5CK4A 4CT5A 1OLOA 1Z6GA 3PG5A 4A0RA 1GWNA 4LHZA 4NCKA 1DAKA 4IVQA 1FOEB 2EWWA 3MRSA 4PQFA 5FUVA 1XEXA 4A9AA 1W4BA 1P61B 1M1YE 1YZNA 1L8QA 4RD6A 1SVIA 4TT3A 2G0NA 1Z2AA 3SU8A 1IXSB 5ELXA 1EFRD 4TN1A 2IEYA 3WP0A 4TTRA 1U2RA 4B6FA 2IYYA 4BLQA 2CVFA 4KVAA 4P0TA 3QNUA 5TVKA 2BIFA 3UXMA 1JXOA 1IHUA 3ZQ6A 3K70D 4OQMA 4JBXA 1HE1C 2ZRKA 2JDIA 2W2VA 5KTYA 4LUCA 3U6KA 2IK8A 3ICQB 2GCNA 3EIEA 3K53A 3UMRA 3GLIB 1W7AA 2GAAA 2Z0MA 2B8WA 4HLDA 3WMFA 1P9WA 4MKFA 2NO1A 2FU5C 4I1OA 4QGHA 1YKSA 4MGIR 2ZUBA 3JZMA 1NIJA 5LD2C 3DHWC 3WNDA 5DHFA 4BEJA 1NN0A 1RZ3A 4NZYA 3SZRA 3VMFA 1W44A 1YZKA 2ZE7A 4DUGA 1KHTA 3LW7A 2J0UA 2C99A 1G291 3RS5A 4ZI2A 3MWJA 3NDBB 3KQUA 1W4AA 3T1OA 3HYRA 4O0MA 1CJKC 5E7JA 4EPWA 3RANA 1VHTA 4L5BA 2DWPA 1VPLA 2H92A 4A36A 2CMKA 1OV4A 3QEJA 1NKTA 2WV9A 2VIIA 2H1LA 1GL7A 1Z2CA 3K0FB 1YE8A 2OAQ1 1NP6A 2F3TA 3KX2A 4GNKA 5BXQC 3QF4A 1IONA 5EZ5A 4KFRA 3K9HA 4HB4A 1IN4A 3THOA 1MV5A 1EFHA 3ZH9B 3TR0A 4A2QA 1Q1ZA 4KAXA 2FEOA 1SXJA 4DZZA 1G41A 1VTKA 2WHXA 3TAUA 2UVQA 2W58A 4YMVA 5FL7D 1N5JA 1QHYA 5LDDC 1E2EA 1ZINA 2GJSA 2GBLA 2F9MA 3AF1A 4G0NA 3IEVA 2P0EA 3EWSA 4HUQA 3AVXA 2ZYVX 2BBWA 3ASYA 3MD0A 5FPKA 4CEHB 4KODA 4B3XA 2QZ4A 4NBSA 2IF0A 3THXA 1YR8A 4RZ2A 1XTQA 1OHHD 1ZIPA 2YVUA 4DSTA 2XZLA 4M9XA 4KU4A 2NPIA 4LJ9A 1K5GA 3F0TA 2JASA 4OJQA 3THYB 3CB4A 2WPDD 1RKBA 4DKXA 5J4HA 1Z08A 2HCBA 3Q7QA 3TGPA 4U5XA 2XJ9A 1NLYA 4IW3B 3HJNA 4AK9A 4FXPA 3NHBA 2CVHA 4GT1A 2ZE5A 4KFTA 3I8SA 4IXMA 1F2TA 4B73A 4KXFB 4B32A 2W6JD 1EFRA 4PPNA 3AVWA 3X1YA 4ZV4A 2CLDX 4R98A 2FZLA 2GK6A 3Q7PA 2VSFA 4A6XA 3GQBA 4CYMA 2Q21A 2HLDD 2DFNA 1W4RA 4JJZA 4YMSA 1WXQA 4AYWA 2Q6TA 1G20E 2ZVQX 1VG8A 1NVWQ 4RFSB 1H8ED 4M1TA 4OI2A 2G0TA 4W5HA 2CBZA 1JECA 1YZGA 3H4MA 5JJKA 4HUTA 4QBIA 5GJWC 1II0A 2CL6X 1HY3A 4B75A 2CLSA 2ZROA 4PHHA 5HZHA 4GOJA 1XZPA 3U2QA 1D8TA 4G5QA 4GSYA 4WXPA 1KY3A 4G5RA 3DZDA 1XJCA 4DCSA 2FNAA 2NO0A 3X1ZA 5JI2E 4V0KA 4FWTA 2VPPA 2WIBA 4K46A 1ZC3A 4JT4A 5CJPA 4PHTA 2GDJA 3T61A 3TR5A 3DOEA 3K0CC 4TLDA 2O8CA 4TL6A 1LTQA 1UAAA 3NBFA 2A2ZA 4WAUA 4URYR 1AJEA 5JLJA 2VHJA 2ZSEA 4GRAA 4C0LA 5JS7A 5G41A 3MGCA 1Q57A 1U81A 3QENA 4QM6A 1E1QD 5CDFE 2CL7X 4FI3C 1II9A 4TMVA 5ANRB 5AUQA 5C2JB 3LQQA 1XPUA 2AFHE 4LZZA 1ZUHA 3OE7A 4TLEA 2IBMA 3B2EA 1OIWA 3C5HA 2ZTSA 2IS4A 5JHHB 2PCLA 4Q9JA 1G5TA 2Q3FA 2QP3A 2JA1A 5FL7A 5TB5A 2XOKD 5SZHB 1G8GA 2RGBA 3N2EA 1VCMA 1EWRA 3D31A 3EARA 2MSEB 2J7KA 3CX7A 3WHKA 3VHLB 1G16A 1CR4A 1RW4A 1Z0DA 1P2SA 4H1VA 2KJQA 1S8FA 5HTKA 1F60A 1XEXB 1XTIA 2OM2A 2VP2A 3B1YA 1LF0A 1LY1A 2QT0A 3QKSA 4C9BA 5JHGB 1P2TA 3KXLA 4FN5A 4GOKA 2KSQA 1F3OA 1PLKA 3FKSA 3ZZUA 1GNRA 1KI4A 1ZBDA 3OEED 4LHXA 3EAQA 4NCNA 5KNBA 3CF2A 1N25A 2WPDA 2AD1A 1BH2A 4B47A 2YWEA 3K09A 5FPSA 1E9CA 5CLLA 3DKPA 5JS8A 4RVCA 5TV2A 5K8UA 4E22A 5KSZA 3QKUA 2W6JA 3SOPA 3B9QA 2FE4A 1A1VA 2A78A 1OKKD 1U9IC 2X2EA 3KXIA 3QPUA 2Q9AA 1U0HC 4Q21A 2FDCA 3FWYA 1UBCA 2YOGA 2FSIA 2YNMA 3M0EA 2YYZA 4OQXA 5FTLA 2VSOA 2XZPA 1CU1A 1PLLA 3NIBA 4ARZA 3BD9A 3U7HB 2GJ8A 2VF8A 4NYIR 4DT1B 3BGWA 4HDCA 4EPTA 1FUUA 3HR8A 2FSFA 1JQLB 3U7GA 2P6RA 2BEJA 3NC1C 2GXQA 4D81A 1ANKA 2R6CA 2ZJYA 1GAJA 2ZI5A 1XJ0A 1VCIA 3QF4B 1GZSA 2ZYTX 4DRZA 4BFYA 3GFPA 1IY0A 3H0KA 1TEVA 5JWHA 4D4MA 4W9MC 5JRZA 3PQCA 1COWD 4P4SA 3KJEA 4C0HA 4BECA 3MJHA 3TW4A 5KYKA 1IJFA 1SXJB 2OXCA 1KDTA 2ZRBA 4QG7A 2VHQA 5UKDA 4G5GA 3CF6R 1N6IA 1XFAA 4S2EA 3K0AA 4Z54A 2NZ8A 4HUQB 1WBDA 3WP1B 4WA7A 3RSOA 2HJGA 1XWIA 4EKDA 4LOAA 4Q1CA 1IN5A 4IOMA 521PA 2N1BA 3C5CA 3SJZA 2IL1A 3BB3A 5AK0A 3AEZA 2BBTA 1G8YA 1L2TA 1BKDR 3TMKA 3W8NA 4TYNA 3THXB 1P4SA 5E4FA 2QMEA 4TLCA 4KFUA 4K81B 1RIFA 1YR7A 2ZRGA 1CJVC 1OT3A 3GJ5A 3M6AA 1E2HA 5KDDA 2IYVA 2EYUA 1Q1EA 3VU9A 4NH0A 1XTSA 3QXSA 2A5GA 4AIIA 2ZEJA 4HAVA 5DE3A 4I4LA 4E03A 3UK6A 4PFSA 4ZKEA 3W5IA 4MRNA 2P3SA 2Q3MA 4PSVA 3RS7A 4TLAA 4LHVA 2BKUA 3VR4A 2WMNB 1F2TB 1EXMA 2ZRAA 2PMKA 2BMEA 3JVVA 4GL2A 2VA8A 3RRYA 3I32A 5AUPB 4LJ7A 4TL8A 3LA6A 1ZVQA 2V3CC 4MYUA 3KFVA 5G53C 3BORA 2ANCA 2UZ3A 1C9KA 4RD1A 1G3UA 4IEEA 4LJAA 1E9DA 2PT7A 2D7CA 3U4QA 3B78A 4JSYA 2O8BA 1BO6A 5H70A 2F1IA 2F9LA 3AF0A 3MCAA 4URUR 1OIXA 3B6EA 2DR3A 4RD0A 3V4RA 1DTSA 2VYFA 2NO7A 2WSMA 3AVVA 4TYWA
chains in the Genus database with same CATH superfamily
2H1RA 3E2MA 5FUWA 2BDUA 3AX6A 3B6IA 3E15A 3UF0A 3UQYS 5A03A 1EQ2A 4RPIA 1TZKA 1NBEA 1ILEA 1YZQA 4Y6PA 1W4LA 2AYZA 1CETA 1RKQA 1CW2B 4DUZB 2GERA 5ARDA 3MHPA 3MRVA 3BE5A 3I8XA 5LM3A 3QEAZ 2E6UX 4M99A 2BGJA 3LT2A 1HMYA 5DHAA 2J3LA 2ATIA 1FRQA 2V8BA 5JH7F 3T4XA 2GJ4A 2FH5B 2ECPA 3ZYCA 3NBUA 1SG9A 3FM9A 4N49A 3UBMA 3BWDD 2IELA 2QVCA 1GILA 1XXHA 4B2YA 5B37A 1KRXA 2FPIB 1RTKA 4KE9A 1L4EA 2DLDA 2FXIA 1KI6A 5T8KA 1MVLA 2WUVA 1XTBA 3AUSA 3ZE9A 3ZE7A 4DWJA 1U80A 1AHHA 3CZ5A 3ND5A 3VXKA 4AZ0B 2CLEB 3SVTA 1DBRA 3SF8B 1R10A 1E3IA 3FKJA 1FRVA 4FEEA 3RS8A 1EXWA 4R41A 2J9FA 3NOVA 3WKBA 3PUVA 3AJRA 4BOYA 1UKBA 1ZICA 1J24A 3RS4A 5JXWA 2F1JA 3ROQA 5C4GB 3C7AA 1DC8A 1D07A 3EXIB 3LBAA 4QPJC 3IUQA 3NBZC 1R8JA 2V96A 4OHMA 2I2XB 5E6UB 3D3JA 4ANFA 5K7SA 3AIMA 2HDHA 3D6UA 1CZUA 4ZVOA 2PUBA 2D00A 4CFZA 1YZVA 4QC2A 4B3TB 1RM3A 1FVHA 1BA3A 1IHDA 3KYJB 1OTHA 4TROA 6ABPA 3JY6A 4KVZA 3H1TA 1VL8A 2ODNA 1Z4KA 4FQ8A 3PICA 3FYUC 4LTMA 2XE7A 3UWOA 4BBZA 3NT4A 4E51A 1W0CA 1KVUA 4UTVA 3DAPA 4M0EA 1A5BB 2QR3A 2XGSA 4Q7MB 4AY3A 4YXWD 5IHPA 2OCKA 4QZVA 3SYLA 1QHXA 1NVTA 2A3RA 1HFEL 4MGKR 2JKZA 4BL5A 4BCBA 3QOXA 2WINI 2ANBA 3DXXA 3PXEA 2I2CA 4G0MA 4K28A 1F7VA 3TFOA 1GRNA 3P27A 2A67A 4DG9A 2E82A 3BKXA 1XCLA 4KK3A 4Z4EA 3M4ZA 2C5LA 3AUJB 3CPEA 3N8NA 4JXJA 3RAJA 3W2HA 3WGQA 4D9MA 2LRHA 4OAPA 3OTQA 2GA8A 3TJMA 3O4VA 1P1IA 3QE3A 3W3AH 3RVNA 2YW9A 1ZSYA 3KO8A 2ZSDA 2PMBA 3IPAA 3P0FA 3GLFA 1NNI1 2PKEA 1FTQA 1VZ2A 3FX2A 3PJDA 5FI0B 4B6GA 2BFDB 1RLIA 1E0SA 1Z2EA 3TSAA 3ZK8A 2NIPA 2ERXA 4Q9NA 3RHTA 3MSXA 2ENWA 3EHDA 2CV1A 4M8SA 2QTRA 1BWSA 4B17A 3KSBC 1JZSA 2X0IA 3QP9A 4OHVA 3UICA 4AX8A 4QULA 3IT1A 3KLPX 3ZLUA 1JG6A 1FK8A 2WWRA 4J0KA 1KDRA 4XWKA 4ARZB 1JSLA 3CEMA 4CV1A 3X2EA 3QY9A 1QYVA 2P68A 3IP7A 1WEHA 3MOGA 4MVJI 4Q9AA 2Q4DA 4EW1A 3FTEA 2ZYUX 3EXG2 4JLPA 2CN1A 3IMCA 2XCIA 4NMXB 2B9VA 1AZWA 4GOOD 4GVLA 3WL7A 5ALPA 4YVFA 2QLFA 4CM7A 3WJ2A 2KS6A 2W0SA 3UJAA 4V24A 5K8CA 3ILYA 4N5HX 3ENVA 5JE8A 4ZMSA 1SOMA 1V16B 1UOEA 3FDIA 3I05A 3WGUA 2J5KA 5GVSA 2JGDB 5GJBA 1VFPA 2AS0A 2C1XA 1NVFA 2H3HA 2PJUA 3H05A 1Y6QA 3NHWA 4QIHA 1UPCA 4IUYA 5EJ5A 1GKIA 2GZDA 2CFSA 4JJ6A 3S28A 1F8YA 3LX6A 1G9TA 1DG1G 2GETA 2F3PA 2JA2A 2YUTA 3FWHA 4C87A 2WWWA 4N65A 1J8DA 3VA7A 4MJXA 2D8MA 4Q3AA 5CXSA 1AG9A 1TAGA 1V9SA 3K0AB 1T9CA 4US2R 5F98A 4WKPA 2JJ1A 1QH8A 5EJ9A 4BVBA 1KRHA 1KOJA 2M32A 4C29A 4E70A 1TD1A 1NONA 1V8DA 3DV9A 3AVOA 4MAAA 1L4MA 3JR3A 2L0XA 4D8WA 3P0HA 2I2BA 1K75A 1KBOA 1Q6ZA 3AP3A 3EUFA 3OCCA 1DJQA 1S2LA 3VVLA 5IP5A 2R8BA 4WNCA 3FJOA 3PFCA 2J3HA 1J6UA 1MABA 4UNPA 3R1IA 2DBYA 2NZVG 4FKZA 4OKSA 1JYEA 1MCZA 2IYLD 4NI5A 1ZJJA 3VYSB 4WZBA 4R2HA 3W5JA 3HFSA 2ZIXB 4PX3A 1VCHA 1GCAA 5E4TA 2J48A 4JJFA 3ADDA 1T3LA 1P9RA 5IN4A 2IOFK 4YJ2F 5JDCA 1ZK2A 4JMLA 2FFRA 3KXPA 1TLFA 3V8EA 2PXAA 4ZI7A 2KW5A 3GEIA 1DAGA 3B9BA 3E9RA 1EVYA 4FHGA 5CFPA 5J2TB 1LZKA 1HG1A 1M2FA 1U2GC 2P0YA 2WJIA 2RHGB 1W59A 1SVKA 1PD1A 3H5RA 3GGGA 1ZOSA 4M83A 3AOEC 3GA0A 5CP8A 4OHZA 2X1MA 2Y4NA 5H3HA 3DFUA 3VKUA 4GL4A 2GDZA 2PAFA 1YJ8A 5M7EA 1FTWA 1GM5A 5KX5A 4WKOA 1JWLA 1QC5A 3UJNA 5JQGA 4P86A 1CWUA 4E07A 1G64A 3F7TA 3QYPA 4QQNA 2C4WA 2HNKA 1OPRA 3O31A 5AVOA 3CUTA 5LYYA 3LD9A 3A2NA 4PWYA 3V8PA 4BO0A 3CRQA 4EGQA 5A3JA 4BVJA 2IZOA 1DBQA 1SC9A 2Y67A 2X3YA 1DVRA 1E1RA 3A4YA 3PNBA 4E32A 2NU6A 3O6VA 1TAUA 1DJPA 4RV4A 4D9CA 4WLFA 2OENG 3T7EA 1EEHA 3PITA 4YCBA 3FD8A 3LI2A 4AURA 2X19A 1QNFA 3ZNNA 1ZIXA 1P5HA 2IP4A 2TMGA 3FNEA 4F3NA 3NNNA 1JR2A 2IP2A 3FBTA 4G0PA 4M49A 1EK5A 3E2IA 4C6TA 1Z8NA 2A57A 1N2HA 2J5BA 3IQHX 1LXCA 1W5SA 3QE0A 2AQHA 2P62A 3KHSA 3PHHA 1ETHA 3WGIA 5HTOA 3RVDA 2Z57A 4K3VA 3CVXA 3A9VA 4DIEA 2VATA 1M0SA 3WKEA 4Q5IA 1H0KA 4YCLA 4YQEA 4XM1A 5K6AC 1I3NA 1LSOA 2L2QA 4BXOA 1ZGAA 4EY7A 3ZDFA 1X2BA 4RTRA 1EE2A 3STUA 4MWEA 2JAQA 4ZT6A 1IWPB 1OMOA 1ZOIA 2W42A 2NVUB 2VDUE 4AJIA 2JRCA 5BVHA 1Q0LA 3T8YA 4LSZA 4G37A 1L0BA 3LG2A 2V3WA 3AV0B 4R7ZA 2PVPA 4IR7A 2W2OA 4U02A 4U39A 3T5DA 1G2IA 1IK6A 1ODIA 1V43A 1A95A 2EKPA 4RSRA 5LB2A 2OFFA 1PDOA 3P5BA 3EYAA 4YR7A 2DT5A 2ONKA 4WRRA 2QTZA 1MQAA 1T8WA 4PVDA 1FA9A 1KU6A 3EZ7A 3GRCA 2J3DA 3R0QA 2DF8A 1QIJA 4DJJA 2RGCA 4PLTA 4Y6RA 5IT9A 2ZU0C 2BZ0A 4OPMA 2XI4A 3SGLA 2WEKA 3IVRA 1CY6A 1MT3A 1JFFB 1OI3A 1T9KA 2HB6A 2P8JA 5JVDB 4KXQA 3HNPA 4UTNA 3G9QA 4QRHA 2BJHA 1LPOA 3HBFA 3PU6A 4ME6A 5DMXA 4IMPA 3CTMA 3TZKA 1UXOA 2DWOA 3LUPA 5DBOA 1XV5A 2BFFB 3VVMA 1HA3A 4PPFA 2UUPA 2CD7A 1STOA 3BXXA 1XZKA 4BLPA 5ADWA 1SPBS 3OJOA 1JEDA 2E48A 1QK3A 1ZIOA 1E7YA 2Z83A 3MIZA 1U0NA 4N0QA 4NFYA 1XCGB 4HZGA 5GAJA 5I7OA 3PEVA 1U8ZA 3BC1A 5KNCD 1D2GA 2GTPA 1K5PA 2X22A 1M66A 1U9CA 5B4UA 1XVLA 2VO1A 1VA5A 1E1CB 1DBIA 1QVWA 1FFCA 4I7EA 4BC1A 1RAIA 4PYQA 1KTVA 3AWDA 4CG2A 5A0FA 4DSNA 2ZGVA 2YY7A 3FH0A 3C6ZA 2CCKA 4L0MA 2GEDA 2C83A 3G5TA 3B1ZA 3PCRB 1Z0AA 2TSYB 3B5JA 4LZAA 3N5KA 1YQEA 1N5LA 1QDUA 3OHSX 2WT8A 5CFZA 5HS4A 1SQSA 4Z0NA 3D8UA 4OF4A 4R2MA 3CX3A 1LK0A 1XEWY 2ZZKA 3QXXA 4E4YA 1SCUB 1H2YA 3WB2A 4CCYB 5JISA 4NQRA 4HNAB 2HYDA 4HVLA 4YPFA 1XKLA 4BMSA 3DZBA 2PKXA 1E3WB 2W6CX 3KUCA 3O93A 4FOSA 2X14A 2XXJA 4PBRA 1RZVA 3I39X 5DCUA 3GCGA 5E2AA 3TPZA 5ALMA 2GARA 4G81A 2QR5A 3PSHA 3IV6A 4H3SA 1YZUA 3LHFA 4G1UC 4G23A 4JWTA 3E4DA 1J2YA 1PR5A 3WIOA 2AG5A 4UHKA 2C2BA 2TECE 1E3SA 1CQJA 1OJ7A 1VC2A 2OESA 3ENQA 1XBTA 1DKMA 3BPSA 1G5HA 4UUNA 1ZVVA 1G4HA 1PJLA 1XGKA 2A6PA 4B6QA 3QELB 4Q4DA 1EP9A 4ZAZA 3ASUA 3K9QO 1XLUA 5LXTF 3UMFA 2Z4RA 2NV6A 4BKUA 2I4RA 3D4BA 3OECA 3NBAA 4IDPA 1Y9DA 1XVTA 2Q7OE 5I7FA 3P1JA 2G9QA 1L3CA 3TX2A 3UWSA 3M1IA 5BY2A 3Q11A 1OLXA 2OO5A 4RHEA 3ZV7A 1T6YA 5L4NA 3STYA 5FI1B 5L3ZA 1L5VA 4JY7A 3SX2A 3IELA 3HJAA 4MVWA 3JTMA 2C5EA 1FFGA 4UNNA 2QMZA 4RS4A 5LD2B 4ZDJA 4TKLA 4HNQA 1AQUA 1NP3A 5FOXA 3S8EA 4Q4HB 5MFZA 1PTJC 1ZGBA 2P2YA 3BE6A 5B7PA 5TMPA 4HNUA 2AMJA 3G2MA 3I6YA 1FF9A 3H5OA 2QYHA 3ORHA 3AZPA 5E38A 1GVNB 1PVDA 3RUDA 1VKZA 2V4UA 4F4IA 3LGSA 3GJ3A 1CS4C 3GH1A 4KQKA 4QYXA 3S1AA 4IUCS 3EXHC 5LLTA 1L7PA 1O6CA 1G6HA 3DBOB 1JA1A 5FPQA 3WKCA 4G4JA 3BVPA 4ETWA 5IZ4A 5L3SA 1XQXA 4EI7A 3OY7A 4KVGA 1U5AA 1Z37A 3JXEA 1ZR2A 1YVPA 5EMMA 2MINA 2PT6A 3CLTC 4JOBA 3U3ZA 3VI4B 1WP9A 3DDHA 3CKKA 2WYWA 4I8DA 1DUIA 2PUJA 2H08A 1B3BA 1KFJB 3RYFA 4N6OA 4KACA 2PO5A 3RFCA 2CK3A 3LH5A 5DN6D 4NCXA 3V1LA 4Z51A 4R7GA 2JFWA 2XXAB 3T7SA 3PHGA 3C70A 2O2ZA 2P69A 1O6ZA 5IFKA 3B3FA 5J47A 2YZGA 1AN9A 1T0BA 2I7CA 3AUFA 3CT6A 2IY8A 2BH2A 1XL0A 3IOBA 2O5CA 1N5RA 1CRQA 1T36A 2OD7A 2WOOA 1Y7HA 3NH9A 2A4MA 1SIWA 2IYUA 4P54A 3ZIUA 4GKAA 4F96A 2FLVA 1JQ5A 5BYKA 4G01B 4E31A 1EX1A 1P2VA 2V58A 2MSLA 1WP4A 2DTDA 3BX1A 3EMDA 3O73A 3R5KA 4NX2A 4KNWA 1GGNA 5ER9A 3F49S 4JLJA 2GYUA 4XR4A 4GOMD 4E15A 1BN6A 3O47A 3J80A 1NG1A 5IK2A 5DASA 1U7UA 5K3EA 1DC4A 5A3VA 3TM4A 3AETB 5EHNA 2B8EA 1N5DA 4K1XA 4Y2TA 4Y2RA 3O1LA 1EB8A 4L16A 2GEUA 2IE8A 5TDHA 2VAXA 4RL4A 1XG5A 3B8EA 3C43A 4MA5A 3T3OA 1JIXA 1GAWA 1JFTA 4MUAA 2F1HA 3FZNA 4V2UA 2GZ1A 6CHYA 5K0CA 2P27A 3Q3JB 3MGGA 4KYVA 1DAFA 5CH8A 2VWGA 4HDNB 2Z5LA 5E4YA 5JW6A 5IXSA 5TLSA 5FUQA 2ZRPA 3EC2A 1T2UA 1T6XA 1ABEA 2DHEA 1OWNA 3PNMA 2AG8A 4C0BA 4CGYA 1OAKA 3DLBA 3LTNC 1T9AA 3ANYB 3B2NA 1YAHA 3MGAA 2JPDA 5KQMA 1FUKA 4NZMA 6Q21A 2EGGA 4G1EB 1J0DA 3NV9A 1KK3A 4RJIA 3DTYA 5FEMA 2G9UA 3ZCPA 3BHMA 1V45E 1A8HA 4HGNA 4PCVA 3T6KA 1LPNA 3MUEA 4OYRA 1RACA 3TOZA 3WC4A 1BHO1 2PGOA 2YHSA 4DDWA 2HTFA 3O7WA 4D44A 4DKJA 1B93A 5ALFA 1UUFA 3I2FA 3UT0A 1GOTA 1R2QA 1I7LA 4UE2A 5C5IA 2XDQB 3WTBA 1XA3A 2AN9A 1UMBA 2Q27A 1JHYA 4AWBA 2QI9C 3CRVA 3P4XA 4OGLA 3RC3A 3OF3A 3ZDDA 4DNQA 3KVVA 5JNSA 2NPOA 4KLNA 1A7UA 4TM7A 2ZS9A 2E4AA 3D1JA 2J46A 2Q5JA 3EEBA 3FETA 3VYRB 1VGQA 5DTRA 4PYNA 4DRXA 2VDNB 1TK3A 2BM1A 4BFCA 5AKIA 1P31A 4TWIA 1PT5A 3V4ZA 3ZWPA 1T91A 1H0SA 2FZCA 3DTVB 3MT0A 3PNYA 4EM6A 5FBHA 4NP6A 2NUTB 3DC2A 2WAOA 2J4CA 2W6IA 4EO7A 3IB3A 3TNFA 4D79A 4AO7A 1NJFA 2NZYA 2G9VA 1CVIA 1YQWA 3JVDA 4IDBA 1KMCA 1XRQA 3EGWA 5CNKA 1CR1A 3IIKA 5HPYB 3O92A 2IVFA 4D41A 5AM3A 4JLNA 4A4DA 3HNRA 1MO5A 1UP7A 2H2DA 2ZYRA 4YK7A 1R9JA 2QAGA 3AM5A 5IULC 4RD3A 4LRSB 3GFSA 3ZV6A 1BU8A 2EOAA 2WTAA 3LUBA 3NC0C 1CFZA 1W5FA 2WRZA 2XGOA 3GLHE 1AX9A 1FVFA 3SKYA 4JYPA 3IAFA 1WO8A 2UZIR 5H7XA 1F4VA 1JDBC 2AN3A 2AZ4A 2HADA 3L1VA 2NZJA 4U7WA 4BZZA 2VTBB 4NZPA 1KI7A 4EYGA 1DTEA 1ZD2P 1C1DA 3A04A 3Q85A 2NYUA 4PZCA 2YHAA 3EZNA 5EUMA 5JH7B 1B6SA 2YWGA 4NPAA 4P3NA 3AVUA 4GXTA 5DJ5A 5DYGA 4DLYA 1R18A 2JGFA 3CM0A 4N0DA 5CVVA 3EHEA 5BSRA 1LX6A 4M1ZA 2JVJA 4QSHA 4HDAA 5FD8A 3RNLA 1WXXA 3WK8A 2EX1A 2V6GA 1MNQA 2VPTA 2WSYB 2BFNA 1ZZGA 2BSAA 1ZKMA 5J2UB 5L3QA 5D1NA 2XZOA 1KJYA 2DETA 2P3QA 4ODIA 4DSUA 1LNQA 1V47A 5EMNA 5D51S 2NUPA 1ZBQA 1W36D 3I64A 3R3ZA 1OYWA 1S01A 2BP7B 1GPH1 1BX0A 1MFPA 1X3LA 4ZOLF 2QG4A 3NAGA 1R6XA 1RAAA 1N7JA 1DELA 3VYUB 2BJWA 1ITZA 2XRMA 3NAZA 3MOIA 4LRTB 3Q3GE 4JZYA 4Y7CA 1RC0A 2ZSIA 1O95A 3OZCA 5ILQA 2IT1A 1T9GS 2Y99A 2XBUA 3GL9A 5G1OA 5EJ2A 3AEQB 1FQOA 3I6MA 1C3OB 2G08A 5B1EA 3BCHA 1AOXA 3U17A 4NENB 4I1SA 3TUZC 3IP8A 1ZW6A 1KHHA 1NBOA 5C1DA 2JLXA 3RK0A 2CXPA 1JR3E 4LPKA 4EITA 1NYQA 4W5QA 2NTNA 4DL9A 1KWGA 3L6DA 2I54A 2RAUA 2Y0PA 2ZVPX 3L46A 3LLSA 4DVJA 1YUNA 1BMFD 5CA1F 2O54A 4YAKA 3MG9A 1NW6A 4XEUA 1V3VA 1Z4IA 3A1TA 1UBUS 3CH7A 3QU4A 3U5TA 5GADl 3DWGA 1UADA 1TA0A 3NIGB 1G3MA 3JQRA 3AJEA 1XEFA 1IEVA 5DKFA 2DKOA 1F2VA 4NQZA 3T12A 2FEWB 1D9XA 3ERCA 2GBLC 3W7AA 4QBHA 2JLYA 4ZU1X 5EIHA 5IAEA 4ZPXA 2GN8A 1QLJA 2LBPA 3ZCUA 1VECA 3X1MA 2C5AA 2J0VA 3F74A 3GDOA 2GR9A 3D0QA 1YFZA 4F9FA 1NSFA 3S1LA 5JAOA 1XVUA 3DLHA 3JPWA 1U3TA 2P77A 2PA0A 3JRWA 3R41A 4J0CA 5AKKA 5JC1A 2DBRA 3R8FA 5JT1A 2R1TB 5IKMA 2IKQA 5ADUS 4ZA2A 1CR6A 4P22A 5LQRA 4UBOA 4JC5A 5LVAA 3ITEA 2Q6LA 1IK4A 2Y0EA 3QEOA 5BOSA 1JB1A 3KYBA 5FI3A 1OXSC 1PG2A 5FOTA 2OM6A 4WJZA 5BSHA 3U60B 4XUGB 4QEDA 4OM7A 1T6BY 2DUWA 4J1TC 2G7MC 3SJ7A 2XF8A 4LYDA 4MIOA 4L0DA 2GWHA 4V3CA 4AS2A 3SLKA 4YIHA 2VXBA 4TZTA 3HR4A 1D7OA 3O8BA 3V32A 5JASA 2A0YA 1FFWA 2X7XA 4BDSA 1E1YA 1W88A 2VDLB 1Q0TA 1RXEA 1V11A 4I4TF 3WYCA 3DL7A 1HDXA 1M0WA 3EG9A 4UXIA 1BFDA 1BYIA 1DINA 3KDSE 3ETCA 3IKLA 5I9BA 3DVRX 3EGDB 3LP5A 4YYZA 4GRIA 4RA6B 4EJSA 5IT4A 1QONA 1H3NA 1F8XA 1RKXA 3AIOA 2QORA 4P38A 4PV7A 3BXEA 4MGYR 2YFQA 5DNYB 4IS2A 3A11A 4MPRA 4HK4A 2ODWA 1U2DA 2X76A 3SQNA 3SXUA 4IWXA 3IODA 4BP9A 4UU0A 5AHKA 3P94A 4JR0A 2HSEA 1HPLA 2PBZA 1R9NA 4NEQA 4KO4S 4PF1A 4C5CA 2ZB3A 3OP1A 3A70A 1ZHOA 5E3HA 2XKBA 4CMAA 4DLWA 1HL3A 3GFBA 1FRZA 5HJ7A 2GNAA 1L5ZA 3LVBA 2HDNB 1SCQA 3IT3A 3JALB 1ZESA 5F2EA 1WCXA 4Q7LA 3IR6A 1Y1PA 2E85A 3FCEA 1OLSB 2IDZA 3OLYA 4WI1A 3E0QA 3W7VA 3EF1A 3R3SA 2EGHA 2Q28A 1O58A 1LBQA 3EQZA 3EMKA 4MRRA 5K99A 3VQTA 3FIUA 1BX3A 1XF9A 3CNQS 1ZONA 1OAOA 1I94B 2ZATA 2GPNA 1N4AA 4GI1A 4KNYA 4MDYA 4OJMX 2QTGA 3RTEA 4A26A 1ZQ9A 3ZKWB 2XTZA 4YJ2B 4EZBA 3PFBA 1VJ0A 4BO4A 1BJRE 4MGHA 3OJFA 3M3PA 2P9QA 2PGXA 3AESB 3K5IA 4PCLA 4PLWA 2FB9A 1E2LA 4FZ5A 2R00C 4EABA 3TBKA 3QPCA 3TVDA 4KO2S 4DB2A 4B7CA 3C7KA 4HXGA 3L4BC 3KQNA 5CDFA 3KQTA 4GE0A 1RBYA 1XB2A 3BA6A 4YMLA 3QVXA 1N2CE 1I7NA 2ZJ5A 4TYNA 5KJCA 5AQEA 1SD5A 2ONJA 2DPXA 1N1DA 1VYUA 2HBYA 2QT9A 4ZYLA 1ZUIA 1JYFA 1QG2A 2GN9A 2IXBA 3DZHA 5EZYB 3I53A 3PFWO 4Q9IA 4CIBA 1YSCA 3PEYA 1RJ9A 4M0MA 3HCCA 1IJEA 3D0OA 3GLGB 1HE3A 2P5YA 4EEKA 1QIFA 4HAXA 4JB3A 5CBKA 1VM6A 2EZ4A 5DOZA 2HO4A 4RABA 2PBFA 4G07A 3U9TA 2H8GA 3TF5A 3H5VA 4ZC8A 1UCFA 4P58A 3SR4A 3UAZA 3QSYA 2R79A 3NRBA 4KXWA 5G0UA 1XX6A 4UOZA 4TKVA 1X92A 1YHNA 1E62A 3OAAA 3ODGA 4LHEA 3VR5H 1TO1E 2H63A 3AY0A 5D3MA 2BSXA 2O8NA 2YJZA 4EF6A 1E5QA 4KHZA 4WNAA 4YBZA 3IERA 5FPPA 2V6IA 4LSWA 2ZBEA 1DARA 3UN1A 3ZGOA 4PR3A 2AMYA 3C3YA 2WA1A 3CUKA 2B3DA 2CNBA 3R3YA 5TMBA 5EIBD 4K6CA 1BX1A 3N74A 3FYUB 4D92A 2O3SA 3DR5A 3RVRA 5CB8A 3W3ZB 1E77A 2AG1A 2HSZA 3GLSA 4OP2A 4YN3A 3R9XB 2NXWA 3T0FA 4UBNA 1VGRA 3EVNA 3GU3A 3UEOA 4I9UA 1X7WA 2J41A 3W8EA 1R0LA 3NKLA 2H11A 3ZU2A 4D4KA 4HQ6A 1XZJA 5J43A 4R1UA 3IAHA 1AU9A 2LCIA 5F78A 3WOVA 4R8LA 2D0IA 4JGIA 1AQNA 2BF7A 1V4BA 2I1VB 2HHJA 3LL7A 1OFUX 2AJCA 4U2KA 4X3PA 5E9AA 3W8FA 4BQEA 5IT5A 1D6NA 3B6KA 5GGYA 3FROA 2A59A 1EB9A 1N3YA 4OU5A 3PLAE 3PWTA 4OQLA 4IWNA 1YDEA 4R1OA 3K96A 4O63O 4F45A 3A1NA 3SDZA 4B3RB 1IPFA 3FNQA 4GZ3A 1TK2A 2PU5A 2G4VA 2F3SA 5IF9A 1T34A 1XMJA 1OGJA 3NEJA 3CHYA 3CS3A 1MTOA 4ZI5A 2C7BA 4ZIRB 5C1PA 1AO0A 5F64A 1N3LA 4JLMA 2A33A 2G9NA 3UT5A 3VNVA 3EZ2A 3GGDA 1K7CA 3A3YA 4HG2A 3SS9X 2ZT5A 1LPMA 5BN3B 3ZE2B 1Z62A 2HF9A 3WLLA 3PDUA 2B35A 1DZ3A 2OFPA 2PTGA 1RJEA 3EUAA 4NPHA 4D02A 3M81A 3FIJA 1WQ1R 3JYQA 4HN2A 2YQ4A 4BPBA 2ZW9A 1XD8A 1QVAA 3D3WA 4I4IA 3J81A 3RODA 1CZRA 2C9YA 3UOGA 5BMVF 5C8YB 5C37A 2WM8A 1KPGA 1ZFNA 4NARA 1P8JA 4QDUA 1RM4A 3QU5A 1BEZA 2PX2A 1ZI6A 3PC8C 1R6BX 1E92A 2I7DA 1XZHA 2A30A 2DBZA 2D2FA 4M53A 4NOKA 4PG4A 3COZA 2WPNA 3QVLA 1XE3A 4XZ3A 4BNFA 3TEFA 4HBGA 3G79A 3OOSA 3ESRA 4GKVA 3ZVLA 2GO7A 4B80A 3R0VA 4ZWNA 2QRZA 4EB6A 2YYYA 5SV2A 3RLFA 1Z0IA 2J08A 4UZFA 4CM8B 2IHTA 1RPJA 4MGZR 4KYTA 1SXJE 4W1SA 4TKMA 2PVCA 4ZVQA 3K1JA 3KT3A 4DLPA 2QX7A 2OCXA 3BDAA 4P7JA 4S0XA 2RJNA 4DQVA 4I9GA 1KIMA 3K0BA 3PXAA 4FVTA 1XWFA 4IHAA 2ECOA 1FMLA 2GT1A 4X8HA 4CKYA 3Q3IA 1SULA 1PL6A 2PCJA 1X1DA 3QG1A 1H8HA 4HJRA 1E5DA 1OVGA 2BELA 2HV8A 1ADJA 2QVYX 3K1YA 3TLZA 1G21E 3BIFA 1W4CA 3ZCTA 2KLHA 1K4MA 2YHBA 1BDJA 4HL6A 4A0SA 2I76A 4MMXB 2OG2A 1J1ZA 1G66A 1UZMA 3R8XA 1Y6FA 2Z04A 4TV9B 1NUHA 4L22A 3K1AB 4U6NA 1KFBB 1QAQA 2ST1A 5CCEA 1MO3A 2Z5GA 3PE4A 4WHMA 3U3MA 1K8YB 4FR0A 3NATA 1E4EB 4KZKA 1YRLA 4XQ9A 2I6XA 2XUGA 3C8MA 3FLMA 1LRKA 3MEQA 1XZBA 2NT3A 4LV5B 1WOMA 2VF4X 1TADA 2IA5A 3AJ9A 3H9JA 4Y1RB 5EFZA 5BQOA 1T9GR 3VAAA 1BXGA 5CDSA 3GJ6A 1KR2A 1VBNA 2QTFA 1JDPA 3DQZA 4GPBA 3WOHA 4FBGA 5FPHA 2X5OA 1WUIS 3AEUA 3OLXA 2X5NA 3BM5A 3P96A 4MW7A 4MS3B 3U37A 4B9AA 4GQBA 4ZVRA 4PHGA 3W5UA 5JV5A 3K4QA 1YH3A 4MUMA 5KU7A 1DP4A 3MWDB 3C3CA 1TF7A 3NHZA 4U2CA 3BF7A 4HQNA 4CKEB 1KOGA 3NBKA 3QVJA 3ZXIA 1V41E 4J2OA 4NPCA 4OI0A 1WSAA 5EY5B 2H0QA 3REQB 4ALKA 1P1RA 4KXXA 4EBFA 3Q7IA 2IV3A 3A6KA 3T4EA 3VZBA 1GGJA 2BFEB 2G5GX 3ZH2A 5HQTA 2LVBA 1SQGA 2J30A 5IAOA 3U7RA 1U5CA 1X9GA 4OP3A 3RFFA 1P0MA 1YJAA 4FILA 2G77B 4W7SA 4CHTA 4HNGA 1JG2A 3AKCA 3F8SA 3H6KA 3KPVA 5T8KC 3IRVA 2GCOB 3TINA 1HZZA 2SICE 3GBSA 2HT6A 4U7TB 3KZXA 2X1VA 1X42A 3T3HA 2QL7A 3I9NA 4MX8A 4RAQA 2XUAA 5H4HA 4RTLA 3RW9A 3TUJC 3DOJA 3KIPA 1QTRA 2VP4A 2WYHA 3DE6X 3M6IA 4LQ4A 2ZT8A 3NBQA 5IBQA 2QVLA 2AFHB 3RGGA 1E0DA 3TNJA 4DSZA 3AKYA 4Q12A 1O97D 2VS1A 1M1XB 1TGVA 1TMKA 3MJRA 4IX1A 2HX1A 5LA6F 1EFLA 3LM8A 4ZO8A 1FNMA 4ER6A 1PJ2A 4GYKA 4NV3A 3PFFA 4BWGA 4L8VA 1WMFA 1UBEA 1Q20A 4MROA 3PPVA 4QL3A 5A71A 5U4XA 4CFYA 1AURA 4DANA 2IUSA 3PA6A 3EDOA 1IRXA 1I4EB 5L4SA 4YRQA 1XD2A 2IEAA 2Y9MB 1GFSA 3HS3A 5IBPA 4UCWA 1ZH8A 2B61A 4QTXA 1F17A 1RU3A 4J1QA 3BJZA 2F64A 3HEAA 4TXHA 4AUNA 5JY1A 3LHSA 4GD3Q 5AK5A 3ZVRA 2R62A 3T9DA 5L7TA 2HIGA 1FTSA 2B7CA 1VL0A 4HLQB 4Q3KA 5EXPA 5LB4A 2G5CA 2WF5A 1CUSA 3UCFA 1WPQA 2FMUA 4R0NA 2TS1A 3FNRA 5LU8A 3LCVB 1PR1A 5CB4A 3ZN2A 1QCDA 1CQZA 2GXAA 2EWVA 3ANSA 1FP2A 3KFXA 4JJAA 1IY9A 1VP9A 3VZDA 3VZQA 5CXUA 2NLOA 5TARA 4Z49A 1VE1A 3SNHA 4G9BA 3DHNA 1LDYA 2AFVA 3MUFA 2RIRA 3SSMA 3VOBA 1Y1TA 5EPOA 4RYLA 3T7CA 3THWB 3ZGNA 3T3DA 3TI7A 3NWJA 4MKZA 4R2XA 1DAPA 3DOIA 4W9RA 4G41A 1N7IA 1SU7A 3SJCA 5C8XA 4TYPA 1QAMA 2WF8A 4QOSA 2BZGA 3OZRA 1V26A 4MLZA 4OQPA 3DNMA 4C3VA 4QVGA 5K5EA 1XU4A 5I45A 2NM0A 1W4ZA 4KQ1A 1T25A 5SZIA 1IM8A 3G17A 4R3WA 4C3UA 3NBYC 4TYQA 3MJEA 3B2QA 3D64A 4QSMA 4RJTA 2QRLA 3AR3A 2GPTA 1KAQA 3RKSA 1HNXB 3ACDA 5HQ3A 1ZK3A 1R0CA 1RD4A 3WKDA 4NBNA 4DVGA 2WKQA 2GPJA 3FRIA 3MRXA 3C24A 5HJEA 3C3XA 3MTAA 4ND8A 5AI8A 1IZ0A 2BW0A 3A3PA 5ENVA 2C9DA 2DY0A 4DCJA 3HXLA 4J7AA 4HLCA 1B1CA 5DU2A 4BE4A 4C89A 1DADA 2ODPA 2XKAA 3A8TA 2H2HA 2WK1A 2C5BA 1X7YB 4FGSA 5CTJA 1A8UA 2VXYA 3QUSA 1MJGM 3L43A 3MVEA 1O96A 3GRVA 5LIPA 1J2JA 4HY3A 2ERYA 4KLZA 4OXKA 4QJ5A 4TUYA 3R3VA 1ZJ4A 1KS2A 5TGZA 4YUYA 1YHZA 2P65A 4M6WB 4PAGA 1TQ2A 4H6PA 1NVUQ 2GD6A 4RSGA 4JKIA 2WABA 3LIPA 3PUXA 1I30A 2Q3HA 2XITA 1NJ2A 3N58A 4CLXA 3FI9A 3QITA 2VK1A 4F97A 4HGOA 1NVVQ 1W0KA 2O07A 3CR8A 3JSAA 1JFRA 3MLAA 3I9MA 2ET6A 4N5IX 4EZEA 1TKBA 1E2DA 4L1KA 4Q19A 3PPXA 4JBWA 4HATA 4QE3A 4P7FA 5AXDA 1S02A 3OD5A 4NZ9A 1VRVA 2AN1A 2QYSA 1SY7A 1C8VB 1QVZA 2O52A 3TIXB 3LRPA 1ESDA 3MB5A 4JEUA 5I48A 3L49A 1SQ6A 4II2A 3GVCA 2QE6A 5J9FA 2WYVA 5FWYA 1NVBA 4BNLA 2H57A 1TA9A 4A2WA 5LQSA 4WGGA 4ZT3A 3EXHB 5ERYA 5FFMA 1EUZA 1RCFA 1TC1A 4DJ5X 4CT4B 2Q07A 3KKNA 4E3ZA 1XP5A 3DWIA 4B44A 2XD4A 7REQA 2WAYA 4WN3A 1UBRS 2I4NA 3N76A 3QEMA 1HYQA 2NTJA 2HRBA 4QXRA 2W2TA 1CG6A 2V6MA 3CVOA 3L0PA 2IYSA 3DEYX 3YASA 1DCFA 4V3BA 2IYNA 4BP1A 3O5AA 3IPRA 1HORA 5CA0B 5FT9A 2W4MA 2C96A 2WFLA 4TZKA 2QNBA 4D9GA 4AMYA 1ADBA 3K8ZA 1QGUB 3GV0A 1WLSA 5L45A 1H66A 1RADA 1E4VA 1NW9B 4UDOA 4Z7NB 3KJNA 4F5YA 4YRRA 4F9TA 1PS0A 4JVOA 4HDKA 2ZYGA 3OPMA 3ON5A 3UGTA 5I5EA 1Z4MA 1T8TA 4A8PA 1LC3A 2YUIA 2ZXEA 3PE3A 2WM3A 7ADHA 3QVGB 3NJRA 3CO5A 4H3VA 4NCAA 4BIIA 1Z5VA 1SB8A 1HEIA 4AJ2A 4HH1A 3PI6A 1A9OA 3U4DA 3HVRA 4TVKA 4DMUB 5KPJA 2G8LA 2F9FA 1QQTA 3GPCA 3IDSA 5U1PA 1R0WA 2YC4C 2CNKA 1YRQA 4NYJR 3PGXA 2GOYA 1WHTA 1WHSA 1NN5A 2FP4A 1UXKA 1CT9A 1UWCA 3IQGX 4DW8A 2I67A 2COEA 3SYMA 1VIVA 5EE3A 2ZIFA 4QGFA 4HVCA 3RS9A 3TW8B 3P9NA 1YJQA 2BGMA 3W5HA 1R37A 1ZN2A 2AJDA 4FHEA 4QHYA 4YJFB 2I6SA 2G09A 2DUNA 2PV0A 1UMKA 2XT0A 4YASA 4NONA 4JI0B 4KTVE 4WCFB 4RK6A 4OU4A 4BAUA 3KB8A 1DWPA 3W05A 1U94A 1GR1A 5F9MA 3DG9A 5I6DA 3F5MA 3KTAB 3IHKA 1L5NA 3AV3A 4MB2A 1PWEA 4UXHA 5JAQA 1NG9A 3EEFA 1CRWG 1VJ5A 4P1ZA 4PFJA 1JLHA 1UF9A 1Y9AA 1E9VA 2ZBGA 4D74A 1Y98A 5HJ5A 1PGQA 2HTEA 1VI2A 3P4UA 1YZTA 3KV1A 3NTUA 1OASA 2ORED 1RPNA 3FHCB 4X8OA 4CMEA 1K8RA 4FCTA 4NWIA 3IAS1 4RDCA 1XXHE 2FK8A 1MQ8B 3DF9A 1KDYA 2BHNA 3PNSA 1GQSA 2ZI4A 2V59A 1J7KA 1MLDA 3LTEA 3RC2A 5FA6A 1EG7A 4I4TB 2H07A 3EA5A 2H7CA 5FLEX 2HRRA 3DQPA 2X0DA 2FPLA 2HFKA 2JFZA 2UZAA 1CY1A 3JQBA 4QOFA 5DXJA 5ECDA 2IYAA 5J40A 4ZKDA 1NWHA 2B9EA 4EPRA 221PA 2B21A