2IYZA

Shikimate kinase from mycobacterium tuberculosis in complex with shikimate-3-phosphate and adp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
169
structure length
168
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRNPGAVVRHILSRLQVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHIKIMATE KINASE
publication title Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 60
structure length 168
sequence length 169
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iyzA00
2V7QA 1KAOA 5FL7D 1XNJA 1OKKA 3KQHA 2Q3FA 1XTSA 3PJRA 1YR9A 1NRJB 1E9EA 5FBVB 3TE6A 4V02A 3TRFA 2QAGC 4DCNA 4Z1MD 2JGNA 4AIIA 2V4ZA 3KFXA 1N6OA 4IEEA 5EXSA 5FUXA 1DO2A 2FSHA 4RJLA 1ESNA 4Q47A 3MG9A 2RGNA 1MO4A 3DZ8A 2GDJA 1E69A 1NY5A 2JIZD 4R7ZA 3VR1A 2WHXA 3GLHA 3ZVMA 1BMFA 1DBSA 4Q9JA 3R7WB 4MH0R 2G1KA 1DS6A 3FMFA 3HR7A 3AVWA 2QP3A 3EXAA 4FW9A 2GA8A 2H18A 3E2IA 2XEXA 3W8RA 1K5GA 2Q3HA 4LJ6A 5KYKA 4JL5A 1JAIA 3RWMB 4DCVA 1KK1A 4C7OA 2MSCB 4AG5A 3P4YA 2GETA 1KI1A 2FV8A 1FFHA 2GXUA 3W8NA 5JZVA 2GWHA 3EZFA 1YKSA 4MDEA 3X1WA 1BIFA 1UJ2A 3KTAB 4EAQA 3IDQA 4DBLC 3WXMA 4QNRA 2IT1A 3GLGA 3AUYA 3PUZA 4JL6A 4DDTA 2RH5A 1Z6GA 1JQLB 4MYTA 4Q03A 3UMSA 1H8EA 3HU1A 4XVQA 3ZS9A 4G0NA 1XEXA 3CH4B 1KI7A 2P6UA 2WV9A 4P33A 2P6NA 4UQOA 4DVGA 1GL7A 1T91A 4TTQA 1ZW6A 5AUPB 4EPXA 1OIXA 3NIBA 1N6NA 1OYWA 2QP4A 1ZYUA 4OI1A 2OCPA 1AA9A 3EPLA 3KXLA 1MRNA 3OEED 5CJPA 1XWIA 2RKOA 3P1JA 4HB3A 1N6RA 2RGGA 1SHZA 1VDZA 1ZNZA 4XD7D 2E1RA 4MYUA 5DHAA 5KSPA 2EYQA 1NY6A 1XD2A 3KUCA 3T06B 1S0UA 1SXJD 4LUCA 2P5TB 4M9QA 1TQ4A 4OHVA 4C0LA 5BXQC 2IXGA 1CP2A 4EFNA 4BZQA 1NG9A 2XNDA 2CHGA 2YOFA 2VHQA 1Z83A 4U02A 2HUPA 1S3GA 4BFXA 1OSNA 2OT3B 4QRHA 5FR1A 4F4JA 5JHGB 4HDCA 3QPWA 1IM2A 2CLDX 4GMXA 2GF9A 3T61A 2WWIA 3RYTC 2J7KA 1P4SA 5ELXA 3B1XA 4DZZA 3FHTA 2RGBA 3LWNA 3EIHA 3TR0A 5IDVA 3WNDA 4DLTA 3FTQA 2JDID 1UFQA 2ZTSA 3A1UA 5EP4A 3R9XA 2C96A 2RHMA 2VEDA 221PA 2VF8A 4QBGB 3I8SA 2JLZA 1EESA 4LY6A 2QROA 4A36A 1T4GA 2BBOA 2NO6A 3IBGA 4Q66C 3EW9A 2OBMA 2ZS7A 4TT3A 3IPXA 4B32A 2CNWD 5KUTA 4PXAA 4PC3A 3TMKA 3V9PA 4QM6A 3CPHA 5DI9A 3DM5A 3RDPA 1KY2A 5B57C 2GTPA 1P60A 3RABA 2ODBA 1LFDB 4LV6A 1TL7C 4N0DA 4WIAA 2GK7A 5EZ6B 4C0QC 3WHKA 5JRJA 1ZM2A 4DLUA 4BFYA 2OV2A 2ZYUX 2F1RA 1SGWA 1W0KD 4G5RA 3SJCA 5JECA 1VCNA 3EPJA 4G5GA 3CNLA 2XOKD 3NH6A 4EJSA 3B82A 2NG1A 3GJ8A 4LJ4A 5B30A 2OAP1 3GJ3A 2CMKA 1DG3A 3UPUA 4PO9A 4NCKA 4JLVA 3BIFA 1HT1E 1KI9A 1YZTA 2BCGY 5CLLA 3ZZUA 2HT1A 4GI7A 5EXXA 4KVAA 3CW2A 1SKYB 2GHIA 3DM9B 3EPHA 2Z43A 5FTJA 2SHKA 4S2EA 2EWWA 3FKSA 2A5YB 2WAXA 3CNOA 3U2QA 3TQFA 4U7DA 4DDWA 2A7QA 4Q4LA 2DPXA 3VNVA 2OCAA 2HXYA 2VH5R 4JYCA 3UK6A 2QQ0A 5EE1A 4OK3A 1OH7A 1MABB 1NIJA 1ZINA 5KO2A 2ZAOA 4XWAA 1IN7A 3KFVA 4KFUA 3SJBA 4Q5IA 1D8TA 1NN3A 3QBVA 4KITB 4A0GA 3SN6A 4QFMA 4IXNA 1E9SA 2WJJA 1TU4A 2ZRKA 4NYMQ 3SYNA 2PLFA 2WMOB 4R2IA 3GJ5A 1RRFA 1XZQA 1US8B 1DE0A 2HEIA 2QBYB 2AXNA 4XVRA 4RCZA 1DTSA 1P2UA 3C8UA 4B34A 3T1OA 2GEVA 3I3SR 3IIMA 3CH5A 1CKEA 2YYZA 2ZI3A 4MRNA 4C30A 2FOLA 4A82A 1RIFA 4G5SA 4YMVA 1A7JA 1RKBA 2WSSD 1P61B 3PQCA 1T9HA 1TTTA 1MT0A 2YWHA 4IRUB 4PC6A 4US0R 4TMZA 2C9CA 4A2QA 1WDTA 1SULA 2BEKA 3I62A 5AJYA 1OW3B 1NJFA 1CULC 4TL7A 2IYXA 1AZSC 3OFNA 5FPKA 2UZIR 1BH2A 1HYQA 2IYYA 1M6NA 2QTHA 3DL0A 3GD7A 3KQKA 3BFVA 3KKQA 4Q1FA 3P4XA 1GKYA 1P2SA 2KBFA 5FPYA 3JVUA 4F93B 2RMKA 2PLRA 4US1R 1YRAA 1AGRA 5C1BA 1A5TA 2IYWA 4EFLA 3VR5A 3RS7A 3UG7A 1T0JB 1HEIA 2R44A 1E79D 1DAEA 2MMGA 1NKTA 4MRVA 1CS4C 4RY2A 3QF4B 2AD1A 1G41A 1EK0A 2I1VB 5AJXA 1H65A 2FG5A 3B85A 4B48A 1JPJA 3A37A 3MSXA 3LBIA 2VHJA 1PV4A 3GFOA 4KXFB 1X8LA 2QAJA 5EUQB 2B21A 5IK2D 1EX6A 1Z6XA 2IXEA 5JWOA 4PO8A 3U4QB 2WPDD 4FI3C 2FJUA 4DCTA 4NTZA 2FE4A 1YZLA 2QT0A 4BASA 2AL7A 2PT5A 5JI2E 3MJHA 3KKNA 4A8JA 2BKEA 4KODA 2ZRAA 3GPLA 1KYIA 1G3UA 1E2JA 2I3BA 3U7GA 4NYIR 4QGAA 2ZUCA 3AKYA 1Q1QA 1GDDA 3EZ6A 2H57A 4H1VA 2V55B 5F2EA 3W5JA 1E2GA 1UM8A 3G5UA 3QPUA 4PAQA 5BW8A 4LWZA 5FPTA 1VG0B 4NHOA 3CO5A 3NXSA 4M53A 3RS5A 1FUKA 1G5RA 1L4UA 2EFCB 3DMNA 3J81k 2ZREA 1X86B 2NO7A 1S9DA 2FH5B 4ZCIA 4TYNA 2LKDA 4HLQB 1RJ9B 1KHTA 4PSVA 4JLDA 3EA5A 2JLRA 2JATA 4JZKA 3FHOA 3IO5A 4E03A 3A6PC 2O8BA 1KI4A 3P27A 1EFRA 2BMFA 3PUVA 4IDNA 5CLQA 4C3ZA 721PA 1KI6A 2ZPTX 1EFTA 1ZC3A 2HLDD 4P4UA 4U5XA 3EARA 1J8YF 3ZIAD 1TX4B 3THYA 4ZCLA 1M74A 2JLYA 1LB1B 5F98A 4A0HA 4DLZA 1FTNA 3U44A 1F2UB 4IFEA 3NDBB 3AP2A 2DWOA 4XOIA 2O8DB 5TARA 1QG4A 2W6JA 2RGCA 3FMOB 2HCJB 4LYFA 4RVCA 5HKKA 2GILA 1XXHB 2F9MA 1XFAA 5J4VA 1FW6A 1XPUA 2F1JA 2JJ2A 2EVWX 3IIKA 3OE7A 4K8OA 4KAXA 4P4TA 4PANA 3OF5A 2ZI7A 2NZ8A 3KKPA 1XZPA 2C98A 1Q57A 2OESA 3JVVA 3OESA 3W3AA 4LC0A 4NZYA 5HE8A 1KOFA 3FE2A 1U0LA 3NBYC 1OXSC 3CRVA 1AQUA 3FHCB 1T5IA 1COWD 1X1SA 1X8JA 2BM1A 1HTWA 5JJIA 3D8BA 2IA5A 2ZJYA 1UKYA 3BS4A 4D6PA 3HJNA 1A4RA 5DSZA 5JSZB 1LY1A 3FVQA 3L0IB 3UANA 4CEIB 1IJEA 1Q1BA 2CE7A 1WCV1 1QDEA 5CM8B 3LQQA 4WZ6A 1WBDA 1U9IC 2QM7A 3QKUA 4QBIA 1K5DA 3HPQA 4TZ0A 3KTAA 2JLVA 3L2OB 1N5IA 2ZI5A 3LW8A 2FZLA 2ZR9A 1Z63A 2R6GA 2OBNA 3ONWA 3Q5DA 4Z51A 1TQ6A 1KK0A 1LVGA 1IN5A 4DB4A 3L0OA 1T3LA 5LB4A 2WSMA 4OQLA 5HCNA 3N2IA 4AD8A 1WXQA 1SXJC 3M6AA 2GJAA 5H8WA 1E96A 1NVWQ 1Q22A 2J59A 4QBFA 1ZM9A 2G3YA 1XF9A 2HT6A 2LCFA 3ZDQA 4ASUD 4S35A 4B3DA 2IX3A 3UMRA 3DPUA 3GLGB 3SYKA 1QHGA 1AGPA 5KDOA 3ETLA 2OLJA 3QG1A 2DB3A 3KL4A 4GBMA 5DNYB 4LBYA 2R6AA 1X6VA 4YQFA 2ODWA 1NSTA 2IK8A 1MKYA 2ZRFA 4IVQA 4PHFA 4MGYR 5EXPA 1RVDA 5FPSA 1Q20A 4PAMA 5KNDA 1UBEA 4UNQA 2GKSA 4TWZA 1RRCA 1S96A 1ZAKA 1CIPA 1P9WA 2E87A 3PEUA 2ORVA 3KX2A 3TNFA 3FOZA 2GVZC 2QSYA 3A36A 3VR6A 3PCRB 1QHHB 3QEJA 4RSGA 1GIAA 1XD2B 2YHSA 1D9XA 3RANA 4OQNA 4RKEA 2OCYC 1P5ZB 4RD6A 1NN1A 2QAGA 4W5WA 2ONKA 1IBRA 2V8OA 3Q7PA 4AYWA 4MRRA 4AKHA 3KJIA 3EAQA 2IW3A 3FYHA 2Z5FA 3DZDA 1MV5A 3BH6A 5JEEA 1CXZA 3GLFB 3S1AB 1Q3HA 3TSWA 5IHPA 2F6RA 4L8GA 4RD3A 2W6IA 3PFIA 1W4CA 1ZD8A 4FMCB 4DSTA 3C41J 4OQXA 4PX9A 3T34A 3V4RA 1OXTA 3QKRB 3Q7QA 2ERXA 4OHZA 3SOPA 3DMDA 1JJ7A 1N0WA 2QORA 4LJ7A 1G6HA 2JJ1D 2A3RA 3CRMA 5JMTA 1N5LA 1FQKA 4PHGA 2FFAA 3F8TA 2W0SA 5FOUA 1ZMXA 4TTRA 5AJVB 3T5GA 3BAFA 2QN6A 3B8HA 1Z5ZA 3QXXA 3PG5A 2REXB 2IYRA 1OIVA 3RAPR 4M1WA 5C4MA 1CR1A 1E94E 3D7MA 1C1YA 1II9A 4PZYA 2J7PD 4HI0E 2GAOA 2VP9A 2ZJOA 3LLUA 3K9HA 4B76A 3AKDA 4YONB 3FGNA 1SXJB 4W5JA 1XJQA 4RD0A 1GL9B 2ZETA 4IEIA 5CIQA 1MABA 1AN0A 1KNQA 2C9YA 1KIMA 4G5OA 1YR7A 5C2JB 2ZSEA 5FBLB 1E2PA 4LGMA 4Q1DA 3TKLA 1IXSB 1E2LA 2FU5C 4UKDA 3CX7A 1W48A 4BEJA 1AQYA 2C8VA 4IFBA 2QNRA 3AVPA 3P26A 4KLZA 1YR6A 1DG1G 5JCPA 3AF1A 2WWGA 1CRQA 2J87A 3T5DA 3QVUA 1I2DA 3SHWA 4OI0A 2KWIA 5J4LA 3ZZ0A 2C9OA 3OAAA 4M2LA 1SHKA 3SBEA 1XD9A 1UDWA 4L15A 2G9NA 1A82A 4ZCMA 3L8YA 2QTFA 1I2MA 1KDTA 3A8TA 821PA 4NCNA 4EKDA 4PO1A 1WBBA 3CF6R 3K70D 2QTVB 1CJUC 3MWYW 2F3RA 2BHRA 4FCVA 2FMXA 4BZPA 1XPOA 5AUQA 1JPNA 2FFQA 2IYSA 4XJXA 1GOTA 2R6DA 1J7KA 4TQAA 4YDSA 2KJQA 2W00A 4ACAA 1NP6A 2HCBA 3OEHA 1FMJA 4MRPA 3A58B 1GKIA 1RPZA 3CRW1 3MGCA 1OT3A 3L8ZA 4ON9A 1HY3A 1X3SA 2QE7A 5EE5B 3QKTA 1FQJA 1OJLA 3Q3JB 1HQYE 2VP4A 2QMOA 3LLMA 2XZLA 1ZUIA 3FB4A 4Q4AB 2NO1A 1M7GA 3CPJB 1W2GA 1VYVA 4TSFD 2FZ4A 4D82A 3CLVA 4A15A 4HATA 4B6FA 3U4QA 2GESA 2R65A 3EG5A 4GSYA 1UF9A 2J46A 2V6IA 4QOSA 3ASZA 2R8RA 3WP0A 4ACBA 2O8CB 5KOYA 4GNKA 4L9WA 3RWOA 1NMYA 1QHXA 1J2JA 4KBFA 4B3FX 4QGGA 4QJ5A 3N2EA 3AVXA 3I73A 2CJWB 1QVAA 2CHVA 5JJKA 2TMKA 5FTNA 2ZR7A 3AGPA 4B3XA 4UNPA 4XSGA 4LZZA 4NONA 2QM8A 5CYPA 3TUIC 2NOAA 1D9ZA 4Q48A 4YXWD 3RLFA 4M1OA 5J4HA 2WWYA 4KFTA 4WZAE 1E9FA 4MRSA 2IF0A 3WBJA 1Q12A 1Z06A 2Z83A 3AGQA 5K8TA 1RJ9A 2JAQA 4JSTA 1SVKA 2D2FA 4JL8A 1S2MA 3UXMA 2H7VA 2WKRA 3GJ4A 4EPVA 3UG6A 2GZDA 4BUJA 1IQPA 2OFWA 1E4VA 4FD2A 1OHHA 4K81B 4N1AA 1VYUA 3RRYA 1XEFA 3W34A 1N5KA 4URVR 1ZUNB 3GEHA 1VECA 3SC3A 1M8PA 1ZM7A 2EFGA 2J9RA 3K09C 1CR2A 1HQCA 1Z29A 2JLWA 1JR3E 2AHOA 4AY2A 4KFSA 4XVUA 4QJ4A 1NMZA 1TAGA 3KKOA 4PZLA 1KTVA 1TPZA 4TMKA 3ZZTA 1E2EA 5A5GA 5KNBA 1W5SA 1Z6AA 4C0SA 2O8DA 4KJZA 1KSGA 2G0NA 2YVUA 4JT2A 4HLUA 5CK5A 2IS1A 4PPFA 2V9PA 3F0TA 5FTKA 4RKFA 2FDCA 3QOFA 2FGJA 1X8KA 2QA5A 4PTLA 4Q9HA 1WP9A 4DLSA 5C4GB 4JJZA 3BB3A 3U44B 3KQLA 4IDQA 2GNOA 2XB4A 2GXAA 4C0KA 1QVRA 5JSZA 1GSIA 2BBSA 4CEIA 4NBSA 3K8YA 1A1VA 3OIVA 2GCPA 3A1SA 4RZXA 4NYJR 1KI2A 4LC1A 1IHUA 4LX0A 3A4LA 4L16A 1A2KC 4EIWA 5AUOB 2F1HA 1HURA 4B2PA 2X2FA 2QI9C 3LRPA 1GKUB 2KI5A 2PX0A 1J90A 4KU4A 3MWLA 4XWOA 1S1CA 4BLOA 4DLWA 1N0VC 2CCKA 4TL9A 3I4LA 4FMDF 2W2XA 4L4UA 3AVYA 1RZ3A 3VNUA 5FBQB 4B73A 1ZVQA 4AC9A 1W0JD 3LVQE 1L7VC 4Q18A 4TLBA 5UKDA 2X77A 2Q3MA 4QHYA 4LHZA 3VR2A 2CXXA 1E98A 1ZU5A 5E7JA 2OG2A 2IYZA 2IUSA 2VA8A 1DO0A 2QG6A 3KXKA 5SZKB 2VHCA 1Y3AA 3I92A 4TL8A 3K0FB 1Z2AA 5EP2A 3WY9A 1NBME 4TYWA 5DIFA 2QT1A 1NJGA 1E2NA 3MWJA 3Q8XB 4DJTA 1RYHA 1UPTA 2ORIA 3PVSA 4O2RA 2XITA 4M1MA 4JLJA 4EPYA 4IDHA 3EZ9A 4HYYA 2KE5A 2ZYWX 2ASEA 1E2MA 2XB2A 4TQUS 3WHLA 1OE0A 1TQDA 5FL7A 4JVMA 3IIJA 1U0JA 5CJ2A 4DB2A 5FR2A 1KNXA 4WZBE 3BB1A 1KO5A 2L0XA 1TEXA 4C0HA 2D2EA 4TYQA 2VPPA 4Z1MA 5DE3A 1BYUA 2VYFA 1U2RA 2WBLC 3TH5A 1NI3A 1XRJA 4HAXA 2QPAA 5LBIA 1W36D 1GAJA 2QPOA 2JIZA 5GJBA 1VG9B 1QHHA 1N25A 3MAAC 4OHWA 3GLIE 2BKUA 3LO5A 3Q85A 4PPQA 4PQYA 3RNLA 5CB8A 1Z6TA 1ZD1A 1DELA 3PITA 1LF0A 4HUQA 1DEKA 4Q00A 4A0FA 1MO3A 4BPBA 2XTNA 5GVRA 4Q7LA 4XTCS 2GBLA 1KGDA 4B47A 2H8KA 5AUNB 3WYAA 1E2FA 4M1SA 2VTKA 3GLFA 3S1AA 2WKPA 4FINA 4PC2A 4V0OA 2KBEA 4OK5A 4Q4JA 1AS0A 1YZUA 5B2ZA 1CTQA 4BFSA 3LBNA 4R2HA 2FEOA 3QKRA 5DN6D 4E07A 2QAGB 4LHVA 1MH1A 4PAOA 4JIMA 3LX8A 1NLYA 2QMUA 4NPHA 5TV2A 3H84A 2PMKA 5GJCA 4A1FA 1U9IA 2AK3A 1ZUHA 4HLCA 4G1UC 2EW1A 2HJVA 2VHTA 1KJYA 4L9SA 2EYUA 4DC9A 1ONBA 2BJVA 4YC7A 2ONJA 4ERNA 4LJ5A 1GG2A 2C04A 3A1WA 4I81A 3TBKA 3TW8B 3OEEA 2OFXA 2QMHA 2F1IA 3B1ZA 3V4FA 4KV9A 3B13B 5SZHB 2E9SA 1XXHE 4B2IA 1GL6A 2WJIA 3CWQA 3FFBA 4LPKA 3K53A 2ZS8A 4XD7A 3LXRA 3LA6A 3PUXA 3SBDA 4ZO4A 1SXJA 1ETUA 4P31A 4URXR 4UNSA 4BLRA 3BK7A 3JZMA 1G8FA 3EWAA 4XH9B 4B2LA 1B23P 2CVFA 2G88A 2F7SA 4LJYA 1T3SA 3PV0A 3MFYA 4LK2A 3WMEA 4FWTA 2QUZA 2VO1A 3EZ7A 4DLYA 1KDPA 2GXQA 4TMWA 1XMJA 5E7MA 2IS2A 1EXMA 2DFLA 3D6TB 1OYYA 2ZROA 1U8AA 1ELOA 2WWFA 1Q21A 2JDIA 4QNMA 5JCZA 1QG2A 2O8EA 1S1MA 1VCIA 1U94A 3GFPA 3X2SA 2HYDA 2WJHA 3K70C 3BOSA 2ERYA 5CDFA 1S4QA 3GQBA 3GLHE 3V00A 4BFWA 3C5CA 3SJAA 4D26A 4HAZA 4WA7A 5JS7A 2CNWA 1GTVA 1PUJA 4M1KA 5AWFC 3IEVA 4RD4A 1IOZA 3VAAA 2J0UB 1IXRC 3MWKA 3AM1A 3C14C 5HR5A 4URWR 4MQBA 1R5BA 2YNMA 5HPYB 2ZRNA 5DGXA 3BWDD 4LDJA 2ZIAA 1E1QD 4GOJA 4JJKA 1IY1A 5C46F 5EUMA 3Q9LA 2V3CC 1K8RA 1PLKA 1CF4A 1XTJA 2XOKA 3GLGE 2FGKA 3ZQJA 1L2TA 2QRNA 5FL3A 1E9RA 3DVLA 4M0LA 1GRRA 5LD2C 1VG8A 4KLNA 3CPEA 3SQWA 3A1VA 3PR1A 2VHUA 3C5HA 2WWHA 1NG1A 1QHYA 3FDIA 4M1TA 1BS1A 3N5CA 3UIEA 4EDHA 3TUJC 4Q4AA 1TEVA 2R62A 3IQXA 3MRSA 5JLJA 2QGNA 3I1FA 2DYKA 1Z28A 2IHYA 3C7KA 4QHSA 2CL6X 4AKEA 1E99A 2W58A 2CCJA 2WWWA 2N46A 3QENA 5TB5A 3O8BA 1M34E 3FPAA 4P3YA 1SVMA 2DFTA 2O5VA 5JI3E 5FUVA 1AK2A 1IY2A 1U0HC 5DISB 3BXZA 3RHFA 4Q19A 2QENA 2O8CA 2P67A 3RC8A 2FPMA 2PL3A 3KZ1E 3PEWA 3HYTA 3IGFA 2OXCA 3LFUA 2CJWA 3U3KA 1D2MA 1KDRA 4PHHA 2AKYA 1NVUQ 2GVDC 1VG1A 4GMDA 3GLFE 1OFTA 1G5TA 4CDGA 3LXXA 1KK2A 1NLZA 4PR0A 1Q1EA 1CJTC 1X1RA 4DRZA 5L3SB 2R6CA 4LI0A 1ZNWA 2BC9A 4A0RA 1VHTA 4DSUA 1NMXA 4FWIB 4FXPA 3T1TA 3CR7A 3EIEA 3T15A 2WSSA 3R9WA 4TN1A 3GEIA 1Q0UA 2ZI9A 1SVOA 3VX4A 2A30A 1FX0B 3IKJA 2O0KA 2ZRHA 3LW7A 2J0VA 3WMFA 4AURA 1YZNA 4HAVA 3AVUA 4NCIA 4CYMA 4CF7A 2RGNC 4AK9A 3VTKA 2F9LA 3ZYCA 2WZQA 1NVVR 1FNNA 1TU3A 3MCAA 2AWNA 1R0ZA 1TF2A 4LBWA 4Q1AA 1M2OB 2C2HA 3QQ5A 2ZVPX 3NC1C 1YZKA 2NZJA 4R9UC 3B9PA 4ZI3A 4QBHA 1FP6A 2G77B 3GP8A 2F43B 3DEFA 1XEWY 3GJ0A 1ZCBA 3KJGA 3KKMA 521PA 2NPFA 1O3YA 2VSXA 1E79A 1YJ5A 3OZXA 1XX6A 2CEAA 1W4RA 5B58C 1ZCAA 2J41A 4WAUA 4PC1A 4LHYA 4LBZA 3QXJA 2XTZA 3CB4A 2ZJ5A 3AKEA 4C0AC 2H92A 1VCMA 1ZRHA 2G1JA 2IWHA 2P6RA 4LHWA 2ZR0A 3KB1A 3U61B 3R8FA 5IK2A 1G4AE 2BOVA 2WPDA 3U7FB 5G53C 5CM9C 5IF9A 4MGKR 2GK6A 1T5LA 4Q02A 1G3QA 1BOFA 1GWNA 2I1QA 3JZAA 1GNPA 3G0HA 2IS6A 4BFVA 1XEWX 2PEZA 2Z4RA 4NL4H 1XTRA 4M21A 4PSKA 1OIWA 1SVLA 2ZAMA 2ZM5A 1SZPA 5SZJA 2ZJ2A 3I5XA 3LY5A 2IL1A 4US2R 2P5SA 3RS2A 5KPDA 5ANRB 3SS8A 3K1JA 1CEEA 4LOAA 1RC8A 2Q21A 2KSQA 4OJQA 4DKXA 2D7CA 4Q01A 1YQTA 3AF4A 2MMCA 4ZI2A 8OHMA 2XSZD 2VBCA 4B6EA 1KY3A 3BORA 4LV5B 1ZNYA 4JVSB 1FTSA 2ZI4A 3CM0A 4AG6A 4URZR 2ZITA 2RAPA 2HLDA 2WTUA 2CK3D 2DWQA 3K0FA 3TAHA 1G1MA 1ESMA 4RD2A 3ZIAA 2XZPA 4GZMA 2FF7A 1WF3A 1UDXA 2I4IA 2PCJA 2ZUBA 2QRZA 1W46A 3NHBA 1W36C 2IF2A 4I4LA 2ZI6A 3KUDA 3TIFA 5J4YA 3THXB 2GF0A 1E6CA 4CT5A 2GEUA 3K0SA 4O3MA 1XD8A 3WYGA 4JLKA 3IILA 3BH7A 2FA9A 1YZQA 3B6EA 2QGZA 3QG5A 4C2UA 2W0MA 3K09A 2J0QA 2AD5A 2X1VA 2WOJA 2VP2A 2H16A 1KJWA 3ND9A 3CR8A 5GJVC 3W6NA 4DLVA 3SI7A 1G3RA 4D4LA 3CRRA 1G291 4V0MA 1OV4A 4PSAA 4LYJA 1COWA 3K0CA 1ZU4A 4EFMA 4P4SB 3ADCA 4D0NA 1ZIOA 4XSHA 5HTKA 1R0XA 5GADl 3NH9A 4EPRA 1VKJA 1T8UA 5JRZA 3VKGA 3TVDA 1PJRA 3ZVRA 4X8HA 4OBEA 3R8CA 2OCBA 1RFLA 5B64A 4GP7A 5FBWB 1Z0KA 1E3MA 4CGZA 1R4AA 2ZJ8A 3MD0A 4ILEA 4A2PA 4D4JA 4BLPA 1P6XA 2DR3A 4URYR 3RRNA 4ZDWA 4IHQA 1P7CA 2HF9A 4HUQB 1VPLA 3KB2A 5DYIA 1LW7A 2W2TA 4EQ6B 4K46A 3QXHA 2D4HA 1U8ZA 2BMEA 2ZSAA 4Q1CA 4GPTA 3O8DA 2OSBA 5EXTA 4DUGD 4BRUA 3FMPB 1JR3D 5FOTA 1NLFA 1II8A 4DCUA 1ZBDA 2HF8A 5BN3A 4Q4JB 2Q6TA 1CJVC 1NN0A 2JA1A 4ASUA 1AZTA 1CJMA 4TLEA 1G4UR 1P3JA 1F2TB 1EWRA 2A5GA 2AXPA 2NO9A 2AFHE 4MGIR 1I4LD 2CLCX 1RW4A 1P9RA 3LQRA 3P20A 3SDZA 3UMFA 1XDBA 4WBSA 1E0SA 3QUSA 3CKLA 4TL6A 4D81A 1U98A 4LBVA 2KB0A 2ZSBA 4BGDA 4LPSA 5F3WB 4B3BA 4LV8B 1UAAA 4LHXA 3IEUA 2X8AA 1OXXK 2ATVA 1E9CA 1P73A 1WMSA 3AKCA 2IYVA 3RRZA 4A4DA 4M4SA 2OEPA 5EP1A 1XMSA 3O8RA 3DKVA 3HPRA 4JS0A 5JS8A 1KSHA 5E95A 4CZ2A 4B75A 1S8FA 3TSOA 2EFEB 4FCWA 3QJYA 3NDPA 5L3RA 1N6PA 2BWJA 1OFHA 1T6NA 3E5HA 3L0PA 4Q21A 4ZKEA 4C9BA 4CEHB 4TYYA 2Z0MA 4W5HA 2GCOB 2GJ8A 1SVIA 1U90A 4Z8XA 1W4AA 1LF5A 2AK2A 5EZ5A 3BFKA 2J0UA 2WOOA 2ZUDA 4Z54A 1TUEA 4V0NA 3DOFA 3E70C 2CE2X 3IHWA 2GCNA 3I72A 1BYIA 1IXZA 1H8HD 3NWJA 1B0UA 1Q3TA 2ANCA 2ZRLA 3W90A 5JWHA 4B43A 3U7EB 1KKMA 1V43A 2WICA 4RFSB 5BYKA 2O8EB 3BB4A 3L43A 2OAQ1 4V03A 2ZE7A 2ANBA 5FBRB 3H0KA 1OH8A 2JJ8A 2JJ1A 3R20A 1NBMD 3LVRE 2IS4A 4Q4HA 1Y63A 3ADKA 5G3YA 5LDDC 3WP1B 2EFDB 1XJ0A 1JBKA 2YV5A 1KAGA 1Z22A 4E09A 1FZQA 2GXSA 3ZLJA 4A8JC 3VKHA 2Q9BA 1AIPA 3GJ6A 4E22A 1JXMA 1XPRA 1R7RA 2A5JA 4HDQB 4DHEA 2XZOA 2IYTA 2BMJA 2CBZA 1FP7A 1UEIA 1XP8A 1PZNA 4D2IA 3H2YA 1T8TA 1AM4D 2EQBA 1AKEA 1UEJA 3IPYA 1AS3A 1C9KA 2PMDA 4WW0A 4IDPA 3U6BA 3CX6A 1DAKA 2VSFA 2ZSFA 4NYMR 3QEOA 5DI3B 3X1DA 3LAWA 2XNSA 2V6JA 1T0HB 1KMHB 4F4CA 1DAFA 1ODFA 3NBFA 3RRMA 3QVVA 3B78A 1UKZA 1G18A 1HE1C 4IVPA 2QEQA 2BV3A 4WVFA 5A0FA 1JALA 1EFCA 5FOSA 1M7BA 2B8TA 4JLMA 4DEYA 2AWOA 3PEYA 3NTUA 2PZFA 3SFZA 5L3SA 1KZGB 3MJRA 3AF3A 3BJIC 1E1RD 2VRWA 1L8QA 3CZPA 3M0EA 4HAYA 4RCYA 1FX0A 4Q9IA 1I4DD 4OK6A 2RHDA 3F3YA 3VQTA 1ZNXA 3K0EA 3OIUA 1MOZA 4NYIQ 3G82C 2Z4SA 4F4IA 4B44A 1D5CA 4D25A 4YMSA 2HXSA 4KI0A 5C18A 4M8NE 3GMTA 1AJEA 4JLAA 2J3EA 1QBKC 3PUWA 1E2HA 3AF0A 1MR3F 4DSOA 3ZVLA 4HDOB 3CRQA 2F43A 1JJVA 3VKWA 5J47A 4B71A 4OYHA 1ZP6A 4BRWA 1CLUA 1UBCA 5F9HA 4MDFA 3PUYA 1P2TA 2V7QD 3QBTA 1K6MA 2D62A 1P72A 1PLJA 5JFGA 1OKKD 3AP3A 3QF7A 3RS3A 1SKYE 2ODEA 4RFVA 4TSFA 4DWJA 4BECA 2X19A 3CF2A 4IJMA 4D0LB 4OQMA 5D3MA 1XTQA 4DDVA 3RVBA 5FFMA 2OXRA 4F7WA 5EE9A 1BO6A 1CR4A 2CCGA 1Q44A 2DFNA 3FFAA 1KSJA 4HUTA 1R2QA 4A2WA 4HLDA 4Y0AA 3BRWD 1W47A 4LJAA 4TTPA 1MO5A 3VU9B 1BMFD 4BE7B 4LYAA 3BBPA 2ZYVX 2GAAA 1E2QA 1I4TD 2WIAA 3BERA 2CHQA 3EASA 1W44A 4I1UA 3TLXA 5BYJA 2YC4C 121PA 4YXWA 2ZRJA 4AYXA 4CRWB 4BLQA 5A4JA 4D0GA 3O47A 5H68A 2A2ZA 4HSEA 3AEZA 1M1YE 3I5YA 3BH0A 4I1SA 4KO8A 1KI8A 3WYFA 4CW7A 2BM0A 2Y8EA 2QY9A 2OE2A 1KO4A 4A6PA 4DT1B 2PCLA 4D4MA 3W5IA 1H8ED 5TY0A 4FMCF 2ZRGA 3U7HB 3OIWA 4EPTA 1RYFA 2OM2A 4ABYA 3B2EA 3THXA 2EU8A 4YMUA 5IT5A 2WWXA 4B3CA 3FWYA 1FPMA 1JXOA 5TMPA 5EP3A 3EX7C 1OB5A 1EX7A 1D2NA 3B7GA 3PIRA 1E9AA 1PUIA 2ODNA 1YVDA 2CLSA 5CK4A 3RS4A 2G0TA 1EFUA 2VSOA 3NG1A 4HEJA 2WKQA 3HU2A 2RCNA 3N70A 4PQFA 4ARZB 5P21A 3EWSA 2IHBA 2QSZA 5FI0B 3QKSB 1YHNA 1IN6A 5EJEA 3FKQA 2OBLA 5L3QB 5KHOC 2O0HA 1Z0AA 2XNDD 3LX5A 1JNYA 2XTMA 1YZGA 4OL0A 4P4SA 5HZHA 1CR0A 3DOEA 3HR8A 3P32A 3HU3A 5JHHB 4ITRC 2OLKA 2A9KA 5LPNA 5EE3A 4HAWA 4J0QA 4MKGA 4HB4A 1OLOA 4G5QA 5DH9A 2PH1A 1KO1A 4FIDA 1XCGB 4MUBA 4NDZA 2V54A 1U81A 2ZU0C 4IOKA 1G17A 2AX4A 2FSIA 2NGRA 4TT3D 2ZRDA 4GZLA 1OPXA 4TMTA 1EFHA 2VF7A 5KDLA 3U3JA 4DSNA 2O8FB 1W0JA 3HDTA 2DCUA 2O52A 1TF7A 4EQ6A 3SE0A 2X2EA 1G8PA 2DHRA 2N42A 3CWZA 4JBXA 4H9GA 3ADDA 1P9NA 4MITA 4EUNA 1DADA 1R8SA 3CUEF 4CT4B 3PEVA 2EWVA 4BLSA 4X8MA 2ZJAA 5FTLA 2P0EA 3C15C 1R0YA 1F2TA 3ND8A 2OILA 1VMAA 1Z0IA 4LYHA 2BBTA 4QHTA 1GUAA 4NH0A 1KMQA 1GNRA 1G19A 3OIYA 4IDOA 4Q9KA 3ZD6A 4Q7MB 2UVQA 4M9ZA 2Z6VA 4QJ3A 3QIAA 3FMIA 3ASYA 2ECKA 4MYCA 1II8B 1P2VA 3X1ZA 1N0UA 2YJTD 1G16A 4IOJA 2D06A 5JEDA 1LS1A 1DAGA 2WJGA 3FKSD 1AS2A 3VHLB 3ZQ6A 3EZ2A 2RGXA 3DDCA 2VIIA 3TQCA 2NMVA 1ANKA 2JLQA 2R2AA 2IEZA 1D2EA 1M7HA 4CEJB 1E0KA 1Z0FA 5HE9A 4ESVA 1G3IA 2R6FA 1VHLA 4X8LA 4A92A 3NEJA 1TUIA 5D3QA 2XAUA 4CEHA 2B7CA 3OHMA 4OKSA 2GCOA 4TLDA 3TVTA 3EPKA 3CZQA 1G64A 4JLNA 4AYTA 1TNDA 3K9LA 5E7IA 3PXGA 2ZU6A 3NBXX 1O87A 4TZ6A 4JBYA 4GFDA 4BLTA 3EA0A 2MSEB 1UBFA 4RFSA 2C78A 1JB1A 4Q7KA 5CITA 2EFHB 5GJWC 5JBQA 2CL7X 3KDSE 3R9IA 4BQSA 2ZQ5A 4O2LA 5DN6A 2YKGA 3ECCA 3BC1A 3LNCA 2NIPA 1LS6A 4ZDJA 1G7CA 1QRAA 4Q7JB 2W83A 4II7A 3RC3A 1OH5A 3I8XA 5SZIA 4PC7A 3U60B 1VCOA 1G8GA 2HJGA 1XBTA 5BWMA 1TF5A 4W7SA 1QZXA 4TQ9A 2HYIC 3RS0A 2BIFA 2B92A 3OFND 4LRWA 3AV0B 4ZKDA 2GEDA 3K9GA 4TMVA 4R71A 1E9DA 1SKQA 4EPWA 2DWPA 1N6LA 3UWOA 4W9MC 1IJFA 1E9BA 2ZYTX 2CDNA 4JSYA 4TLAA 5K8UA 2C95A 1LNZA 1W0KA 5FOXA 4OHXA 1N2CE 4G3XA 4GP6A 4QGHA 4FMBB 2ORWA 1E2IA 1VIYA 4KYUA 4UXJA 5KNCA 3U6KA 1WB9A 4FCTA 1KZ7B 1SVSA 3NHAA 2D3WA 4Q4HB 3C16C 3A4NA 4KCGA 3QNUA 3IQWA 2IYQA 4WXRA 3HYRA 1AKYA 5KDDA 1EGAA 2ZVQX 4NCJA 4BFTA 5DI3A 1W49A 3B1WA 2AN9A 4UJ3A 4UXHA 1OF1A 2VL7A 2GJKA 3VHXA 1KMHA 4V0KA 1E0JA 3EC2A 4Q9LA 5K8LA 4IKEA 5H70A 3ICEA 3B1YA 2MSDB 5L8VA 2VP6A 1E4YA 1U8YA 3EIQA 2QQEA 3TR5A 2FX3A 2G6BA 3IUYA 5DYGA 2REOA 4V0LA 1ZC4A 5F9FA 4JVNA 1QHIA 3THWA 5KSOA 4IXMA 1R5OA 2B7BA 3LBHA 3REGA 4B74A 2AKAB 1IN8A 2H17A 4P32A 3T1VA 2BCJQ 1PLLA 2DY1A 3W3ZB 3DHWC 1Z8FA 5TVKA 2W2VA 1YRBA 3SR0A 3T35A 2YWEA 4HLUC 4JKYA 4IVRA 4PPNA 3TW4A 2ZSDA 1E1QA 1FL9A 2WVJA 2ZE5A 2ZJZA 2D74A 2ZEJA 1KKLA 3WNBA 2HV8A 1GFIA 1IN4A 1YR8A 4OI4A 4ZPXA 1OFUX 2FFHA 1EFRD 1JAHA 1R5NA 3AB3A 1E2KA 2CVHA 3DO6A 1KJZA 2NO0A 1OXUA 5FI1B 1GRQA 4AKGA 1CJKC 2IWRA 4I1VA 4F91B 2J45A 2FEMA 5BN4A 3K70B 1R0WA 3TK1A 1VIAA 2VP5A 5DO9A 3SU8A 4ZDKA 3Q72A 2DFKB 5EE0A 3WRXC 3AF2A 3D31A 4KYIB 3WMGA 1IY0A 2W6JD 1N5JA 4B35A 4IW3B 2QL6A 3K9NA 5HKKD 2XGJA 4XIGS 3K0AB 4TYPA 2NQ2C 4DEXA 3GLIB 4ZIRB 2JJ2D 3OE7D 1SXJE 4JKIA 4IOLA 4M9XA 2BEJA 2OZEA 3LH5A 3RSLA 1R10A 2DBYA 3VU9A 3SNHA 4LJ9A 3BD9A 4YMTA 1MO6A 5FPHA 5IRCD 3SQXA 4DCSA 2BJWA 3U3OA 2JCSA 2XXAB 1UBGA 2FNAA 4GOKA 5LD2B 2C99A 4B3GA 3VR3A 3NKVA 5E4FA 4JMPA 4P0TA 5D3MB 3UATA 1Z07A 3DKPA 4ZDIA 1PVOA 3QI2A 2ZE8A 4NP6A 1UKEA 5CIWA 5LB2A 5CDFE 4N0EA 1J99A 1W1WA 1Z2CA 2OO7A 2VP0A 4NYJQ 3KQUA 4RD1A 4URUR 3LD9A 4UJ5A 621PA 2FFBA 2PX3A 5M04A 1DAIA 4DT1A 4DXAA 2P3SA 4NCHA 3VMFA 4NU0A 3L0SA 4YMWA 3W9YA 4LCBA 2RB4A 1T3HA 4NE2A 3QSYA 4KSBA 2D7DA 1Z0DA 2PJRA 3SJZA 4GRAA 1LTQA 4XTRA 1S3SA 4HZUB 4QM7A 3A1TA 2Q9CA 3ICQB 1G8YA 3LDAA 1Z0JA 4BFUA 2GBLC 2ZRPA 3U3MA 5JJLA 5TXGA 2JLUA 2AFIE 2PT7A 1ZJ6A 1A2BA 4BZXA 4OI2A 4AWXA 4C4PA 2A5DA 3GJ7A 3VX3A 1V5WA 4ARZA 2C77A 1ZM4A 3R7WA 3AUXA 1YE8A 2ZJBA 3QKSA 3I32A 3F5FA 4UNNA 3U5ZB 3H4MA 3MUFA 5L3QA 5H1YA 4I1OA 1D6JA 2VQSA 1JECA 4Q1BA 3QXSA 4WXPA 1VTKA 2NPIA 4JLOA 4GOXA 4F92B 4LJ8A 4KBGA 3SYLA 2UZ3A 3O8CA 4QC2A 4BEBA 1L4YA 1F3OA 1UADA 3GLHB 4CIDA 2QP9X 1W7AA 2WJYA 2YOHA 3NVAA 3BGWA 4QGFA 1U99A 1OFIA 3AP1A 1Z08A 1QHNA 2RGAA 2VLIA 3HP1A 1S9HA 4N3NA 1KSFX 1YU9A 2B8WA 4MGZR 4M1YA 3TSZA 4OHYA 2WJVA 1WE2A 3SEAA 5E3HA 5DHFA 3C4JA 2P2LA 5EQTA 3B5JA 2O8FA 4BFZA 3VR4A 4CVNA 4EJSC 2IYUA 2XSZA 4C7OB 2BDTA 1G8HA 2AR7A 2QZ4A 2W6ID 4UXIA 5G41A 4PPGA 1N6IA 2XJ9A 3AH8A 5FOVA 1XTIA 3GCGA 4C2TA 4TMXA 2ZS9A 1SQ5A 2FPLA 3T1QA 2N1BA 2CK3A 2FN4A 2IC5A 4POAA 5CB6A 2J5XA 1XEXB 1G7TA 2FSGA 4OJKA 3AVOA 1TADA 5FH9A 3AVTA 3IBYA 4NMMA 3CIOA 2IXFA 2ZRBA 6Q21A 2WIBA 2F55A 3TGPA 2GJ9A 1ZM3A 3HWSA 4B33A 1HH4A 3T12A 1KDOA 2ZANA 5KU1A 1XJCA 4R98A 3CNNA 5AJWA 3CBQA 3UWKA 1HE8B 1JEDA 4FN5A 4RZUA 2LWIA 1EG7A 1N6HA 1XU4A 2IEYA 4GL2A 1DAHA 1HV8A 3CONA 3SZRA 1G21E 4JT4A 4OQFA 4JLBA 1QHSA 4CEJA 1XMIA 2GZHA 3IHLA 1F5NA 1UKVY 4DIDA 1OB2A 1VYTA 4KVGA 1MRSA 1NL3A 5KPJA 1CU1A 4I99A 1NKSA 1G5PA 4PFSA 4AKIA 3AVQA 3I61A 5FUWA 4O25A 4X8OA 2G83A 3AVVA 1C4OA 3B1VA 1R6BX 2FPKA 3A4MA 3QY0A 3MLEA 2FSFA 3M4YA 1W36B 2ZXUA 2PZGA 4FMDB 1WQ1R 2WMNB 1GZSA 1XTKA 4MKIA 4QXAA 2NTYC 4LSGA 1CRPA 4MKFA 2YINC 4NKRA 4ZV4A 2RGEA 3OAAD 4JVLA 3U3RA 4UNRA 2YZ2A 4Y0VA 4DIEA 1KK3A 2IUTA 3QXCA 5K8IA 1NF3A 2UKDA 1IONA 4YDHB 1FOEB 1RRGA 4ESHA 5KSYA 2JASA 4DUGA 3KXIA 4QL3A 1JR3A 2QU8A 2XX3A 1JI0A 1TQ2A 5HZKA 2YWGA 3X1YA 1DAMA 1RE0A 1IAQA 3EC1A 4PQRA 4A9AA 2RGDA 5J40A 1OH6A 5DLQC 1P62B 1FUUA 3OEHD 2O0JA 3B60A 4EJSB 1NVXQ 2JLXA 4QKQA 3SFVA 421PA 2JEOA 5BQ5A 4A6XA 3KQNA 2QE7D 1DPFA 4HB0A 4IOMA 2BMDA 4XWKA 1GRNA 3KJHA 1F60A 2YOGA 3TUZC 2BVNA 3Q5EA 1GVNB 2ZRMA 3GEEA 3MMPA 3PENA 4Z8YA 4KHZA 2IYLD 3LV8A 5GVSA 2YWFA 1DARA 2J7PA 2OHFA 4KFRA 2PEYA 3UKDA 1GILA 2PJZA 1GP2A 1US8A 3QE0A 2WAYA 5G40A 2QBYA 1Q1ZA 1XB2A 1XMVA 2IBMA 4G01B 4PZZA 5FOWA 1KI3A 2OFOA 3SHFA 3ZVNA 5AJZA 2IUUA 3ZS8A 4F38A 4U00A 4V0ME 1RRPA 1HA3A 2PBRA 4H1UA 4BWYA 4C0BA 3IO3A 3ZGXA 1KO7A 1GM5A 3TJZA 1HT2E 2GRJA 2Q9AA 1N6KA 1FNMA 1II0A 1DVRA 1NIPA 2V1XA 3TAUA 1Z6YA 1EWQA 3KJEA 1H8HA 3REFA 1HUQA 5TDHA 1Z47A 3ZD7A 1TMKA 3M1IA 2XJ4A 3VFDA 3ZJYA 4KSCA 2ZRCA 3WRYC 2A5FA 4D4KA 5KSZA 4QG7A 3THWB 3AQ4A 1CBUA 1NBMA 3L82B 1NNEA 2ZRIA 1OHHD 4GDFA 2ATXA 5G3ZA 3QF4A 4C0JA 4D80A 2R9VA 3NEYA 2FWRA 1WRBA 1JEEA 1NSFA 4DLXA 1G6OA 3GJXC 4M9SA 2A78A 1N3BA 5KTYA 4WOPA 3E1SA 3CX8A 3NBZC 1NVVQ 3H1TA 5BN5A 3W6OA 1E32A 1DOAA 1E0AA 1J70A 2ZE6A 4JLPA 4RZ2A 1ZIPA 3K0AA 1LV7A 3GLIA 4MUAA 4ZIRA 1R8QA 2K5UA 3H86A 1BKDR 5J4KA 5CYOA 5HCIA 1J8MF 4MYHA 1XCMA 2YC2C 3ZH9B 2GZAA 3W6PA 1Z3IX 2Q0HA 2QPTA 1GNQA 2BBWA 4PHTA 4O0MA 1ZD9A 2B6HA 4HZIA 2REBA 1W4BA 2XXAA 1G3MA 1JR6A 1SVWA 2WM9B 4MA4A 4MKHA 3GFTA 2OUKA 1GITA 2JLSA 3CF0A 4A8JB 1F48A 3RSOA 2F3TA 3B9QA 3QPVA 5AK0A 4E5UA 1JQJC 2J0SA 4L5BA 1E1RA 5FUYA 1G20E 3NC0C 5J5CA 4DLRA 1F6BA 1G7RA 1G7SA 3BFXA 4HAUA 4Q1EA 4JBWA 3WNCA 2V1UA 5AR1A 2P65A 4M22A 2C5LA 1P75A 1KO8A 2C03A 3D3QA 1W2HA 1F2UA 4TLCA 1W5TA 4YLGA 3ADBA 1OXVA 4RZ3A 3K0CC 5JWRA 2O8BB 3BE4A 4JYBA 2H1LA 2CL0X 1QF9A 2HDNB 1KI6B 4HZUA 2GJSA 3WBKA 1XXHA 2PZEA 4HB2A 2H5EA 2QMEA 5FTMA 2J1LA 3X1XA 3THYB 1G9XA 2LKCA 1WA5A 4AI6A 4GT1A 1XCPA 3THOA 4DDUA 1NN5A 5L3VA 1FMLA 1E2DA
chains in the Genus database with same CATH superfamily
5DB4A 1H0RA 1I80A 4HGNA 1PUXA 1BDBA 4QREA 3OCJA 1WMBA 4Z9YA 1KVSA 4V24A 4BNDB 4WDQA 4F0JA 4O8CA 3DEKA 3LX6A 3WZLA 4AY4A 5FBVB 5EESA 3QEBZ 1P0QA 1SD1A 1TQ8A 2QAGC 1K9SA 1JDBB 3A25A 4AIRA 2HNBA 4KRGA 3KFXA 4AIIA 1N6OA 1DO2A 4LCEA 2E4VA 5AIBA 5BPHA 1FDOA 3J80A 4WBNB 2H1OA 5F4ZA 1E20A 3LKBA 3MG9A 3V33A 1MO4A 4M37A 3DZ8A 5JR3A 1NW9B 2JK1A 1HDYA 4Y2RA 3P9SA 5ECYA 3T4XA 2HA7A 1GG5A 3LFTA 3UAVA 3ZY6A 4Q9JA 2IPXA 2XWBF 1SMKA 3KTDA 4OXRA 2QYOA 3ZWCA 2ZULA 3IE1A 1B15A 4G0QA 4E70A 1R0KA 2OZPA 3B8EA 3O90A 1ENOA 1X1EA 3HB5X 3KZXA 1CY1A 1M6EX 4LJ6A 4MDYA 3MYYA 2YHUA 2QYTA 3G79A 4G1MB 3RVRA 1VL6A 2XT6A 1ZUWA 5HKBA 5HRCA 1NI4A 4RM2A 4AG5A 4PXYA 2GETA 3GXBA 3CUVA 2VDWB 2GXUA 3JWIA 5IAKA 1U3FA 4Z1OA 4LXTA 3KTAB 3UTDA 1SCBA 1RKQA 1UMDB 3IDQA 3KEGA 4QNRA 4LXUA 5L6LB 3IKTA 1NX6A 3BZUA 5EJAA 4Q03A 2CT8A 3UMSA 1GN9A 1GUYA 3HU1A 5EXEA 3ZS9A 3MXOA 4R0MA 5K20A 4P33A 1M2NA 3CMMA 4NABA 3U9LA 1RAHA 3CA8A 3ZTTA 4DVGA 5A3SA 1MCZA 1VA4A 2OC4A 1QOZA 4K7JA 4EPXA 3RSGA 5C37A 3EAFA 4DOMA 4RTSA 5AW0A 3C1UA 3ENQA 3TYXA 4U3JB 2QP4A 2HC9A 1MEOA 3KXLA 1MRNA 4NU5A 1PWHA 4XGKA 2RKOA 3P1JA 1TVKA 4BBZA 4BZWA 1UOQA 3D6VA 3VTZA 1N6RA 1THGA 2XZTA 3QVMA 3GAZA 3C6YA 4MV3A 3ZX5A 4CI0B 4PZCA 3OZEA 1ZNZA 2VBIA 4XD7D 4YJHA 5DHAA 1DRVA 3QYAA 1JVSA 2EYQA 1XD2A 5KSPA 4ANFA 4L2IA 1SXJD 1U2EA 2IYNA 2P5TB 4ITVA 4LUCA 4OHVA 4C0LA 3FG9A 1C7RA 2W48A 4MUIA 1AQNA 1X7XB 4OGKA 1HETA 3DOIA 4DNFA 4C05A 2ATCA 4C0WA 4BZQA 2XNDA 1GZ7A 3ZE8A 2XUPA 3SZGA 5EYPB 3WOVA 1OSNA 3DYVA 2RI6A 4MMZB 4RHYA 3ZCRA 1Y3DE 2DBZA 2WINI 2ZBPA 3LL7A 4HDCA 2O4UX 5I8WA 2E4XA 1HRKA 5LU9A 4DV6B 2P9HA 1LWNA 4O1MA 3WNDA 1TTQB 4YRJA 2AOUB 2JDID 2LP4Y 2H2DA 2YVQA 5CNKA 3WQBA 3A1UA 3OICA 3DVSX 1ISIA 4XA8A 3P96A 5F12A 2RHMA 3SJ7A 4CG3A 3OMWA 1TJ4A 3G2NA 4QBGB 3LVBA 3WGZA 2HU2A 4DC1A 3I4CA 4ZAWA 2QROA 3PNVA 4OSOA 5C1DA 1USKA 1KBZA 4V0QA 2OBMA 3IPXA 5KUTA 4MDHA 3TMKA 1SXHA 1L4FA 4M0CA 2FEWB 3C3PA 3RDPA 4ZEWA 2XRFA 5B57C 4UZSA 1GPUA 1SO8A 2GTPA 4LY3A 4M7RA 4Z0PA 3SF8B 3RABA 4KO1S 1LFDB 4LV6A 2QUBA 2P4QA 4WIAA 2NYRA 5IUKC 5TGDA 2CBGA 2NUBA 5DWVA 4G25A 3H9JA 4EI9A 4Y2YA 4I50B 1EM8B 3PTZA 2OV2A 4BFYA 2OA0A 2HO5A 2PGAA 1KVQA 3CCCA 3SJCA 3W0LB 2DUJA 4A8HA 3SEQA 4P3NA 1GQSA 3A4VA 3CNLA 3G1UA 3EPJA 4D74A 3O21A 1JIUA 1U3CA 1VPEA 1WW8A 2WTEA 1EUDB 1QVWA 2NG1A 1X7YA 1ZLYA 1T1RA 3EE6A 3OQ6A 3T7EA 5I9NA 1W30A 1DG3A 2ZSIA 4PO9A 2HQOA 4ZQBA 5THKA 4MV5A 1HT1E 1GTMA 1KI9A 2A3NA 2R1TB 2XODA 4UE6A 3TDMA 4MEAA 4BQRA 5I7SA 4Y2XA 4P98A 4H7HA 4GR5A 1AUPA 3NCTA 4Q16A 4UNIA 3K71B 1FMFA 3CW2A 3ZE0B 1TT5A 1SKYB 2VF5X 2VVTA 5I7RA 5JJ5A 1VLJA 2BGMA 5ALZA 5TSDA 5FTJA 1RAIA 3DFUA 2VDUE 3JRNA 2QLTA 1RU3A 2YN2A 2WAXA 3R3XA 2Q5FA 5E3JA 4MRMA 3OCCA 1IJBA 2A7QA 1CB0A 4LVCA 1EEXB 3CUYA 3NOOA 4DW8A 3OLZA 3L84A 3NV7A 3VNVA 1JEJA 2JIBA 4JYCA 1Y81A 2FW1A 5TIIA 2HSDA 3BDVA 4Y9SA 3T9EA 4EB0A 2JZNA 3E81A 2XLCA 1NIJA 3DV0B 4HNSA 2PTHA 4B3TB 2ZAOA 1M2JA 4XWAA 3PA8A 3FZGA 2VZ9A 1D8TA 1NN3A 2H1HA 2VJKA 4NENB 4KITB 3SN6A 2JFHA 4EZBA 4MV4A 4QFMA 1WVMA 5JNWA 3QUCA 3KKLA 1RLUA 3NASA 3SYNA 1P7PA 5LDHA 2NU9A 2PVSA 1WUHS 5SYAA 4TKVA 3GY0A 2F67A 4R1UA 1RRFA 1MTOA 1AURA 5DHTA 1EHYA 1US8B 2X41A 3G68A 1Z8NA 2H4WA 5AVWA 4XVRA 5J3JA 4XJSA 4X41A 1VJ0A 3C8UA 3AB7A 2O23A 4K9MA 4Z7QB 1BHSA 2FETA 4XZ3A 1YFZA 2YYZA 1X9HA 3C8ZA 2H7XA 4A82A 1XQ1A 5B1SA 3H83A 3DBRA 3CW9A 1TTTA 3W04A 1M1UA 3CLKA 5THXA 1YI1A 4IRUB 1Q14A 1E3TA 2HNKA 1HDGO 3BK2A 1OX6A 2C9CA 1WDTA 3SK0A 1V9LA 3KZOA 4IXTA 4MLDA 4CL8A 3I62A 4CDRA 1B0AA 3TCXB 4RQAA 4RKWA 1AZSC 2WJ3A 2GD1O 4UTVA 3HWX1 4BNXA 2Y2VA 2UZIR 1BH2A 2IYYA 3DL0A 1M6NA 1UP4A 3GD7A 5AP9A 4BNWA 2UU9B 1I2ZA 1QMGA 1V8OA 2JLAA 4JX8A 4MWEA 4PONA 3KKQA 4JU9A 4Q1FA 4RYDA 3STWA 1IE3A 3IEMA 2Y1DA 3LHFA 4HYEA 2YJZA 3L4BC 3RTBA 2KBFA 2YV3A 1L8OA 1FUIA 1I2AA 5AQEA 3B3QA 1NC3A 1QDLB 3MGGA 5K0GA 3JQGB 5C1BA 5HUHA 3B9RA 4FHZA 3TI9A 2C3OA 3WMRA 5LYJA 2R44A 4HNTA 4B4WA 3LRXA 3GZTB 2MMGA 3N2GB 3DC2A 5E8RA 1YBFA 4RY2A 3QF4B 2QS9A 4HNHA 4ZQEA 3RUCA 2JI9A 3L7KA 3L4KA 1DHRA 1S8OA 5HGXA 3AHFA 3L18A 3LBIA 2I6XA 2VHJA 1H66A 2XUHA 3FWHA 3IX7A 3QLVA 3R3WA 4OXIA 1X8LA 5H7XA 5EUQB 2HK8A 2QTLA 1H3EA 1XZKA 3ZI7A 4ZP1A 5ELMA 4NTZA 2FE4A 1YZLA 4HF7A 3I8OA 2QT0A 3LE8A 4H2DA 4FYVA 1C3XA 3R5SA 1VKRA 3GO4A 2LDXA 1WP4A 3ZD8A 2W8BA 2C8KA 3KKNA 3WGTA 1PV1A 2CL5A 4JBIA 4KODA 4YJ3F 2DR2A 4LC9A 3UCFA 4DIFA 3HNOA 1XQVA 1VPWA 1NW6A 4IGEA 4M8IA 4QGAA 2BKXA 1D07A 4CM6A 1TJPB 5F2EA 1UM8A 3G5UA 3R1IA 2Z2ZA 3QPUA 1UT6A 1KMCA 1P18A 3ETGA 3N2NA 4LWZA 4QPPA 3UAWA 2AZ4A 1Q0TA 3VXKA 2AOXA 4NHOA 4FK8A 1ABBA 2EW2A 1SOWA 3F73A 2PV0A 5D5PA 1BE6A 3G89A 1LSSA 1EP3B 2R8YA 2ZREA 1X86B 3F2VA 1S9DA 1GG8A 2FH5B 2ODAA 3O8OA 4JLDA 3E48A 1ODIA 1WSDA 3AJDA 2OO5C 2XGMA 3A6PC 4FONA 4E03A 3GUYA 3M9LA 4EY4A 1KI4A 4IDNA 721PA 3ENVA 4DA7A 1KI6A 2VAVA 2ZPTX 4JI4B 1VJTA 2AFHA 2HLDD 3HU5A 3HBNA 4U5XA 5BSVA 4RHUA 3L8EA 1TFRA 1TX4B 2H08A 3JYOA 3ZIAD 4K1LA 3SXUB 4LN1A 1R9GA 1U1IA 2QN9A 4OIFA 2JLYA 4R1SA 4GEGA 3ENZA 4H18A 1WS6A 4PLGA 1KDYA 3CCFA 3IB6A 5IKEA 3LYLA 3QFFA 4KMMA 3U44A 1PTJA 3JAMA 1QGED 4ZAZA 2P5YA 2AVDA 1FBNA 4I9NA 4IFEA 3CLSC 4B4VA 2Q7OE 1JJIA 3JD0A 3LCRA 2W6JA 3O38A 2I9PA 3EAGA 1T35A 5EQJB 3E9YA 1C9NA 5U1PA 4ZHSA 4AJJA 4NV0A 1JQ3A 1XLUA 2HCJB 3R7AA 1XXHB 2YXBA 3AUAA 1XFAA 3AJRA 1MN6A 5SY4A 1FW6A 1CK4A 4ML3A 4MVJM 3OF5A 1ILEA 2IHUA 2OESA 1EUCA 4Z9XA 4LC0A 3FE2A 5BUQA 1YZFA 1C3OA 3FHCB 1T5IA 1COWD 1E5VA 1X1SA 4M0UA 3F71A 5LNK6 1K08A 3DDSA 5JJIA 5KJCA 3RSHA 4M83A 4XARA 1D1QA 2ZJYA 2QPLA 3E18A 1UKYA 3VSCA 1TLLA 2AMVA 2V7TA 1A4RA 2JKZA 2O2HA 4HVTA 4KYVA 3UANA 4QTTB 3WKCA 1KRWA 3D1LA 1IJEA 1Q1BA 4C7JA 3R7SA 5KX5B 5CM8B 3I5UA 1TKBA 1OOEA 2QJOA 2JBWA 3AR3A 1Z17A 3F49S 3AR4A 5K6TA 1MQ8B 2MR5A 2VT2A 3V80A 3GCDA 1KMMA 4QFDA 3VZSA 4D8YA 4LE0A 2RAUA 4EATA 4UBMA 3JQBA 3LW8A 1P1KA 3WYEA 1G42A 1YK0A 2ZR9A 3LP5A 4JYMA 4WD3A 3OTWA 1Z63A 4ZVMA 4I50F 3ONWA 4KPUA 5C9ZA 2HD4A 3AYZB 4KE8A 4OLHA 5I4KA 2FQYA 1A7UA 3RVSA 4DB4A 1SURA 1T3LA 1SOUA 3VH1A 2J5QA 3D6NB 1ZH6A 2PUJA 2VDVE 4Y7DA 4F3CA 3M6AA 2GJAA 3SQMA 1KEEB 1S7GA 5IM4F 2XE6A 1Q22A 2OD2A 3COPA 3OWHA 5A9RA 3SFTA 2X0DA 2G3YA 2LCFA 3ZDQA 5BNFA 4DXDA 4BGEA 5KOIA 2E4WA 4IX1A 5BYBA 2A9VA 2HHCA 4S35A 1U8EA 3UB4A 3ZHZA 3GLGB 2G82A 3UMMA 4KN9S 3LLCA 4H1TA 4KUHA 3ETLA 2O4CA 4D8TA 3VPSA 2I4NA 9LDBA 1ZHFA 3LDFA 3QPBA 1L1QA 1OWNA 3RGWS 3WAJA 2DB3A 4WK4B 5JXIA 3ORHA 1QP4A 5DTMA 4CTMA 2OD9A 2AZXA 4S1PA 1Z15A 1NSTA 1QHFA 1YV9A 2ODWA 4L8WB 5FPSA 4HGPA 2HGZA 1Q20A 4HY3A 5EKUA 2GKSA 2Q6IA 3LI2A 5HPYB 1RRCA 3DAHA 1ZAKA 4OGLA 4BNZA 2VOJA 1I0LA 3W5DA 5CX1B 3NW9A 3DWGA 2ORVA 1HYEA 3OZTA 3P2YA 2ID8A 5A4IS 1ZJZA 2GVZC 1P7WA 3MMNA 4JCCA 3VR6A 1QVZA 3I42A 3R41A 2QV7A 1I1QB 4G4GA 1Y8QA 5E4TA 1TW3A 2BGTA 5BWOA 3ZIDA 1H4SA 1F7UA 2OCYC 3EQ8A 3CG4A 4KVZA 1V71A 4EHLA 1SUFA 2G70A 2ZW9A 1YF3A 1IBRA 2V8OA 2NYAA 4AYWA 4MRRA 1OAAA 2R87A 4OHRA 4DIMA 2GD2A 1SB8A 2Q99A 1EVKA 2WAOA 1M1XB 2Z5FA 1W5EA 3RNOA 4BNJA 4E3WA 2C97A 1GCAA 3CURA 4NOKA 2NVUB 4AJNA 2MOKA 5IHPA 1ZHOA 4OMUA 4TSRA 4I19A 4RD3A 4FR5A 4OBWA 4IYJA 4MB6A 2OVBA 1R3UA 3PFIA 4PG4A 2QMYA 5DTQA 2B2XA 5FP0A 3U3DA 5U9CA 3FCOA 4U9HS 2Y3IA 5IARA 4ZEVA 3G5TA 1K97A 4O4HB 1Z33A 3IVGA 2H52A 3QKRB 5C1IA 1H05A 3Q7QA 2AOVA 1P91A 2B4QA 1QORA 2M6RA 2OV4A 3H1EA 1JJ7A 1N0WA 2GZ2A 1WCYA 3GP5A 1HG1A 2C82A 2DY0A 5I51A 2JJ1D 2CDRA 2HU5A 3DBOB 3OC0A 1N5LA 3R0QA 4R1OA 5JMTA 3B70A 3M8KA 4MUMA 4TTRA 5A6SB 4ZOAA 3BAFA 4Q93A 3B8HA 1JXQA 5JZMA 2I7TA 1XAHA 2C2OA 2Y1OA 3LTNC 2V6MA 4ZAYA 1CUJA 1KEZA 3QW4B 4K2HA 5FNVF 1NW3A 1HYBA 3IQGX 1WO8A 2H85A 2EZ8A 3H2KA 1MX5A 2IIPA 1N36B 4KE6A 1GPLA 1TDJA 2GAOA 4B0OA 5ESDA 5DT2A 3CZAA 3VKVA 1RRKA 1UAYA 3FGNA 4P34A 3K0BA 4NK4A 4J8PA 1KQFA 3CLRD 2IIBA 2Q4OA 3HRKA 3NGXA 3Q5GA 3TZKA 4W5JA 1M83A 3QNWA 4IRMA 4E11A 4BU0A 3NLLA 4XVCA 1AHPA 1DRWA 4IEIA 4TT8A 5T41A 4EW6A 1AN0A 2W2OA 5GOTA 3D1JA 3KSMA 1T0UA 3GDGA 4PX3A 4YP0A 2EJVA 4G5OA 3SX4A 1TZMA 5ABPA 3UJHA 5C2JB 1Z5OA 4C5BA 2V7XA 4L28A 2ZSEA 2X3FA 1E2PA 4LGMA 4ZOQI 1IXSB 3QU4A 3WHIA 5DTRA 2V5UA 1GPMA 4NX2A 1BU8A 1W48A 3OD5A 1HYHA 4JWKA 2QNRA 3UWDA 3AVPA 3P26A 5E0OA 5JCPA 1CRQA 1NXTA 1RKVA 5A3JA 2FQQA 5FNZA 1NW4A 1BGWA 2SICE 2GKGA 1BG6A 3RYIB 4L9RA 1VL2A 4GQBA 1NXQA 3BXGA 3PX3A 4QXQA 3WGOA 5KVVA 3ZZ0A 4BQQA 2GF2A 3OAAA 3WRWA 3SBEA 3WIUA 1XD9A 4ZAXA 3U7IA 1O5TA 2N3ZA 2EKZA 1GDTA 3L8YA 2QTFA 1I2MA 5AD1A 1AKTA 1PU2A 3BMOB 1NVGA 1ZONA 3E6AA 2GRUA 4NCNA 4EKDA 2DFVA 4E5NA 5JXWA 5B3JC 1WBBA 1CCWA 1FJXA 1E1KA 1UBLS 3K70D 3L06A 1S2GA 3V42A 2WQ6A 1UM9B 1RVV1 1T15A 2F3RA 2BHRA 2XNHA 4RK4A 4XEUA 1QCZA 2Q41A 1DIHA 2ZIZA 1RD4A 4ENRA 3O1IC 3FJYA 2EBUA 4TQAA 1OXBB 2TECE 2KJQA 2W00A 4E33A 3C2QA 1NP6A 5BR7A 1RQNA 4HNUA 1V3TA 1GKIA 1PK7A 4ND5A 2XZDA 1TO1E 4UVGA 4CM8A 1KDZA 4F1JA 4UOEA 1HGXA 1E58A 4ER7A 4HJRA 3U39A 3CQ9A 4QOJA 4CMIA 1EIZA 3LT5A 3UV6A 1EFVB 1HZJA 2FSVC 3CCBA 3IIEA 1VHJA 1XZNA 2V58A 3FCEA 3K1TA 4G2NA 2QW0X 3LLMA 5AKYA 4PNEA 3AIKA 4EECA 3EXFA 5HSGA 1KYXA 5EMJA 1RAFA 3FB4A 1H69A 2Z58A 2E1PA 2MU1A 4Q4AB 4RXTA 4KQWA 1LPBB 1L7OA 1UQTA 4XD2A 2Y66A 1IOWA 4TSFD 3V4VB 5HBGA 4Z4CA 4B6FA 3THRA 4PGGA 4XPIA 5H3HA 1H0HA 2J46A 2O2EA 1BKYA 4LISA 1NRIA 4Z9FA 4P54A 4I4CA 2DPLA 1LVHA 4RADA 3ASZA 3S6JA 4CTJA 4B80A 5KOYA 1YXMA 2H4XA 4L9WA 1NMYA 4KBFA 1J2JA 3WK6A 5EGSA 4KYTA 2G5GX 4X3OA 3FXAA 5BPFA 2CJWB 4WNAA 5BN1A 1QVAA 3ISVA 3UJNA 4IY1A 1AUVA 3BCHA 3AGPA 2PWZA 4IDAA 4UNPA 4GLFA 1C7JA 4NONA 4XSGA 3ROQA 4U2DA 1QIDA 3OWOA 1ZI9A 2XA2A 3RKUA 3RLFA 1U2SA 4CKCA 4KFTA 3L0DA 4E2FA 1IHXA 1KS9A 2OYSA 2UXCB 2GCEA 3BE6A 1PW7A 1A5ZA 1S02A 5DYWA 2VPIA 2Z83A 1M76A 2JAQA 3G2QA 4FC6A 1TCAA 4IGKA 4LYYA 1JXAA 1M0TA 4JL8A 5SV2A 1PJLA 1KU0A 3OM0A 3QWAA 4KQ6A 1Y3FE 3GFFA 2R6HA 4YAKA 3L6EA 2W93A 3KJQA 2C1EA 4OU4A 1IQPA 4ZMRA 2XQVA 4OM7A 5T4HA 1VYUA 3RRYA 4ZVQA 1XEFA 1GTL1 3W7AA 3WL5A 3SC3A 1SFRA 2EFGA 3D8NA 1DBQA 5JS2A 3R6DA 4BV2A 1N78A 3SX0A 2R96A 3EXIB 4QD3A 3T3PB 1Y1SA 1CR2A 1HQCA 4HH0A 1V8PA 2JLWA 3AERB 4KFSA 4RK1A 3KYDA 1QGOA 3KKOA 5KWIA 3O4VA 1NUQA 3FPJA 1YMQA 3ZZTA 1RWXA 5T4BA 5A5GA 5KNBA 2JAHA 2FN3A 1X70A 3EDOA 4C0SA 2O8DA 1X1TA 1RQ7A 5FHQA 3Q87B 4WLEA 4UAUA 1KSGA 1O8CA 4KXQA 1Z39A 3H97A 3C0KA 1JN0A 4ZHQA 4OQYA 2YVUA 4OOFA 1OYOA 4WKCA 4WNYA 3V32A 3SP1A 4EYKA 2WTAA 3QX8A 4HH4A 1YQXA 3CZ5A 4JT2A 3P2KA 4HGOA 4Q12A 2IS1A 3NGLA 2FDCA 3RAFC 2FMHA 4M60A 2FGJA 1J6UA 2P0AA 1WP9A 4M99A 4Q9HA 4MP6A 5C4GB 4DLSA 4JJZA 3BB3A 4H1WA 2J6BA 3TOCA 3KQLA 2I78A 1IVSA 3ABRB 1OU0A 3K0HA 3KPJA 3PC6A 4IFTA 3ZJ5A 4LZLA 4HHEA 1OFVA 2DJIA 3M2PA 4IS2A 4PS0A 5JSZA 1VJDA 1JU3A 3I6ZA 4NBSA 2PFKA 2GCPA 4QDKA 5B58T 5LQUA 3FVVA 1KI2A 2TSYB 2J09A 4UOQA 4ARAA 7YASA 1YI0A 1IHUA 2HMWA 3OQIA 4X90A 5TMEA 1A2KC 1U7ZA 2R00C 2QW1A 1NASA 2QI9C 2PH3A 3IELA 1GKUB 3LRPA 3O84A 2KI5A 2IZOA 4L78A 2IP1A 2WIKA 5BSHA 1KYYA 2LW7A 3AUJB 1D04A 4HXGA 5BR4A 1N0VC 13PKA 2CCKA 3AI2A 1D2GA 1CUGA 4GPZA 3O4RA 4PTYA 4K6MA 2W2XA 1GCUA 3CLHA 4HDRA 1NBHA 1XN1A 4Q18A 3ACBA 1BCRB 4G0XA 4TLBA 1JMVA 2FPIB 2BGRA 2X77A 4N82A 1JT2A 2XMRA 1F0NA 4LHZA 2IPMA 2XQGA 4YAOA 4DG5A 1E98A 4LF6B 2OG2A 2IYZA 3N7AA 4K0RA 4DANA 4YA6A 2IUSA 3KXKA 4WHMA 4DTIA 3ZGVA 2C4UA 1Y3AA 3I92A 2XGOA 4UUMA 1W1UA 1NF8A 1QOQB 1Z2AA 5EP2A 3WY9A 4WA8A 2QL5A 2RHRA 1U5AA 4MP3A 4OD0A 4DJTA 4DKJA 2EBWA 3CNEA 4YPFA 1XK7A 1CQPA 1TK9A 4G23A 3U0BA 1F0YA 1J24A 3VOSA 5BSEA 3SC2A 4RMGA 2KE5A 2PKRA 4ZT2A 1CUZA 3GNQA 4LXHA 1EEHA 4CKZA 2GX6A 5DNDA 1U0JA 4DB2A 4J1SA 1HE5A 1KNXA 2DPMA 2Q5JA 3BB1A 3GARA 2L0XA 4OAQA 3ZGLA 4ZV7A 4BIIA 1KU6A 2BMVA 3O5AA 4IAOA 1CDDA 5I4CA 2WBLC 4ZVLA 1XRJA 1AUXA 4HAXA 2QMZA 5LBIA 1FDTA 1GAJA 4F7DA 5BMVF 2HWUA 3L9XA 4KQIA 3W2IA 5T3YA 2BEWA 2AN3A 4BVJA 3IQZA 1QHHA 1VSVA 5J2TB 1ID8A 2EEPA 2BKUA 4PPQA 4PQYA 3EBPA 3KVYA 2IU0A 3RVNA 1GPYA 4G63A 2NN3C 3IOEA 4IO0A 3G0BA 1W9MA 5FHRA 3ULKA 4B8WA 3F7NA 1MLDA 1IMOA 3D43A 3KEMA 3QGMA 4GE0A 4KX3A 2FFJA 4HUQA 5IJWA 1JBQA 4L5CA 1O8BA 2IIVA 4FGLA 4H3SA 3OZAA 2OCXA 3V97A 4AL4A 5BQFA 2DM6A 2OZKA 3GF4A 4J2HA 5AUNB 1KGDA 4LY9A 2PD4A 1N8SA 1E2FA 1WHSA 4B6QA 4NNPA 2AC7A 4NI5A 4WQMA 3GRCA 3HCCA 1JLLB 3S1AA 4LRXA 1Y9EA 2PX2A 1KARA 1DKMA 4NEQA 3UFXA 1ULTA 3V6LA 1X39A 4LRQA 4YAGA 1MP0A 2HA6A 1ZA2A 3UNXA 3SHTA 3T1YB 4BFSA 1QRDA 5HF8A 4NBKA 1GV0A 2IOFA 3ORQA 1SA0B 4R51A 1NAHA 3IR6A 5DN6D 4E07A 1Z5PA 3LPDA 2VATA 4O2BB 4BMXA 1R5JA 1V7ZA 2FMIA 3LT0A 5ALQA 4EOGA 4KG7A 2QMUA 2Q2OA 3E84A 3H84A 2YZ7A 2BRUC 3O1JC 4A1FA 4BWVA 4TV9A 1U9IA 4TXNA 3VI3B 1CD5A 1YA4A 1ZUHA 5HF9A 2VTEA 3UXHA 2VHTA 4B4DA 2EYUA 1SQGA 2Y0CA 3LUDA 1GG2A 3FDJA 3TW8B 4X3CA 1UP7A 4CR7A 1B14A 2OFXA 2QMHA 2NZVG 2PJUA 2NXJA 3B1ZA 1FTQA 3KEFA 1X1AA 4DF3A 1RHKA 1XXHE 3LT1A 2PSHA 3PSHA 1AMUA 1XDSA 4XD7A 1R4MB 3DULA 3LA6A 1ENYA 3JR3A 3PUXA 3L0YA 3IXMA 4K9PA 4MGEA 1SXJA 2HRDA 4ZO4A 3SX2A 5KNCD 3DFZA 4UNSA 4OY3A 1LDYA 1A4XA 3D2LA 2BMWA 4B2LA 4A2CA 3HB4X 3L4JA 2HDOA 2F7SA 4LJYA 3ANNA 3FI9A 1V3UA 3PV0A 3WMEA 3TFOA 4P7BA 4OXNA 1MFZA 2CHEA 4G0MA 3EZ7A 3FBTA 2FPPA 3WOHA 5J2UA 4JB8A 4BN5A 5E7MA 5B55A 2YL2A 2CB0A 4ENWA 3AFIA 4XKJA 4ESOA 3DTVB 2BFCB 1K4MA 1EXMA 2G1UA 3D6TB 1OYYA 1MX1A 3OPYB 2VPZA 2JDIA 5AOAA 3BTOA 2GLXA 2VK8A 2ZDGA 1D0SA 1QG2A 1X92A 3IOYA 3ZUPA 2HYDA 4OFXA 4KXUA 1G8JA 2D0IA 2WJHA 4KTTE 2PQ2A 2Y77A 2ERYA 4OP1A 5CDFA 4DV7B 1RXVA 2G7MC 4IV0A 3GQBA 4AY6A 3GLHE 1B73A 4KGVA 1L5HB 1EUZA 1Y89A 4WA7A 1RJFA 2XUOA 2ZK7A 4JHLA 1IOZA 4RD4A 5G0VA 1EZ4A 4ND6A 1UJ6A 3ASVA 1FS4A 1IXRC 1WUKS 2QRLA 1STOA 4PY2A 2ZWOA 1XO1A 4HNQA 2FAXA 3A31A 2B6NA 3EY9A 1R5BA 5AKJA 3W4KA 2IH4A 1UXGA 3L7BA 1LCIA 4ROSA 4ATNA 4RJTA 5C46F 1PR0A 5EUMA 4YWJA 1NYQA 4J6FA 1RIIA 3SDSA 4QLBA 3KQOA 3GLGE 4GWKA 2Y67A 4KACA 1L5ZA 1E9RA 1I0IA 3H5RA 3BICA 5K7SA 3HWRA 1JG6A 5LD2C 1W34A 4EQZA 2DUMA 3T3MB 3CPEA 1QP8A 1HSOA 1UMCB 3I1YA 1NSYA 2GBFA 2G25A 3LXUX 2PUHA 3C5HA 3R6LA 4J0CA 3T38A 4TRNA 2VPWA 3FYUC 1BS1A 4RIHA 1NVAA 3JAWA 4UPEA 4EDHA 4P3PA 1R8JA 2V6GA 3SSAA 1RZVA 1E3JA 2J5RA 2JAWA 3ZY4A 2IKSA 5JDCA 3ETHA 2GCGA 3QZUA 2NSLA 1R4ZA 5CT8A 1LQ2A 3GRPA 3I1FA 2PZMA 4NH4A 4NU6A 4PN7A 3C7KA 3N87A 3O74A 1BD4A 4FQ8A 1IB0A 5EJGA 2GAIA 5SY9A 3QWIA 3S28A 5TB5A 2OBFA 3UYLA 5ALOA 1EXVA 2QD3A 2IY7A 2BI7A 1EA7A 1PQPA 3JQ8A 3S2GA 3BREA 2QENA 2P67A 5FLEX 5BV7A 1JHRA 2FPMA 3G2HA 2XDQB 3HWWA 2HSWA 3CEHA 3LFUA 4U63A 3AIIA 4FNGA 2YQ5A 1NVUQ 2ZB7A 1S8NA 2X1LA 3HCNA 3PYLA 5EHNA 1OFTA 2I2XB 1FDVA 1G5TA 3DWFA 3QFTA 5FWXA 3D54D 3WI7A 1XZLA 4CKEB 2ZSHA 3F6BX 1Y42X 1RJDA 1Z7YA 1NONA 1Q1EA 3LKDA 4PX5A 5HJ2A 3JQ9C 3VR3D 3ZHVA 4CIVA 5J43A 5L3SB 5F77A 5MN4A 2OP1A 1ZNWA 4WN3A 3PKIA 4A0RA 2P68A 2GPSA 2PS3A 1UPCA 4FWIB 1KPHA 4IO1A 4N3BA 1GGEA 5CFZA 2D5BA 1RQ2A 2QRGA 3OEYA 4IZ6A 3WGLA 4F60A 1I7QB 3ZE1B 2GEFA 1P45A 3KT0A 1N3IA 2DQ4A 1VE9A 2O0KA 2QZSA 2ZRHA 1KEUA 3C3BA 2QNBA 4ZEXA 2QJWA 2Y71A 4AURA 7AT1A 1YZNA 2VYND 4ZOBA 4J43A 1X13A 4H77A 3VTKA 4ZRDA 1K2WA 1U80A 2AUMA 2I65A 2ZCUA 3CHYA 1TU3A 2I1LA 4HCJA 1JMKC 2ZJ3A 3MCAA 2ZYIA 4EMSA 5AW8A 3D81A 1R0ZA 1TF2A 5DRTA 2DF8A 2BUBA 1M2OB 1T5HX 2Q1TA 3QQ5A 1XDZA 1BW9B 1D2CA 3NC1C 4MVJD 4BVFA 4LK3A 5KSWB 3ESRA 2R8ZA 4QBHA 1UJ5A 3MCWA 2Q4EA 2H9AA 5F5XA 2F43B 3GP8A 3COJA 1ZCBA 1ZD3A 2AI3A 4JC4A 3H6KA 1YJ5A 3KO8A 3OZXA 3U49A 1EVYA 2HTFA 1G21A 3IP9A 3AR7A 4HUJA 3S1SA 1TJYA 4D9FA 1ZCAA 1BN7A 3WIOA 5HQTA 3ECSA 1E59A 4LWQA 2XTZA 1K75A 1QV9A 1LWOA 1Z68A 4UMEA 1FXWF 4C0AC 2G1JA 1VJGA 2IWHA 3ELYA 2K7ZA 3DB2A 1PNQA 3KB1A 3LUAA 3FNHA 4QYMA 1CZUA 4LSWA 3WYCA 4BNUA 3GPDG 4YPOA 3R6GA 1CNFA 4D96A 2QTTA 2WYVA 2JGIA 2ZOSA 4MGKR 1OXKB 4MROA 4D9EA 1Y6GA 4Q02A 1FPQA 1G3QA 1YZYA 4AQYB 4I08A 5YASA 2YN0A 4BFVA 2PEZA 2Z4RA 3OZCA 1WD5A 4M21A 3WDKA 4R40A 1M2VA 4TWIA 5JJBA 3VZPA 2XUIA 3F6SA 4YX9A 1TYCA 1NBOA 2ZJ2A 3I5XA 3UMYA 2C4VA 2IL1A 5JZBA 4YAUA 2WTBA 4S1NA 1MW8X 2MSNA 2C07A 3KKZA 2C2GA 4D5GA 1A3CA 3QELA 3AHCA 1O97C 4OJNA 1CEEA 1CHDA 2VHYA 2OGUA 2Q21A 3P0HA 5ERXA 4EM6A 5EJ2A 3EXG1 3PQFA 1YQTA 4N01A 2EV9A 3ND6A 2PYZA 3MBKA 4RZQA 4BJHB 2BGKA 3VH3A 4HDNB 5KQRA 1ZNYA 4N8EA 1BU5A 1TA9A 1FTSA 2ZI4A 4OHMA 5IBPA 3TR6A 4F9TA 2D0PB 5FDFA 5JALA 3E5RA 4AG6A 3B7PA 2AF4C 5C81A 1XU7A 2ECFA 5C8YB 3JWPA 1YSCA 1H85A 2HLDA 2JVKA 2I76A 3LWZA 3WKAA 2WTUA 3C4VA 2V3VA 4I55B 3I5MA 1G1MA 1ESMA 1OAOC 3C8HA 2A8YA 3BIXA 3HO8A 2XGSA 1TXGA 1K89A 4LTNA 5NULA 3ZIAA 1A9OA 1WB5A 2JC3A 1F14A 2WTNA 1W36C 2AEJA 2IF2A 3D4OA 1GCIA 2HSZA 2ZUWA 3OT1A 3HKBB 3TIFA 1YJAA 4LY0A 4F8YA 3K6SA 1G5IA 4O3MA 3WB1A 1K88A 4MVWA 2ATEA 2C94A 4YJ3A 4ZALA 3BH7A 3OKAA 3JQRA 3J7TA 5LLTA 2WD9A 4DM7A 2AUNA 5MFPA 2Y1LA 3B6EA 2QGZA 1LXCA 4M6WA 4M7OA 2W0MA 1UJMA 4P8RA 5JCJD 4N5HX 4DBZA 1P33A 2YWBA 3UAZA 1OV6A 4YMGA 2OCIA 3ND9A 1LFAA 3W6NA 4BX9A 4F2GA 1XQYA 3I6YA 1VGQA 4TYYA 3FBWA 4IUCS 4RF2A 1KZ4A 4BJ1A 2JFOA 4BNKA 1NNLA 1C9YA 3I76A 1V4NA 1SC4A 2GHTA 2VJPA 5KYGA 1COWA 1E6MA 1MDFA 1N77A 8MHTA 4EFMA 3UBTA 1OR8A 2EGHA 2GN8A 1E5DA 1ZISA 3OTIA 4NVRA 5AK5A 4B79A 4BLUA 5B4TA 5GZ1A 1G8AA 3V7WA 5LXTB 1VKJA 4UHBA 1TKAA 1ISFA 1O0SA 4AY5A 3LOPA 4PAGA 1IEQA 2JJMA 4K9SA 1U0FA 1M6HA 3H5IA 3ZVRA 4TWJA 4OBEA 3R8CA 1JS1X 2OCBA 4IGAA 3DLPX 3DT9A 5JANA 4DAOA 2XMPA 2QTBA 2YH2A 3GRVA 1DQPA 4FYXA 3UOAB 3I2HA 3I9V1 3MTQA 4KK3A 4UHEA 3DWIA 1NVEA 4KN6A 4U8HA 4FJ0A 4A2PA 4ID9A 4D4JA 4PN3A 2JGEA 3FTFA 4URYR 3CR3C 5AVYA 3ZDZB 3K0KA 4IHAA 1ZDMA 1P7CA 2WZBA 3PC7A 1VPLA 5DYIA 2PMEA 1CYEA 1DKQA 2BH9A 2B4TO 4K46A 3X0DA 2D4HA 2JL1A 4DUGD 4Q1CA 3O8DA 3NORA 2P9JA 2GI4A 1CY7A 1II8A 4DV5B 4DCUA 3MCZA 1E1CB 1LBQA 3PT9A 2HF8A 3Q6IA 5BN3A 2DBQA 4GG1A 2JCBA 1C8LA 2ZT6A 4JEUA 5THQA 5KVCA 5KTPA 2BFFA 2Z2KA 3AR5A 4OBXA 1GQFA 4O59O 4B6RA 4OJYA 2AXPA 1HFWA 1TCCA 2NO9A 3L07A 4DTCA 1XDGA 3HGTA 1I4LD 3LQRA 4O1HA 1THTA 4IWNA 5C0OE 3A0UA 3DF9A 1HMPA 3GLVA 4R9SA 1NUTA 3O9VA 3PXAA 5HBRA 3SBOA 4C7BA 3WAGA 3HO1A 1N92A 1X7ZB 5TGZA 3Q8KA 3ORSA 2BR3A 2KB0A 2WV7A 2ZSBA 2IEDA 3LOQA 4KGXA 3ZHTA 1IM5A 5F3WB 5HWSA 1MD9A 2IYPA 2VNIA 1W73A 4OEHA 5ERGB 1W1IA 2X2OA 4UBKA 4YPVA 2OGTA 4K88A 4OYLA 4AP6A 1CE8A 3ITDA 3T8YA 1WMSA 2QXTA 3P0FA 4FT2A 3LY7A 4TZKA 3RRZA 5HQ3A 2VT6A 4KQKA 2FZGA