2IYZA

Shikimate kinase from mycobacterium tuberculosis in complex with shikimate-3-phosphate and adp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
169
structure length
168
Chain Sequence
b'APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRNPGAVVRHILSRLQVPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHIKIMATE KINASE
publication title Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 60
structure length 168
sequence length 169
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iyzA00
1KI8A 1YKSA 2JCSA 3DZ8A 3H2YA 1IN4A 3OHMA 4FCVA 1QHXA 3FMIA 4V0KA 1MABA 1OIWA 4NKRA 2Z5FA 1OFTA 1WCV1 1JR3D 3K0EA 2GEDA 4X8HA 2W0MA 1C9KA 3I73A 1U94A 3SJCA 4UJ5A 1H8ED 3P20A 3I3SR 4A92A 3HU2A 1J90A 4HB3A 2CK3A 5LBIA 2GJ8A 2CBZA 1JR3E 2VQSA 2NO0A 1S4QA 1XMVA 3LX8A 4LV5B 3U6BA 1RRFA 3GLHA 1A7JA 2FZ4A 1NBMA 3ZDQA 1R2QA 4L9SA 2TMKA 4Q9IA 2FPLA 3C16C 3L8YA 4PANA 2HJVA 2R6CA 2MMCA 3M0EA 4ACAA 2VP5A 2BM0A 1L7VC 2FWRA 4MRVA 1DBSA 1ZNWA 3CX7A 3KFXA 3IILA 4A0RA 4FMDF 2R6GA 5EUQB 3WNCA 1OXXK 5AUQA 3THYB 1XTQA 1DOAA 4DEYA 2WJHA 1ZRHA 1M1YE 4ZCLA 4MYUA 4GMXA 3WMEA 4D80A 5FL3A 1E2IA 1EX7A 2A5JA 2P5TB 4Q9HA 2FPMA 1UKZA 2W0SA 2GHIA 2IUTA 2HDNB 2OSBA 2CHQA 1W4BA 1T4GA 3UXMA 1PUJA 4E5UA 1YZUA 4O2LA 1GDDA 2CNWA 2QZ4A 2ODBA 2WJIA 3MWLA 4BLOA 1ELOA 4MYTA 2FDCA 2IA5A 3P4YA 1BYIA 2XNDD 3RS3A 4BEJA 2P2LA 2VA8A 5E3HA 2J0QA 2I1VB 4TL7A 1KO5A 1FL9A 3TQFA 1P62B 2A5YB 1XFAA 4KSBA 5TVKA 3N2EA 1W44A 1GG2A 5BN5A 3ASZA 3OFNA 4A36A 2ZUDA 3WY9A 4PC2A 2W2TA 1OH8A 4M22A 2GVDC 3X1WA 4LK2A 5EE0A 2XZLA 1R4AA 2HXYA 2PZGA 5F9HA 5B30A 1HY3A 2DHRA 5AUPB 3KJIA 4PPGA 3A1TA 2FV8A 1K8RA 2PL3A 4XSGA 2G9NA 5D3QA 4IOLA 2QAGC 4XH9B 2GILA 4CGZA 2OESA 2I1QA 1YZTA 3QBTA 3LNCA 4DSUA 4KITB 3G5UA 2YV5A 2GJKA 3CH5A 1KMQA 1ZD8A 2QNRA 5JI2E 3JZAA 2JA1A 4LSGA 3CUEF 4G1UC 4BRUA 5FFMA 4PC3A 4PHTA 3QKUA 4M0LA 2X2FA 4NMMA 4OHWA 1U99A 2ONJA 5LD2B 3I62A 2BEJA 1IXSB 1BKDR 4BFWA 1AGRA 1IM2A 1W7AA 5FH9A 4TT3A 3JVVA 2ZVPX 3MD0A 2WKRA 4L8GA 1EG7A 4WXPA 4AYTA 5L3SB 3SBDA 1CU1A 2HLDA 1T91A 4NHOA 4V0ME 3PV0A 2YJTD 4LI0A 4PAMA 2G77B 1W0KD 2V6IA 2VHUA 3FKSA 1ZC3A 4CEJB 4LWZA 3GP8A 1Q20A 4Q9KA 3BAFA 5L3VA 4UJ3A 4GOJA 1KZGB 3ZS8A 2ZYVX 4P4SA 821PA 3E70C 1IN7A 1P2UA 3AUYA 4C30A 3VR1A 4F4CA 1DG1G 2VSXA 1TX4B 2W2VA 4A6PA 1G8FA 3QVVA 2GDJA 4PAQA 3NIBA 2D3WA 3OEEA 2O8DA 1RYHA 4TLCA 3KUCA 4Q1CA 4ASUD 1Z07A 2IW3A 4IXNA 2JJ8A 3A6PC 1IBRA 4LJ5A 3SR0A 4Q9JA 3BFVA 1ESNA 1NN1A 2HT6A 2XTNA 1OXSC 2YZ2A 4QOSA 5CIWA 2OBNA 3NG1A 2QRNA 5DN6D 4IDOA 3MG9A 1N0UA 3R9XA 3AF4A 2WMNB 2CEAA 4HLUA 1T0JB 3E2IA 3H4MA 2WHXA 4BQSA 3AVTA 2IYUA 4F91B 1W2GA 4TSFA 2V54A 3KUDA 4NCKA 4W5HA 2QMHA 4ILEA 4LV6A 5TB5A 2ONKA 2FEOA 1W4AA 3UANA 2Z0MA 1E0KA 4V02A 3SDZA 3E1SA 2FOLA 1CIPA 5KDOA 4B33A 1Q12A 3K53A 2FH5B 1L4YA 3AVUA 1OKKD 1G8YA 2J5XA 4C0AC 5L3QB 2WM9B 3DMDA 1DPFA 1YZGA 3GEHA 1N25A 4A9AA 2BDTA 2PZFA 4W7SA 1HQYE 3CPEA 4K46A 4FI3C 1G3RA 2PLFA 5JEDA 1VPLA 1N5KA 2EQBA 3LLUA 4QHSA 4B35A 1OB2A 3ZVNA 3EPHA 4NYIQ 4UQOA 2Z4SA 1IJFA 4AI6A 1MO5A 1P73A 4B74A 2QSZA 1SQ5A 1WA5A 5F3WB 2BM1A 3IEUA 3AVXA 3IHLA 1GL7A 1GZSA 1UKYA 2PX0A 2FJUA 3RRZA 4AC9A 3K0SA 2RGCA 3K0FB 1E2KA 3U5ZB 4IKEA 1Q21A 1G5PA 1FP7A 2QRZA 1RRGA 3KJGA 1K6MA 3CRRA 4U00A 3QKRA 3SBEA 4MDEA 2CHVA 3AVPA 1DAHA 2QENA 2ODEA 1II8B 4ESVA 3HPQA 3HR7A 5KSOA 4HSEA 3AKEA 5DYIA 2V1UA 1J7KA 2C96A 3I32A 1IXZA 5BW8A 4S2EA 4IDQA 3R7WB 3NKVA 3GJ7A 4F38A 3LRPA 1T3LA 1EFHA 3MAAC 3KJHA 2IS1A 1XD2A 1J70A 4EJSA 4URZR 1KAOA 3MWYW 2PMDA 3OAAA 2XTMA 4P4TA 3TAHA 2ZS7A 1ZIOA 4JZKA 1KI3A 2QQEA 2B92A 4TLBA 4WAUA 5B58C 3LW7A 4E07A 3RC8A 1VG1A 3SU8A 5K8TA 3U4QA 4LHXA 1E94E 2G83A 3A58B 3IO3A 2ASEA 1OFHA 5C1BA 5KU1A 2ZRNA 1SXJC 4QGFA 4PHHA 4B3GA 4RKFA 1AZTA 1ZM4A 4CEHA 1XNJA 4ITRC 4R98A 4MGZR 5HKKA 2J3EA 3PEYA 3R20A 2RGNC 2GF0A 3D7MA 3EZ6A 3NHBA 4DCTA 4IJMA 1E1QA 1GNPA 2OE2A 3V00A 3VU9A 4BLRA 4C9BA 3AVVA 3ICQB 2QA5A 4GP7A 2JASA 4B3BA 1DELA 3CNOA 3EXAA 2EFGA 2IF0A 3D3QA 2QL6A 2EFDB 3HYRA 4OQLA 3AUXA 4XJXA 4D4LA 5CM8B 2D4HA 1GKIA 3O8CA 1KO8A 2WIAA 4AYWA 1OYYA 4OK3A 2YINC 3IDQA 2PX3A 3CF0A 1A2KC 1JB1A 1FNMA 3MGCA 1E2JA 3ND8A 3QQ5A 3WYFA 4DSTA 5JZVA 4MUAA 3KB1A 4JYCA 3IPYA 1G291 3BERA 3BK7A 2XGJA 1V43A 1MR3F 5FUWA 3WMFA 5FOVA 4PX9A 3VTKA 3DO6A 1LFDB 4HAZA 3ZIAD 3RSLA 3THWB 2GK6A 4QGAA 2OILA 2QAGB 3T1QA 1CJVC 2ZYUX 2AL7A 4NCNA 521PA 5C2JB 1Z3IX 1E9SA 3AF2A 2ZE5A 4AG6A 5SZKB 5HZHA 1HTWA 1H8HA 1UBGA 4Q4AA 5LB4A 3U7FB 3MUFA 1GRRA 3W6OA 3C15C 3K0AA 2VHTA 3B1YA 4WOPA 3PJRA 4AKEA 1ZCAA 3TW4A 3A37A 3EZ9A 2R65A 4JLKA 3CR8A 2DBYA 2P6NA 4N3NA 1AS0A 1KDOA 1XXHA 5SZHB 3T06B 4MKIA 1G8HA 4B71A 2PJZA 4QGHA 2ZUCA 5F98A 4MUBA 5J4HA 3S1AA 3B2EA 2AHOA 4OK6A 1Q1EA 3K09A 1SVSA 4A6XA 2YHSA 1UADA 3SI7A 2L0XA 4CZ2A 2ZXUA 3K70C 2CJWA 3FKQA 4K8OA 2AX4A 3REFA 2CDNA 1BMFA 2ZJ8A 4A82A 2D7DA 3JZMA 3R9WA 1NIPA 1R0YA 1F2UB 3QXXA 2WWIA 4WA7A 5G3ZA 1E32A 1Z08A 5KSZA 4Q1BA 1VYTA 1AKYA 3AKDA 1Z2AA 1XB2A 1E9AA 4PO9A 1WF3A 1RIFA 4Q00A 4LC0A 4JMPA 3SQWA 3ZLJA 1W4CA 2RGDA 1N6HA 2G1JA 5G40A 3BB3A 1QF9A 1W36C 4KU4A 1OE0A 3RVBA 3DKPA 2C04A 4B73A 1E79D 2JEOA 5FR2A 4JLDA 5D3MB 1JPNA 1ZNYA 1RW4A 2IYVA 4HEJA 3TBKA 4AKHA 1IQPA 4HDQB 1OT3A 3BBPA 4NH0A 2ZRPA 3OEHA 1T8UA 4OI2A 3F5FA 1ZIPA 2NG1A 3RC3A 4H1VA 3C5CA 4TZ6A 2AXPA 2B7BA 3CRQA 4ZKEA 1EFRA 2ERXA 4ARZB 1SVWA 1G7CA 2XJ4A 4I1UA 3U3RA 4D81A 4O2RA 4YMSA 1OH7A 4US1R 4OHVA 1T6NA 2RGXA 4XSHA 5JFGA 1VG8A 2G3YA 5EZ6B 2PCJA 1CP2A 2QMEA 1X8JA 4KHZA 4MRRA 3O8RA 3EA0A 3E5HA 1AM4D 5DO9A 5KOYA 4QBHA 3I5YA 4Y0VA 2VF8A 5H1YA 1G5TA 3LD9A 2QSYA 2FA9A 2OBLA 2IHYA 4P0TA 3SFVA 4F7WA 2R6AA 1KI4A 5E7JA 4IEEA 5K8LA 3CWZA 4EAQA 5CB8A 2OLKA 2JLQA 2EWWA 4DT1A 4R7ZA 1KI7A 3V4RA 2WWYA 4KBGA 3LDAA 1IY1A 1ESMA 1KHTA 3UMRA 5JSZB 4JVMA 4LZZA 5P21A 2NOAA 2J0SA 2GEUA 1CR4A 1RJ9B 2BMEA 4ZIRA 4DRZA 4U02A 1WQ1R 4YONB 3QEOA 3U44B 1AN0A 3A1WA 1DTSA 1YVDA 2QGNA 1TQ4A 4C7OB 2AWOA 1S96A 5EXPA 3DL0A 3QE0A 1CBUA 5J4LA 2X19A 5KNCA 1WB9A 3WHKA 4U5XA 2NPFA 1P60A 4QL3A 1OYWA 5CJPA 4EUNA 1V5WA 3GQBA 1TEXA 3CRW1 4TMVA 3DVLA 2C78A 1G9XA 3GMTA 5DH9A 4K81B 1VECA 4M1WA 1G3QA 1Z06A 2J0UB 2ZSFA 4NONA 4GPTA 4Q7LA 4ZI2A 4JLAA 3T1OA 3UWKA 4P3YA 2J9RA 1JAIA 3ZQ6A 1ZJ6A 1SXJB 2EWVA 4Q1FA 1PLJA 2WAXA 1R7RA 2PT7A 2N46A 4EPRA 4C0JA 3U7EB 1XTIA 2JLYA 3Q7PA 2Q21A 2QBYA 1P61B 2V9PA 1OLOA 3PXGA 3A1VA 2AKAB 1MO3A 1XTRA 5GJWC 4A0HA 1AJEA 4BWYA 4HDCA 1S9HA 3AM1A 1E9EA 2B6HA 5DIFA 1R5BA 2DYKA 3NC0C 4G5RA 3LX5A 3NTUA 3GLGB 2GVZC 4ZCIA 4JYBA 4FMBB 2WTUA 1E0SA 4PPQA 2WV9A 3CRMA 4LY6A 2JLZA 4ZI3A 1KMHA 1VMAA 4LBWA 5J4VA 1CXZA 1MRSA 1UJ2A 5BXQC 2W6JD 2BV3A 3GLIB 2O8FA 2ANBA 2I3BA 2GBLC 1OF1A 2Z4RA 4V03A 4CIDA 4RFVA 3K1JA 5DI3B 2PH1A 2DB3A 4PPNA 2ATXA 1J8YF 1KIMA 1UPTA 2FFBA 3B8HA 3KKOA 5FBWB 2G0NA 2LKCA 4M4SA 2ZAMA 1A82A 1YRAA 4GBMA 4V0NA 2WSSA 3FHOA 4LHVA 3BJIC 2EFEB 3WHLA 3ND9A 3OIYA 4XOIA 1Z6TA 3CWQA 4WBSA 1ZBDA 5KDLA 2GTPA 3FHTA 1E98A 4BEBA 5KUTA 1ZU5A 4HLUC 2ZJBA 3QF4B 1JR3A 4DKXA 3QXHA 1G8GA 2VIIA 2QTFA 4LHYA 4JL8A 4HZUB 1JI0A 2FF7A 1H8EA 1TNDA 2QEQA 4O3MA 1WXQA 1IY0A 4GMDA 2CCJA 1QBKC 2WKQA 3K0CC 4PC6A 2G0TA 2H17A 4LBZA 3LVQE 1FUKA 2FEMA 1HV8A 1NKTA 3EX7C 4DWJA 4TL8A 3ADBA 5EP1A 2ZVQX 1CR1A 1S0UA 3VHXA 3W6PA 4QKQA 3FE2A 1CRPA 1XCMA 3WNDA 2O5VA 1VIAA 1LY1A 1WRBA 4KVAA 1F2TB 3K70B 2VTKA 2J7KA 1G1MA 3LXRA 1P9NA 4B44A 3LAWA 1KKLA 1ZU4A 1EGAA 5ELXA 4LJ8A 4Q1DA 4NYMR 3SN6A 1NMYA 4BGDA 1P2VA 3QKSB 3SFZA 3CF2A 4P31A 2XB2A 2GCOA 4PR0A 2N1BA 2XTZA 4UNNA 3QY0A 3I8SA 2KB0A 5CM9C 1A5TA 5GADl 1W36B 1G17A 1OB5A 2ZRIA 3PUYA 4TYQA 1AGPA 4Q4JA 2UZ3A 2NIPA 2XNDA 1LNZA 3MWJA 3BB4A 2VP6A 1E2MA 1LW7A 2A5GA 2C98A 3Q72A 2Q3HA 1FTSA 3DM9B 1FP6A 4QG7A 3RS2A 4Q18A 5AUOB 3GFOA 4IW3B 4MRPA 3U3JA 1XU4A 1GVNB 4PO8A 4DCNA 5TY0A 4MYHA 4EJSC 1UM8A 1QDEA 3CIOA 4LGMA 4QHYA 2ECKA 4OKSA 2C2HA 1SXJD 721PA 3C14C 1NSTA 1GUAA 1MRNA 3FFBA 4HUQA 1JNYA 3UPUA 2WWXA 1DADA 5DHFA 5FI1B 4LBYA 2IXEA 4YMVA 2O8CA 3EZ2A 1US8B 2YC2C 1Z0KA 2A78A 1DO0A 1SXJE 3K9GA 1E9RA 3SYNA 5BN4A 3EPLA 1YJ5A 2HYIC 2QE7D 3RLFA 1TQ6A 1SVOA 4MQBA 5JRZA 1U8ZA 2BCGY 3QI2A 4GZLA 4LYJA 1Q1QA 2A5DA 1ZCBA 4BLSA 4Z51A 1QHHA 3UK6A 1IAQA 3ZJYA 5C18A 4V0MA 1F48A 3QENA 2F7SA 4DIEA 5EXSA 3H1TA 3I5XA 1KYIA 5KNBA 5FOXA 4PC7A 3JVUA 3MJHA 2OLJA 2ZQ5A 4LJ6A 4IOKA 1R8SA 1YR9A 1B0UA 4C2TA 4NCHA 2C9CA 1CLUA 4RJLA 4L5BA 2IYRA 3WRXC 1U0JA 3GLIE 1MOZA 1W0KA 2ZITA 4Z1MD 3EA5A 1Z28A 3P4XA 3GJ8A 1GOTA 1AQUA 3HYTA 2I4IA 4BRWA 3EARA 4RZ3A 5B64A 3PIRA 1LS1A 2LWIA 1VKJA 2ZTSA 2FU5C 1NNEA 1KK3A 4EFMA 3HP1A 1E2LA 4D2IA 3KQUA 4QJ5A 1C4OA 1Z29A 4F93B 1W4RA 4ASUA 1CF4A 2FZLA 1QHNA 2QTHA 1F60A 1WE2A 2CVFA 1G20E 1J8MF 1KK1A 4IFEA 1ZUHA 4OQFA 1S1MA 2F1JA 4B3XA 4DLYA 1E4VA 3AVOA 1DAMA 4KYUA 2BKEA 4TTQA 5DN6A 1M7HA 2QTVB 4M21A 4EIWA 2ZE7A 5CYOA 4DIDA 1OPXA 1Z63A 2FSGA 2OBMA 2EFHB 2R8RA 4Z54A 1GWNA 2K5UA 4LJYA 3I1FA 1JBKA 1Z8FA 3C41J 3AF3A 8OHMA 4CT5A 1LF0A 3A4LA 2QM7A 2YWHA 3HU3A 2GAAA 4XD7D 3K70D 1P9WA 2RHMA 2YOGA 4E03A 5KDDA 3THYA 1LS6A 2HT1A 3SS8A 2RB4A 1ZYUA 3KJEA 1OKKA 4DLUA 3U60B 1X8LA 1I4LD 4OBEA 4WXRA 3PEWA 4JIMA 2PEZA 5FBRB 1Z0FA 4KFTA 4UXHA 3RRMA 1HH4A 3QUSA 4PZLA 4P4SB 4B76A 2CE2X 1N0VC 1JECA 2KSQA 4KFSA 3VX4A 5DNYB 1R5OA 1COWD 3HU1A 4BZPA 1KAGA 1YR7A 4URUR 3AVWA 2REXB 1W36D 2G1KA 3RS5A 3CBQA 2KBEA 4NL4H 1G3UA 2H57A 4IVPA 4FCWA 2XSZD 4TMKA 4B34A 1KZ7B 4JVSB 3GPLA 3BIFA 4WIAA 4DDUA 5IHPA 5JCPA 2XOKD 3VR4A 5EP2A 4ZCMA 2O8BA 3ICEA 1Q44A 4KI0A 3CW2A 4D0GA 1GTVA 4Z8XA 2J59A 2IXFA 3WP1B 1FTNA 2IYYA 5EJEA 3X1DA 4EPTA 2CL7X 1HUQA 2V7QD 5JHGB 1AKEA 2X77A 3GEEA 4JKIA 3RRYA 1S9DA 4AKIA 1FQKA 3L0IB 3NVAA 4DLSA 2NQ2C 2Q3FA 1OHHD 3U2QA 1N6RA 2JDID 4BECA 4Q5IA 1ODFA 3HDTA 3PUVA 1K5GA 4CEIB 1OXUA 1HA3A 4KAXA 3TUJC 2A9KA 4G5SA 4B3DA 1ZUIA 2ZJYA 2HXSA 2CLSA 2ZETA 2OXRA 4HLCA 5EE5B 4US2R 4OK5A 2CMKA 2KBFA 2JATA 1JAHA 3QXJA 4O0MA 1FX0B 4XVUA 3ADKA 1KJYA 2A7QA 3QEJA 3BB1A 2XITA 1ZM2A 3B78A 3QNUA 4C0BA 1ZW6A 4MKHA 3B60A 2OAP1 3IBGA 1P2TA 5E7IA 4AIIA 1DG3A 4KFUA 1W5SA 1W2HA 2RHDA 4JVNA 5CDFE 5KO2A 1KDRA 1A4RA 5FBQB 2ZRFA 3B5JA 1E69A 4UNSA 4TMXA 3FMOB 5L3SA 2FN4A 1F5NA 2IYXA 3QKRB 1GRNA 4EQ6A 4I1VA 1OSNA 4US0R 4FMCF 5GJBA 1ZD9A 4GT1A 3KXKA 1YE8A 2WWWA 3K9LA 4CF7A 3EPJA 1ZM9A 4UNRA 4JT4A 4QNMA 1UEJA 1G6OA 1EFUA 3PCRB 1BO6A 1SGWA 2QAJA 1QHSA 3A1UA 4B2LA 4Q4LA 1B23P 4XWAA 2C9YA 4ZDWA 2NTYC 3I4LA 1X3SA 1R0XA 4EJSB 2GXAA 2JLVA 4LV8B 1A2BA 4C0HA 2FFAA 2IYTA 4LBVA 2H16A 2XXAA 1D2MA 3VHLB 2RGEA 2F9MA 4I1SA 1G3IA 2MSEB 1KGDA 2GXSA 4OJQA 4GDFA 4GNKA 3ZIAA 2OHFA 1UFQA 5AWFC 1QG4A 4CEHB 1RZ3A 1JEEA 4II7A 3N70A 1QHGA 1WDTA 1E0JA 2OFWA 2KE5A 1G21E 2WMOB 3NBFA 1U9IC 2PJRA 4QBGB 4D0NA 4FXPA 3O8BA 5EP4A 1VYUA 4V0OA 3NXSA 1YR8A 1DARA 4DLWA 3K8YA 2PBRA 1II9A 2ZJAA 5L3QA 4E22A 3WP0A 2GCNA 1DAEA 3CZQA 2X2EA 3TSOA 2NZ8A 4C0KA 1Z6AA 2JLXA 1M34E 1XJ0A 1R6BX 1IN6A 1Z83A 2QQ0A 4X8MA 3GFPA 5SZIA 4R71A 1RRCA 3KQHA 1Z0DA 4WZBE 1OH5A 1FNNA 1NY5A 3NBZC 1AQYA 4TTPA 2ZRGA 1U0HC 2VO1A 1NLFA 2A30A 4D4JA 6Q21A 1XJCA 1QVRA 3PUWA 1G7SA 3IIMA 4FWTA 5JWRA 1UKVY 4LJAA 4MGYR 5AJYA 4TL6A 3K0FA 2IS2A 4LC1A 4IHQA 3IKJA 1XX6A 4TZ0A 3WRYC 2WWFA 1D8TA 1TADA 2ZRDA 2BMDA 4OQXA 3IEVA 5C46F 3PENA 2F1RA 2A2ZA 3GLFB 1MO6A 1DAIA 1E0AA 2D62A 1II8A 4M9QA 3QIAA 5EE1A 4RFSA 1VHLA 3TGPA 2HCJB 4B3CA 1XDBA 3KKQA 4NDZA 3WXMA 3TW8B 2D7CA 3T15A 3U3KA 5JS8A 4Q4AB 1T8TA 3UATA 2Q9CA 1YQTA 3L43A 4Q4HB 2V1XA 1KSGA 1UF9A 3R7WA 1Z6YA 2H5EA 4KYIB 1Z0IA 2ZJ5A 1N6PA 1E79A 1P9RA 4FMDB 1FMLA 1VCMA 3FB4A 5AJWA 1QRAA 1CTQA 2PMKA 3NEJA 4I1OA 4PFSA 5TMPA 4LCBA 3THXA 3RSOA 3TQCA 3CX8A 4G01B 3S1AB 4A15A 4JLJA 2P67A 2ZEJA 4HB4A 2FFQA 1FPMA 2CJWB 2ZJZA 1XRJA 1NJGA 2HUPA 2ORIA 5L3RA 4QNRA 3RS4A 4HYYA 3MWKA 3B9QA 3TAUA 4BFSA 2JAQA 1AZSC 3ZD6A 4NYMQ 5LB2A 4PC1A 3THOA 4HATA 1KK0A 3AQ4A 1TMKA 1G3MA 2FNAA 1XEXB 4B75A 1JQLB 2OUKA 1T3HA 2BC9A 1G16A 4HAVA 4NCJA 1NRJB 1NJFA 2OCBA 3T1TA 5FTLA 1N2CE 4EFNA 5EE3A 1S3GA 2YWFA 1ZC4A 4B6FA 2EU8A 4RD0A 3NC1C 1XMIA 4L16A 3IIKA 3W9YA 3M4YA 1CJUC 3LLMA 2Q9AA 5BYKA 4A8JC 2V6JA 1L4UA 1DE0A 4OHZA 1SKYB 4DDVA 3RYTC 1FFHA 3Q7QA 5HE9A 1RFLA 3PEVA 1RKBA 2W58A 3RS7A 3W3ZB 1E9FA 1YZQA 5GJVC 3TLXA 3UMFA 5KNDA 1F6BA 3BD9A 4KFRA 1IN5A 4OI0A 2GJ9A 5BYJA 3TKLA 1NI3A 4TN1A 5J40A 2VSFA 2QAGA 2HCBA 5B57C 1G5RA 1E1RD 4URXR 1OH6A 2EW1A 4PTLA 4HZIA 4AKGA 5DE3A 1XEWX 5EZ5A 2CCKA 3W8NA 4OI4A 4DUGD 4B32A 3BFXA 1KTVA 3QKTA 2E1RA 1E6CA 1AS3A 4M53A 2GK7A 4Q01A 4URYR 5AJXA 2BBWA 5GVRA 2REOA 5G41A 3OIUA 3KXIA 1E4YA 2IWHA 3T35A 2WPDD 4B6EA 3MMPA 4TLDA 4HDOB 4H1UA 1D5CA 1OV4A 3L0SA 2GNOA 3MJRA 3TSWA 1Y3AA 4YLGA 4DT1B 4QM6A 5CK5A 2V4ZA 2A5FA 3PEUA 1II0A 1L8QA 4DLRA 3QSYA 1ZNZA 1PLKA 3U7HB 4MRNA 4QC2A 1GM5A 2ZU0C 5FBLB 2XAUA 1RE0A 1HYQA 3Q85A 2IF2A 4PSAA 2VH5R 3BGWA 4BASA 3TUZC 1G4AE 2F43B 4UXIA 1GP2A 2F3TA 2B8WA 2NO7A 3P32A 1N6OA 5G3YA 3KXLA 3BRWD 2WAYA 1F2UA 4F4IA 2W6JA 2OCAA 1R5NA 2GCPA 5IK2D 3B1VA 5BQ5A 3GFTA 4DB4A 2RMKA 5K8IA 1EWQA 2GWHA 2ZUBA 1CJKC 1KI6B 2G88A 2JJ1D 2HEIA 3QF7A 4JJKA 3AF1A 4BFTA 2IYQA 3KTAA 3EPKA 2QPTA 3Q5DA 1T0HB 4XVRA 1E2NA 4GI7A 2ZI5A 2F3RA 2J45A 4QJ4A 4G5QA 3EWSA 5TARA 3ZS9A 1C1YA 2QT1A 3UIEA 3GLFE 1J2JA 3GJXC 4BUJA 2WOJA 1CR0A 2QUZA 4XWKA 2JJ2D 3TVDA 1Z2CA 5CLQA 2AN9A 4H9GA 2DWPA 1NL3A 4OJKA 4JSYA 2KWIA 1MH1A 3PG5A 4NTZA 2PEYA 1KSHA 1TU4A 2D2FA 4BFZA 2DR3A 3NDPA 3RRNA 4MGIR 121PA 4M9XA 2C9OA 1BYUA 1N6IA 3A1SA 1LV7A 5GVSA 1J99A 4MKFA 3CPJB 4BLPA 3QG5A 3VMFA 4AWXA 4Q19A 4ARZA 2ZI9A 1KO4A 1U81A 4W5WA 1KMHB 2ZI6A 2YWEA 2ODNA 1FW6A 1DAFA 5FTMA 5FTJA 5HCIA 1VYVA 3Q3JB 2O8FB 4FCTA 2BIFA 4HAYA 4YMWA 1U2RA 1WMSA 5ANRB 3B1XA 3AH8A 3OE7D 3LWNA 3KQLA 4XVQA 5A5GA 1NLYA 4YDHB 2O8EA 2WBLC 1E9DA 4QM7A 4TYYA 4BLQA 2CCGA 3N2IA 4M1TA 3QPVA 4PSVA 4A0FA 3QXCA 1PJRA 2UKDA 2ZSBA 4JLNA 3C8UA 4L15A 1D6JA 5TDHA 4F4JA 3HR8A 2WOOA 4LHWA 3RHFA 2BCJQ 1T9HA 1X8KA 1YZNA 3OESA 1GKUB 3PUXA 4TLEA 5JSZA 5K8UA 1FZQA 1ZUNB 5L8VA 2JLWA 4C0LA 3FPAA 5HTKA 5KSYA 3EIEA 2DY1A 3L0PA 1G64A 3CZPA 1E2DA 2NO9A 4C3ZA 1S2MA 3P27A 1Z6XA 3U44A 4JKYA 2B7CA 4MH0R 3V4FA 4EPVA 4OI1A 2ANCA 4FN5A 2O0KA 3GEIA 2RH5A 2OAQ1 1DAGA 4JBXA 4LPKA 4C7OA 2ZRBA 5G53C 4CVNA 4C2UA 3OIVA 1SKYE 3PQCA 2J46A 4QGGA 4A4DA 3BFKA 2QM8A 2IUUA 2R2AA 4JL5A 1NVVR 2DCUA 2DFLA 2PCLA 4NP6A 4YXWA 5EUMA 1AA9A 1LTQA 2R6FA 3L2OB 4Q47A 1GNRA 5AR1A 5AK0A 1SXJA 4IDNA 1XPOA 3GJ4A 4CDGA 4KXFB 3X1XA 1KO7A 3W5JA 3LBIA 2IC5A 1TUEA 2RGAA 1RVDA 2VHCA 4O25A 3PUZA 2ZS9A 2GEVA 3CONA 2NGRA 5CIQA 4BFVA 3F0TA 1N5IA 2ORVA 1I4DD 4R2HA 2W6ID 3TIFA 2QE7A 4XTCS 2GCOB 2HF9A 1Q57A 4QFMA 1NLZA 1F3OA 4BFYA 5C4MA 3ZVMA 3TUIC 4PQRA 4HLQB 1Z22A 4AYXA 3VKWA 3M6AA 3GLIA 4M9SA 3DM5A 3P1JA 1OXTA 1WP9A 3FOZA 1Q0UA 1XF9A 1U90A 5DI3A 5JWHA 4A8JB 4Z8YA 3IQXA 2OFXA 4S35A 1HT2E 2GA8A 2UVQA 1DVRA 2J87A 3QJYA 3IPXA 3HJNA 4Z1MA 3ETLA 4A0GA 1XBTA 3VNVA 1MABB 3T1VA 1SVLA 4IDPA 2ZRMA 2IYZA 3SC3A 1SZPA 4HUQB 2P5SA 2Q9BA 3WYGA 1XWIA 1R0ZA 3TVTA 4GOXA 3PR1A 4JBWA 2FSFA 4A2PA 4DLXA 1OIVA 2H7VA 2X8AA 4CRWB 5IF9A 3QF4A 4G3XA 1ZAKA 3BH7A 4Q1EA 1G4UR 1XTJA 2VP2A 1JJVA 1XZPA 1IY2A 2ZAOA 1KDPA 4I99A 4DDWA 4RD1A 3SEAA 3WBKA 4RZ2A 1W5TA 5CITA 1U0LA 1TAGA 4MGKR 3GLHB 5E7MA 5FL7D 3NH6A 1KSFX 4CYMA 1G18A 3IQWA 4NE2A 5EQTA 2ERYA 3LH5A 2HYDA 3CLVA 3SHWA 3CKLA 1VCNA 4IDHA 2CXXA 3A8TA 1W46A 1W0JD 1E99A 2AKYA 4D4MA 5JBQA 5JMTA 2N42A 1MV5A 1U8AA 2MSCB 1NG1A 1KK2A 1VCIA 2OO7A 3LFUA 2QP4A 4XD7A 2YC4C 1F2TA 2QU8A 1MT0A 1YRBA 2VP9A 4F92B 1ONBA 1GIAA 3LBHA 3A4NA 3G0HA 2PZEA 4Q7JB 2UZIR 2J7PD 4YDSA 4JLBA 4MRSA 3MFYA 3QKSA 2P6UA 3BH0A 2JGNA 1X6VA 2OM2A 3ASYA 2P0EA 4PXAA 3BC1A 1G8PA 2GAOA 2V3CC 1YZKA 1COWA 2RAPA 1OW3B 3CB4A 4Q21A 1UBCA 4EFLA 2XZOA 4BFXA 1NKSA 2FE4A 4LYAA 3X2SA 2D74A 3GLGE 2J0VA 4M1OA 2BMJA 4IVRA 3FMPB 5FPSA 2ZPTX 2RGBA 4WZAE 5CK4A 4N0EA 3EIQA 3T5DA 1UAAA 2XSZA 4IFBA 2Y8EA 3AB3A 2BKUA 1M6NA 2HV8A 4HI0E 2VHQA 5BN3A 4TL9A 2XOKA 1G7TA 3OF5A 1XCPA 3AP1A 1KO1A 1ZD1A 3DEFA 3LBNA 3LA6A 3TK1A 1P72A 4EPWA 3FYHA 3TRFA 2V7QA 5FUVA 3EIHA 4Q48A 5FI0B 1E9CA 1MO4A 2W00A 3NDBB 1XMSA 2AXNA 1G6HA 3LY5A 5TXGA 1EWRA 1OHHA 4Q9LA 2JDIA 1N6KA 2ZREA 2C99A 2G6BA 4JVLA 3RABA 2VPPA 4QBFA 1CR2A 1SVMA 1US8A 2JIZD 2GJSA 3W3AA 2E9SA 1R8QA 4DSNA 4JLPA 3R8FA 1DEKA 1JR6A 3IHWA 4QJ3A 2DPXA 2NZJA 1E3MA 5JJKA 3LXXA 1EFCA 2GXUA 2Z43A 1EFTA 1M2OB 1UBFA 3B6EA 4GRAA 5CDFA 2VHJA 1KI9A 4FINA 2ZANA 4FW9A 4LRWA 4RCYA 4Y0AA 4IVQA 2R62A 4HUTA 3J81k 2H1LA 3ZYCA 3DPUA 4CT4B 2ODWA 4ERNA 2OCPA 1O87A 4ZO4A 3VR6A 3L82B 2FSHA 1VCOA 2EYQA 1X86B 2NO6A 3EAQA 4NYJR 5HZKA 2IXGA 5KYKA 2O8BB 3K09C 5HPYB 1Z5ZA 3SQXA 5A0FA 4WVFA 5FUYA 2YNMA 3MLEA 3TE6A 3VNUA 4BFUA 2GXQA 5FOUA 1GILA 2ZYWX 1HQCA 2BWJA 2CLDX 1PZNA 4WZ6A 5CB6A 1Q1BA 3AP2A 1ZM7A 2CL0X 1QHIA 2KJQA 2J1LA 3WNBA 2O8DB 1TPZA 1P4SA 3C7KA 3TNFA 3ECCA 2IWRA 5JRJA 4NBSA 2IS4A 1EESA 4URWR 5H70A 2CK3D 4M2LA 1CKEA 3B1ZA 4OQMA 3L0OA 1FUUA 1TQDA 4LYHA 4J0QA 4GZMA 5CLLA 4DHEA 1M74A 5EXTA 1NBMD 1KDTA 2V55B 1ZNXA 1S8FA 4LPSA 4GP6A 3QXSA 4QBIA 1S3SA 3SYLA 4G0NA 5EXXA 2WIBA 4TYNA 1UKEA 2ZSAA 4OHYA 4D4KA 2F1IA 1AIPA 4LJ4A 1OJLA 4B47A 1FOEB 3WMGA 3K9HA 3GLHE 1NBME 1OFIA 4HLDA 2IYLD 2OEPA 4RKEA 1QZXA 1NIJA 5KPDA 3IUYA 3D31A 2KI5A 3KKPA 4TYWA 3F8TA 3H86A 4X8LA 1WBDA 2ZRAA 4EQ6B 3U7GA 5JJIA 5H8WA 5F2EA 5FOTA 3W6NA 4C4PA 5LDDC 2Q0HA 1RPZA 1IN8A 5FPKA 5FPTA 1L2TA 2GBLA 2LKDA 2ZIAA 1JXMA 4P32A 2BBOA 2VBCA 4PSKA 1RRPA 1VG9B 3AF0A 3H84A 1AS2A 4N1AA 2CNWD 1EX6A 1XZQA 4M1KA 3RWMB 4DVGA 4P4UA 3SJZA 1E9BA 1N5LA 1E2FA 5JJLA 3SOPA 1NSFA 4TYPA 3ADCA 4PPFA 2ZI7A 1CJMA 2QMOA 4JSTA 4L9WA 4G5GA 5HE8A 3DOEA 2XXAB 2WWGA 2XZPA 2FPKA 3MRSA 421PA 2WKPA 1XEWY 3OFND 2CVHA 1U8YA 4LX0A 4TMZA 4KLZA 2CHGA 1G7RA 1UBEA 3VKHA 3VR2A 1KKMA 4CEJA 4HAWA 4N0DA 1W49A 1H65A 1NMXA 3OZXA 4DCVA 1RYFA 2B21A 4HB0A 3RS0A 2ZYTX 1E2HA 4E09A 3K0CA 4A2WA 1YR6A 3M1IA 3GCGA 3WBJA 4PAOA 2YOHA 4AG5A 1XD2B 1Q3TA 4CEIA 4DSOA 1GL6A 2GESA 2BBTA 3EG5A 3FHCB 1NP6A 5JECA 4BLTA 4AK9A 3PVSA 4C0QC 3AGQA 3B7GA 5LPNA 3U4QB 4FIDA 3K9NA 3ADDA 2RCNA 1FX0A 1IHUA 2QPAA 2QG6A 2ZRKA 3KFVA 4Q02A 5FPHA 5EE9A 2NO1A 1I2DA 2WZQA 2ZRJA 2QT0A 1Z0JA 1TL7C 3ZVLA 3IBYA 1E2GA 3MSXA 2W83A 1XD9A 2QI9C 4KO8A 4TT3D 4HAXA 3T34A 2FG5A 4ACBA 3H0KA 4JJZA 3VU9B 2BVNA 2HLDD 4RD2A 4PHFA 4KVGA 2PLRA 3QOFA 4FWIB 2C77A 4P33A 4RSGA 4XWOA 3BH6A 3IIJA 3TMKA 2DFKB 1FQJA 3NWJA 3FKSD 3I92A 4NCIA 5IRCD 4MKGA 2BMFA 3BE4A 4UNPA 1EK0A 3C4JA 3PITA 5KHOC 2O0HA 1BIFA 3AV0B 3CM0A 3KKNA 3NH9A 4RFSB 4EPXA 1GAJA 1MKYA 4KSCA 1S1CA 2IBMA 2ZJOA 2FX3A 1W1WA 2GF9A 1G41A 2CLCX 4Q66C 3EZFA 1YZLA 1ZMXA 2D2EA 2GJAA 4DC9A 1Q3HA 3OEED 4BE7B 2IS6A 3CNNA 3B13B 3FDIA 3ONWA 4GL2A 2GETA 1ZINA 1JEDA 1LB1B 1NVWQ 5DLQC 1NMZA 1NG9A 3AKYA 5DGXA 3DDCA 4Q7KA 4JLMA 2BJVA 2ZRHA 2ZRLA 3FGNA 3AGPA 1IONA 2FSIA 3THXB 4TSFD 1NVVQ 3NBYC 4IXMA 3O47A 4TMWA 3KDSE 4RD6A 1DO2A 1A1VA 4W5JA 1KNQA 4X8OA 4YMUA 4YMTA 2C03A 3Q9LA 1Z6GA 3QVUA 4YC7A 2AWNA 3V9PA 1E1RA 4JT2A 2WWHA 1XEFA 1JXOA 1VDZA 2F6RA 2XX3A 2ZR9A 4LJ9A 5DISB 1PLLA 1UDXA 3RAPR 2EYUA 4DUGA 2WJVA 3K0AB 3BS4A 3BWDD 1W47A 1P75A 1ZM3A 3VFDA 1G19A 2ZRCA 1QVAA 1TU3A 5JCZA 3SHFA 1XXHB 3AEZA 3KZ1E 2WPDA 3N5CA 1NF3A 4AURA 2JLRA 3LW8A 1GFIA 1T3SA 2GZDA 2ZE8A 3LVRE 1CEEA 2DFTA 4PQFA 5M04A 3EW9A 2ZR0A 4R2IA 2RKOA 2AD1A 1R10A 1KY2A 2ZI3A 3NHAA 1BH2A 1JJ7A 2IL1A 2C5LA 1XTSA 4GFDA 3UG6A 1IXRC 2FFHA 3SNHA 2XNSA 4G5OA 4DLZA 3CR7A 2YWGA 5DSZA 2ZS8A 2C95A 2C8VA 2YKGA 1NN3A 3IGFA 5F9FA 1X1SA 3KKMA 2Z6VA 5J47A 2AK3A 5IK2A 3LV8A 4DCUA 2VYFA 4KCGA 1UEIA 2GRJA 3RDPA 4QRHA 4IEIA 5J4KA 4PQYA 3GLFA 2EVWX 2HF8A 2IEZA 5FPYA 2JJ1A 2ZROA 3BORA 3VX3A 2VF7A 5KSPA 3B85A 3GJ5A 2P3SA 1OFUX 1TQ2A 1BOFA 4IRUB 4LOAA 3C5HA 1W48A 4TQAA 4Q4HA 3NEYA 4Q03A 3OAAD 4GOKA 4UKDA 2DFNA 2IYWA 2JJ2A 2BEKA 2XB4A 1JQJC 1XPUA 1LF5A 2OT3B 3ZZTA 4RZXA 2YVUA 3T12A 5JWOA 3THWA 1GNQA 4EDHA 5JI3E 2F1HA 5A4JA 1CS4C 3G82C 2IX3A 1SVKA 1HE8B 4M8NE 1CULC 4MYCA 5HKKD 4RZUA 4ON9A 5JLJA 4LYFA 1HT1E 3D6TB 3GD7A 2BJWA 5CJ2A 4NPHA 1E1QD 4DJTA 1NN5A 2JLUA 4LJ7A 1EXMA 3T61A 1IJEA 3AVQA 4RY2A 1SVIA 1ZP6A 1SKQA 3KB2A 3FFAA 2R6DA 4URVR 1TEVA 2E87A 3B82A 3D8BA 4DBLC 5HR5A 3CRVA 5H68A 4LHZA 1VTKA 1XEXA 5C4GB 3OE7A 1HURA 4D6PA 3FWYA 3KTAB 3DZDA 4HB2A 221PA 2AFIE 4DB2A 2Q6TA 5IDVA 4UXJA 1Z47A 3CPHA 1E96A 1Z0AA 2IT1A 3CO5A 1GSIA 3PFIA 1KJWA 4ZIRB 5DHAA 1PUIA 5B2ZA 3R9IA 1KOFA 4KJZA 1KI1A 5FTKA 5JEEA 3U61B 2MSDB 3W34A 4Q1AA 3LQQA 5BWMA 3UMSA 5IT5A 4W9MC 2BHRA 4AD8A 4YQFA 2XEXA 1ETUA 4D25A 4WW0A 1XPRA 3VKGA 2BOVA 2XJ9A 3ZZ0A 4KBFA 5FOSA 5JS7A 3FMFA 2X1VA 1ZVQA 4TLAA 2F55A 4C0SA 4HAUA 2O0JA 2O52A 2DWQA 2QY9A 3NBXX 2IHBA 3B1WA 2CE7A 2MMGA 2AK2A 4LDJA 2QP3A 1TF2A 3FVQA 3W8RA 1XCGB 1H8HD 2AR7A 3DHWC 3X1ZA 3OIWA 5J4YA 4I4LA 2YOFA 4B2PA 2OG2A 2D06A 1M8PA 2ATVA 4M1SA 1YHNA 2VRWA 1M7GA 1HE1C 4DLVA 2HJGA 4ZV4A 3ZD7A 4RCZA 2QBYB 1QHYA 5D3MA 4XTRA 5DI9A 3TR0A 2O8EB 1N6NA 3AVYA 1WBBA 5TV2A 2GKSA 3REGA 1E2EA 4PHGA 3QPUA 2QORA 2A3RA 4FMCB 4OYHA 1XMJA 1P3JA 2V8OA 1M7BA 1XXHE 4QXAA 3CX6A 2W6IA 2VLIA 3A36A 5FR1A 3VR3A 3KQNA 4NYJQ 1BMFD 2YYZA 2H18A 3LQRA 5GJCA 2F43A 1TF5A 1I2MA 2VP4A 3I72A 1Q22A 4NYIR 3UG7A 3TR5A 3GJ3A 1CRQA 1D2NA 3CH4B 1DAKA 4M1YA 2ZSEA 4BZQA 3U6KA 1BS1A 1VG0B 3QBVA 4LUCA 4B2IA 3A4MA 4OQNA 3I61A 2B8TA 2WJYA 1I4TD 4IOMA 2WVJA 1R0WA 3SJBA 2Z83A 4DLTA 1XJQA 1KI6A 4RVCA 4UNQA 4U7DA 4A2QA 1D9XA 3VAAA 4D82A 2GZHA 4PZZA 1SULA 3L8ZA 3VQTA 1SHKA 2ORWA 2VSOA 2NPIA 4M9ZA 3EWAA 4FD2A 1RJ9A 3X1YA 2IUSA 2J41A 2ZR7A 3SJAA 3W5IA 3VR5A 2NMVA 1IOZA 4CW7A 1Q1ZA 3OEHD 3P26A 5AJVB 3ZZUA 1DS6A 3RANA 3B9PA 4OHXA 1U9IA 3EZ7A 4ZDIA 2OFOA 4KODA 1KSJA 3KL4A 3SZRA 1P5ZB 4M1MA 2FMXA 3KQKA 3HPRA 1EFRD 1ANKA 4OL0A 5FUXA 3ZGXA 4XIGS 1TUIA 5FOWA 1JPJA 2QN6A 4B3FX 3Q8XB 5FL7A 1RC8A 1N3BA 2Q3MA 3CF6R 2ZJ2A 4I81A 1N5JA 3F3YA 5UKDA 3W90A 1JALA 4TQ9A 1PV4A 2P6RA 4DEXA 4Q7MB 2J0UA 3I8XA 4GSYA 1O3YA 4DCSA 4L4UA 2OV2A 1Y63A 1KNXA 4TMTA 1VIYA 1W0JA 1OXVA 3U3OA 4B48A 2QGZA 4IOJA 5JHHB 4ZDKA 1XP8A 4MITA 1NY6A 1KI2A 3GJ6A 2AD5A 4JBYA 3SE0A 1GKYA 1NVUQ 1FMJA 4PZYA 2IYSA 3EC1A 2RGNA 3Q5EA 2VEDA 5LD2C 2CL6X 3O8DA 5KTYA 2QPOA 2R44A 3QG1A 2PT5A 3IO5A 4D26A 4ZKDA 1PVOA 2J7PA 2WJGA 621PA 2FGKA 4DZZA 1E2PA 3BXZA 4ESHA 3GLGA 3RWOA 5DYGA 4AY2A 1D9ZA 2EFCB 2JLSA 2R9VA 2FGJA 3DMNA 4NZYA 3TJZA 2VL7A 1P2SA 4EPYA 2ZM5A 3MCAA 5EP3A 3SYKA 1AK2A 2QMUA 1T5IA 1U98A 2AFHE 4Q4JB 4JLVA 4RD3A 2WICA 2QP9X 4B43A 4TTRA 3EC2A 1N0WA 5E95A 1TTTA 2F9LA 1P7CA 3ZH9B 3AP3A 3FTQA 2ZSDA 4NU0A 3U3MA 1D2EA 2REBA 3WYAA 1XD8A 5AJZA 1N6LA 2DWOA 3ZQJA 1GRQA 2GZAA 4JLOA 4KV9A 3GJ0A 4TWZA 2SHKA 4QHTA 4PO1A 3AKCA 1KY3A 2WSMA 4JL6A 3BOSA 4MDFA 2P65A 1SHZA 4RD4A 5CYPA 4DXAA 2O8CB 1KJZA 2BBSA 4ZDJA 5J5CA 2OXCA 4MA4A 1P6XA 1GL9B 5KPJA 4KLNA 5FTNA 1XTKA 1UDWA 5E4FA 4EKDA 5AUNB 4HZUA 2JIZA 3DKVA 3EASA 4POAA 3T5GA 4ABYA 3TH5A 3ZVRA 4D0LB 2ZU6A 1VHTA 2WJJA 2IK8A 3CNLA 5SZJA 4DDTA 3TSZA 1E2QA 4A1FA 3LO5A 1QHHB 3UKDA 3RNLA 4BZXA 3DOFA 5HCNA 2OCYC 2IEYA 3UWOA 3HWSA 1HEIA 2W2XA 1YU9A 2OZEA 2ZI4A 4R9UC 2LCFA 1CJTC 3KX2A 1GITA 1T5LA 1X1RA 2VP0A 1LVGA 1K5DA 1NN0A 4V0LA 4TQUS 3R8CA 5FBVB 4A8JA 1OIXA 4BPBA 1TF7A 1NVXQ 2WSSD 2RGGA 4JS0A 2ZE6A 3QPWA 2H92A 4ZPXA 1QG2A 4YXWD 2QROA 2H8KA
chains in the Genus database with same CATH superfamily
4TXNA 1XO1A 5E3IA 1KI8A 1IHXA 1E1MA 1YKSA 4QLAA 3DZ8A 4BBZA 3GU3A 5EIAA 1AV7A 1U6IA 3QRWA 4QXMA 2FR8A 3FMIA 1DEHA 4QYMA 2QQGA 1V0JA 4AP5A 1WCV1 1QVZA 3KKLA 4A0QA 1TGYA 1FDTA 2RH9B 3K0EA 1D5WA 4GMHA 5KWSA 5C7OO 5IPFA 4RIHA 1EZ4A 2VR1A 1YS4A 3SQNA 1HNZB 3I73A 1VM6A 3SJCA 1EX9A 2QY6A 3UMCA 4HGYA 4F8JA 1PX0A 4FZVA 5LQSA 2ZIVB 1OJ7A 2GLXA 5LBIA 2CBZA 3D9QX 1RYYA 2VQSA 3UA3A 4RYDA 3W6UA 5AJHA 4FHZA 1RRFA 3B6ZA 3GLHA 1LBEA 2FZ4A 1HE2A 1NBMA 4LMBA 1WDKA 1R2QA 1CS0B 1PFKA 3KWLA 5D5PA 1M83A 4ACAA 2Y4NA 3CCBA 3P2OA 4WNAA 4YGXB 5HBRA 3SZMA 5BSEA 1L7VC 4LE2A 2FWRA 4XARA 3MUNA 1DBSA 2ZXFA 3QYFA 1S2GA 2XA9A 3QFSA 4WESB 5K3FA 2I76A 2H8GA 1PYGA 1OXXK 4RQAA 3ZNQA 4YRAA 5AUQA 5IKXA 1GSOA 3TO5A 1H0SA 2CLFB 2PSHA 4GLBA 4D9EA 1XU9A 3HA7A 2O8NA 3DQZA 2WJHA 5DFAA 3V2UA 2G71A 4ZCLA 1GO2A 2WHQA 3C3YA 3N28A 3SEFA 1YVPA 4D80A 5FL3A 2P0AA 4D43A 5BW6B 2WIKA 1Z5WA 1MO2A 2WD9A 4X64B 1NQXA 2WWTA 4B8WA 3EA4A 1YUBA 4OTZA 1FFXB 3RTEA 1T4GA 5C1IA 2AW5A 4WCFC 5THQA 5KQSA 4E5UA 2JFXA 1UP4A 3NJ4A 2IPLA 5ADWA 1E5VA 2ODBA 2WJIA 4X65B 1XHEA 4XUDA 1W5AA 3MWLA 4KOAA 4BLOA 2FDCA 4FQ8A 4NJMA 3P4YA 2VQEB 3V48A 4M8LA 2VA8A 1M6VA 2I1VB 2IYAA 4TL7A 1KO5A 2MR5A 4WK4B 3TQFA 2CV0A 1DIBA 2GYUA 3PXAA 1XFAA 5AK6A 5EKUA 4OOFA 1GYPA 3RFXA 5ESXA 3UW1A 4GUDA 5EZYA 5TS3A 1TAHA 5ALOA 1BOOA 4PC2A 5DHQA 4BB0A 2W2TA 4WZZA 1ZITA 3DOUA 3RROA 4BNJA 1B00A 3AEQB 3QJGA 4I4NA 3M6FA 4NMWA 4RYLA 1KJJA 1RHKA 4DIKA 4QT0A 1Y8QB 4V0RA 2HIAA 4J07A 4KR6A 1IHOA 2QUHA 3I2IA 4G1FA 2OHVA 2PZGA 3EXG2 2Y0DA 5F9HA 3MEQA 1GDHA 2DHRA 1X74A 4U7GA 3TTWA 4YMGA 4UM7A 3JQBA 5J59A 3ABOB 1E7WA 1EJ6A 1T2FA 4PPGA 5AUPB 1M34B 1XIVA 1HDEA 2GM3A 2FV8A 1K8RA 3W5SA 2XGOA 3KNZA 1QMPA 2WNSA 3WJ1A 3LNCA 2XZDA 1JEJA 1SXQA 2VAMA 3C70A 2WT9A 1F0KA 4MJ7A 4UOQA 3CH5A 1H1LB 1KMQA 2Q2WA 1DJNA 1OILA 1SOWA 3JZAA 5DX8A 4LSGA 4XRRA 3AG5A 3ABSB 4Y6OA 1PEYA 1I6WA 4LTDA 4ZVNA 1G5FA 5FFMA 1EYZA 2Z2ZA 1TD9A 1YHYA 3RHTA 3QKUA 4F04A 3AOEA 4C4OA 2Q0XA 1SHUX 4QULA 4UUBA 2XA1A 2YWXA 5HGXA 3KTFA 3LLVA 3UAOA 4E88A 3HL4A 5AI6A 2B0CA 3BG5A 1W7AA 3FDZA 4G85A 2HMUA 1I2CA 4UHHA 1EG7A 3IA2A 3SBDA 4KN9S 2X4DA 3PV0A 4LI0A 1PR2A 4PAMA 4PNZA 5CDGA 2FJ0A 1K7FB 1JILA 3D2CA 1SUIA 3TE7A 5TEVA 4CPDA 5DVZA 2VHUA 5K3OA 1ZC3A 4CEJB 3NVKI 1UINA 5A4FS 1KQ3A 3U5TA 3BWEA 1VKZA 2QRKA 1MA3A 2DPHA 3WNVA 4QELA 3HO1A 2N1MA 4D8TA 4OHCA 2ZYVX 3P2MA 5E9AA 1N4AA 5HMLA 2Q5LA 3E70C 2EX1A 3W5UA 5ADHA 4C30A 2AKEA 4LDAA 4GZ3A 3O8QA 3RK1A 1TRKA 4YRIA 2VJPA 2W2VA 3P2IA 1JSRA 1DIAA 4A6PA 1NX6A 4RPIA 5KNCH 3DEZA 3QVVA 2R1ZA 1NNLA 3GXBA 4B3HA 3KUCA 3WGNA 2B61A 1Z07A 5FFFA 2IW3A 3FX2A 3A6PC 1IBRA 1N2EA 3EXHC 1KR2A 3M6IA 3BFVA 1NN1A 2HT6A 2NV2B 2UVPA 2YZ2A 1STOA 3B3QA 3E9QA 3GXOA 4QOSA 4RE5A 1U1FA 4YECA 5EJ4A 4OX9Y 4IDOA 2MDTA 2HEGA 3CW8X 1YOVA 1NNI1 3AF4A 3FPBA 3MG9A 5FRDA 1MPTA 2I6UA 4UBMA 3E2IA 2P2ZA 4TSRA 3AVTA 4NQZA 4UVIA 2IPXA 2DQYA 4W5HA 5FD8A 2QMHA 3AM3A 4ILEA 1AKRA 1B2LA 1Z4KA 3MS7A 4X93A 5TB5A 3UKJA 3ZCXA 1PG5A 3FA2A 2VXCA 2VN8A 1ZR2A 4AJPA 1QYCA 1J4AA 1UK6A 4YXFA 3EQ6A 2AHRA 2FOLA 3E1SA 4FJ0A 5DYWA 4B33A 2HM7A 4CM9A 1I2ZA 4J1SA 4J91A 4LFBB 1ADJA 3KVOA 5F1OA 3C7TA 1I3NA 4LN1A 1W5FA 1L7BA 1OKKD 4UZEA 2GCEA 2J5XA 5L3QB 1N3LA 1MB9A 2AV6A 4H1WA 5L7WA 1YZGA 2G5PA 1B76A 1D0IA 3GEHA 3HRKA 4PYRA 2QN2A 4JT8A 2C9ZA 1KPIA 4W7SA 1HQYE 3KSMA 3MSCA 2QSUA 2PLFA 3EUAA 1QNFA 4K46A 1MFZA 4WN9B 3VDXA 1RJDA 5JEDA 1VPLA 1JU3A 3LLUA 4Z9FA 1OYOA 3QOWA 4Z53A 2Z2JA 5H4GA 1H66A 3O4IA 1JDUA 2B3TA 1GZUA 4UQOA 4AI6A 1YXMA 1P73A 1O9HA 4B74A 4F71A 2X41A 5I8ZA 1UT6A 4DMFA 3BMNB 1HRDA 1TO6A 1SQ5A 1UFVA 2QN3A 2X8BA 2BM1A 3H65A 3OEWA 1U0SY 3S2FA 5FULA 3IHLA 1EVKA 3PIDA 3ZR4B 4AJ1A 2JGKA 4CKZA 2FJUA 4BMDA 1EDBA 4AC9A 1QGAA 4YJGA 3U5ZB 1G5QA 3T5PA 1GG8A 3VNSA 3T4XA 3NOVA 4HD8A 2R6JA 3NNDA 4CIAA 1I10A 2DHDA 1YVUA 2JH8A 3KJGA 3ETDA 2I87A 1YNSA 3PQ8A 3EVZA 2HWUA 2I55A 4IJ6A 4MVXA 3L6UA 5G0SA 1KARA 5T8KA 4AJHA 1AB5A 5ALFA 1ZDMA 2QLLA 4NZPA 1V9CA 2CB0A 4YI3A 1FS4A 5A04A 2YMLA 4C6SA 3AVPA 3R7WA 4ESVA 1L4BA 4BE4A 4N39A 4P34A 3ZI7A 3KM0A 3M1LA 4ONEA 1THGA 3TKAA 3R76A 2JFBA 1NJ8A 1PDVA 4QOFA 3TXYA 1C30B 2FG6C 2WF7A 3K2EA 5AM2A 4BYGA 5AW7A 4YCJA 4QGSA 5B7QA 4QWWA 5DHSA 3EQ9A 3LRPA 1T3LA 3FPGA 4TQGA 2J3JA 4CMKA 3IP7A 2H7YA 3BF8A 4CG3A 4GF5A 4I50B 3YASA 3I34X 1JBQA 3H04A 1SEVA 1SEPA 2XTMA 3EGXB 5EHGA 1KOJA 4O2BB 4TS3A 3BWXA 1ZMOA 2PK3A 1OTXA 2XBMA 3S55A 3H13A 4LHXA 2AYYA 3AUTA 5C8VA 2MYNA 4PVDA 2ZRNA 1SXJC 4PHHA 1V1MA 4B3GA 2H2GA 4WLFA 4C21A 1ZM4A 3PA6A 5TVGA 1RJEA 1BG6A 2PKQP 3UOGA 2GEFA 3ZWMA 4OJTA 4ZYVA 3PEYA 4K87A 4RY9A 4KZPA 5AVVA 1DEXA 1IDN1 3R20A 3LGXA 3D7MA 3EZ6A 3LUGA 4UHJA 4DCTA 2BLLA 5IVPA 4E94A 2TMDA 3V00A 4ZOQI 4MPJA 2H5JA 4ZVMA 4WCFB 4KSYA 3D6JA 1M66A 1NVFA 2AZTA 4GP7A 3CNOA 5IBQA 3EZLA 2VQ3A 4R9VA 3HXOA 2AFIA 1C0PA 4D4LA 3B20A 1P4GA 2FUG1 3HYRA 4OQLA 4RUKA 5JXJA 4YCNA 2D6FA 2XUPA 2D4HA 1GTJ1 2O14A 3LT2A 2NVUB 4WERA 1VFPA 3GYGA 2PV7A 1EVJA 4OK3A 3ED1A 4JR2A 3RVJA 1Q2XA 4E4TA 4DV7B 3TLAA 2PX3A 3A32A 2WTBA 3DTVB 3GV0A 3MGCA 1CUAA 2XCOA 3ND8A 3QQ5A 4OBWA 4DSTA 4MUAA 3VHQA 2QZPA 3ZXIA 2Y1XA 2QYSA 3J7TA 1G291 4X20B 1N5RA 1P7VA 1V43A 1FFYA 3PDHA 1M6HA 3RU3A 3X44A 1VMEA 3I30X 4TTJA 5FUWA 3WMFA 2KYRA 2YXEA 3JASA 1WMEA 3DPIA 2ZYSA 1BHSA 2AVNA 4U1RA 1U1DA 2REQB 5AKIA 3WAGA 2IH2A 1IMJA 1MF7A 4X24A 5U1PA 4FR2A 2GK6A 2QW1A 2VDPB 3H17A 3JWGA 2WUWE 3E9NA 2C4KA 2OILA 1YGYA 4KYVA 3GGDA 1ISGA 4TTSA 5IXYA 4LC9A 1RTTA 3LPLA 2ARKA 3BZBA 5BWLA 3O83A 5FUQA 2FMHA 4YV7A 1I9CA 4NCNA 4H0FA 5ICCA 1Z3IX 1E9SA 1T5HX 2WDPA 4ADSG 3UXYA 4EVSA 3HBNA 4OLFA 4UEKA 4IQ0A 1HTWA 2YV1A 1BVRA 1DBWA 3QU7A 3OMXA 4W1PA 3WYCA 5BVGA 3E05A 3OF2A 3FSGD 3A05A 4HG2A 3NIWA 3WOVA 1JEAA 5HRCA 3IVMA 3MOSA 4HYTA 1ZCAA 2OV1A 1MH9A 5FQOA 1DXYA 4MWSA 5I9NA 5J2TF 2D2IA 1AS0A 1HSOA 1KDOA 1XXHA 3AMVA 4MKIA 3T06B 1EKXA 1NXWA 5KQRA 3HZOA 2C4TA 2EV9A 3EFOB 4MUBA 4KQ2A 2PS1A 2FSVA 3S1AA 4H31A 2A9PA 2E4VA 3FNRA 1XZHA 1SVSA 3A1EA 3DH0A 5DK4A 4A6XA 4YAGA 1UADA 4F2WA 2CJWA 3KALA 4UE6A 3ZHVA 1N34B 4O4JF 5AK3A 3QE9Y 2CDNA 1SD2A 4RK5A 1F2UB 2B37A 5G3ZA 1V16A 3LKBA 5KSZA 1WO8A 1UDAA 4Q1BA 1VJTA 2H0AA 1P9OA 1JIQA 3FNQA 1AKYA 3GJSA 3AKDA 3UBTA 1VBKA 1MQ9A 4G8JA 4Y2VA 3NOXA 1ZH8A 3FCEA 4G65A 1UDRA 2WE8A 4MINA 4JROA 4LC0A 1D1QA 1MJGM 4JMPA 4O33A 2QIOA 3EXHB 3GZNB 4U2GA 3BBLA 1W4CA 3EE6A 3MGKA 1N6HA 2G1JA 4PSUA 5AQEA 1ZMRA 5G40A 5D3ZA 3W5DA 1QF9A 1FDSA 3AONB 4J03A 1OE0A 5IYZA 3AHCA 2P9BA 4KNWA 3QLJA 4I1RA 1GFSA 1JVNA 1OBCA 3PYXA 4HGOA 3O94A 2VRBA 2O19A 2QLTA 3S27A 1O77A 2NZVG 3I37X 3LZ6A 3TZEA 3ZKWB 4KR3A 1OZGA 3HBFA 4WRRA 2BISA 3JRXA 5HTOA 2J32A 1JPNA 1ZNYA 1RW4A 2R8ZA 3HZHA 5HDBB 3W5VA 1IQPA 3ZXYA 3DNMA 2CT8A 2RI1A 4G41A 4TMFA 1HDCA 3OCYA 4DR6B 2NU9B 4MW4A 2ZRPA 3R9KA 4EHKA 1JIJA 3UJNA 1T8UA 1U63A 5LKAA 4LYDA 4KO4S 2PSFA 3F5FA 1NUUA 2Z3ZA 1ZIPA 2FFJA 2QQ5A 4G4SP 5IBPA 3DVRX 2VDJA 4H1VA 3TCNA 4Y2JA 4TWRA 5LCXA 4ZKEA 1EFRA 4S04A 3FUVA 1GZVA 1QP7A 2XJ4A 3H2JA 4I1UA 4NABA 4OYLA 2IHVA 1EUYA 2C0CA 5FPQA 2AVDA 2AEMA 2FX2A 1UMDA 1XGKA 2ZBFA 3AINA 1UZMA 4LWOA 2NU6B 2G3YA 4XSHA 3VH4A 1BXRA 1K06A 3G9XA 4KHZA 3O8RA 1K86A 3C3PA 3LDHA 3CC8A 4MS1A 2Y0BA 1AM4D 1YDEA 3DZHA 4OPMA 1WCYA 2GM5A 2KX7A 2VF8A 4HGRA 2WUEA 3LD9A 5AHRA 5H1YA 5L53A 5BQFA 1N1GA 1T8YA 2QSYA 4EA6A 2VC2B 2IHYA 4DY4A 3TZCA 3CZ9A 4F7WA 3NWBA 1Q74A 3CVYA 1N7JA 4MWGA 4QLBA 4PGGA 1KI4A 5A7GA 4WDQA 3AEUA 5K8LA 4YUYA 2PZAA 4EUFA 5JSQA 2PTGA 2HIHA 2OZKA 1P17A 2BELA 2F90A 1LD3A 1JHXA 2EWWA 3FPFA 1F8YA 1M10A 4YJ3F 3WMWA 1XXLA 5A4IS 1W19A 3JAMA 2NP7A 4NPAA 4JBNA 1L5WA 2J0SA 3R6LA 2GEUA 5DK6A 3RM3A 1ONOA 3C6QA 1DIRA 1IH8A 1KEUA 1G55A 4U02A 1UZLA 2Y67A 3GRKA 3COYA 3QEOA 5EI5A 1VXRA 3B1JA 1DTSA 5JPCA 1E89A 1FFAA 1ZVMA 2IYPA 5FEMA 5A5EA 1IVYA 1R6VA 3T0GA 4JUIA 1LCIA 1O57A 4I08A 2VH1A 3F2IA 4JCOA 3DL0A 4OMDA 5AXDA 5GONF 3BREA 3DCNA 4U9HS 3SZ3A 5EYPA 1RQXA 1NOKA 3H2KA 4TM8A 2X58A 3MJDA 4M8SA 1OYWA 3BK2A 4OXXA 4TVOA 1V5WA 5GOZA 1DRVA 4G56A 4B79A 2P4UA 3CRW1 5ALMA 1RYBA 1YOBA 1G9XA 2EDAA 2X76A 3FOCA 4M1WA 1G3QA 2ZSFA 2J0UB 3NHPA 3TTXA 4Q7LA 4QSMA 2NW6A 3IKTA 2UXBB 4MW7A 5B37A 3T1OA 1U0BB 2CDCA 4P3YA 2J9RA 2HMTA 1TUBB 2C1ZA 2VJQA 3PQ5A 3O26A 3OM8A 1SXJB 3JZDA 3BHNA 2G4VA 4TMYA 4PNEA 1ISFA 2E4WA 2FPXA 5TT1A 4B4VA 3RJTA 2N46A 2D0IA 4GMFA 5TGDA 5JJBA 1WABA 1ZK2A 4C4TA 4LRXA 2O4CA 3TECE 4D8UA 1OLOA 3PXGA 3TZBA 3G1TA 1QKJA 5KYTA 3PD1A 4L0CA 1MO3A 1ZWLA 2AJBA 2EP7A 2ZIWB 3WV5A 5FAXA 3AUKA 2I3GA 4HDCA 2J31A 2M6LA 4BWYA 2B6HA 3FTDA 4DLNA 3AM1A 1R5BA 2COUA 2BGTA 4OATA 3NTUA 4UOZA 2YV2A 3CJRA 1IQUA 3STYA 3GLGB 1A98A 1T5SA 5DGIA 1W1IA 4YP9A 1K8XB 1U2GA 2PAFA 2XXBA 1B0ZA 3NWEA 3LBYA 3QLTA 1GZ5A 3GDFA 4EYGA 1YQEA 5K5EA 2JLZA 4JXZA 5ALIA 1TIPA 1VMAA 1UWVA 2C07A 3AUAA 3DVAB 1UJ2A 4AZ3A 4BFCA 3UQZA 4BMZA 3GLIB 1Y6FA 1YZFA 2BH2A 2HSGA 2I3BA 2CXQA 1SD1A 4PYNA 5EMLA 1U80A 4RPJA 3RSGA 2SKCA 4OD0A 2ZWVA 4I2VA 3K1JA 2NNWB 4QUAA 3AETB 4CV2A 4XAQA 2O2IA 2FFBA 2HMVA 2HQBA 3B8HA 1WTAA 5KYYA 4NFYA 1QC5B 5A5FA 2G0NA 5E4TA 3N0RA 4PLFA 2ZAMA 3OZIA 5TF4A 1UQUA 2LXNA 2F3QA 4H6XA 1CRLA 3BD6A 3PJEA 5IXJA 1RYMA 1UM9B 1X14A 3BJIC 5SY6A 2D7JA 4MYSA 5EJMA 3LE8A 4W9NC 3IQDB 1KEEA 1L4LA 3JD0A 4XOIA 2V7EA 2R0QC 4P08A 1Z6TA 5F51A 4AZWA 4CWAA 1J2EA 8MHTA 2B36A 3P9NA 3RHSA 2F17A 4GOOD 2J5BA 3FHTA 2JAUA 1IYZA 1YSCA 1ZU5A 3NRBA 4HLUC 5DASA 1IOLA 3QF4B 4DQVA 3SVTA 3UMJA 2G5GX 3TQQA 4DKXA 3ZK7A 1PTJA 5CHYA 3MD9A 1FFWA 1G8GA 1YAHA 2VIIA 2QTFA 2X13A 3DYBA 3F5QA 4HK4A 3RVMA 1A50B 2FF7A 4RTSA 4GRIA 3N07A 3PR3A 2VZ9A 3KQMA 3BRQA 3RAGA 4ZAFA 1QBKC 4PC6A 4FZJA 1FUKA 2BFFB 4CQMD 3CUUA 4JP2A 4R2JA 1BN6A 3NGMA 1RC1A 4HC4A 1UH5A 3OM1A 2HRQA 4NIMA 4P5PA 3WK5A 3DFIA 2O1EA 3MRVA 1QGUB 3EDMA 4EJ0A 3BVPA 3WNDA 1SZJG 3K9QO 2VHEA 1LY1A 2H1CA 4HDRB 4YHHB 2C58A 3WWZA 4O59O 3U09A 3QGMA 4PSDA 1QFYA 4YUXA 2VTKA 1EFVB 1G1MA 4PGAA 1GTMA 1J9ZA 5LXTA 4MYRA 1MG0A 3LAWA 1KKLA 4IGFA 1EGAA 3PT5A 3NI2A 4Q1DA 1QR6A 1RQLA 1ST3A 2V5VA 5ECWA 1P2VA 3BQNB 4EO7A 5B58T 2QWXA 4UAGA 3W06A 3TLEA 3OIGA 3ZDAA 1XCJA 2A4KA 2GCOA 2R7MA 3RU7A 5L4LA 3BRCA 5BPFA 1JEQB 3RE1A 3UB4A 4DWOA 4XEUA 4TV8A 1YQWA 2AMFA 2CEKA 7MHTA 1A5TA 1B4DA 1CK4A 3HL0A 3LMKA 3LJKA 2GM9A 4TGLA 3TRKA 5GADl 4NBUA 1OB5A 3TPCA 2GB4A 3HGQA 3OP1A 1EZZA 3IUJA 2UZ3A 1YA6A 2NIPA 3LRXA 1LNZA 3ILSA 3IQEA 3ZW8A 5CVVA 3N8DA 2VP6A 2A5GA 2R1TB 2Q3DA 4GXTA 3GA0A 4G2TA 1ZFNA 5CD1A 1FTSA 3DM9B 4QG7A 3JQ8B 5BN3B 2G06A 4HDSA 1XUOA 5ENZA 1H9AA 3DEKA 2I6TA 2VZEA 2EAUA 1NI4B 1XU4A 3EDOA 4RXUA 4C7MA 1KP3A 2OV6A 3PQ4A 1PO7A 1OREA 1RS0A 4PO8A 4U7FA 3V4SA 3WGZA 4EJSC 4LYYA 5ALYA 1NLUA 1G8JA 3CIOA 4KIFA 4YONB 4IX1A 1E1KA 3RU9A 4CQMB 3KXPA 2QNIA 4Q3KA 2ZSKA 1SELA 3KYCA 1W59A 5JPIA 2IDZA 4XKJA 3H75A 4HDMA 3BWCA 2W2KA 4L8FA 3CU5A 3HTXA 3PR2B 3DBLA 2F64A 3B1FA 2LE0A 2A78A 3PJFA 4Z3DA 3B7PA 1P1FA 5DTMA 1NYTA 3KQVA 2XUIA 1SXJE 4L8VA 2QUJA 3GPCA 1O4WA 2FN9A 4WD3A 3JYOA 2CXNA 2WJ4A 3ZDXB 3EVBA 1ZN7A 2HYIC 2HJHA 3G2LA 4YP1A 4G0ZA 2H9IA 3TIVA 3FTEA 4B85A 5DOZA 3VTAA 1EUCB 3SBOA 2C7RA 2R751 4QFDA 2DUJA 4RWEA 5FYDA 1F48A 1M1NB 4DIEA 2GEKA 3O4JA 2GYYA 3I5XA 3G8CA 4EK9A 1ZEJA 1KYIA 1V11A 1P1KA 2VHXA 3DULA 4MDHA 5FOXA 4BLWA 2PWAA 4UEJA 3ZGOA 3CMMA 4Q93A 4WXYB 4IOKA 1R8SA 1WZIA 1W25A 4KQ9A 2B34A 1ODKA 2V97A 3B38A 1ISHA 3GPIA 3JQ9C 4G1BA 4J4HA 4NCHA 4PTZA 4L5BA 2NAFA 2YDYA 3S28A 1P74A 3B89A 1IZYA 3OCWA 4BMOB 3GLIE 3KYDA 3DBHB 1Q5PA 1PKEA 2I7DA 1ACJA 1GOTA 1WXXA 1AQUA 1FNBA 2W6QA 3QLEA 3A3OA 2JS7A 4LNAA 3W79A 5MN4A 5B64A 5E2BA 3ZTTA 1LS1A 1Z8HA 4HQKA 2DQKA 4LMRA 4MTLA 4CKBA 1QX4A 3NPAA 2QTNA 4F5DA 2X8JA 3HJCA 4EFMA 1DFIA 3CR3C 4GLOA 5IC6A 2Q3JA 4QJ5A 5JD4A 3QEAZ 1ZJ5A 4BVKA 1LDGA 4F93B 5F5LA 4QQKA 4C3UA 2B98A 1CF4A 2EBUA 2QTHA 4OQFA 4B3XA 1J8MF 5BSUA 1ZUHA 1LSOA 3EWNA 3O2JA 3AVOA 2ORYA 2BKEA 4TTQA 2QTVB 1VE9A 3FPSA 4YQZA 2ZE7A 1RJGA 1QIKA 4DIDA 1ZRNA 2Z1DA 1Z63A 1PZHA 1QORA 3UXEA 2EFHB 1UKAA 1VBFA 3A04A 1NDUA 2XUGA 4YJ3B 2O6HA 5A4MS 3F6SA 1QZTA 8ATCA 5HUHA 8OHMA 3AF3A 3D81A 1IBCA 4NS4A 1QPZA 3GUZA 3IAM1 1LF0A 4P35A 2OBYA 4BPRA 2P27A 3HU3A 1XAHA 2GAAA 1Y8ZA 4KO3S 3DHVA 5KX5F 3K70D 3N5KA 5CB0A 2YOGA 1NPTO 4KLCA 3QX9A 4PV7A 4FEEA 5EGNA 4I8XA 3VUEA 2W93A 4RETA 4WZBB 4DAEA 1X8LA 3FWPA 4DANA 3PP8A 5F7OA 1R8JA 1P18A 1YR2A 3E0XA 3E9EA 4JIMA 3B3JA 1Z0FA 4KFTA 1CJBA 2OHXA 2Q41A 1R15A 3C1OA 4UXHA 3VZDA 3GDOA 3RRMA 1HH4A 2MYPA 4OP3A 2YJZA 4BNNA 3NT2A 3M5CA 4U2FA 3O38A 1RWKA 5HF9A 4XYLA 3PQ2A 4QARA 3VX4A 4ESOA 1A97A 3CN9A 1XELA 5BQPA 1FXWF 3JV7A 3LKDA 3HU1A 3WJAA 3C6KA 2X4LA 2WVAA 3L1IA 3OU7A 3WSVA 2J5QA 2ISQA 2XE6A 2G1KA 4XIJA 3UF0A 3ZLVA 3ZXXA 5I8PA 2FW0A 4GO1A 2FMIA 4OL9A 3RS5A 4KPYA 1U8XX 4NL4H 5ES3A 3BIWA 3D6UA 4EKNB 3AHHA 3KOMA 5BRAA 4KRYA 2L18A 2WE7A 2LGJA 2H2IA 4WXEA 3HJUA 4LWQA 3RODA 4HNQA 4ML3A 4WIAA 4DDUA 3P96A 5IHPA 1JPUA 3EYAA 2XOKD 3CUSA 1UBSB 1L3CA 4B4OA 2PUGA 2O8BA 1GNVA 4D0GA 2OP0A 2OWDA 3T99A 4L22A 1PHRA 2VWPA 3DDNA 4R1LA 1FTNA 3WGGA 1TCCA 3WP1B 3IQZA 1ECFA 4X95A 4PLHA 3VBCA 3OKAA 2X77A 2FWAA 5CFPA 2OBXA 1S9DA 4AKIA 1XQWA 4QJIA 3NVAA 3QVOA 2Q6LA 2ZGVA 5FO0A 1OHHD 3CWCA 3U2QA 1N6RA 1XP5A 3PUVA 1K5GA 4FFLA 5D1NA 2B1GA 1JWBB 1UC4B 2FPGB 1MZVA 3DZJA 3OQPA 4GX0A 2X6RA 3W3AD 1WR8A 4D44A 1UANA 4G5SA 4IWNA 1NW6A 2ROQA 4HKTA 2J9ZB 3OHSX 2ZETA 1Q0RA 3PFWO 5EE5B 3N0TA 1UPBA 2VJCA 3EQ8A 4CFZA 2JATA 4FSXA 4J6FA 1JAHA 4XVUA 1O0BA 1GAEO 5B2FA 2H0QA 1U2DA 2AMLA 2H1WA 3BB1A 4K9RA 4X45A 1PE0A 2J3DA 3OPYA 1L5MA 4FLEA 4F9GA 1SR8A 2WU1A 1E5LA 2JIBA 4ND2A 5IMBA 3T7AA 3WDKA 5KB3A 3PDJA 3INTA 1DDGA 4GI1A 4QSHA 1ZPDA 1DG3A 1UPUA 2GO1A 1W2HA 2J9YB 2H52A 2CY0A 2RHDA 4DLBA 3TQSA 1KDRA 2YWCA 5FBQB 4A8PA 3S4YA 1PWYE 2W6CX 3ZGVA 1J24A 1E69A 4TMXA 3MLBA 1FMFA 3UGQA 3WGHA 1BE6A 1NJ5A 1F5NA 2I54A 3T38A 2QL7A 1W5BA 1XG5A 3TLYA 1GRNA 1G6KA 1UXIA 1DNPA 4US0R 2ZBEA 4GT1A 5EHZA 1NQ5A 3KXKA 3K9LA 2V98A 1BVHA 3EPJA 4DDKA 4JT4A 2IYNA 3TQRA 4FOTA 4DMUB 4CQNA 4D4HA 3RAFC 1UEJA 4KPUA 3CQ9A 3HN7A 1G6OA 1PEAA 2GN2A 3PCRB 5HF8A 3E3NA 2DTDA 2AUMA 2IU3A 1DUSA 4EEKA 5H16A 2WSYB 3GIWA 3S8MA 4IXWA 3GJZA 4L2IA 4XWAA 1FRQA 1DXQA 1OR8A 3O2SB 2C9YA 2Q29A 3NBKA 1DZ3A 3NFRA 4OXQA 4ARBA 4P84A 4EJSB 3ST7A 4LV8B 4CLEA 4TROA 2FFAA 2NUBA 4I4CA 2H16A 5CAEB 1HRKA 1D2MA 4NMHA 5HK8A 3AHIA 3U4HA 2CGEA 2D5AA 3OZFA 3VOSA 5C1DA 5JALA 1J23A 1EFKA 4AMGA 1WM1A 4CIYA 2PR2A 1XN4A 2D1YA 4GDFA 1Z26A 2DM6A 3ZIAA 2OHFA 1YIAA 3A1NA 3D7LA 1GAXA 1GVHA 1QG4A 4CF3A 4CEHB 3IMKA 2FCAA 4IJVA 4A8TA 3P7MA 3SF0A 3DUFB 2X86A 1V39A 2EHJA 4XYBA 3KEQA 1E0JA 4JEUA 5GP1A 1KE1A 5JXIA 1WW3A 1Z5PA 1F38A 5BSRA 3HYLA 3V8EA 1DFGA 4CMIA 1OVMA 1V5IA 4QBGB 4D0NA 4FXPA 4HY3A 4CM4A 1UP6A 1PN3A 3FIJA 3DJYA 3KR1A 4V0OA 1YR8A 1DARA 4Z9BA 3QVKA 5IDWA 5JAPA 3K8YA 4YT4A 2LNDA 1II9A 3BK1A 3AIMA 5FPPA 1F17A 3MS4A 2GCNA 3OZVA 4C1BA 2XRMA 2X2EA 2D1TA 2BTEA 3O8OB 1Y1LA 1Z6AA 5JZBA 2RHGB 1WNTA 5IF3A 3SOZA 3TOSA 5IX8A 2C7GA 1R6BX 2QQ0A 2YJ4A 3H87A 4HYQA 3N3BC 4J90A 4R2XA 4TS9A 3A9CA 3LC1O 4XJSA 3R6TA 4R71A 3KQHA 4WZBE 1CQZA 2OV3A 1OH5A 4LF5B 4ZI5A 2HOQA 3NBZC 1AQYA 1S8NA 1Z37A 2ZRGA 5ALRA 5CXQA 5GZ3A 4O2AF 2VO1A 4XASA 5G2OA 5JXWA 3BCRA 1FLVA 2F3SA 1NFFA 3TR6A 3TSAA 6Q21A 2FPRA 1DKPA 3PUWA 4QRDA 1ULUA 1QQTA 1CUUA 2RKBA 4JDUA 1QG6A 4B1FA 1UKVY 4LJAA 4YRGA 3OJ0A 3BSSA 4MGYR 4WQMA 3IOYA 2IFTA 4W9RA 2IS2A 4QEKA 2ZJ1A 4TZ0A 1DGQA 4FW8A 3WRYC 4BWGA 1ZGCA 1E3EA 5J5VA 3O84A 4PLCA 2BFCB 2A2ZA 1TCBA 4X3OA 2JAPA 1MO6A 1E0AA 4MGEA 5C5IA 2BM8A 1NMQA 4M9QA 5JFOA 2FPUA 1RM5A 1VHLA 4JB0A 2VYND 5F35A 2ACWA 1VKOA 3QP9A 1PGNA 1GQRA 1UMCB 2WIDA 3H2SA 1E20A 3KKQA 4NDZA 4RELA 3WXMA 2D7CA 3EEFA 4WBXC 4Q4AB 1T8TA 2H6EA 1X1AA 3MINA 2Q9CA 1YQTA 4C3OB 1JHOA 4Q4HB 2V1XA 2Y2UA 2R6HA 3F9IA 4DG8A 2O6LA 3QELB 1GLVA 3UCFA 4DA6A 1N6PA 1E79A 1QFJA 3ME5A 1TLLA 1W4LA 3FSEA 5AJWA 1F2DA 5ES4B 1RXUA 1B8VA 1CTQA 3IELA 2GUGA 3LOPA 3NEJA 3MMZA 2ISSD 4LXIA 2FWNA 4I1OA 3VH2A 3E7DA 5A4AA 1YS2X 2I9PA 3DLIA 4G84A 3V1UA 2RH8A 2UU9B 2QRUA 5AP9A 3HXQA 3S2SA 2ZEJA 4FDMA 4BX8A 1JTEA 4HB4A 2HJRA 2FFQA 3EVDA 1JL3A 2G0AA 3DXYA 1KL7A 4LXYA 1XE3A 4HR7A 4RVSA 3D4BA 1LRKA 1NJGA 2Z8XA 3PE4A 3RGGA 4EL5A 5FT9A 5FWYB 3QVTA 4NJEB 5L3RA 1YJAA 2BFNA 3RS4A 4RKYA 2JAQA 4C4XA 3PNQA 4JI4B 5EJFA 2M6SA 3OI7A 5LB2A 3HVJA 4KXLA 7ADHA 3KOWA 3D43A 1TMKA 2C97A 1ODLA 4ZEWA 1TW3A 5CYGA 4HWOA 2QD3A 2O50A 4A73A 4FYIA 4BNWA 3DAGA 1HO3A 4V1CB 3T1TA 4E4YA 2BFPA 3INGA 1N2CE 1NUHA 3RRXA 1NONA 5AKEA 2Y1KA 1I01A 1ZC4A 3D3WB 1FDVA 1U0GA 3OUTA 2HIMA 3EXIA 3DV0A 3JAKA 4L16A 3PI6A 4RD0A 3IIKA 1TJYA 1USIA 1VDMA 1CJUC 1E3TA 3G9ZA 3LLMA 5ALDA 5AT1A 4HDKB 2Q9AA 3SJ7A 5JADA 3WQBA 4HTFB 5BYKA 1GN9A 3WTCA 1YB2A 1DE0A 1JSLA 3D2LA 2WSBA 2CJPA 3H9BA 3L7NA 4RJIA 4EX7A 4JI8B 1QMGA 1FFHA 1S4MA 3PGKA 2GVNA 4GQAA 2W58A 4XM0A 5EGSA 3RS7A 3UJHA 2B8JA 4CMCA 3Q7RA 2YXDA 1X3LA 3FZQA 2BI4A 2PQMA 2FR0A 5KNDA 2A1IA 3MYYA 5C0OE 1MP0A 3WFZA 1XMPA 5E7QA 4GM4A 4CV3A 1IN5A 3R44A 3NHKA 2GJ9A 4ID3A 4IUYA 4RL6A 1NI3A 1W52X 5J40A 1XLVA 4HTAA 2QAGA 1JKJA 2HCBA 3DLBA 3QBJA 4RNDB 2I2DA 4URXR 5IM5A 1OH6A 2EW1A 3DOIA 1ZJZA 3I6MA 4REQB 2OXTA 4JR0A 3TL2A 4HZIA 4ALMA 4B6SA 3BILA 1XEWX 4DLKA 2NUAA 3JD3A 4R3NA 4UBOA 4D92A 4MV9A 1KAMA 3IAAA 4UM9D 1NRXA 2WR8A 4GBJA 4BKPA 1YJQA 2HK9A 2EARA 4KQMA 4PCAA 5AIAA 2PZ8A 4B32A 4DM4A 5CH3A 3QKTA 2E1RA 1E6CA 4Q01A 3UAYA 2GK7A 4WPGA 5GVRA 2JIMA 1EUDA 5BNTA 3KXIA 2RGUA 2JCXA 4Q3OA 4X94A 4B6EA 5KTPA 1KIAA 2B4AA 3DJFA 4HDOB 2ZBDA 4H1UA 4RVNA 4TLDA 1LPPA 4UVHA 3WXBA 3FB1A 1OV4A 4KQJA 3RAEC 1NFRA 1Y3AA 3AJ8A 3TSWA 3Q4GA 5BOSB 3Q87B 3K32A 3VR6H 3G2MA 3CVVA 3PEUA 4FSHA 4BO2A 2ZZNA 3MCTA 2FUCA 1VE3A 1YL5A 4N40A 1PLKA 2X1HA 3GDWA 4MRNA 4Q6WA 4QC2A 5FBLB 4GI3A 2XAUA 3GI1A 1HYQA 1XTUA 2QTMA 2RHWA 2Y2VA 3HP4A 3Q85A 1H9BA 2VH5R 5D1HA 4H4CA 4HFRA 3FPHA 2JEZA 3KEMA 3LUJA 4RSRA 3LPMA 4KQ6A 2B8WA 3S2YA 4ZT3A 4C5AA 3HUEA 5C8XA 5JMWA 4EI2A 3KXLA 4D4IA 3T7RA 4AB1A 4F4IA 2XECA 2DECA 1WNFA 2OCAA 4MVJH 4KWTA 2GCPA 1CT9A 1WX1A 1Y4DE 2ZWOA 1U0EA 4HCJA 4WKOA 5FFNA 3RYFA 2QQFA 1A9ZA 4PIVA 3VPXA 1P2GA 4G2NA 3GFTA 4WOBA 2AN3A 1AURA 1IXKA 3KJZA 5D6OA 3DCJA 1JXAA 1K5PA