2IZCB

Apostreptavidin ph 2.0 i222 complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
123
structure length
123
Chain Sequence
b'AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTAVIDIN
publication title Binding of biotin to streptavidin stabilizes intersubunit salt bridges between Asp61 and His87 at low pH.
pubmed doi rcsb
molecule tags Biotin-binding protein
total genus 26
structure length 123
sequence length 123
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 2izcB00
1HXLA 1VWDB 1SWTA 2RTIB 2RTRB 1RXKA 1SWFA 2Y3FA 4Y59A 3RDSA 1SRGA 3RDMA 4Z2PA 4YVBA 1RXJA 3T2WA 3VGWA 1NQNA 4Z2VA 4BX6A 1MM9A 1SLEB 3SZJA 4BX7A 2C1QA 4BX5B 1LDOA 5IRAA 1VWHB 1MEPA 1RSTB 1STSB 1HQQA 4OKAA 2A5BA 1RSUB 2IZGB 3RDXA 1SWRA 3SZIA 2IZBA 1SWJA 2RTBB 2IZHB 1DF8A 1VWNB 2MF6A 2Y3EA 1LCZA 3X00A 5CSEA 2OFAA 1NQMA 3MM0A 2RTGB 2Y32A 1N9YA 1SRJA 3RDOA 5F2BA 4JO6A 3WZOA 1VWIB 3EW2A 2IZIA 4DNEA 3RE5A 1SWGA 1VYOA 2RTLA 2IZFB 2IZEB 1MK5A 4Z2OA 1VWAB 1VWFB 2RTJA 4CPHB 4BBOA 5L3YA 5JD2A 4GD9A 1VWBB 4BX5A 4Y5DA 1N4JA 4Z6JA 1VWJB 1VWOB 3WZQA 3RY1A 3T6FA 4U46A 1SWLA 4BJ8A 1VWRB 2RTPB 3WZNA 2OFBA 2RTMA 1PTSA 4BCSA 4EKVA 1SWHA 2IZKA 2IZDB 1HY2A 2ZSCA 4GDAA 2RTEB 1N7YA 4GJSA 5IRUA 1KL4A 1KL5A 1Y55X 4GGTA 1SWSA 4JHQA 2QCBA 4Z27A 2A5CA 4JNJA 3VHHA 5IRWA 1VWCB 1NDJA 1MOYA 3VHMA 1NBXA 1KL3A 1LUQA 1LDQA 2GH7A 4Z28A 4CPEA 4CPHA 1SLFB 1VWKB 1SWBA 3T6LA 1STRB 2IZCB 2WPUA 1VWMB 1SWKA 4I60A 1SWUA 2C1SA 1Y52X 1SWCA 1WBIA 5K67A 2OF8A 1SRIA 2RTFB 1VWQB 1RXHA 1SRHA 5K68A 2G5LA 2UYWA 3FDCA 1SLDB 2A8GA 3RY2A 2OF9A 5B5GA 2RTQB 1HXZA 2CAMA 5B5FA 1SWDA 1VWEB 2FHNX 1SREA 2BC3A 3RDUA 1LCVA 2RTNB 3WYQA 2RTCB 3VHIA 4CPIA 3WZPA 1SWEA 2UZ2A 1VWPB 1SLGB 1AVEA 1LELA 1VWGB 2RTHB 3PK2A 1VWLB 2IZLB 2RTOB 2F01A 3MG5A 1RAVA 4GGRA 1N43A 1IJ8A 1SWOA 3RDQA 4BX6B 2IZAA 4BX7B 2FHLA 1I9HA 1SRFA 1SWPA 2RTDB 4IRWA 3EW1A 2C4IA 3RE6A 4GGZA 1SWAA 1N9MA 5CHKA 4GJVA 2RTKA 1SWQA 3WYPA 1STPA 1SWNA 2RTAA 1Y53X 1KFFA 1NC9A 2IZJA 2AVIA 1AVDA 3SZHA 4CPFA 2JGSA 3T2XA 1LCWA
chains in the Genus database with same CATH superfamily
1HXLA 4QNIA 5DG4A 2RTRB 3SLTA 3FIDA 3JS1A 1CBRA 2Z4HA 4D6BA 1EPAA 2PI3O 1B0OA 4TLJA 1CBSA 3RDMA 1JV4A 5F58A 3V8UA 2AF5A 1TOWA 2WQ9A 3T2WA 4FBRA 1L6MA 2K23A 4ZGFA 4BX6A 1MM9A 1NP4A 1T0VA 3SZJA 4BX7A 1GKAA 5D47A 4O4UA 4DQ4A 1OEEA 1RLBE 1OEJA 4GRJA 2I5ZO 1LDOA 2KTDA 3CMPA 5IRAA 4BX5B 1W4TA 2VFCA 2G8CO 5HBSA 2AT3X 4O9SA 3RSWA 3B2KA 2OY7A 2IZBA 3MVFA 5FAZA 2OVEA 3PQSA 1SWJA 5LJKA 1DF8A 1GX3A 1VWNB 2Q2PA 4ID2A 4GZVA 5L8IA 2AL0X 4U3QA 5HZ9A 3OE3A 1EIIA 3AEHA 2OFRX 5CSEA 1ZNEA 2O62A 3HWEA 3H3IA 3FA8A 4NYQA 4ZJ0A 3AUMO 3B2JA 2RTGB 2Y32A 1G5WA 1SRJA 4AZOA 1HMTA 4JO6A 1HMRA 3WOVA 3P6DA 3WZOA 3ZW0A 3EW2A 5HZ8A 2FTBA 4WBKA 5AEOA 2MWHA 1AB0A 3RE5A 1BLRA 2VFBA 4YFPA 3N91A 2RTLA 2IZFB 3BLGA 5HTDA 1OBPA 2FR3A 4MVIA 4N7CA 4OMXA 1A3YA 4XMFA 4Y5DA 3FELA 4LZVA 1SXWA 2X4MA 2LBAA 1ERBA 1ML7A 3KQ0A 1SWLA 4U46A 1DZKA 3EBWA 2A3FX 4BJ8A 1DV9A 1PBYA 2RTMA 1PTSA 3Q6LA 4A1HA 4EKVA 1SWHA 3OJYC 2BHVA 1LFOA 1DFVA 3P6EA 4QGVA 3CKFA 2RTEB 4O4OA 1OPAA 4GJSA 5IRUA 2QMIA 1O1VA 3B2HA 5HCDC 3T1DA 2FS7A 2HZQA 1Y55X 4GGTA 2QCBA 3DTQA 3FR2A 3TZSA 3JQOA 1XCAA 3JSQA 4O49A 5IRWA 3FW5A 2FR2A 1N0SA 4QZUA 3KFHA 3CQRA 5H9KA 2G7BA 4A1YA 2JU8A 4CV7A 2GH7A 4Z28A 1IW2A 1GM6A 3Q34A 2BS6A 1O8VA 1EW3A 1IFBA 3T6LA 3TGCA 4ZHCA 1ZNKA 2HZRA 2C1SA 3VE2A 1KT4A 1SWCA 1WBIA 2HYSA 4FGIB 4KCAA 3RBYA 4EEJA 1EALA 3BX7A 1S44A 2FKGA 2RTFB 1KT3A 4I9RA 4OMWA 3VE1A 2K62A 2CBSA 2X8FA 5LJDA 1ACDA 5B5GA 3WJGA 1E5PA 1KZXA 3VG2A 4U9CA 3WYQA 1SREA 4KH8A 4WFUA 2AMMX 2LKKA 3CR6A 1A57A 2UZ2A 5AQ6A 2DJGA 1Y9LA 3PPTA 1E00A 2RTHB 2I5VO 3CBSA 5L8OA 2IZLB 2F01A 5EDBA 3ZUIA 1SXYA 2PY1A 3U0DA 3NX2A 4Y0PA 4AZPA 1LIBA 2FHLA 2OVDA 2OY8A 4TJZA 4CDDA 2ACPX 1SWPA 2R56A 1AELA 5D8JA 2YG2A 3NPOA 4L1NA 3UEVA 4TQ2A 5IO7A 5HA0A 2C4IA 3TGAA 4YBPA 5BYPA 1KT5A 4GGZA 1DF3A 1JIWI 1LIEA 1IKJA 5CHKA 4GJVA 5B2AO 1KZWA 1SWQA 4IB8A 1EQDA 3NQKA 1STPA 4XMCA 2RTAA 5IO5A 2IZJA 1KFFA 5H8TA 3SZHA 5HZ6A 1EIOA 4CPFA 4ZHFA 3PEDA 1YWAA 4OS8A 2RA6A 2X34A 1SWTA 2AT6X 2RTIB 1KT6A 4Y0QA 3STKA 4OEMA 5IO6A 3ELXA 1BWYA 1OBUA 4Z2PA 1OEKA 4YDAA 4AW8A 4YVBA 1RXJA 4ORWA 3VGWA 1FEMA 4IB7A 1NQNA 4O4SA 2Q39A 4IABA 3UEUA 5D48A 1JJXA 2MJIA 4EFGA 5HCEC 5CE4A 4MVKA 1K3BA 1LICA 1VWHB 1Z24A 1XKIA 1HQQA 3L4RA 2A5BA 2IZGB 2CM9A 3QQ2A 4IB9A 4O3ZA 3WJDA 4O3XB 2FLJA 3F6ZB 2QM9A 1AVGI 1EXSA 2IZHB 3O22A 5D4AA 3MX7A 1OBQA 3FENA 1ZNDA 1FELA 1BSYA 1UZ2X 4NV8A 4ORXA 3LHNA 1MX8A 1GX8A 3RDOA 5F2BA 3BRNA 1W6FA 1FTPA 1VWIB 1WUBA 2G78A 4COTA 2A0AA 4NNSA 1I06A 3P24A 1IKEA 4ARHA 1I04A 2IZEB 4GETA 1VWAB 4CPHB 1ZNLA 3FA6A 1BRQA 3SAOA 4EQAC 5JD2A 4GD9A 1JJJA 2DM5A 5LJEA 5F6ZA 4WHIA 4A60A 3SOTA 4Z6JA 1VWOB 3WZQA 1ZRYA 2F09A 3C77X 1LPJA 5HCCC 1SXUA 1VWRB 3FIQA 2RTPB 3WZNA 2OFBA 2Q9SA 4BCSA 1X8NA 4GE1A 4TKBA 5LKFA 1B4MA 2IZDB 2RCTA 4OS3A 1SY0A 5FQ7E 3IFBA 4N7DA 1JMXA 3C78X 1GT1A 2AT5X 1N7YA 2X8TA 4NV7A 4QYPA 1KL5A 3BDRA 4JHQA 2CM4A 1ICNA 4KIIA 1DZMA 2FGSA 5HTEA 3VPJE 2HNXA 4ML7B 3VHHA 2L68A 2AT0X 4ORUA 2LB6A 3VHMA 1SMPI 4ODDA 1ALBA 4MISA 4OS0A 1FDQA 5CYBA 3U9PC 1KGLA 1H91A 2WR6A 4NLJA 3FEPA 4HFOA 3CBCA 4ZH9A 2QOMA 1SLFB 3KFIA 1SWBA 3WJCA 4R0BA 2MHDA 2WPUA 1VWMB 1SWKA 4EXZA 3B2LA 3B2IA 5B11O 5K67A 3CKGA 1MVGA 1SRIA 3WJEA 1VWQB 1Y9TA 1SRHA 5K68A 2WEWA 4NLIA 5F1EA 2OF9A 2LBVA 1JBHA 1HXZA 1QABE 1E2TA 2CAMA 1HQPA 1JYJA 4WFVA 3RDUA 4YKOA 1LCVA 1VPRA 5JR8A 1SWEA 5HAEA 4ES7A 3HOLA 3WBGA 4I3BA 3BY0A 4YKMA 1QWDA 1VWLB 2A13A 1DZPA 4YH0A 4ZGUA 2ACOA 4GGRA 1N43A 3WXQA 2E4JA 1IJ8A 1SWOA 4GKCA 4GU8A 4BX6B 4ZHDA 2IZAA 4HPDA 1I78A 2FS6A 5FQ6E 1GKAB 1U0XA 2MM3A 1I9HA 2QOSC 3NQ9A 4BX7B 1GXAA 1PBOA 2QO6A 2RTDB 1B56A 4GH7A 3RE6A 4GNWA 3ZI8A 3RKGA 3BU1A 1SWAA 3HPEA 3VG7A 4RUUA 3P6FA 5B29A 4HPCA 1NC9A 2HMBA 2X32A 2Q4NA 1AVDA 5H9AA 5LJCA 4I6SA 3T2XA 2KTSA 4I95A 2L5PA 1UYOX 1VWDB 2ANSA 2GTFX 1RXKA 3SLJA 3ZW0B 1SRGA 3BS2A 1YWBA 2ALLX 4CSBA 2JOZA 5AJCA 1KQXA 4MVEA 1SY3A 5C0NA 4ORSA 3ZW1A 3NQ3A 4Z2VA 2NP1A 1QY0A 4IMNA 2GJ5A 4L3RA 5F7GA 4CDCA 2F73A 1MEPA 4ZHGA 1STSB 3OBLA 1X8PA 4U8UN 4CK4A 1BBPA 2OL8O 3D9WA 5D45A 1FENA 1IFCA 4IMOA 1SA8A 1ZNHA 3HK1A 4IAWA 2RTBB 3VG3A 1LKEA 1YWDA 4ON1A 2Y3EA 5F6BA 1LCZA 1QFVA 2MO5A 3FA7A 1CRBA 2WWPA 2BSZA 3D95A 4NW4A 4I3CA 3K3LA 1NQMA 1N9YA 2OY5O 1OPBA 2G79A 1TVQA 3D97A 4DNEA 1X8OA 2JMBA 2X45A 3NX1A 4HPAA 3ZWEA 1SWGA 2EU7X 1VYOA 2QO5A 4LKTA 4YFRA 2WSJA 4Z2OA 1BM5A 1E06A 1VWFB 1BJ7A 2RTJA 4ALOA 4MIRA 4IBAA 1D2UA 1VWBB 4YMYA 4BX5A 2W2AA 1N4JA 3HOEA 1NP1A 4XMEA 1YWCA 3IA8A 4ZHHA 2VDFA 3D4RA 3HWDA 1OSPO 5FENA 5KIDA 1QY2A 3APUA 1GT5A 4QQ1A 1KQWA 4M7MA 1MX7A 5IXGA 2IZKA 4UU3A 1HY2A 2ZSCA 2W2FA 4JGLA 5B27A 5L8NA 1LIDA 4GDAA 3ZQ3A 4KC7A 1KL4A 3AKMA 1JYDA 3VG6A 1A18A 1LNMA 1U18A 1SWSA 5BVTA 1CJ5A 2YMSA 4Z27A 2XKLA 4JNJA 4INNA 1B8EA 2A2GA 2N93A 3LTWA 3CQNA 1VWCB 2OL6O 4GUZA 1E02A 1NDJA 1YP7A 4QYNA 3CWKA 3FYFA 4CDFA 3PH6A 1PMPA 1U17A 1LUQA 1T8VA 1X89A 2IFBA 4Y0SA 2NNEA 4CPEA 1G7NA 1MUPA 4GDZA 4FBOA 1STRB 1SY2A 5EZ2A 2WEXA 4BVMA 2LFOA 4I60A 1SWUA 3NR3A 1Y52X 5AJBA 3VG5A 3EM0A 1S7DA 2X46A 4BQUA 2OF8A 3D96A 4YFQA 2OL7A 2GTLN 4RUNA 5DPQA 4PSQA 2AT8X 2WQAE 4O3YA 1SLDB 2A8GA 5B5FA 1GGLA 2CZTA 4NP1A 1BEBA 1VWEB 1GT3A 3AKNA 4TKJA 2RTCB 2X8SA 3VHIA 4CPIA 3TF6A 1VWPB 1SLGB 4LKPA 2X56A 2AH7X 3PK2A 5HZ5A 3O19A 3WYPA 4DQ3A 2RTOB 1RAVA 4M6SA 4I3DA 3HWFA 5FQ8E 1R0UA 2L9CA 1YIVA 3I17A 4QGWA 2W2BA 4KC8A 4MEEA 2L67A 4U8UO 2KD2A 3WJBA 3FR4A 4ZCBA 2RQ0A 2FKJA 2M4LA 3EW1A 3PH5A 3NP1A 1I4UA 4AZRA 1EUOA 3APVA 3FEKA 3QKGA 1DZJA 3EBKA 1P6PA 1YUPA 2RTKA 4IAXA 4CDEA 1SWNA 2JW1A 2KW1A 5HZQA 1ADLA 1FJ1E 1CBIA 1Y0GA 3HTYA 4XMDA 4FQBB 1T68X 2OY1O 2OZQA 5LKEA 1LCWA 2XSTA 3NADA 3KZAA 2JU7A 3P6CA 4Y59A 3S60A 2DJFA 2Y3FA 1G85A 1SWFA 4IB6A 1W5RA 4Y0RA 3RDSA 5LJHA 3KFGA 3PP6A 1JJUA 4I9SA 3ZZVA 3BSZE 1TW4A 2POAA 1CBQA 1ICMA 1SLEB 3STMX 2C1QA 1ZNGA 1BSOA 1X8QA 3FMZA 3I0AA 4FBVA 4YCHA 1RSTB 3UEXA 2P8GA 2JN3A 1ERXA 4C5PA 4OKAA 1JMZA 1RSUB 4OELA 1D3SA 2NNDA 3RDXA 1IIUA 1SWRA 3SZIA 4DCBA 1PM1X 5B3MO 2JU3A 3P6HA 1JZUA 1EPBA 2OVSA 2Z4IA 4NYRA 3U03A 2MF6A 4GNYA 4YGHA 3X00A 1X8UA 4ALBA 3KVNA 3HWGA 1HMSA 1KOIA 1LIFA 4QRLA 1I05A 2OFAA 3F8AA 4U8UM 1KT7A 3MM0A 1QG5A 2KT4B 3F9DA 2RN4A 4AZMA 1HN2A 3S26A 2IZIA 4QAEA 2CZUA 3VU1A 3S5VA 1PEEA 4AZQA 1X71A 4KT5A 5HWZA 2R74A 4TKHA 1MK5A 4YGZA 2OFMX 4BBOA 1YP6A 5KICA 5L3YA 2WUTA 2HKDA 2HLVA 1FE3A 2AKQA 2GTLO 4D6AA 1VWJB 3T6FA 3RY1A 3DSZA 4NNTA 1VYFA 3RZYA 2NNQA 2BT9A 3NBXX 1QFTA 4LZUA 1SXXA 3UAQA 5H9LA 5BVQA 5LJBA 3FW4A 1EI5A 5K06A 3EC5A 1S2PA 3ELZA 2FRSA 3APWA 4HWMA 4B55A 4ZFXA 3PECA 3BX8A 5KHPA 4YBUA 3UEWA 3GE2A 2A5CA 4XMGA 2OVAA 3ZUOA 2LA7A 1A2DA 4K19A 2GC9A 1QY1A 4YGGA 1MOYA 4ZR2A 3WJFA 1TOUA 1NBXA 1SY1A 1MDCA 1KL3A 4EDEA 5HA1A 1K24A 1LDQA 4CPHA 4BOEA 1VWKB 1GT4A 1LF7A 1O1UA 1UYNX 4ZH6A 1VYGA 2BLGA 5EEEA 1DC9A 4AYHA 1UREA 2IZCB 3KFFA 2RD7C 3OD9A 5EDCA 2ZAGA 2ZAIA 4AZNA 1HBQA 4O3WA 3MBTA 1NGLA 4LQZA 3S5XA 1KXOA 3C76X 2FWVA 4QGXA 1RXHA 3VG4A 4GK9A 2G5LA 2UYWA 3FDCA 3LV4A 3RY2A 3BU9A 2RTQB 4MVLA 3G7XA 3WVMA 1SWDA 2FHNX 2RCQA 2BC3A 5LJGA 4ORRA 2RTNB 4TNNA 3WZPA 4UU2A 1AVEA 1LELA 1TXLA 1VWGB 5H9NA 2GTLM 1AQBA 3FR5A 3MG5A 4BGFA 3P02A 2QO4A 4PJ2A 3RDQA 4XMHA 4YDBA 2CBRA 3ZW1B 5EEDA 1BRPA 4YCEA 4HPBA 5FFHA 3O2YA 1SRFA 2A2UA 3FA9A 3ZW2A 1RBPA 4IRWA 4A8ZA 3STNA 1G74A 3APXA 3EYCA 3FLLA 3P6GA 1HBPA 1QQSA 5EPQA 1N9MA 1GX9A 3RWXA 1JQPA 2ASNX 3PDFA 2X55A 4O4XA 2R73A 2OYBO 3SLOA 3PQUA 1Y53X 3GAQA 2FT9A 4ORYA 5B10O 2AVIA 3TGBA 1BSQA 5BVSA 2JGSA 4QZTA 3E3CA 2BS5A 2Q2MA 3EMMA
chains in the Genus database with same CATH topology
1HXLA 1VWDB 1SWTA 2RTIB 2RTRB 1RXKA 1SWFA 2Y3FA 4Y59A 3RDSA 1SRGA 3RDMA 4Z2PA 4YVBA 1RXJA 3T2WA 3VGWA 1NQNA 4Z2VA 4BX6A 1MM9A 1SLEB 3SZJA 4BX7A 2C1QA 4BX5B 1LDOA 5IRAA 1VWHB 1MEPA 1RSTB 1STSB 1HQQA 4OKAA 2A5BA 1RSUB 2IZGB 3RDXA 1SWRA 3SZIA 2IZBA 1SWJA 2RTBB 2IZHB 1DF8A 1VWNB 2MF6A 2Y3EA 1LCZA 3X00A 5CSEA 2OFAA 1NQMA 3MM0A 2RTGB 2Y32A 1N9YA 1SRJA 3RDOA 5F2BA 4JO6A 3WZOA 1VWIB 3EW2A 2IZIA 4DNEA 3RE5A 1SWGA 1VYOA 2RTLA 2IZFB 2IZEB 1MK5A 4Z2OA 1VWAB 1VWFB 2RTJA 4CPHB 4BBOA 5L3YA 5JD2A 4GD9A 1VWBB 4BX5A 4Y5DA 1N4JA 4Z6JA 1VWJB 1VWOB 3WZQA 3RY1A 3T6FA 4U46A 1SWLA 4BJ8A 1VWRB 2RTPB 3WZNA 2OFBA 2RTMA 1PTSA 4BCSA 4EKVA 1SWHA 2IZKA 2IZDB 1HY2A 2ZSCA 4GDAA 2RTEB 1N7YA 4GJSA 5IRUA 1KL4A 1KL5A 1Y55X 4GGTA 1SWSA 4JHQA 2QCBA 4Z27A 2A5CA 4JNJA 3VHHA 5IRWA 1VWCB 1NDJA 1MOYA 3VHMA 1NBXA 1KL3A 1LUQA 1LDQA 2GH7A 4Z28A 4CPEA 4CPHA 1SLFB 1VWKB 1SWBA 3T6LA 1STRB 2IZCB 2WPUA 1VWMB 1SWKA 4I60A 1SWUA 2C1SA 1Y52X 1SWCA 1WBIA 5K67A 2OF8A 1SRIA 2RTFB 1VWQB 1RXHA 1SRHA 5K68A 2G5LA 2UYWA 3FDCA 1SLDB 2A8GA 3RY2A 2OF9A 5B5GA 2RTQB 1HXZA 2CAMA 5B5FA 1SWDA 1VWEB 2FHNX 1SREA 2BC3A 3RDUA 1LCVA 2RTNB 3WYQA 2RTCB 3VHIA 4CPIA 3WZPA 1SWEA 2UZ2A 1VWPB 1SLGB 1AVEA 1LELA 1VWGB 2RTHB 3PK2A 1VWLB 2IZLB 2RTOB 2F01A 3MG5A 1RAVA 4GGRA 1N43A 1IJ8A 1SWOA 3RDQA 4BX6B 2IZAA 4BX7B 2FHLA 1I9HA 1SRFA 1SWPA 2RTDB 4IRWA 3EW1A 2C4IA 3RE6A 4GGZA 1SWAA 1N9MA 5CHKA 4GJVA 2RTKA 1SWQA 3WYPA 1STPA 1SWNA 2RTAA 1Y53X 1KFFA 1NC9A 2IZJA 2AVIA 1AVDA 3SZHA 4CPFA 2JGSA 3T2XA 1LCWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HXL A;  1VWD B;  1SWT A;  2RTI B;  2RTR B;  1RXK A;  1SWF A;  2Y3F A;  4Y59 A;  3RDS A;  1SRG A;  3RDM A;  4Z2P A;  4YVB A;  1RXJ A;  3T2W A;  3VGW A;  1NQN A;  4Z2V A;  4BX6 A;  1MM9 A;  1SLE B;  3SZJ A;  4BX7 A;  2C1Q A;  4BX5 B;  1LDO A;  5IRA A;  1VWH B;  1MEP A;  1RST B;  1STS B;  1HQQ A;  4OKA A;  2A5B A;  1RSU B;  2IZG B;  3RDX A;  1SWR A;  3SZI A;  2IZB A;  1SWJ A;  2RTB B;  2IZH B;  1DF8 A;  1VWN B;  2MF6 A;  2Y3E A;  1LCZ A;  3X00 A;  5CSE A;  2OFA A;  1NQM A;  3MM0 A;  2RTG B;  2Y32 A;  1N9Y A;  1SRJ A;  3RDO A;  5F2B A;  4JO6 A;  3WZO A;  1VWI B;  3EW2 A;  2IZI A;  4DNE A;  3RE5 A;  1SWG A;  1VYO A;  2RTL A;  2IZF B;  2IZE B;  1MK5 A;  4Z2O A;  1VWA B;  1VWF B;  2RTJ A;  4CPH B;  4BBO A;  5L3Y A;  5JD2 A;  4GD9 A;  1VWB B;  4BX5 A;  4Y5D A;  1N4J A;  4Z6J A;  1VWJ B;  1VWO B;  3WZQ A;  3RY1 A;  3T6F A;  4U46 A;  1SWL A;  4BJ8 A;  1VWR B;  2RTP B;  3WZN A;  2OFB A;  2RTM A;  1PTS A;  4BCS A;  4EKV A;  1SWH A;  2IZK A;  2IZD B;  1HY2 A;  2ZSC A;  4GDA A;  2RTE B;  1N7Y A;  4GJS A;  5IRU A;  1KL4 A;  1KL5 A;  1Y55 X;  4GGT A;  1SWS A;  4JHQ A;  2QCB A;  4Z27 A;  2A5C A;  4JNJ A;  3VHH A;  5IRW A;  1VWC B;  1NDJ A;  1MOY A;  3VHM A;  1NBX A;  1KL3 A;  1LUQ A;  1LDQ A;  2GH7 A;  4Z28 A;  4CPE A;  4CPH A;  1SLF B;  1VWK B;  1SWB A;  3T6L A;  1STR B;  2IZC B;  2WPU A;  1VWM B;  1SWK A;  4I60 A;  1SWU A;  2C1S A;  1Y52 X;  1SWC A;  1WBI A;  5K67 A;  2OF8 A;  1SRI A;  2RTF B;  1VWQ B;  1RXH A;  1SRH A;  5K68 A;  2G5L A;  2UYW A;  3FDC A;  1SLD B;  2A8G A;  3RY2 A;  2OF9 A;  5B5G A;  2RTQ B;  1HXZ A;  2CAM A;  5B5F A;  1SWD A;  1VWE B;  2FHN X;  1SRE A;  2BC3 A;  3RDU A;  1LCV A;  2RTN B;  3WYQ A;  2RTC B;  3VHI A;  4CPI A;  3WZP A;  1SWE A;  2UZ2 A;  1VWP B;  1SLG B;  1AVE A;  1LEL A;  1VWG B;  2RTH B;  3PK2 A;  1VWL B;  2IZL B;  2RTO B;  2F01 A;  3MG5 A;  1RAV A;  4GGR A;  1N43 A;  1IJ8 A;  1SWO A;  3RDQ A;  4BX6 B;  2IZA A;  4BX7 B;  2FHL A;  1I9H A;  1SRF A;  1SWP A;  2RTD B;  4IRW A;  3EW1 A;  2C4I A;  3RE6 A;  4GGZ A;  1SWA A;  1N9M A;  5CHK A;  4GJV A;  2RTK A;  1SWQ A;  3WYP A;  1STP A;  1SWN A;  2RTA A;  1Y53 X;  1KFF A;  1NC9 A;  2IZJ A;  2AVI A;  1AVD A;  3SZH A;  4CPF A;  2JGS A;  3T2X A;  1LCW A; 
#chains in the Genus database with same CATH topology
 1HXL A;  4QNI A;  5DG4 A;  2RTR B;  3SLT A;  3FID A;  3JS1 A;  1CBR A;  2Z4H A;  4D6B A;  1EPA A;  2PI3 O;  1B0O A;  4TLJ A;  1CBS A;  3RDM A;  1JV4 A;  5F58 A;  3V8U A;  2AF5 A;  1TOW A;  2WQ9 A;  3T2W A;  4FBR A;  1L6M A;  2K23 A;  4ZGF A;  4BX6 A;  1MM9 A;  1NP4 A;  1T0V A;  3SZJ A;  4BX7 A;  1GKA A;  5D47 A;  4O4U A;  4DQ4 A;  1OEE A;  1RLB E;  1OEJ A;  4GRJ A;  2I5Z O;  1LDO A;  2KTD A;  3CMP A;  5IRA A;  4BX5 B;  1W4T A;  2VFC A;  2G8C O;  5HBS A;  2AT3 X;  4O9S A;  3RSW A;  3B2K A;  2OY7 A;  2IZB A;  3MVF A;  5FAZ A;  2OVE A;  3PQS A;  1SWJ A;  5LJK A;  1DF8 A;  1GX3 A;  1VWN B;  2Q2P A;  4ID2 A;  4GZV A;  5L8I A;  2AL0 X;  4U3Q A;  5HZ9 A;  3OE3 A;  1EII A;  3AEH A;  2OFR X;  5CSE A;  1ZNE A;  2O62 A;  3HWE A;  3H3I A;  3FA8 A;  4NYQ A;  4ZJ0 A;  3AUM O;  3B2J A;  2RTG B;  2Y32 A;  1G5W A;  1SRJ A;  4AZO A;  1HMT A;  4JO6 A;  1HMR A;  3WOV A;  3P6D A;  3WZO A;  3ZW0 A;  3EW2 A;  5HZ8 A;  2FTB A;  4WBK A;  5AEO A;  2MWH A;  1AB0 A;  3RE5 A;  1BLR A;  2VFB A;  4YFP A;  3N91 A;  2RTL A;  2IZF B;  3BLG A;  5HTD A;  1OBP A;  2FR3 A;  4MVI A;  4N7C A;  4OMX A;  1A3Y A;  4XMF A;  4Y5D A;  3FEL A;  4LZV A;  1SXW A;  2X4M A;  2LBA A;  1ERB A;  1ML7 A;  3KQ0 A;  1SWL A;  4U46 A;  1DZK A;  3EBW A;  2A3F X;  4BJ8 A;  1DV9 A;  1PBY A;  2RTM A;  1PTS A;  3Q6L A;  4A1H A;  4EKV A;  1SWH A;  3OJY C;  2BHV A;  1LFO A;  1DFV A;  3P6E A;  4QGV A;  3CKF A;  2RTE B;  4O4O A;  1OPA A;  4GJS A;  5IRU A;  2QMI A;  1O1V A;  3B2H A;  5HCD C;  3T1D A;  2FS7 A;  2HZQ A;  1Y55 X;  4GGT A;  2QCB A;  3DTQ A;  3FR2 A;  3TZS A;  3JQO A;  1XCA A;  3JSQ A;  4O49 A;  5IRW A;  3FW5 A;  2FR2 A;  1N0S A;  4QZU A;  3KFH A;  3CQR A;  5H9K A;  2G7B A;  4A1Y A;  2JU8 A;  4CV7 A;  2GH7 A;  4Z28 A;  1IW2 A;  1GM6 A;  3Q34 A;  2BS6 A;  1O8V A;  1EW3 A;  1IFB A;  3T6L A;  3TGC A;  4ZHC A;  1ZNK A;  2HZR A;  2C1S A;  3VE2 A;  1KT4 A;  1SWC A;  1WBI A;  2HYS A;  4FGI B;  4KCA A;  3RBY A;  4EEJ A;  1EAL A;  3BX7 A;  1S44 A;  2FKG A;  2RTF B;  1KT3 A;  4I9R A;  4OMW A;  3VE1 A;  2K62 A;  2CBS A;  2X8F A;  5LJD A;  1ACD A;  5B5G A;  3WJG A;  1E5P A;  1KZX A;  3VG2 A;  4U9C A;  3WYQ A;  1SRE A;  4KH8 A;  4WFU A;  2AMM X;  2LKK A;  3CR6 A;  1A57 A;  2UZ2 A;  5AQ6 A;  2DJG A;  1Y9L A;  3PPT A;  1E00 A;  2RTH B;  2I5V O;  3CBS A;  5L8O A;  2IZL B;  2F01 A;  5EDB A;  3ZUI A;  1SXY A;  2PY1 A;  3U0D A;  3NX2 A;  4Y0P A;  4AZP A;  1LIB A;  2FHL A;  2OVD A;  2OY8 A;  4TJZ A;  4CDD A;  2ACP X;  1SWP A;  2R56 A;  1AEL A;  5D8J A;  2YG2 A;  3NPO A;  4L1N A;  3UEV A;  4TQ2 A;  5IO7 A;  5HA0 A;  2C4I A;  3TGA A;  4YBP A;  5BYP A;  1KT5 A;  4GGZ A;  1DF3 A;  1JIW I;  1LIE A;  1IKJ A;  5CHK A;  4GJV A;  5B2A O;  1KZW A;  1SWQ A;  4IB8 A;  1EQD A;  3NQK A;  1STP A;  4XMC A;  2RTA A;  5IO5 A;  2IZJ A;  1KFF A;  5H8T A;  3SZH A;  5HZ6 A;  1EIO A;  4CPF A;  4ZHF A;  3PED A;  1YWA A;  4OS8 A;  2RA6 A;  2X34 A;  1SWT A;  2AT6 X;  2RTI B;  1KT6 A;  4Y0Q A;  3STK A;  4OEM A;  5IO6 A;  3ELX A;  1BWY A;  1OBU A;  4Z2P A;  1OEK A;  4YDA A;  4AW8 A;  4YVB A;  1RXJ A;  4ORW A;  3VGW A;  1FEM A;  4IB7 A;  1NQN A;  4O4S A;  2Q39 A;  4IAB A;  3UEU A;  5D48 A;  1JJX A;  2MJI A;  4EFG A;  5HCE C;  5CE4 A;  4MVK A;  1K3B A;  1LIC A;  1VWH B;  1Z24 A;  1XKI A;  1HQQ A;  3L4R A;  2A5B A;  2IZG B;  2CM9 A;  3QQ2 A;  4IB9 A;  4O3Z A;  3WJD A;  4O3X B;  2FLJ A;  3F6Z B;  2QM9 A;  1AVG I;  1EXS A;  2IZH B;  3O22 A;  5D4A A;  3MX7 A;  1OBQ A;  3FEN A;  1ZND A;  1FEL A;  1BSY A;  1UZ2 X;  4NV8 A;  4ORX A;  3LHN A;  1MX8 A;  1GX8 A;  3RDO A;  5F2B A;  3BRN A;  1W6F A;  1FTP A;  1VWI B;  1WUB A;  2G78 A;  4COT A;  2A0A A;  4NNS A;  1I06 A;  3P24 A;  1IKE A;  4ARH A;  1I04 A;  2IZE B;  4GET A;  1VWA B;  4CPH B;  1ZNL A;  3FA6 A;  1BRQ A;  3SAO A;  4EQA C;  5JD2 A;  4GD9 A;  1JJJ A;  2DM5 A;  5LJE A;  5F6Z A;  4WHI A;  4A60 A;  3SOT A;  4Z6J A;  1VWO B;  3WZQ A;  1ZRY A;  2F09 A;  3C77 X;  1LPJ A;  5HCC C;  1SXU A;  1VWR B;  3FIQ A;  2RTP B;  3WZN A;  2OFB A;  2Q9S A;  4BCS A;  1X8N A;  4GE1 A;  4TKB A;  5LKF A;  1B4M A;  2IZD B;  2RCT A;  4OS3 A;  1SY0 A;  5FQ7 E;  3IFB A;  4N7D A;  1JMX A;  3C78 X;  1GT1 A;  2AT5 X;  1N7Y A;  2X8T A;  4NV7 A;  4QYP A;  1KL5 A;  3BDR A;  4JHQ A;  2CM4 A;  1ICN A;  4KII A;  1DZM A;  2FGS A;  5HTE A;  3VPJ E;  2HNX A;  4ML7 B;  3VHH A;  2L68 A;  2AT0 X;  4ORU A;  2LB6 A;  3VHM A;  1SMP I;  4ODD A;  1ALB A;  4MIS A;  4OS0 A;  1FDQ A;  5CYB A;  3U9P C;  1KGL A;  1H91 A;  2WR6 A;  4NLJ A;  3FEP A;  4HFO A;  3CBC A;  4ZH9 A;  2QOM A;  1SLF B;  3KFI A;  1SWB A;  3WJC A;  4R0B A;  2MHD A;  2WPU A;  1VWM B;  1SWK A;  4EXZ A;  3B2L A;  3B2I A;  5B11 O;  5K67 A;  3CKG A;  1MVG A;  1SRI A;  3WJE A;  1VWQ B;  1Y9T A;  1SRH A;  5K68 A;  2WEW A;  4NLI A;  5F1E A;  2OF9 A;  2LBV A;  1JBH A;  1HXZ A;  1QAB E;  1E2T A;  2CAM A;  1HQP A;  1JYJ A;  4WFV A;  3RDU A;  4YKO A;  1LCV A;  1VPR A;  5JR8 A;  1SWE A;  5HAE A;  4ES7 A;  3HOL A;  3WBG A;  4I3B A;  3BY0 A;  4YKM A;  1QWD A;  1VWL B;  2A13 A;  1DZP A;  4YH0 A;  4ZGU A;  2ACO A;  4GGR A;  1N43 A;  3WXQ A;  2E4J A;  1IJ8 A;  1SWO A;  4GKC A;  4GU8 A;  4BX6 B;  4ZHD A;  2IZA A;  4HPD A;  1I78 A;  2FS6 A;  5FQ6 E;  1GKA B;  1U0X A;  2MM3 A;  1I9H A;  2QOS C;  3NQ9 A;  4BX7 B;  1GXA A;  1PBO A;  2QO6 A;  2RTD B;  1B56 A;  4GH7 A;  3RE6 A;  4GNW A;  3ZI8 A;  3RKG A;  3BU1 A;  1SWA A;  3HPE A;  3VG7 A;  4RUU A;  3P6F A;  5B29 A;  4HPC A;  1NC9 A;  2HMB A;  2X32 A;  2Q4N A;  1AVD A;  5H9A A;  5LJC A;  4I6S A;  3T2X A;  2KTS A;  4I95 A;  2L5P A;  1UYO X;  1VWD B;  2ANS A;  2GTF X;  1RXK A;  3SLJ A;  3ZW0 B;  1SRG A;  3BS2 A;  1YWB A;  2ALL X;  4CSB A;  2JOZ A;  5AJC A;  1KQX A;  4MVE A;  1SY3 A;  5C0N A;  4ORS A;  3ZW1 A;  3NQ3 A;  4Z2V A;  2NP1 A;  1QY0 A;  4IMN A;  2GJ5 A;  4L3R A;  5F7G A;  4CDC A;  2F73 A;  1MEP A;  4ZHG A;  1STS B;  3OBL A;  1X8P A;  4U8U N;  4CK4 A;  1BBP A;  2OL8 O;  3D9W A;  5D45 A;  1FEN A;  1IFC A;  4IMO A;  1SA8 A;  1ZNH A;  3HK1 A;  4IAW A;  2RTB B;  3VG3 A;  1LKE A;  1YWD A;  4ON1 A;  2Y3E A;  5F6B A;  1LCZ A;  1QFV A;  2MO5 A;  3FA7 A;  1CRB A;  2WWP A;  2BSZ A;  3D95 A;  4NW4 A;  4I3C A;  3K3L A;  1NQM A;  1N9Y A;  2OY5 O;  1OPB A;  2G79 A;  1TVQ A;  3D97 A;  4DNE A;  1X8O A;  2JMB A;  2X45 A;  3NX1 A;  4HPA A;  3ZWE A;  1SWG A;  2EU7 X;  1VYO A;  2QO5 A;  4LKT A;  4YFR A;  2WSJ A;  4Z2O A;  1BM5 A;  1E06 A;  1VWF B;  1BJ7 A;  2RTJ A;  4ALO A;  4MIR A;  4IBA A;  1D2U A;  1VWB B;  4YMY A;  4BX5 A;  2W2A A;  1N4J A;  3HOE A;  1NP1 A;  4XME A;  1YWC A;  3IA8 A;  4ZHH A;  2VDF A;  3D4R A;  3HWD A;  1OSP O;  5FEN A;  5KID A;  1QY2 A;  3APU A;  1GT5 A;  4QQ1 A;  1KQW A;  4M7M A;  1MX7 A;  5IXG A;  2IZK A;  4UU3 A;  1HY2 A;  2ZSC A;  2W2F A;  4JGL A;  5B27 A;  5L8N A;  1LID A;  4GDA A;  3ZQ3 A;  4KC7 A;  1KL4 A;  3AKM A;  1JYD A;  3VG6 A;  1A18 A;  1LNM A;  1U18 A;  1SWS A;  5BVT A;  1CJ5 A;  2YMS A;  4Z27 A;  2XKL A;  4JNJ A;  4INN A;  1B8E A;  2A2G A;  2N93 A;  3LTW A;  3CQN A;  1VWC B;  2OL6 O;  4GUZ A;  1E02 A;  1NDJ A;  1YP7 A;  4QYN A;  3CWK A;  3FYF A;  4CDF A;  3PH6 A;  1PMP A;  1U17 A;  1LUQ A;  1T8V A;  1X89 A;  2IFB A;  4Y0S A;  2NNE A;  4CPE A;  1G7N A;  1MUP A;  4GDZ A;  4FBO A;  1STR B;  1SY2 A;  5EZ2 A;  2WEX A;  4BVM A;  2LFO A;  4I60 A;  1SWU A;  3NR3 A;  1Y52 X;  5AJB A;  3VG5 A;  3EM0 A;  1S7D A;  2X46 A;  4BQU A;  2OF8 A;  3D96 A;  4YFQ A;  2OL7 A;  2GTL N;  4RUN A;  5DPQ A;  4PSQ A;  2AT8 X;  2WQA E;  4O3Y A;  1SLD B;  2A8G A;  5B5F A;  1GGL A;  2CZT A;  4NP1 A;  1BEB A;  1VWE B;  1GT3 A;  3AKN A;  4TKJ A;  2RTC B;  2X8S A;  3VHI A;  4CPI A;  3TF6 A;  1VWP B;  1SLG B;  4LKP A;  2X56 A;  2AH7 X;  3PK2 A;  5HZ5 A;  3O19 A;  3WYP A;  4DQ3 A;  2RTO B;  1RAV A;  4M6S A;  4I3D A;  3HWF A;  5FQ8 E;  1R0U A;  2L9C A;  1YIV A;  3I17 A;  4QGW A;  2W2B A;  4KC8 A;  4MEE A;  2L67 A;  4U8U O;  2KD2 A;  3WJB A;  3FR4 A;  4ZCB A;  2RQ0 A;  2FKJ A;  2M4L A;  3EW1 A;  3PH5 A;  3NP1 A;  1I4U A;  4AZR A;  1EUO A;  3APV A;  3FEK A;  3QKG A;  1DZJ A;  3EBK A;  1P6P A;  1YUP A;  2RTK A;  4IAX A;  4CDE A;  1SWN A;  2JW1 A;  2KW1 A;  5HZQ A;  1ADL A;  1FJ1 E;  1CBI A;  1Y0G A;  3HTY A;  4XMD A;  4FQB B;  1T68 X;  2OY1 O;  2OZQ A;  5LKE A;  1LCW A;  2XST A;  3NAD A;  3KZA A;  2JU7 A;  3P6C A;  4Y59 A;  3S60 A;  2DJF A;  2Y3F A;  1G85 A;  1SWF A;  4IB6 A;  1W5R A;  4Y0R A;  3RDS A;  5LJH A;  3KFG A;  3PP6 A;  1JJU A;  4I9S A;  3ZZV A;  3BSZ E;  1TW4 A;  2POA A;  1CBQ A;  1ICM A;  1SLE B;  3STM X;  2C1Q A;  1ZNG A;  1BSO A;  1X8Q A;  3FMZ A;  3I0A A;  4FBV A;  4YCH A;  1RST B;  3UEX A;  2P8G A;  2JN3 A;  1ERX A;  4C5P A;  4OKA A;  1JMZ A;  1RSU B;  4OEL A;  1D3S A;  2NND A;  3RDX A;  1IIU A;  1SWR A;  3SZI A;  4DCB A;  1PM1 X;  5B3M O;  2JU3 A;  3P6H A;  1JZU A;  1EPB A;  2OVS A;  2Z4I A;  4NYR A;  3U03 A;  2MF6 A;  4GNY A;  4YGH A;  3X00 A;  1X8U A;  4ALB A;  3KVN A;  3HWG A;  1HMS A;  1KOI A;  1LIF A;  4QRL A;  1I05 A;  2OFA A;  3F8A A;  4U8U M;  1KT7 A;  3MM0 A;  1QG5 A;  2KT4 B;  3F9D A;  2RN4 A;  4AZM A;  1HN2 A;  3S26 A;  2IZI A;  4QAE A;  2CZU A;  3VU1 A;  3S5V A;  1PEE A;  4AZQ A;  1X71 A;  4KT5 A;  5HWZ A;  2R74 A;  4TKH A;  1MK5 A;  4YGZ A;  2OFM X;  4BBO A;  1YP6 A;  5KIC A;  5L3Y A;  2WUT A;  2HKD A;  2HLV A;  1FE3 A;  2AKQ A;  2GTL O;  4D6A A;  1VWJ B;  3T6F A;  3RY1 A;  3DSZ A;  4NNT A;  1VYF A;  3RZY A;  2NNQ A;  2BT9 A;  3NBX X;  1QFT A;  4LZU A;  1SXX A;  3UAQ A;  5H9L A;  5BVQ A;  5LJB A;  3FW4 A;  1EI5 A;  5K06 A;  3EC5 A;  1S2P A;  3ELZ A;  2FRS A;  3APW A;  4HWM A;  4B55 A;  4ZFX A;  3PEC A;  3BX8 A;  5KHP A;  4YBU A;  3UEW A;  3GE2 A;  2A5C A;  4XMG A;  2OVA A;  3ZUO A;  2LA7 A;  1A2D A;  4K19 A;  2GC9 A;  1QY1 A;  4YGG A;  1MOY A;  4ZR2 A;  3WJF A;  1TOU A;  1NBX A;  1SY1 A;  1MDC A;  1KL3 A;  4EDE A;  5HA1 A;  1K24 A;  1LDQ A;  4CPH A;  4BOE A;  1VWK B;  1GT4 A;  1LF7 A;  1O1U A;  1UYN X;  4ZH6 A;  1VYG A;  2BLG A;  5EEE A;  1DC9 A;  4AYH A;  1URE A;  2IZC B;  3KFF A;  2RD7 C;  3OD9 A;  5EDC A;  2ZAG A;  2ZAI A;  4AZN A;  1HBQ A;  4O3W A;  3MBT A;  1NGL A;  4LQZ A;  3S5X A;  1KXO A;  3C76 X;  2FWV A;  4QGX A;  1RXH A;  3VG4 A;  4GK9 A;  2G5L A;  2UYW A;  3FDC A;  3LV4 A;  3RY2 A;  3BU9 A;  2RTQ B;  4MVL A;  3G7X A;  3WVM A;  1SWD A;  2FHN X;  2RCQ A;  2BC3 A;  5LJG A;  4ORR A;  2RTN B;  4TNN A;  3WZP A;  4UU2 A;  1AVE A;  1LEL A;  1TXL A;  1VWG B;  5H9N A;  2GTL M;  1AQB A;  3FR5 A;  3MG5 A;  4BGF A;  3P02 A;  2QO4 A;  4PJ2 A;  3RDQ A;  4XMH A;  4YDB A;  2CBR A;  3ZW1 B;  5EED A;  1BRP A;  4YCE A;  4HPB A;  5FFH A;  3O2Y A;  1SRF A;  2A2U A;  3FA9 A;  3ZW2 A;  1RBP A;  4IRW A;  4A8Z A;  3STN A;  1G74 A;  3APX A;  3EYC A;  3FLL A;  3P6G A;  1HBP A;  1QQS A;  5EPQ A;  1N9M A;  1GX9 A;  3RWX A;  1JQP A;  2ASN X;  3PDF A;  2X55 A;  4O4X A;  2R73 A;  2OYB O;  3SLO A;  3PQU A;  1Y53 X;  3GAQ A;  2FT9 A;  4ORY A;  5B10 O;  2AVI A;  3TGB A;  1BSQ A;  5BVS A;  2JGS A;  4QZT A;  3E3C A;  2BS5 A;  2Q2M A;  3EMM A; 
#chains in the Genus database with same CATH homology
 1HXL A;  1VWD B;  1SWT A;  2RTI B;  2RTR B;  1RXK A;  1SWF A;  2Y3F A;  4Y59 A;  3RDS A;  1SRG A;  3RDM A;  4Z2P A;  4YVB A;  1RXJ A;  3T2W A;  3VGW A;  1NQN A;  4Z2V A;  4BX6 A;  1MM9 A;  1SLE B;  3SZJ A;  4BX7 A;  2C1Q A;  4BX5 B;  1LDO A;  5IRA A;  1VWH B;  1MEP A;  1RST B;  1STS B;  1HQQ A;  4OKA A;  2A5B A;  1RSU B;  2IZG B;  3RDX A;  1SWR A;  3SZI A;  2IZB A;  1SWJ A;  2RTB B;  2IZH B;  1DF8 A;  1VWN B;  2MF6 A;  2Y3E A;  1LCZ A;  3X00 A;  5CSE A;  2OFA A;  1NQM A;  3MM0 A;  2RTG B;  2Y32 A;  1N9Y A;  1SRJ A;  3RDO A;  5F2B A;  4JO6 A;  3WZO A;  1VWI B;  3EW2 A;  2IZI A;  4DNE A;  3RE5 A;  1SWG A;  1VYO A;  2RTL A;  2IZF B;  2IZE B;  1MK5 A;  4Z2O A;  1VWA B;  1VWF B;  2RTJ A;  4CPH B;  4BBO A;  5L3Y A;  5JD2 A;  4GD9 A;  1VWB B;  4BX5 A;  4Y5D A;  1N4J A;  4Z6J A;  1VWJ B;  1VWO B;  3WZQ A;  3RY1 A;  3T6F A;  4U46 A;  1SWL A;  4BJ8 A;  1VWR B;  2RTP B;  3WZN A;  2OFB A;  2RTM A;  1PTS A;  4BCS A;  4EKV A;  1SWH A;  2IZK A;  2IZD B;  1HY2 A;  2ZSC A;  4GDA A;  2RTE B;  1N7Y A;  4GJS A;  5IRU A;  1KL4 A;  1KL5 A;  1Y55 X;  4GGT A;  1SWS A;  4JHQ A;  2QCB A;  4Z27 A;  2A5C A;  4JNJ A;  3VHH A;  5IRW A;  1VWC B;  1NDJ A;  1MOY A;  3VHM A;  1NBX A;  1KL3 A;  1LUQ A;  1LDQ A;  2GH7 A;  4Z28 A;  4CPE A;  4CPH A;  1SLF B;  1VWK B;  1SWB A;  3T6L A;  1STR B;  2IZC B;  2WPU A;  1VWM B;  1SWK A;  4I60 A;  1SWU A;  2C1S A;  1Y52 X;  1SWC A;  1WBI A;  5K67 A;  2OF8 A;  1SRI A;  2RTF B;  1VWQ B;  1RXH A;  1SRH A;  5K68 A;  2G5L A;  2UYW A;  3FDC A;  1SLD B;  2A8G A;  3RY2 A;  2OF9 A;  5B5G A;  2RTQ B;  1HXZ A;  2CAM A;  5B5F A;  1SWD A;  1VWE B;  2FHN X;  1SRE A;  2BC3 A;  3RDU A;  1LCV A;  2RTN B;  3WYQ A;  2RTC B;  3VHI A;  4CPI A;  3WZP A;  1SWE A;  2UZ2 A;  1VWP B;  1SLG B;  1AVE A;  1LEL A;  1VWG B;  2RTH B;  3PK2 A;  1VWL B;  2IZL B;  2RTO B;  2F01 A;  3MG5 A;  1RAV A;  4GGR A;  1N43 A;  1IJ8 A;  1SWO A;  3RDQ A;  4BX6 B;  2IZA A;  4BX7 B;  2FHL A;  1I9H A;  1SRF A;  1SWP A;  2RTD B;  4IRW A;  3EW1 A;  2C4I A;  3RE6 A;  4GGZ A;  1SWA A;  1N9M A;  5CHK A;  4GJV A;  2RTK A;  1SWQ A;  3WYP A;  1STP A;  1SWN A;  2RTA A;  1Y53 X;  1KFF A;  1NC9 A;  2IZJ A;  2AVI A;  1AVD A;  3SZH A;  4CPF A;  2JGS A;  3T2X A;  1LCW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...