2IZIA

Streptavidin-biotin ph 2.53 i4122 structure
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
122
structure length
122
Chain Sequence
b'AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTAVIDIN
publication title Binding of biotin to streptavidin stabilizes intersubunit salt bridges between Asp61 and His87 at low pH.
pubmed doi rcsb
molecule tags Biotin-binding protein
total genus 24
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 1997-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 2iziA00
1SWKA 4JHQA 1WBIA 2RTMA 2MF6A 2AVIA 2FHLA 2Y3EA 1LUQA 3RY2A 1RXJA 1SWCA 4Z2OA 1SWBA 2RTOB 3RDOA 2IZFB 1LDQA 1MM9A 1N4JA 5JD2A 2RTKA 4Z6JA 4Z2VA 2IZIA 1STRB 1VWBB 4JO6A 4GD9A 4YVBA 5B5GA 4CPHB 1SWLA 2RTEB 1N43A 1KL3A 2IZHB 1AVEA 2Y32A 3T2XA 2IZCB 3RDQA 1NDJA 1NBXA 1VWJB 1SWAA 4JNJA 2ZSCA 1KL5A 3PK2A 2UYWA 4BBOA 1N9MA 1SWDA 3WZQA 1KL4A 2IZKA 2G5LA 4Y5DA 3RY1A 2A5CA 1SRGA 1VWPB 2OF9A 2RTLA 4Z2PA 3WZNA 1SWNA 1VWCB 4CPHA 2QCBA 3VHMA 4U46A 2GH7A 2IZDB 4GJVA 1VWIB 3MG5A 4I60A 3RDXA 4BCSA 4CPIA 1VWHB 2IZAA 1VWAB 5K68A 3FDCA 1SWRA 2IZLB 1RAVA 5IRUA 2A5BA 4GJSA 4GDAA 1NC9A 1SWOA 2RTJA 1RXHA 2CAMA 2RTPB 1SRHA 1SWPA 3RE6A 3VHHA 2OF8A 4EKVA 3RDSA 3SZIA 1Y53X 1N7YA 3T2WA 4BX7B 3X00A 4Z27A 1VWQB 2RTFB 2UZ2A 5L3YA 2Y3FA 4OKAA 2C4IA 5F2BA 2JGSA 1SLDB 2IZBA 3EW1A 1MEPA 1MK5A 3MM0A 2RTQB 1SWHA 2RTAA 1VWLB 1HQQA 2RTBB 2IZEB 2C1QA 1PTSA 3WYQA 1VWEB 2RTRB 1SLFB 2C1SA 1N9YA 1STPA 1HXLA 4BX5B 2FHNX 1Y52X 4CPFA 1IJ8A 1RXKA 4GGRA 4BX7A 1SWSA 1LDOA 3VGWA 4Z28A 1HXZA 1SRFA 1SWGA 3T6FA 3RDMA 1NQMA 1LCVA 1AVDA 1NQNA 1VWMB 2RTNB 1SWFA 5K67A 3T6LA 1SLEB 4BX5A 2RTGB 1SLGB 1SWQA 4BX6B 1VWNB 2F01A 5CHKA 3WYPA 3VHIA 5B5FA 2IZGB 1STSB 5IRAA 1MOYA 1RSUB 2RTHB 1DF8A 1VWFB 1LCZA 1LCWA 1Y55X 2RTIB 1SWJA 5IRWA 3SZHA 4Y59A 2IZJA 2RTCB 2BC3A 3WZOA 1SWEA 2A8GA 4BX6A 4CPEA 3RDUA 1VYOA 4DNEA 1LELA 1SRJA 2WPUA 1RSTB 2RTDB 2OFBA 1SWTA 3RE5A 4BJ8A 1VWRB 1VWKB 4GGZA 1SWUA 1SREA 1VWGB 5CSEA 1KFFA 3EW2A 3WZPA 4GGTA 1VWOB 1HY2A 4IRWA 1SRIA 1I9HA 3SZJA 2OFAA 1VWDB
chains in the Genus database with same CATH superfamily
3UEXA 2X46A 1X8UA 2RTMA 3V8UA 3FA6A 1BWYA 3LTWA 1RXJA 1SWCA 1X8PA 2X8SA 3KFFA 4XMHA 5D8JA 4Z2OA 2IZFB 1MM9A 1OPAA 4ORSA 2FLJA 4AZRA 4Z2VA 2IZIA 2JU7A 3VPJE 4GD9A 4GNYA 2WQ9A 1EIOA 1N43A 3ZQ3A 1KL3A 4QYPA 2LBVA 2GTLO 1EPAA 2X34A 2POAA 4ORXA 1OSPO 2AMMX 2FWVA 3FLLA 4O3YA 1CBQA 2ZSCA 3FENA 4Y0QA 5FFHA 5HCCC 2QO4A 2VDFA 3PK2A 2MO5A 4KT5A 5DG4A 1SWDA 1DC9A 4KH8A 2LKKA 3WZQA 3JQOA 2IFBA 4QAEA 5HZ6A 2LFOA 3RY1A 1SY3A 2FGSA 1VWPB 2G79A 1DV9A 1CJ5A 2OF9A 1AVGI 1E2TA 3WZNA 4FGIB 3EM0A 4GKCA 5EDCA 2FS6A 2GH7A 4GJVA 1VWIB 3MG5A 3BU1A 3NX2A 4I60A 4NW4A 4WFVA 5D48A 3RDXA 1DZJA 2IZAA 1VWAB 1GT5A 5H8TA 5K68A 1BBPA 2IZLB 1GGLA 1LIDA 4QZTA 4OMWA 1Y9LA 4GDAA 3CR6A 2X32A 4QGWA 3VE1A 1NC9A 4CDDA 2OL7A 2P8GA 2RTJA 2RTPB 3EC5A 3NBXX 2Q2MA 3P6GA 4ALOA 4TKHA 3U9PC 1AQBA 2EU7X 4YCEA 3VG6A 4OMXA 4BX7B 2BLGA 1A18A 1TW4A 4HPCA 2OVDA 1VWQB 2OZQA 2RTFB 4KC8A 1U18A 3HK1A 3X00A 1KT6A 1JMZA 2JGSA 3PDFA 2IZBA 4IAXA 1MEPA 1HMTA 1QY0A 4WFUA 1LPJA 2RTAA 3HWDA 1NP1A 4YH0A 2IZEB 2C1QA 2Z4IA 4LZUA 3WYQA 1VWEB 2CZTA 4EEJA 5EPQA 1YUPA 1B56A 4YCHA 4YFQA 2ALLX 3VE2A 4R0BA 5KIDA 4U3QA 1A57A 1SWSA 3UEVA 1BM5A 1LDOA 1O1VA 2FKJA 4GRJA 5CYBA 4ZHHA 4GUZA 3T6FA 5LKFA 3RDMA 2OVSA 3VG4A 1UYNX 5HTEA 1T0VA 4U8UM 5F6ZA 1LCVA 2E4JA 4WBKA 3ELZA 2YMSA 4ORRA 2K23A 1SLEB 3LHNA 3FR2A 3NX1A 4BX5A 4ZHGA 1E02A 1VWNB 3KQ0A 3SAOA 1JV4A 4NYRA 5B5FA 1MUPA 3F8AA 5IRAA 2RTHB 3D96A 1DF8A 4MEEA 1BSOA 4KIIA 1KQXA 4MVLA 1LCZA 3P6HA 1JJUA 2DM5A 2RN4A 2Q4NA 1S2PA 5IRWA 1SXYA 2AT8X 3U0DA 3RBYA 4EXZA 4I3BA 4C5PA 4ZR2A 5FQ6E 3SLOA 4AW8A 2KD2A 1K3BA 4GH7A 5L8NA 3ZW0A 4XMEA 4GK9A 1A3YA 2OY1O 1MVGA 2VFCA 1SWTA 2JN3A 4O49A 3PECA 5CSEA 4DQ4A 3EW2A 4TNNA 3WZPA 3PH5A 1I9HA 2ACPX 1BSQA 4INNA 3CBCA 3OBLA 1VWDB 1SWKA 3P02A 4KCAA 2AT6X 2GC9A 3MBTA 1BRQA 1HQPA 5LJHA 1FENA 2VFBA 2AVIA 2JW1A 3BSZE 5H9KA 2A0AA 3RY2A 3P6DA 1SWBA 2RTOB 3CWKA 1QABE 1QFTA 2RQ0A 4O3XB 3P6FA 1XKIA 3RDOA 2RA6A 2RTKA 1JIWI 1STRB 3APUA 2OVAA 4HFOA 5B5GA 4MVEA 1SWLA 5JR8A 5AJBA 2JOZA 2F73A 2W2AA 2IZHB 1AVEA 4OEMA 4I9SA 5F58A 3RDQA 1NDJA 4ZH9A 1NBXA 4CDFA 2AF5A 5KHPA 1ML7A 4GETA 1KL5A 4L3RA 4ORYA 2X4MA 3RWXA 5HCDC 3BDRA 3RKGA 2OFMX 2ZAIA 1W5RA 2HNXA 1KL4A 2I5ZO 4NP1A 4U9CA 5L3YA 2AT0X 2KT4B 1E06A 2ASNX 4O3WA 1I4UA 1ZNEA 1B8EA 1BLRA 2RTLA 1OPBA 2LBAA 1SWNA 1ERBA 1VWCB 1KT5A 2QCBA 3VHMA 1JBHA 1QY2A 5LJDA 2FTBA 5B11O 4TJZA 4CPIA 1HMSA 1HMRA 1PBYA 1R0UA 1EW3A 1VWHB 3DTQA 5B27A 5AEOA 1LICA 4CSBA 1RAVA 2A5BA 5HA0A 1G74A 2XKLA 3BX8A 3H3IA 4U8UN 1G5WA 4M6SA 3WXQA 3VU1A 1RXHA 3FW4A 1SXWA 1SWPA 4EQAC 2OVEA 1SY1A 1KT7A 1NGLA 2CZUA 1Y53X 3T2WA 1LFOA 4QNIA 1KXOA 1X8QA 4YMYA 1TVQA 4N7DA 5KICA 4OKAA 2C4IA 1KT3A 4MISA 1SLDB 4ORWA 3WBGA 1MK5A 2OYBO 2RTQB 3APWA 3NP1A 3OE3A 4ES7A 1YWDA 2N93A 1SWHA 3TGAA 2JMBA 2RTBB 4CK4A 3NR3A 1PTSA 3KFIA 4QQ1A 3SOTA 3ZUOA 2RTRB 1SLFB 2LA7A 2OFRX 2R74A 3ZZVA 1STPA 2AKQA 1I05A 1QWDA 2FHNX 4CPFA 1IJ8A 1RXKA 4TKJA 4BX7A 4YBPA 2QM9A 4NV8A 1LKEA 3WVMA 4MVKA 3VGWA 2ACOA 2G78A 3L4RA 4NYQA 4Z28A 2FR2A 1HN2A 1HXZA 1SRFA 1RLBE 1SWGA 3B2IA 5IO5A 1NQMA 4AZPA 4MIRA 2L5PA 4CDCA 4QGVA 1T8VA 4Y0RA 1SWFA 4BVMA 1LIFA 5K67A 3PPTA 4HWMA 3S26A 1KT4A 2GTLN 5IXGA 4XMFA 3FW5A 4BX6B 3WYPA 4PSQA 3BRNA 2BHVA 2IZGB 1STSB 1KZXA 4KC7A 3HOLA 1I06A 2R56A 3PH6A 1VYFA 1A2DA 1S44A 1ZRYA 5HBSA 5AQ6A 4FBVA 1SWJA 1YP7A 4BOEA 4QYNA 1ACDA 2F09A 2NNQA 4O4SA 3C76X 3FA9A 1Z24A 3NQ9A 2RTCB 4IB9A 2BC3A 2X8FA 4XMCA 2G8CO 3B2LA 3EBKA 1SWEA 3I0AA 1GT3A 4GDZA 2Q9SA 3F9DA 4N7CA 4A1YA 4YFRA 2FT9A 3P6EA 1VYOA 1YWBA 2DJGA 3MVFA 4XMGA 1KGLA 3N91A 2KTDA 3ZW1B 4A60A 4QZUA 5F6BA 1JQPA 2HZRA 3IA8A 3STMX 1GXAA 2OFBA 3RE5A 2A3FX 1VWRB 3HTYA 1IKEA 2KW1A 4GE1A 3UAQA 5L8OA 5HTDA 1KFFA 3CQNA 2FKGA 1MX7A 2MM3A 3PQSA 4QRLA 1HY2A 2CBRA 5HZQA 3AKMA 1GKAB 5LJGA 3SZJA 2W2BA 1DF3A 4LKPA 3QQ2A 2ZAGA 1EIIA 4JHQA 1WBIA 2HLVA 1I78A 3IFBA 4NNTA 4A1HA 2MHDA 5LJEA 1JZUA 1LDQA 1N4JA 2WR6A 3CKGA 3FIDA 5JD2A 2BSZA 5B10O 1W6FA 4COTA 2HKDA 2QO6A 4Y0PA 1CBIA 1JJXA 1KOIA 4CPHB 1UYOX 1SXXA 1TXLA 3KFGA 2IZCB 3NPOA 3P24A 4ID2A 1SWAA 3BLGA 1D2UA 2MJIA 3FMZA 3FA8A 2PY1A 1LNMA 4I9RA 2R73A 1QQSA 3UEUA 4YGZA 4ZHCA 5LJBA 2IZKA 2WUTA 4CV7A 3HWEA 3D95A 4O4OA 4NV7A 1XCAA 1SRGA 2L67A 1GM6A 3FR5A 2AT3X 5HZ8A 1ZNKA 3O2YA 1OEEA 3LV4A 2OY5O 2BT9A 4AZNA 2GJ5A 2FRSA 4YBUA 1KZWA 3I17A 3KVNA 4HPBA 3WJFA 1BEBA 2KTSA 4BCSA 3Q34A 3FDCA 4HPDA 4D6BA 3STKA 4TQ2A 1HBPA 2QO5A 1TOUA 3B2JA 5EDBA 3APXA 4I95A 2OY8A 4UU2A 5F1EA 3ZW2A 1S7DA 2RCTA 2G7BA 4FBOA 3VHHA 2RCQA 2JU8A 1ERXA 2DJFA 4NLIA 1N7YA 2Z4HA 4I3DA 2XSTA 4ORUA 5BVSA 3GE2A 5IO6A 1B4MA 5BVTA 3U03A 5BYPA 5BVQA 1ZNHA 4ZH6A 3MM0A 5HCEC 3WJCA 3NADA 3RZYA 3T1DA 5FQ7E 4ZCBA 1HQQA 3OD9A 2K62A 4EDEA 4ZGFA 2C1SA 1N9YA 3KZAA 1HXLA 1VYGA 2MWHA 1PBOA 3G7XA 4IB7A 4OELA 4WHIA 5H9LA 1GX3A 3BS2A 4GGRA 3JSQA 5D4AA 1H91A 5L8IA 5HWZA 4EFGA 4O4UA 2QMIA 4UU3A 3CKFA 1RBPA 2Q39A 2ANSA 1NQNA 1WUBA 1BJ7A 1VWMB 2RTNB 4LZVA 4OS8A 4OS3A 3WJDA 4DCBA 3BY0A 1ZNGA 3ZWEA 1FDQA 2O62A 3BX7A 2AH7X 3AUMO 2QOMA 3WOVA 2F01A 4FBRA 1MX8A 1X8OA 4O4XA 1MOYA 1ZNLA 1VWFB 2FS7A 5H9AA 4AYHA 4CDEA 4YDAA 1LCWA 1SMPI 1Y55X 2RTIB 1O1UA 3GAQA 1GX9A 5H9NA 5B3MO 3UEWA 3ZUIA 3NQKA 1PMPA 2IZJA 4TLJA 4Y59A 1KQWA 4GU8A 4B55A 5CE4A 1MDCA 4XMDA 1Y0GA 2Q2PA 5DPQA 3WZOA 4A8ZA 2A8GA 4BX6A 3BU9A 2CM9A 1JJJA 4ODDA 3CBSA 3O19A 4JGLA 3RDUA 1B0OA 1CBSA 4RUUA 4AZMA 1T68X 1BSYA 4Y0SA 2A2GA 4YGGA 4RUNA 4PJ2A 2RTDB 3FA7A 1QFVA 4GGZA 1NP4A 1X71A 1SREA 1G85A 2BS5A 1JYDA 2L9CA 3EMMA 1JMXA 4NLJA 5HA1A 4BQUA 4IRWA 1G7NA 4ZHFA 1SRIA 4LQZA 2QOSC 3F6ZB 2OY7A 1D3SA 2OFAA 4GNWA 2X55A 3C77X 4I3CA 1FEMA 1VPRA 2MF6A 1O8VA 1ICNA 2FHLA 2Y3EA 1LUQA 1UREA 1L6MA 3WJGA 3ZW1A 4LKTA 1QY1A 3HWGA 5EZ2A 2A13A 4Z6JA 3AEHA 2W2FA 1I04A 1W4TA 2WSJA 1VWBB 3HOEA 4JO6A 5EEDA 3CMPA 4YVBA 3NQ3A 5AJCA 2NP1A 2X45A 1DZPA 5FENA 2RTEB 1UZ2X 1E00A 1YIVA 2CBSA 1GKAA 2RD7C 2WEXA 3HPEA 1U0XA 2Y32A 3T2XA 5HZ5A 1E5PA 1VWJB 4AZOA 4JNJA 1EALA 1OBQA 1JYJA 4BBOA 1FTPA 2UYWA 1N9MA 5D45A 1EQDA 5HZ9A 2BS6A 1LF7A 2G5LA 1GX8A 3EBWA 3PP6A 4L1NA 4Y5DA 2A5CA 3P6CA 3D9WA 4FQBB 3PEDA 4OS0A 3VG7A 2A2UA 4Z2PA 3EYCA 4CPHA 1N0SA 5LJKA 3C78X 4U46A 2OL8O 2IZDB 4NNSA 2NNDA 3O22A 1EPBA 1X8NA 3DSZA 4O9SA 4ALBA 4ARHA 4ZFXA 1PEEA 1SWRA 3HWFA 4IABA 3FELA 4ON1A 5IRUA 4GJSA 1AB0A 1SWOA 2CAMA 1FE3A 1DFVA 5K06A 1EXSA 1SRHA 3RE6A 4EKVA 2OF8A 3RDSA 4IMOA 2L68A 3SZIA 4HPAA 2I5VO 1IIUA 1EUOA 4YKOA 4Z27A 2UZ2A 3VG5A 2Y3FA 4K19A 5F2BA 3OJYC 4DQ3A 4IB6A 3EW1A 5IO7A 1OBUA 2YG2A 4YDBA 3JS1A 1X89A 4TKBA 5LKEA 1SXUA 2CM4A 1VWLB 5B29A 5HAEA 1YWCA 1P6PA 2HZQA 3D97A 2X8TA 3VG2A 2AT5X 4ZGUA 1DZMA 1CBRA 1FELA 1GT4A 5B2AO 1SA8A 4BX5B 3TGCA 2WQAE 4YFPA 1Y52X 4I6SA 2HMBA 4IMNA 3RSWA 3SLTA 4BGFA 1ZNDA 1OEKA 1GT1A 2M4LA 1IKJA 1DZKA 1AELA 3S5VA 4YKMA 1BRPA 4ML7B 3Q6LA 2GTFX 4AZQA 2JU3A 3MX7A 3KFHA 1K24A 3S5XA 1AVDA 2X56A 1IFCA 1LIEA 2HYSA 3APVA 3QKGA 3D4RA 1YWAA 3PQUA 3CQRA 5EEEA 1QG5A 1SY2A 3ELXA 4IB8A 3T6LA 1YP6A 1SLGB 1SWQA 2RTGB 2GTLM 2OL6O 5CHKA 3VHIA 4IBAA 3ZW0B 1FJ1E 3B2KA 5C0NA 3AKNA 3TGBA 4GZVA 1RSUB 1SY0A 3ZI8A 2AL0X 4O3ZA 3VG3A 2WWPA 1TOWA 1LIBA 4U8UO 3TF6A 3SLJA 3SZHA 4D6AA 1U17A 3B2HA 4QGXA 5FAZA 3TZSA 5LJCA 1CRBA 2PI3O 3FIQA 3S60A 2LB6A 1ADLA 1HBQA 1EI5A 4CPEA 3FEPA 3WJEA 2WEWA 4DNEA 1ICMA 4YGHA 1LELA 1OBPA 2NNEA 4IAWA 3K3LA 1SRJA 1IW2A 2FR3A 1RSTB 2WPUA 3FYFA 4M7MA 1OEJA 4MVIA 4ZJ0A 3STNA 4BJ8A 1VWKB 1PM1X 1SWUA 1VWGB 5D47A 5FQ8E 3FEKA 4GGTA 5F7GA 1VWOB 1Y9TA 3WJBA 3FR4A 1ALBA 3E3CA 1IFBA 4ZHDA
chains in the Genus database with same CATH topology
1SWKA 4JHQA 1WBIA 2RTMA 2MF6A 2AVIA 2FHLA 2Y3EA 1LUQA 3RY2A 1RXJA 1SWCA 4Z2OA 1SWBA 2RTOB 3RDOA 2IZFB 1LDQA 1MM9A 1N4JA 5JD2A 2RTKA 4Z6JA 4Z2VA 2IZIA 1STRB 1VWBB 4JO6A 4GD9A 4YVBA 5B5GA 4CPHB 1SWLA 2RTEB 1N43A 1KL3A 2IZHB 1AVEA 2Y32A 3T2XA 2IZCB 3RDQA 1NDJA 1NBXA 1VWJB 1SWAA 4JNJA 2ZSCA 1KL5A 3PK2A 2UYWA 4BBOA 1N9MA 1SWDA 3WZQA 1KL4A 2IZKA 2G5LA 4Y5DA 3RY1A 2A5CA 1SRGA 1VWPB 2OF9A 2RTLA 4Z2PA 3WZNA 1SWNA 1VWCB 4CPHA 2QCBA 3VHMA 4U46A 2GH7A 2IZDB 4GJVA 1VWIB 3MG5A 4I60A 3RDXA 4BCSA 4CPIA 1VWHB 2IZAA 1VWAB 5K68A 3FDCA 1SWRA 2IZLB 1RAVA 5IRUA 2A5BA 4GJSA 4GDAA 1NC9A 1SWOA 2RTJA 1RXHA 2CAMA 2RTPB 1SRHA 1SWPA 3RE6A 3VHHA 2OF8A 4EKVA 3RDSA 3SZIA 1Y53X 1N7YA 3T2WA 4BX7B 3X00A 4Z27A 1VWQB 2RTFB 2UZ2A 5L3YA 2Y3FA 4OKAA 2C4IA 5F2BA 2JGSA 1SLDB 2IZBA 3EW1A 1MEPA 1MK5A 3MM0A 2RTQB 1SWHA 2RTAA 1VWLB 1HQQA 2RTBB 2IZEB 2C1QA 1PTSA 3WYQA 1VWEB 2RTRB 1SLFB 2C1SA 1N9YA 1STPA 1HXLA 4BX5B 2FHNX 1Y52X 4CPFA 1IJ8A 1RXKA 4GGRA 4BX7A 1SWSA 1LDOA 3VGWA 4Z28A 1HXZA 1SRFA 1SWGA 3T6FA 3RDMA 1NQMA 1LCVA 1AVDA 1NQNA 1VWMB 2RTNB 1SWFA 5K67A 3T6LA 1SLEB 4BX5A 2RTGB 1SLGB 1SWQA 4BX6B 1VWNB 2F01A 5CHKA 3WYPA 3VHIA 5B5FA 2IZGB 1STSB 5IRAA 1MOYA 1RSUB 2RTHB 1DF8A 1VWFB 1LCZA 1LCWA 1Y55X 2RTIB 1SWJA 5IRWA 3SZHA 4Y59A 2IZJA 2RTCB 2BC3A 3WZOA 1SWEA 2A8GA 4BX6A 4CPEA 3RDUA 1VYOA 4DNEA 1LELA 1SRJA 2WPUA 1RSTB 2RTDB 2OFBA 1SWTA 3RE5A 4BJ8A 1VWRB 1VWKB 4GGZA 1SWUA 1SREA 1VWGB 5CSEA 1KFFA 3EW2A 3WZPA 4GGTA 1VWOB 1HY2A 4IRWA 1SRIA 1I9HA 3SZJA 2OFAA 1VWDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SWK A;  4JHQ A;  1WBI A;  2RTM A;  2MF6 A;  2AVI A;  2FHL A;  2Y3E A;  1LUQ A;  3RY2 A;  1RXJ A;  1SWC A;  4Z2O A;  1SWB A;  2RTO B;  3RDO A;  2IZF B;  1LDQ A;  1MM9 A;  1N4J A;  5JD2 A;  2RTK A;  4Z6J A;  4Z2V A;  2IZI A;  1STR B;  1VWB B;  4JO6 A;  4GD9 A;  4YVB A;  5B5G A;  4CPH B;  1SWL A;  2RTE B;  1N43 A;  1KL3 A;  2IZH B;  1AVE A;  2Y32 A;  3T2X A;  2IZC B;  3RDQ A;  1NDJ A;  1NBX A;  1VWJ B;  1SWA A;  4JNJ A;  2ZSC A;  1KL5 A;  3PK2 A;  2UYW A;  4BBO A;  1N9M A;  1SWD A;  3WZQ A;  1KL4 A;  2IZK A;  2G5L A;  4Y5D A;  3RY1 A;  2A5C A;  1SRG A;  1VWP B;  2OF9 A;  2RTL A;  4Z2P A;  3WZN A;  1SWN A;  1VWC B;  4CPH A;  2QCB A;  3VHM A;  4U46 A;  2GH7 A;  2IZD B;  4GJV A;  1VWI B;  3MG5 A;  4I60 A;  3RDX A;  4BCS A;  4CPI A;  1VWH B;  2IZA A;  1VWA B;  5K68 A;  3FDC A;  1SWR A;  2IZL B;  1RAV A;  5IRU A;  2A5B A;  4GJS A;  4GDA A;  1NC9 A;  1SWO A;  2RTJ A;  1RXH A;  2CAM A;  2RTP B;  1SRH A;  1SWP A;  3RE6 A;  3VHH A;  2OF8 A;  4EKV A;  3RDS A;  3SZI A;  1Y53 X;  1N7Y A;  3T2W A;  4BX7 B;  3X00 A;  4Z27 A;  1VWQ B;  2RTF B;  2UZ2 A;  5L3Y A;  2Y3F A;  4OKA A;  2C4I A;  5F2B A;  2JGS A;  1SLD B;  2IZB A;  3EW1 A;  1MEP A;  1MK5 A;  3MM0 A;  2RTQ B;  1SWH A;  2RTA A;  1VWL B;  1HQQ A;  2RTB B;  2IZE B;  2C1Q A;  1PTS A;  3WYQ A;  1VWE B;  2RTR B;  1SLF B;  2C1S A;  1N9Y A;  1STP A;  1HXL A;  4BX5 B;  2FHN X;  1Y52 X;  4CPF A;  1IJ8 A;  1RXK A;  4GGR A;  4BX7 A;  1SWS A;  1LDO A;  3VGW A;  4Z28 A;  1HXZ A;  1SRF A;  1SWG A;  3T6F A;  3RDM A;  1NQM A;  1LCV A;  1AVD A;  1NQN A;  1VWM B;  2RTN B;  1SWF A;  5K67 A;  3T6L A;  1SLE B;  4BX5 A;  2RTG B;  1SLG B;  1SWQ A;  4BX6 B;  1VWN B;  2F01 A;  5CHK A;  3WYP A;  3VHI A;  5B5F A;  2IZG B;  1STS B;  5IRA A;  1MOY A;  1RSU B;  2RTH B;  1DF8 A;  1VWF B;  1LCZ A;  1LCW A;  1Y55 X;  2RTI B;  1SWJ A;  5IRW A;  3SZH A;  4Y59 A;  2IZJ A;  2RTC B;  2BC3 A;  3WZO A;  1SWE A;  2A8G A;  4BX6 A;  4CPE A;  3RDU A;  1VYO A;  4DNE A;  1LEL A;  1SRJ A;  2WPU A;  1RST B;  2RTD B;  2OFB A;  1SWT A;  3RE5 A;  4BJ8 A;  1VWR B;  1VWK B;  4GGZ A;  1SWU A;  1SRE A;  1VWG B;  5CSE A;  1KFF A;  3EW2 A;  3WZP A;  4GGT A;  1VWO B;  1HY2 A;  4IRW A;  1SRI A;  1I9H A;  3SZJ A;  2OFA A;  1VWD B; 
#chains in the Genus database with same CATH topology
 3UEX A;  2X46 A;  1X8U A;  2RTM A;  3V8U A;  3FA6 A;  1BWY A;  3LTW A;  1RXJ A;  1SWC A;  1X8P A;  2X8S A;  3KFF A;  4XMH A;  5D8J A;  4Z2O A;  2IZF B;  1MM9 A;  1OPA A;  4ORS A;  2FLJ A;  4AZR A;  4Z2V A;  2IZI A;  2JU7 A;  3VPJ E;  4GD9 A;  4GNY A;  2WQ9 A;  1EIO A;  1N43 A;  3ZQ3 A;  1KL3 A;  4QYP A;  2LBV A;  2GTL O;  1EPA A;  2X34 A;  2POA A;  4ORX A;  1OSP O;  2AMM X;  2FWV A;  3FLL A;  4O3Y A;  1CBQ A;  2ZSC A;  3FEN A;  4Y0Q A;  5FFH A;  5HCC C;  2QO4 A;  2VDF A;  3PK2 A;  2MO5 A;  4KT5 A;  5DG4 A;  1SWD A;  1DC9 A;  4KH8 A;  2LKK A;  3WZQ A;  3JQO A;  2IFB A;  4QAE A;  5HZ6 A;  2LFO A;  3RY1 A;  1SY3 A;  2FGS A;  1VWP B;  2G79 A;  1DV9 A;  1CJ5 A;  2OF9 A;  1AVG I;  1E2T A;  3WZN A;  4FGI B;  3EM0 A;  4GKC A;  5EDC A;  2FS6 A;  2GH7 A;  4GJV A;  1VWI B;  3MG5 A;  3BU1 A;  3NX2 A;  4I60 A;  4NW4 A;  4WFV A;  5D48 A;  3RDX A;  1DZJ A;  2IZA A;  1VWA B;  1GT5 A;  5H8T A;  5K68 A;  1BBP A;  2IZL B;  1GGL A;  1LID A;  4QZT A;  4OMW A;  1Y9L A;  4GDA A;  3CR6 A;  2X32 A;  4QGW A;  3VE1 A;  1NC9 A;  4CDD A;  2OL7 A;  2P8G A;  2RTJ A;  2RTP B;  3EC5 A;  3NBX X;  2Q2M A;  3P6G A;  4ALO A;  4TKH A;  3U9P C;  1AQB A;  2EU7 X;  4YCE A;  3VG6 A;  4OMX A;  4BX7 B;  2BLG A;  1A18 A;  1TW4 A;  4HPC A;  2OVD A;  1VWQ B;  2OZQ A;  2RTF B;  4KC8 A;  1U18 A;  3HK1 A;  3X00 A;  1KT6 A;  1JMZ A;  2JGS A;  3PDF A;  2IZB A;  4IAX A;  1MEP A;  1HMT A;  1QY0 A;  4WFU A;  1LPJ A;  2RTA A;  3HWD A;  1NP1 A;  4YH0 A;  2IZE B;  2C1Q A;  2Z4I A;  4LZU A;  3WYQ A;  1VWE B;  2CZT A;  4EEJ A;  5EPQ A;  1YUP A;  1B56 A;  4YCH A;  4YFQ A;  2ALL X;  3VE2 A;  4R0B A;  5KID A;  4U3Q A;  1A57 A;  1SWS A;  3UEV A;  1BM5 A;  1LDO A;  1O1V A;  2FKJ A;  4GRJ A;  5CYB A;  4ZHH A;  4GUZ A;  3T6F A;  5LKF A;  3RDM A;  2OVS A;  3VG4 A;  1UYN X;  5HTE A;  1T0V A;  4U8U M;  5F6Z A;  1LCV A;  2E4J A;  4WBK A;  3ELZ A;  2YMS A;  4ORR A;  2K23 A;  1SLE B;  3LHN A;  3FR2 A;  3NX1 A;  4BX5 A;  4ZHG A;  1E02 A;  1VWN B;  3KQ0 A;  3SAO A;  1JV4 A;  4NYR A;  5B5F A;  1MUP A;  3F8A A;  5IRA A;  2RTH B;  3D96 A;  1DF8 A;  4MEE A;  1BSO A;  4KII A;  1KQX A;  4MVL A;  1LCZ A;  3P6H A;  1JJU A;  2DM5 A;  2RN4 A;  2Q4N A;  1S2P A;  5IRW A;  1SXY A;  2AT8 X;  3U0D A;  3RBY A;  4EXZ A;  4I3B A;  4C5P A;  4ZR2 A;  5FQ6 E;  3SLO A;  4AW8 A;  2KD2 A;  1K3B A;  4GH7 A;  5L8N A;  3ZW0 A;  4XME A;  4GK9 A;  1A3Y A;  2OY1 O;  1MVG A;  2VFC A;  1SWT A;  2JN3 A;  4O49 A;  3PEC A;  5CSE A;  4DQ4 A;  3EW2 A;  4TNN A;  3WZP A;  3PH5 A;  1I9H A;  2ACP X;  1BSQ A;  4INN A;  3CBC A;  3OBL A;  1VWD B;  1SWK A;  3P02 A;  4KCA A;  2AT6 X;  2GC9 A;  3MBT A;  1BRQ A;  1HQP A;  5LJH A;  1FEN A;  2VFB A;  2AVI A;  2JW1 A;  3BSZ E;  5H9K A;  2A0A A;  3RY2 A;  3P6D A;  1SWB A;  2RTO B;  3CWK A;  1QAB E;  1QFT A;  2RQ0 A;  4O3X B;  3P6F A;  1XKI A;  3RDO A;  2RA6 A;  2RTK A;  1JIW I;  1STR B;  3APU A;  2OVA A;  4HFO A;  5B5G A;  4MVE A;  1SWL A;  5JR8 A;  5AJB A;  2JOZ A;  2F73 A;  2W2A A;  2IZH B;  1AVE A;  4OEM A;  4I9S A;  5F58 A;  3RDQ A;  1NDJ A;  4ZH9 A;  1NBX A;  4CDF A;  2AF5 A;  5KHP A;  1ML7 A;  4GET A;  1KL5 A;  4L3R A;  4ORY A;  2X4M A;  3RWX A;  5HCD C;  3BDR A;  3RKG A;  2OFM X;  2ZAI A;  1W5R A;  2HNX A;  1KL4 A;  2I5Z O;  4NP1 A;  4U9C A;  5L3Y A;  2AT0 X;  2KT4 B;  1E06 A;  2ASN X;  4O3W A;  1I4U A;  1ZNE A;  1B8E A;  1BLR A;  2RTL A;  1OPB A;  2LBA A;  1SWN A;  1ERB A;  1VWC B;  1KT5 A;  2QCB A;  3VHM A;  1JBH A;  1QY2 A;  5LJD A;  2FTB A;  5B11 O;  4TJZ A;  4CPI A;  1HMS A;  1HMR A;  1PBY A;  1R0U A;  1EW3 A;  1VWH B;  3DTQ A;  5B27 A;  5AEO A;  1LIC A;  4CSB A;  1RAV A;  2A5B A;  5HA0 A;  1G74 A;  2XKL A;  3BX8 A;  3H3I A;  4U8U N;  1G5W A;  4M6S A;  3WXQ A;  3VU1 A;  1RXH A;  3FW4 A;  1SXW A;  1SWP A;  4EQA C;  2OVE A;  1SY1 A;  1KT7 A;  1NGL A;  2CZU A;  1Y53 X;  3T2W A;  1LFO A;  4QNI A;  1KXO A;  1X8Q A;  4YMY A;  1TVQ A;  4N7D A;  5KIC A;  4OKA A;  2C4I A;  1KT3 A;  4MIS A;  1SLD B;  4ORW A;  3WBG A;  1MK5 A;  2OYB O;  2RTQ B;  3APW A;  3NP1 A;  3OE3 A;  4ES7 A;  1YWD A;  2N93 A;  1SWH A;  3TGA A;  2JMB A;  2RTB B;  4CK4 A;  3NR3 A;  1PTS A;  3KFI A;  4QQ1 A;  3SOT A;  3ZUO A;  2RTR B;  1SLF B;  2LA7 A;  2OFR X;  2R74 A;  3ZZV A;  1STP A;  2AKQ A;  1I05 A;  1QWD A;  2FHN X;  4CPF A;  1IJ8 A;  1RXK A;  4TKJ A;  4BX7 A;  4YBP A;  2QM9 A;  4NV8 A;  1LKE A;  3WVM A;  4MVK A;  3VGW A;  2ACO A;  2G78 A;  3L4R A;  4NYQ A;  4Z28 A;  2FR2 A;  1HN2 A;  1HXZ A;  1SRF A;  1RLB E;  1SWG A;  3B2I A;  5IO5 A;  1NQM A;  4AZP A;  4MIR A;  2L5P A;  4CDC A;  4QGV A;  1T8V A;  4Y0R A;  1SWF A;  4BVM A;  1LIF A;  5K67 A;  3PPT A;  4HWM A;  3S26 A;  1KT4 A;  2GTL N;  5IXG A;  4XMF A;  3FW5 A;  4BX6 B;  3WYP A;  4PSQ A;  3BRN A;  2BHV A;  2IZG B;  1STS B;  1KZX A;  4KC7 A;  3HOL A;  1I06 A;  2R56 A;  3PH6 A;  1VYF A;  1A2D A;  1S44 A;  1ZRY A;  5HBS A;  5AQ6 A;  4FBV A;  1SWJ A;  1YP7 A;  4BOE A;  4QYN A;  1ACD A;  2F09 A;  2NNQ A;  4O4S A;  3C76 X;  3FA9 A;  1Z24 A;  3NQ9 A;  2RTC B;  4IB9 A;  2BC3 A;  2X8F A;  4XMC A;  2G8C O;  3B2L A;  3EBK A;  1SWE A;  3I0A A;  1GT3 A;  4GDZ A;  2Q9S A;  3F9D A;  4N7C A;  4A1Y A;  4YFR A;  2FT9 A;  3P6E A;  1VYO A;  1YWB A;  2DJG A;  3MVF A;  4XMG A;  1KGL A;  3N91 A;  2KTD A;  3ZW1 B;  4A60 A;  4QZU A;  5F6B A;  1JQP A;  2HZR A;  3IA8 A;  3STM X;  1GXA A;  2OFB A;  3RE5 A;  2A3F X;  1VWR B;  3HTY A;  1IKE A;  2KW1 A;  4GE1 A;  3UAQ A;  5L8O A;  5HTD A;  1KFF A;  3CQN A;  2FKG A;  1MX7 A;  2MM3 A;  3PQS A;  4QRL A;  1HY2 A;  2CBR A;  5HZQ A;  3AKM A;  1GKA B;  5LJG A;  3SZJ A;  2W2B A;  1DF3 A;  4LKP A;  3QQ2 A;  2ZAG A;  1EII A;  4JHQ A;  1WBI A;  2HLV A;  1I78 A;  3IFB A;  4NNT A;  4A1H A;  2MHD A;  5LJE A;  1JZU A;  1LDQ A;  1N4J A;  2WR6 A;  3CKG A;  3FID A;  5JD2 A;  2BSZ A;  5B10 O;  1W6F A;  4COT A;  2HKD A;  2QO6 A;  4Y0P A;  1CBI A;  1JJX A;  1KOI A;  4CPH B;  1UYO X;  1SXX A;  1TXL A;  3KFG A;  2IZC B;  3NPO A;  3P24 A;  4ID2 A;  1SWA A;  3BLG A;  1D2U A;  2MJI A;  3FMZ A;  3FA8 A;  2PY1 A;  1LNM A;  4I9R A;  2R73 A;  1QQS A;  3UEU A;  4YGZ A;  4ZHC A;  5LJB A;  2IZK A;  2WUT A;  4CV7 A;  3HWE A;  3D95 A;  4O4O A;  4NV7 A;  1XCA A;  1SRG A;  2L67 A;  1GM6 A;  3FR5 A;  2AT3 X;  5HZ8 A;  1ZNK A;  3O2Y A;  1OEE A;  3LV4 A;  2OY5 O;  2BT9 A;  4AZN A;  2GJ5 A;  2FRS A;  4YBU A;  1KZW A;  3I17 A;  3KVN A;  4HPB A;  3WJF A;  1BEB A;  2KTS A;  4BCS A;  3Q34 A;  3FDC A;  4HPD A;  4D6B A;  3STK A;  4TQ2 A;  1HBP A;  2QO5 A;  1TOU A;  3B2J A;  5EDB A;  3APX A;  4I95 A;  2OY8 A;  4UU2 A;  5F1E A;  3ZW2 A;  1S7D A;  2RCT A;  2G7B A;  4FBO A;  3VHH A;  2RCQ A;  2JU8 A;  1ERX A;  2DJF A;  4NLI A;  1N7Y A;  2Z4H A;  4I3D A;  2XST A;  4ORU A;  5BVS A;  3GE2 A;  5IO6 A;  1B4M A;  5BVT A;  3U03 A;  5BYP A;  5BVQ A;  1ZNH A;  4ZH6 A;  3MM0 A;  5HCE C;  3WJC A;  3NAD A;  3RZY A;  3T1D A;  5FQ7 E;  4ZCB A;  1HQQ A;  3OD9 A;  2K62 A;  4EDE A;  4ZGF A;  2C1S A;  1N9Y A;  3KZA A;  1HXL A;  1VYG A;  2MWH A;  1PBO A;  3G7X A;  4IB7 A;  4OEL A;  4WHI A;  5H9L A;  1GX3 A;  3BS2 A;  4GGR A;  3JSQ A;  5D4A A;  1H91 A;  5L8I A;  5HWZ A;  4EFG A;  4O4U A;  2QMI A;  4UU3 A;  3CKF A;  1RBP A;  2Q39 A;  2ANS A;  1NQN A;  1WUB A;  1BJ7 A;  1VWM B;  2RTN B;  4LZV A;  4OS8 A;  4OS3 A;  3WJD A;  4DCB A;  3BY0 A;  1ZNG A;  3ZWE A;  1FDQ A;  2O62 A;  3BX7 A;  2AH7 X;  3AUM O;  2QOM A;  3WOV A;  2F01 A;  4FBR A;  1MX8 A;  1X8O A;  4O4X A;  1MOY A;  1ZNL A;  1VWF B;  2FS7 A;  5H9A A;  4AYH A;  4CDE A;  4YDA A;  1LCW A;  1SMP I;  1Y55 X;  2RTI B;  1O1U A;  3GAQ A;  1GX9 A;  5H9N A;  5B3M O;  3UEW A;  3ZUI A;  3NQK A;  1PMP A;  2IZJ A;  4TLJ A;  4Y59 A;  1KQW A;  4GU8 A;  4B55 A;  5CE4 A;  1MDC A;  4XMD A;  1Y0G A;  2Q2P A;  5DPQ A;  3WZO A;  4A8Z A;  2A8G A;  4BX6 A;  3BU9 A;  2CM9 A;  1JJJ A;  4ODD A;  3CBS A;  3O19 A;  4JGL A;  3RDU A;  1B0O A;  1CBS A;  4RUU A;  4AZM A;  1T68 X;  1BSY A;  4Y0S A;  2A2G A;  4YGG A;  4RUN A;  4PJ2 A;  2RTD B;  3FA7 A;  1QFV A;  4GGZ A;  1NP4 A;  1X71 A;  1SRE A;  1G85 A;  2BS5 A;  1JYD A;  2L9C A;  3EMM A;  1JMX A;  4NLJ A;  5HA1 A;  4BQU A;  4IRW A;  1G7N A;  4ZHF A;  1SRI A;  4LQZ A;  2QOS C;  3F6Z B;  2OY7 A;  1D3S A;  2OFA A;  4GNW A;  2X55 A;  3C77 X;  4I3C A;  1FEM A;  1VPR A;  2MF6 A;  1O8V A;  1ICN A;  2FHL A;  2Y3E A;  1LUQ A;  1URE A;  1L6M A;  3WJG A;  3ZW1 A;  4LKT A;  1QY1 A;  3HWG A;  5EZ2 A;  2A13 A;  4Z6J A;  3AEH A;  2W2F A;  1I04 A;  1W4T A;  2WSJ A;  1VWB B;  3HOE A;  4JO6 A;  5EED A;  3CMP A;  4YVB A;  3NQ3 A;  5AJC A;  2NP1 A;  2X45 A;  1DZP A;  5FEN A;  2RTE B;  1UZ2 X;  1E00 A;  1YIV A;  2CBS A;  1GKA A;  2RD7 C;  2WEX A;  3HPE A;  1U0X A;  2Y32 A;  3T2X A;  5HZ5 A;  1E5P A;  1VWJ B;  4AZO A;  4JNJ A;  1EAL A;  1OBQ A;  1JYJ A;  4BBO A;  1FTP A;  2UYW A;  1N9M A;  5D45 A;  1EQD A;  5HZ9 A;  2BS6 A;  1LF7 A;  2G5L A;  1GX8 A;  3EBW A;  3PP6 A;  4L1N A;  4Y5D A;  2A5C A;  3P6C A;  3D9W A;  4FQB B;  3PED A;  4OS0 A;  3VG7 A;  2A2U A;  4Z2P A;  3EYC A;  4CPH A;  1N0S A;  5LJK A;  3C78 X;  4U46 A;  2OL8 O;  2IZD B;  4NNS A;  2NND A;  3O22 A;  1EPB A;  1X8N A;  3DSZ A;  4O9S A;  4ALB A;  4ARH A;  4ZFX A;  1PEE A;  1SWR A;  3HWF A;  4IAB A;  3FEL A;  4ON1 A;  5IRU A;  4GJS A;  1AB0 A;  1SWO A;  2CAM A;  1FE3 A;  1DFV A;  5K06 A;  1EXS A;  1SRH A;  3RE6 A;  4EKV A;  2OF8 A;  3RDS A;  4IMO A;  2L68 A;  3SZI A;  4HPA A;  2I5V O;  1IIU A;  1EUO A;  4YKO A;  4Z27 A;  2UZ2 A;  3VG5 A;  2Y3F A;  4K19 A;  5F2B A;  3OJY C;  4DQ3 A;  4IB6 A;  3EW1 A;  5IO7 A;  1OBU A;  2YG2 A;  4YDB A;  3JS1 A;  1X89 A;  4TKB A;  5LKE A;  1SXU A;  2CM4 A;  1VWL B;  5B29 A;  5HAE A;  1YWC A;  1P6P A;  2HZQ A;  3D97 A;  2X8T A;  3VG2 A;  2AT5 X;  4ZGU A;  1DZM A;  1CBR A;  1FEL A;  1GT4 A;  5B2A O;  1SA8 A;  4BX5 B;  3TGC A;  2WQA E;  4YFP A;  1Y52 X;  4I6S A;  2HMB A;  4IMN A;  3RSW A;  3SLT A;  4BGF A;  1ZND A;  1OEK A;  1GT1 A;  2M4L A;  1IKJ A;  1DZK A;  1AEL A;  3S5V A;  4YKM A;  1BRP A;  4ML7 B;  3Q6L A;  2GTF X;  4AZQ A;  2JU3 A;  3MX7 A;  3KFH A;  1K24 A;  3S5X A;  1AVD A;  2X56 A;  1IFC A;  1LIE A;  2HYS A;  3APV A;  3QKG A;  3D4R A;  1YWA A;  3PQU A;  3CQR A;  5EEE A;  1QG5 A;  1SY2 A;  3ELX A;  4IB8 A;  3T6L A;  1YP6 A;  1SLG B;  1SWQ A;  2RTG B;  2GTL M;  2OL6 O;  5CHK A;  3VHI A;  4IBA A;  3ZW0 B;  1FJ1 E;  3B2K A;  5C0N A;  3AKN A;  3TGB A;  4GZV A;  1RSU B;  1SY0 A;  3ZI8 A;  2AL0 X;  4O3Z A;  3VG3 A;  2WWP A;  1TOW A;  1LIB A;  4U8U O;  3TF6 A;  3SLJ A;  3SZH A;  4D6A A;  1U17 A;  3B2H A;  4QGX A;  5FAZ A;  3TZS A;  5LJC A;  1CRB A;  2PI3 O;  3FIQ A;  3S60 A;  2LB6 A;  1ADL A;  1HBQ A;  1EI5 A;  4CPE A;  3FEP A;  3WJE A;  2WEW A;  4DNE A;  1ICM A;  4YGH A;  1LEL A;  1OBP A;  2NNE A;  4IAW A;  3K3L A;  1SRJ A;  1IW2 A;  2FR3 A;  1RST B;  2WPU A;  3FYF A;  4M7M A;  1OEJ A;  4MVI A;  4ZJ0 A;  3STN A;  4BJ8 A;  1VWK B;  1PM1 X;  1SWU A;  1VWG B;  5D47 A;  5FQ8 E;  3FEK A;  4GGT A;  5F7G A;  1VWO B;  1Y9T A;  3WJB A;  3FR4 A;  1ALB A;  3E3C A;  1IFB A;  4ZHD A; 
#chains in the Genus database with same CATH homology
 1SWK A;  4JHQ A;  1WBI A;  2RTM A;  2MF6 A;  2AVI A;  2FHL A;  2Y3E A;  1LUQ A;  3RY2 A;  1RXJ A;  1SWC A;  4Z2O A;  1SWB A;  2RTO B;  3RDO A;  2IZF B;  1LDQ A;  1MM9 A;  1N4J A;  5JD2 A;  2RTK A;  4Z6J A;  4Z2V A;  2IZI A;  1STR B;  1VWB B;  4JO6 A;  4GD9 A;  4YVB A;  5B5G A;  4CPH B;  1SWL A;  2RTE B;  1N43 A;  1KL3 A;  2IZH B;  1AVE A;  2Y32 A;  3T2X A;  2IZC B;  3RDQ A;  1NDJ A;  1NBX A;  1VWJ B;  1SWA A;  4JNJ A;  2ZSC A;  1KL5 A;  3PK2 A;  2UYW A;  4BBO A;  1N9M A;  1SWD A;  3WZQ A;  1KL4 A;  2IZK A;  2G5L A;  4Y5D A;  3RY1 A;  2A5C A;  1SRG A;  1VWP B;  2OF9 A;  2RTL A;  4Z2P A;  3WZN A;  1SWN A;  1VWC B;  4CPH A;  2QCB A;  3VHM A;  4U46 A;  2GH7 A;  2IZD B;  4GJV A;  1VWI B;  3MG5 A;  4I60 A;  3RDX A;  4BCS A;  4CPI A;  1VWH B;  2IZA A;  1VWA B;  5K68 A;  3FDC A;  1SWR A;  2IZL B;  1RAV A;  5IRU A;  2A5B A;  4GJS A;  4GDA A;  1NC9 A;  1SWO A;  2RTJ A;  1RXH A;  2CAM A;  2RTP B;  1SRH A;  1SWP A;  3RE6 A;  3VHH A;  2OF8 A;  4EKV A;  3RDS A;  3SZI A;  1Y53 X;  1N7Y A;  3T2W A;  4BX7 B;  3X00 A;  4Z27 A;  1VWQ B;  2RTF B;  2UZ2 A;  5L3Y A;  2Y3F A;  4OKA A;  2C4I A;  5F2B A;  2JGS A;  1SLD B;  2IZB A;  3EW1 A;  1MEP A;  1MK5 A;  3MM0 A;  2RTQ B;  1SWH A;  2RTA A;  1VWL B;  1HQQ A;  2RTB B;  2IZE B;  2C1Q A;  1PTS A;  3WYQ A;  1VWE B;  2RTR B;  1SLF B;  2C1S A;  1N9Y A;  1STP A;  1HXL A;  4BX5 B;  2FHN X;  1Y52 X;  4CPF A;  1IJ8 A;  1RXK A;  4GGR A;  4BX7 A;  1SWS A;  1LDO A;  3VGW A;  4Z28 A;  1HXZ A;  1SRF A;  1SWG A;  3T6F A;  3RDM A;  1NQM A;  1LCV A;  1AVD A;  1NQN A;  1VWM B;  2RTN B;  1SWF A;  5K67 A;  3T6L A;  1SLE B;  4BX5 A;  2RTG B;  1SLG B;  1SWQ A;  4BX6 B;  1VWN B;  2F01 A;  5CHK A;  3WYP A;  3VHI A;  5B5F A;  2IZG B;  1STS B;  5IRA A;  1MOY A;  1RSU B;  2RTH B;  1DF8 A;  1VWF B;  1LCZ A;  1LCW A;  1Y55 X;  2RTI B;  1SWJ A;  5IRW A;  3SZH A;  4Y59 A;  2IZJ A;  2RTC B;  2BC3 A;  3WZO A;  1SWE A;  2A8G A;  4BX6 A;  4CPE A;  3RDU A;  1VYO A;  4DNE A;  1LEL A;  1SRJ A;  2WPU A;  1RST B;  2RTD B;  2OFB A;  1SWT A;  3RE5 A;  4BJ8 A;  1VWR B;  1VWK B;  4GGZ A;  1SWU A;  1SRE A;  1VWG B;  5CSE A;  1KFF A;  3EW2 A;  3WZP A;  4GGT A;  1VWO B;  1HY2 A;  4IRW A;  1SRI A;  1I9H A;  3SZJ A;  2OFA A;  1VWD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...