2IZJA

Streptavidin-biotin ph 3.50 i4122 structure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
122
structure length
122
Chain Sequence
b'AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTAVIDIN
publication title Binding of biotin to streptavidin stabilizes intersubunit salt bridges between Asp61 and His87 at low pH.
pubmed doi rcsb
molecule tags Biotin-binding protein
total genus 26
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 1997-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 2izjA00
1MK5A 1STRB 4BJ8A 1SWHA 1SLEB 5K67A 1WBIA 2FHNX 3PK2A 4BX6B 4CPEA 1HXLA 4BX6A 4YVBA 1SWCA 2UYWA 1SLFB 4Z27A 3FDCA 1VWMB 4GGRA 4Z2OA 2RTFB 1SWTA 2IZCB 3T2WA 3WYPA 2IZFB 1VWEB 3RDSA 1VWJB 3RDQA 1VWIB 1STSB 2OF9A 3EW2A 1N7YA 4BX5B 1SRFA 4BX5A 1VWAB 1N43A 2IZBA 1SRGA 4BCSA 1RXHA 2RTGB 3X00A 1LDOA 3WZQA 4CPFA 1LCWA 5B5GA 2F01A 1VWCB 2GH7A 1SWLA 4BX7B 1RXJA 2AVIA 3T2XA 1SWPA 1N9YA 2ZSCA 2C1QA 1VWHB 1LDQA 1SWFA 2C4IA 1AVEA 2RTQB 1HXZA 1NDJA 4BBOA 1N4JA 2RTKA 4CPIA 1RSTB 2IZLB 2RTLA 3RY2A 3SZJA 1MOYA 2RTCB 2RTJA 4Y5DA 1NQMA 3EW1A 4I60A 3RE6A 1PTSA 2WPUA 2RTEB 1I9HA 2RTDB 1VYOA 1SWEA 4Y59A 3VHHA 2UZ2A 3SZIA 1AVDA 1SRHA 2G5LA 1SLDB 1SWNA 2Y32A 4GD9A 5CHKA 4Z2PA 5K68A 1SLGB 2IZAA 2MF6A 1SWOA 1SWUA 1SWKA 1VWNB 3MG5A 1Y52X 1VWKB 2RTRB 1KL5A 4GGZA 3WZPA 5IRAA 3RDMA 1KFFA 3WZNA 2IZDB 1LUQA 2A5CA 1MEPA 4CPHB 2OFAA 4BX7A 4CPHA 2A5BA 3WYQA 4JNJA 2IZKA 4Z2VA 3RY1A 2JGSA 1SWGA 2FHLA 2Y3FA 1VWLB 4Z28A 3RDUA 5IRUA 1VWPB 1RXKA 1SWRA 2RTMA 1VWQB 1SWSA 4Z6JA 1SRIA 3RDXA 4OKAA 1KL3A 2IZGB 1VWRB 2RTIB 1STPA 1MM9A 5B5FA 1KL4A 2A8GA 2RTBB 2BC3A 2OFBA 1LCVA 2RTOB 4JHQA 4U46A 1DF8A 1SWJA 3T6LA 2C1SA 5IRWA 1VWBB 1NBXA 3RE5A 3VGWA 1Y55X 1HQQA 1IJ8A 1LCZA 2IZEB 1LELA 4GDAA 1Y53X 4GJSA 1SWBA 1VWGB 2RTPB 2Y3EA 2OF8A 1VWDB 3MM0A 5CSEA 3SZHA 1SREA 4DNEA 4GGTA 1SWDA 3VHIA 1SWQA 1NQNA 3WZOA 4EKVA 4GJVA 2RTAA 1NC9A 1RAVA 3RDOA 5L3YA 2RTNB 5F2BA 2IZHB 4JO6A 1VWFB 2QCBA 2RTHB 1HY2A 4IRWA 1N9MA 3VHMA 5JD2A 1VWOB 2IZIA 1RSUB 2CAMA 3T6FA 1SRJA 2IZJA 1SWAA
chains in the Genus database with same CATH superfamily
1MK5A 2LFOA 4PSQA 2FR3A 4NLJA 3ZW0A 1GX8A 1WBIA 1XCAA 2GTLM 2OL7A 4I3CA 5FFHA 2ANSA 1ACDA 3T1DA 4EXZA 4EDEA 4YGHA 1TOWA 1OPAA 4GGRA 2QOSC 2RTFB 3HPEA 2MJIA 3JSQA 3NQ9A 3WYPA 1O1VA 1VWEB 2IZFB 4ZGUA 2NNDA 1KOIA 4COTA 1STSB 2WR6A 1FDQA 3EW2A 4TKHA 2X32A 5F6ZA 1JJJA 3IA8A 4OMWA 2LKKA 3MBTA 1N43A 1LF7A 4IMNA 1RXHA 5HA1A 3X00A 1X8UA 3KFHA 4ZJ0A 3FR4A 4QAEA 2OFRX 1LCWA 1W4TA 3CWKA 3BU1A 4I9RA 1OBUA 3P6DA 2X8SA 3O2YA 1FTPA 1RXJA 1SY1A 2L9CA 4U8UN 3ZZVA 4QYNA 3TZSA 3D9WA 1SWPA 5IXGA 3JQOA 1VWHB 1LDQA 1SWFA 2EU7X 2LA7A 3D97A 3I17A 4CPIA 1LICA 3ELZA 4IABA 4EEJA 5AJBA 1RSTB 4YCEA 4A60A 2YG2A 2RTCB 1NQMA 1YUPA 1PBYA 3P02A 4I60A 2BT9A 1TVQA 1CBSA 1QG5A 2WPUA 1VYOA 1SWEA 4ORYA 1X89A 4FQBB 4ALOA 2L68A 3CR6A 2G5LA 2JU3A 4GD9A 3UAQA 1B0OA 4CDCA 5K68A 2G8CO 3LTWA 4QGXA 5HBSA 4XMEA 1CBIA 1ZNEA 1VWNB 3CKGA 3FMZA 4AZRA 1SA8A 3NADA 1W5RA 1Y52X 3FELA 1X8PA 1LIEA 5IRAA 4TJZA 2WEWA 2G7BA 1A2DA 2KD2A 2OL8O 3HWDA 1MX8A 3UEXA 2QMIA 4CDFA 4IAWA 3NR3A 2AH7X 5LJHA 4JNJA 1ICNA 3FA8A 3KFGA 5EEDA 3PDFA 1FEMA 1SXXA 1YP6A 3RDUA 4NNTA 5IRUA 1VWPB 2WQ9A 1RXKA 1BSQA 1X8QA 1VWQB 1SWSA 2RTMA 1SRIA 1JMXA 2YMSA 3BS2A 2A13A 3KFIA 3RDXA 4ZHFA 3C78X 4IBAA 3IFBA 1MVGA 2L67A 2A8GA 3RSWA 3BY0A 1PEEA 2N93A 3HWGA 4Y0PA 5KIDA 4GZVA 2A2GA 4ORUA 1E06A 4JHQA 2RTOB 3APVA 4ML7B 3T6LA 2MHDA 2CZTA 3FLLA 5IRWA 2BS6A 3ZUOA 3ZW2A 1HQQA 3JS1A 4MIRA 2RCQA 1QWDA 1LELA 1ZNGA 3B2HA 4FGIB 4MEEA 4GJSA 1SWBA 2RTPB 3RWXA 4BGFA 2OF8A 1VWDB 4CDDA 1CJ5A 4YH0A 3MM0A 3AUMO 4A1YA 1GT4A 2RQ0A 1SREA 4IMOA 4R0BA 4DNEA 3VG6A 4FBVA 4TLJA 2NP1A 3FEPA 1NQNA 2X55A 1HBQA 3G7XA 3PH6A 3PQUA 4GJVA 4NNSA 5FQ6E 4NYRA 5HWZA 3ZW1B 3B2LA 4I95A 3ZW1A 1MUPA 1Y0GA 2KTSA 4NYQA 4MVKA 5FENA 3U03A 1TXLA 2VDFA 2HLVA 2RTHB 2QCBA 4N7DA 4O49A 3L4RA 4IRWA 1KT5A 3GAQA 2AL0X 1GT1A 2Q2PA 1AVGI 4OMXA 1HMSA 1N9MA 2F73A 1QY2A 4YDBA 4KCAA 1EXSA 4KIIA 3T6FA 4YKOA 2JN3A 1SRJA 1DZPA 1BEBA 1STRB 1YIVA 1BSOA 1SXWA 1SLEB 5LJEA 2FHNX 3PK2A 5HTDA 1HXLA 5LJDA 3WVMA 1ML7A 1SWCA 5C0NA 1SLFB 4YGZA 1VWMB 5F7GA 1CRBA 4Z2OA 2W2BA 4AZQA 3ZWEA 3D4RA 1Y9TA 3NPOA 4IB6A 1YWAA 1HMRA 1P6PA 1VWIB 1DZMA 3EC5A 4MVIA 4TNNA 4ZCBA 3TGAA 2OF9A 3NQ3A 3U9PC 4BVMA 1FE3A 5LJKA 2HZRA 1I4UA 5AQ6A 3I0AA 2GTLO 3WJCA 2IZBA 1G5WA 1K3BA 3BU9A 4MVLA 5HCEC 3O22A 2RTGB 2RA6A 1L6MA 1EI5A 1VWCB 1YWCA 2AKQA 2FLJA 1SWLA 1A57A 1BWYA 5HCDC 1RBPA 4KT5A 1EALA 3WJFA 3T2XA 1N9YA 4OS8A 1LIBA 3CBSA 2C4IA 3CQNA 1I78A 4LZVA 3VG5A 2RTLA 2VFBA 3Q6LA 4UU3A 3SZJA 3VE1A 4Y0RA 2RTJA 4M6SA 3UEVA 1HQPA 3RE6A 1OPBA 4AYHA 1I9HA 2DM5A 3SAOA 1Z24A 4Y59A 3VG3A 3VHHA 5LKEA 2M4LA 3SZIA 1AVDA 1SRHA 3HWFA 4NW4A 2FKGA 2WWPA 2Y32A 3AKNA 4Z2PA 1SLGB 3V8UA 4GH7A 5FAZA 3ZUIA 4O9SA 1D2UA 4NV8A 2HMBA 1SWKA 4FBOA 4ALBA 4BBOA 4I3DA 2GC9A 1MX7A 3CQRA 4OS3A 4L3RA 1KT4A 4HPAA 1KL5A 4HPDA 1JV4A 4EQAC 3KZAA 1IW2A 2E4JA 2OYBO 3EM0A 2A5CA 1NGLA 1MEPA 3BX7A 1A3YA 1OEKA 1D3SA 1A18A 2FS6A 2XKLA 1QY1A 1X8OA 3B2IA 3OBLA 1JYDA 2ASNX 4HPBA 3HOLA 3LV4A 4JGLA 5B2AO 3RBYA 1UYOX 1SWGA 5H9LA 2Y3FA 3STKA 4Z28A 3FIQA 1ADLA 1SWRA 1G85A 4ORXA 2LBAA 4Z6JA 1IKEA 1EUOA 4OKAA 1YWDA 1KT7A 4RUNA 2HZQA 2IZGB 1VWRB 3APWA 3QKGA 4GETA 3SLOA 3D95A 4AZMA 1T0VA 1ERXA 4QZUA 1KL4A 5D4AA 1KT3A 2OVSA 5B5FA 3APUA 4XMGA 1PM1X 4XMFA 3HWEA 5HA0A 1LCVA 4BQUA 1KQXA 1SWJA 2QOMA 4EFGA 3FW5A 1VWBB 1NBXA 1VPRA 2QO6A 1JQPA 1T8VA 1Y55X 1O1UA 2AT0X 4AZPA 3TGCA 1CBRA 2IZEB 2Z4HA 4I9SA 4IAXA 4WHIA 3ZI8A 2CM4A 5HZ9A 1SMPI 2OY8A 1IKJA 1SXYA 2JMBA 1KGLA 3TF6A 4A1HA 2K23A 3MVFA 1SY0A 2X56A 3P6EA 4U3QA 5LKFA 3SZHA 2X34A 1ALBA 4DQ3A 5CE4A 1SWQA 3B2KA 3WZOA 4EKVA 4ZHGA 5L8NA 2ACPX 1NC9A 5K06A 3WYQA 5L3YA 1YWBA 3NP1A 3OD9A 4N7CA 1ZNDA 3NX2A 2F09A 2OFMX 4JO6A 2VFCA 4K19A 1BSYA 1NP1A 3SLTA 3NQKA 5HZ5A 1S7DA 5HCCC 2HNXA 3VG7A 2KTDA 1Y9LA 2X8TA 1RSUB 2GTLN 3PPTA 1E02A 5HZQA 4ZFXA 2IZJA 3HOEA 1XKIA 3SLJA 1QQSA 1SWHA 3FR5A 1LIFA 1TOUA 2OVEA 4D6BA 5B29A 5K67A 3PECA 3DTQA 5EDBA 4CPEA 4BX6B 3CMPA 4BX6A 2UYWA 2NNQA 4I3BA 2FGSA 3N91A 3KFFA 2X45A 4YKMA 3C77X 4ORSA 3VG4A 3WOVA 1DZKA 1OBPA 3GE2A 3RDSA 4I6SA 1VWJB 2MWHA 3RDQA 2AT3X 1U18A 4ZH6A 1SXUA 2ACOA 1N7YA 4YFQA 5AEOA 2W2FA 3D96A 1SRFA 2A0AA 1LPJA 3VU1A 3APXA 1DZJA 1SRGA 4LKTA 3F8AA 1EW3A 1ZNHA 3P6CA 5EZ2A 3RKGA 3WJDA 1LDOA 3WZQA 4CPFA 5B5GA 1AB0A 4YMYA 4DCBA 1GX9A 2GH7A 3DSZA 3NX1A 4BX7B 1I06A 1MDCA 3BSZE 4TQ2A 2AVIA 3HK1A 4NLIA 3P6FA 3WJBA 1DV9A 1R0UA 2RTQB 4U8UM 5BVSA 1ZNLA 3VG2A 4YFRA 1NDJA 2OY5O 1GKAB 1N4JA 1ZRYA 2RTKA 1GKAA 2R73A 2BLGA 4LKPA 4QYPA 1ICMA 2JU8A 1IIUA 1MOYA 3HTYA 4Y5DA 1IFCA 4IB9A 2DJFA 4O4XA 4FBRA 1PTSA 2RTEB 1QY0A 4O3WA 5B3MO 1B8EA 4YBPA 5KHPA 5F1EA 2FKJA 5D48A 4HPCA 4L1NA 5FQ8E 3S60A 2IZAA 5IO7A 3MX7A 1SWUA 3UEUA 1I05A 3OE3A 3RZYA 1VWKB 2OVAA 2RTRB 4GGZA 4NV7A 1GT3A 3RDMA 3WZPA 4INNA 2OY7A 3WZNA 2OY1O 1OSPO 4ES7A 1S2PA 1DC9A 1GGLA 2OFAA 3CBCA 3PEDA 4WFVA 1EIIA 2LBVA 2IZKA 4ARHA 2Q39A 4AZOA 2Q9SA 2OZQA 2W2AA 2JGSA 4XMHA 2FHLA 2KT4B 2BS5A 1VWLB 3EBKA 2BSZA 3U0DA 5D45A 4MVEA 3EBWA 1BBPA 4QRLA 3O19A 3TGBA 2XSTA 1LNMA 1KL3A 1H91A 1KT6A 2RTIB 4LQZA 4XMDA 5EDCA 2Q4NA 3WXQA 4ZHCA 3QQ2A 1EQDA 2MM3A 1ERBA 2RTBB 1K24A 2BC3A 4U46A 1KQWA 1BM5A 2X8FA 3K3LA 4YDAA 5B27A 3RE5A 4GKCA 1BRPA 3EYCA 1GX3A 3NBXX 4GRJA 5LJBA 1EIOA 2PY1A 3FR2A 3WJGA 4AW8A 5BVQA 3C76X 4QZTA 3ZW0B 4BOEA 4CDEA 5HZ8A 1Y53X 4O4OA 4UU2A 1QFVA 1VWGB 1X8NA 2NNEA 4IB7A 4GNYA 2FT9A 1X71A 1HBPA 4GGTA 5HAEA 1SWDA 2R74A 3S5VA 5HTEA 4PJ2A 3FA9A 3RDOA 1RAVA 4GNWA 1RLBE 2O62A 5DPQA 4ZGFA 5F2BA 4ZHDA 5L8OA 1QFTA 3CKFA 3KQ0A 4O3ZA 3BLGA 1VWFB 4WBKA 1E2TA 2CZUA 3EMMA 1HY2A 3F9DA 3H3IA 2JW1A 2P8GA 3E3CA 2X4MA 2R56A 1I04A 2ZAIA 2AMMX 5JD2A 3VHMA 2IZIA 3FA7A 5IO6A 1AELA 2A2UA 5BVTA 2LB6A 1SWAA 1S44A 1WUBA 1GXAA 4OELA 4ZR2A 2ALLX 4BJ8A 2CBRA 2AT5X 4QGVA 4YVBA 5B11O 2KW1A 4Z27A 5DG4A 1U0XA 4ON1A 3FDCA 1UREA 4QQ1A 1YP7A 3T2WA 1SWTA 1SY2A 2GTFX 2IZCB 1JBHA 1AQBA 5L8IA 1G74A 1TW4A 4TKJA 2OVDA 5D8JA 4KC7A 4O3XB 4BX5B 4OS0A 4BX5A 1FJ1E 1GM6A 1VWAB 5H9KA 4BCSA 4YGGA 1B56A 3AEHA 1PMPA 3KVNA 2F01A 3FENA 2RN4A 3P6GA 1JJXA 1FENA 2HKDA 3P6HA 4O3YA 4OEMA 2ZAGA 2QO4A 1N0SA 3P24A 2ZSCA 2C1QA 2AT6X 4GK9A 1O8VA 1AVEA 5H8TA 1HXZA 2HYSA 1KZXA 5FQ7E 1GT5A 3PQSA 3STNA 5KICA 4WFUA 2IZLB 3RY2A 1VYFA 1DF3A 3EW1A 4ORRA 5HZ6A 1U17A 2FTBA 5F58A 1LFOA 2WSJA 5LJGA 2RTDB 1PBOA 1HMTA 2AF5A 2CBSA 2JOZA 1JJUA 2UZ2A 3UEWA 4M7MA 2X46A 3PP6A 2RCTA 4Y0SA 1SLDB 1SWNA 4KH8A 2I5ZO 5CHKA 1KZWA 4U8UO 2MF6A 4CSBA 1SWOA 2GJ5A 3MG5A 4LZUA 4GUZA 1DFVA 1BLRA 4TKBA 1KFFA 2I5VO 2IZDB 5LJCA 3FEKA 1LUQA 4QNIA 5D47A 4YBUA 4CPHB 1E5PA 5F6BA 4BX7A 2A5BA 5EEEA 4CPHA 4AZNA 1UYNX 3RY1A 4Z2VA 2AT8X 3BDRA 5BYPA 3BX8A 2BHVA 1JMZA 1ZNKA 2G78A 5H9NA 3VPJE 1T68X 3WBGA 2POAA 4IB8A 1OEJA 1SY3A 4ODDA 5AJCA 4D6AA 3FW4A 1E00A 3FYFA 2FWVA 1UZ2X 1STPA 4C5PA 2OL6O 1MM9A 2PI3O 1BJ7A 4GE1A 3SOTA 1LKEA 2FS7A 2K62A 4KC8A 4B55A 2JU7A 1HN2A 1EPBA 2WUTA 2G79A 2MO5A 4DQ4A 2OFBA 4GU8A 4A8ZA 1JZUA 1OBQA 1DF8A 5IO5A 4MISA 2C1SA 3FIDA 3OJYC 4XMCA 4NP1A 3VGWA 1NP4A 2WQAE 1IJ8A 2IFBA 4Y0QA 1LCZA 1JYJA 4QGWA 4HWMA 4GDAA 2RD7C 2Z4IA 1EPAA 1BRQA 1FELA 1JIWI 2Y3EA 3ELXA 2FRSA 2QM9A 3S26A 2DJGA 1QABE 5CSEA 5B10O 4ID2A 3PH5A 4HFOA 1VYGA 4O4UA 3VHIA 5EPQA 4YFPA 5JR8A 1KXOA 4CK4A 3BRNA 1W6FA 4ZHHA 1OEEA 2RTAA 4U9CA 4RUUA 3LHNA 2RTNB 3B2JA 4CV7A 3FA6A 2L5PA 1IFBA 2IZHB 2WEXA 3Q34A 5CYBA 1CBQA 5H9AA 3WJEA 3ZQ3A 4O4SA 3F6ZB 4ZH9A 2QO5A 4GDZA 3STMX 2FR2A 1LIDA 3AKMA 3VE2A 4ORWA 3S5XA 4YCHA 1VWOB 2CAMA 1G7NA 1B4MA 2CM9A 2Q2MA 2A3FX
chains in the Genus database with same CATH topology
1MK5A 1STRB 4BJ8A 1SWHA 1SLEB 5K67A 1WBIA 2FHNX 3PK2A 4BX6B 4CPEA 1HXLA 4BX6A 4YVBA 1SWCA 2UYWA 1SLFB 4Z27A 3FDCA 1VWMB 4GGRA 4Z2OA 2RTFB 1SWTA 2IZCB 3T2WA 3WYPA 2IZFB 1VWEB 3RDSA 1VWJB 3RDQA 1VWIB 1STSB 2OF9A 3EW2A 1N7YA 4BX5B 1SRFA 4BX5A 1VWAB 1N43A 2IZBA 1SRGA 4BCSA 1RXHA 2RTGB 3X00A 1LDOA 3WZQA 4CPFA 1LCWA 5B5GA 2F01A 1VWCB 2GH7A 1SWLA 4BX7B 1RXJA 2AVIA 3T2XA 1SWPA 1N9YA 2ZSCA 2C1QA 1VWHB 1LDQA 1SWFA 2C4IA 1AVEA 2RTQB 1HXZA 1NDJA 4BBOA 1N4JA 2RTKA 4CPIA 1RSTB 2IZLB 2RTLA 3RY2A 3SZJA 1MOYA 2RTCB 2RTJA 4Y5DA 1NQMA 3EW1A 4I60A 3RE6A 1PTSA 2WPUA 2RTEB 1I9HA 2RTDB 1VYOA 1SWEA 4Y59A 3VHHA 2UZ2A 3SZIA 1AVDA 1SRHA 2G5LA 1SLDB 1SWNA 2Y32A 4GD9A 5CHKA 4Z2PA 5K68A 1SLGB 2IZAA 2MF6A 1SWOA 1SWUA 1SWKA 1VWNB 3MG5A 1Y52X 1VWKB 2RTRB 1KL5A 4GGZA 3WZPA 5IRAA 3RDMA 1KFFA 3WZNA 2IZDB 1LUQA 2A5CA 1MEPA 4CPHB 2OFAA 4BX7A 4CPHA 2A5BA 3WYQA 4JNJA 2IZKA 4Z2VA 3RY1A 2JGSA 1SWGA 2FHLA 2Y3FA 1VWLB 4Z28A 3RDUA 5IRUA 1VWPB 1RXKA 1SWRA 2RTMA 1VWQB 1SWSA 4Z6JA 1SRIA 3RDXA 4OKAA 1KL3A 2IZGB 1VWRB 2RTIB 1STPA 1MM9A 5B5FA 1KL4A 2A8GA 2RTBB 2BC3A 2OFBA 1LCVA 2RTOB 4JHQA 4U46A 1DF8A 1SWJA 3T6LA 2C1SA 5IRWA 1VWBB 1NBXA 3RE5A 3VGWA 1Y55X 1HQQA 1IJ8A 1LCZA 2IZEB 1LELA 4GDAA 1Y53X 4GJSA 1SWBA 1VWGB 2RTPB 2Y3EA 2OF8A 1VWDB 3MM0A 5CSEA 3SZHA 1SREA 4DNEA 4GGTA 1SWDA 3VHIA 1SWQA 1NQNA 3WZOA 4EKVA 4GJVA 2RTAA 1NC9A 1RAVA 3RDOA 5L3YA 2RTNB 5F2BA 2IZHB 4JO6A 1VWFB 2QCBA 2RTHB 1HY2A 4IRWA 1N9MA 3VHMA 5JD2A 1VWOB 2IZIA 1RSUB 2CAMA 3T6FA 1SRJA 2IZJA 1SWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MK5 A;  1STR B;  4BJ8 A;  1SWH A;  1SLE B;  5K67 A;  1WBI A;  2FHN X;  3PK2 A;  4BX6 B;  4CPE A;  1HXL A;  4BX6 A;  4YVB A;  1SWC A;  2UYW A;  1SLF B;  4Z27 A;  3FDC A;  1VWM B;  4GGR A;  4Z2O A;  2RTF B;  1SWT A;  2IZC B;  3T2W A;  3WYP A;  2IZF B;  1VWE B;  3RDS A;  1VWJ B;  3RDQ A;  1VWI B;  1STS B;  2OF9 A;  3EW2 A;  1N7Y A;  4BX5 B;  1SRF A;  4BX5 A;  1VWA B;  1N43 A;  2IZB A;  1SRG A;  4BCS A;  1RXH A;  2RTG B;  3X00 A;  1LDO A;  3WZQ A;  4CPF A;  1LCW A;  5B5G A;  2F01 A;  1VWC B;  2GH7 A;  1SWL A;  4BX7 B;  1RXJ A;  2AVI A;  3T2X A;  1SWP A;  1N9Y A;  2ZSC A;  2C1Q A;  1VWH B;  1LDQ A;  1SWF A;  2C4I A;  1AVE A;  2RTQ B;  1HXZ A;  1NDJ A;  4BBO A;  1N4J A;  2RTK A;  4CPI A;  1RST B;  2IZL B;  2RTL A;  3RY2 A;  3SZJ A;  1MOY A;  2RTC B;  2RTJ A;  4Y5D A;  1NQM A;  3EW1 A;  4I60 A;  3RE6 A;  1PTS A;  2WPU A;  2RTE B;  1I9H A;  2RTD B;  1VYO A;  1SWE A;  4Y59 A;  3VHH A;  2UZ2 A;  3SZI A;  1AVD A;  1SRH A;  2G5L A;  1SLD B;  1SWN A;  2Y32 A;  4GD9 A;  5CHK A;  4Z2P A;  5K68 A;  1SLG B;  2IZA A;  2MF6 A;  1SWO A;  1SWU A;  1SWK A;  1VWN B;  3MG5 A;  1Y52 X;  1VWK B;  2RTR B;  1KL5 A;  4GGZ A;  3WZP A;  5IRA A;  3RDM A;  1KFF A;  3WZN A;  2IZD B;  1LUQ A;  2A5C A;  1MEP A;  4CPH B;  2OFA A;  4BX7 A;  4CPH A;  2A5B A;  3WYQ A;  4JNJ A;  2IZK A;  4Z2V A;  3RY1 A;  2JGS A;  1SWG A;  2FHL A;  2Y3F A;  1VWL B;  4Z28 A;  3RDU A;  5IRU A;  1VWP B;  1RXK A;  1SWR A;  2RTM A;  1VWQ B;  1SWS A;  4Z6J A;  1SRI A;  3RDX A;  4OKA A;  1KL3 A;  2IZG B;  1VWR B;  2RTI B;  1STP A;  1MM9 A;  5B5F A;  1KL4 A;  2A8G A;  2RTB B;  2BC3 A;  2OFB A;  1LCV A;  2RTO B;  4JHQ A;  4U46 A;  1DF8 A;  1SWJ A;  3T6L A;  2C1S A;  5IRW A;  1VWB B;  1NBX A;  3RE5 A;  3VGW A;  1Y55 X;  1HQQ A;  1IJ8 A;  1LCZ A;  2IZE B;  1LEL A;  4GDA A;  1Y53 X;  4GJS A;  1SWB A;  1VWG B;  2RTP B;  2Y3E A;  2OF8 A;  1VWD B;  3MM0 A;  5CSE A;  3SZH A;  1SRE A;  4DNE A;  4GGT A;  1SWD A;  3VHI A;  1SWQ A;  1NQN A;  3WZO A;  4EKV A;  4GJV A;  2RTA A;  1NC9 A;  1RAV A;  3RDO A;  5L3Y A;  2RTN B;  5F2B A;  2IZH B;  4JO6 A;  1VWF B;  2QCB A;  2RTH B;  1HY2 A;  4IRW A;  1N9M A;  3VHM A;  5JD2 A;  1VWO B;  2IZI A;  1RSU B;  2CAM A;  3T6F A;  1SRJ A;  2IZJ A;  1SWA A; 
#chains in the Genus database with same CATH topology
 1MK5 A;  2LFO A;  4PSQ A;  2FR3 A;  4NLJ A;  3ZW0 A;  1GX8 A;  1WBI A;  1XCA A;  2GTL M;  2OL7 A;  4I3C A;  5FFH A;  2ANS A;  1ACD A;  3T1D A;  4EXZ A;  4EDE A;  4YGH A;  1TOW A;  1OPA A;  4GGR A;  2QOS C;  2RTF B;  3HPE A;  2MJI A;  3JSQ A;  3NQ9 A;  3WYP A;  1O1V A;  1VWE B;  2IZF B;  4ZGU A;  2NND A;  1KOI A;  4COT A;  1STS B;  2WR6 A;  1FDQ A;  3EW2 A;  4TKH A;  2X32 A;  5F6Z A;  1JJJ A;  3IA8 A;  4OMW A;  2LKK A;  3MBT A;  1N43 A;  1LF7 A;  4IMN A;  1RXH A;  5HA1 A;  3X00 A;  1X8U A;  3KFH A;  4ZJ0 A;  3FR4 A;  4QAE A;  2OFR X;  1LCW A;  1W4T A;  3CWK A;  3BU1 A;  4I9R A;  1OBU A;  3P6D A;  2X8S A;  3O2Y A;  1FTP A;  1RXJ A;  1SY1 A;  2L9C A;  4U8U N;  3ZZV A;  4QYN A;  3TZS A;  3D9W A;  1SWP A;  5IXG A;  3JQO A;  1VWH B;  1LDQ A;  1SWF A;  2EU7 X;  2LA7 A;  3D97 A;  3I17 A;  4CPI A;  1LIC A;  3ELZ A;  4IAB A;  4EEJ A;  5AJB A;  1RST B;  4YCE A;  4A60 A;  2YG2 A;  2RTC B;  1NQM A;  1YUP A;  1PBY A;  3P02 A;  4I60 A;  2BT9 A;  1TVQ A;  1CBS A;  1QG5 A;  2WPU A;  1VYO A;  1SWE A;  4ORY A;  1X89 A;  4FQB B;  4ALO A;  2L68 A;  3CR6 A;  2G5L A;  2JU3 A;  4GD9 A;  3UAQ A;  1B0O A;  4CDC A;  5K68 A;  2G8C O;  3LTW A;  4QGX A;  5HBS A;  4XME A;  1CBI A;  1ZNE A;  1VWN B;  3CKG A;  3FMZ A;  4AZR A;  1SA8 A;  3NAD A;  1W5R A;  1Y52 X;  3FEL A;  1X8P A;  1LIE A;  5IRA A;  4TJZ A;  2WEW A;  2G7B A;  1A2D A;  2KD2 A;  2OL8 O;  3HWD A;  1MX8 A;  3UEX A;  2QMI A;  4CDF A;  4IAW A;  3NR3 A;  2AH7 X;  5LJH A;  4JNJ A;  1ICN A;  3FA8 A;  3KFG A;  5EED A;  3PDF A;  1FEM A;  1SXX A;  1YP6 A;  3RDU A;  4NNT A;  5IRU A;  1VWP B;  2WQ9 A;  1RXK A;  1BSQ A;  1X8Q A;  1VWQ B;  1SWS A;  2RTM A;  1SRI A;  1JMX A;  2YMS A;  3BS2 A;  2A13 A;  3KFI A;  3RDX A;  4ZHF A;  3C78 X;  4IBA A;  3IFB A;  1MVG A;  2L67 A;  2A8G A;  3RSW A;  3BY0 A;  1PEE A;  2N93 A;  3HWG A;  4Y0P A;  5KID A;  4GZV A;  2A2G A;  4ORU A;  1E06 A;  4JHQ A;  2RTO B;  3APV A;  4ML7 B;  3T6L A;  2MHD A;  2CZT A;  3FLL A;  5IRW A;  2BS6 A;  3ZUO A;  3ZW2 A;  1HQQ A;  3JS1 A;  4MIR A;  2RCQ A;  1QWD A;  1LEL A;  1ZNG A;  3B2H A;  4FGI B;  4MEE A;  4GJS A;  1SWB A;  2RTP B;  3RWX A;  4BGF A;  2OF8 A;  1VWD B;  4CDD A;  1CJ5 A;  4YH0 A;  3MM0 A;  3AUM O;  4A1Y A;  1GT4 A;  2RQ0 A;  1SRE A;  4IMO A;  4R0B A;  4DNE A;  3VG6 A;  4FBV A;  4TLJ A;  2NP1 A;  3FEP A;  1NQN A;  2X55 A;  1HBQ A;  3G7X A;  3PH6 A;  3PQU A;  4GJV A;  4NNS A;  5FQ6 E;  4NYR A;  5HWZ A;  3ZW1 B;  3B2L A;  4I95 A;  3ZW1 A;  1MUP A;  1Y0G A;  2KTS A;  4NYQ A;  4MVK A;  5FEN A;  3U03 A;  1TXL A;  2VDF A;  2HLV A;  2RTH B;  2QCB A;  4N7D A;  4O49 A;  3L4R A;  4IRW A;  1KT5 A;  3GAQ A;  2AL0 X;  1GT1 A;  2Q2P A;  1AVG I;  4OMX A;  1HMS A;  1N9M A;  2F73 A;  1QY2 A;  4YDB A;  4KCA A;  1EXS A;  4KII A;  3T6F A;  4YKO A;  2JN3 A;  1SRJ A;  1DZP A;  1BEB A;  1STR B;  1YIV A;  1BSO A;  1SXW A;  1SLE B;  5LJE A;  2FHN X;  3PK2 A;  5HTD A;  1HXL A;  5LJD A;  3WVM A;  1ML7 A;  1SWC A;  5C0N A;  1SLF B;  4YGZ A;  1VWM B;  5F7G A;  1CRB A;  4Z2O A;  2W2B A;  4AZQ A;  3ZWE A;  3D4R A;  1Y9T A;  3NPO A;  4IB6 A;  1YWA A;  1HMR A;  1P6P A;  1VWI B;  1DZM A;  3EC5 A;  4MVI A;  4TNN A;  4ZCB A;  3TGA A;  2OF9 A;  3NQ3 A;  3U9P C;  4BVM A;  1FE3 A;  5LJK A;  2HZR A;  1I4U A;  5AQ6 A;  3I0A A;  2GTL O;  3WJC A;  2IZB A;  1G5W A;  1K3B A;  3BU9 A;  4MVL A;  5HCE C;  3O22 A;  2RTG B;  2RA6 A;  1L6M A;  1EI5 A;  1VWC B;  1YWC A;  2AKQ A;  2FLJ A;  1SWL A;  1A57 A;  1BWY A;  5HCD C;  1RBP A;  4KT5 A;  1EAL A;  3WJF A;  3T2X A;  1N9Y A;  4OS8 A;  1LIB A;  3CBS A;  2C4I A;  3CQN A;  1I78 A;  4LZV A;  3VG5 A;  2RTL A;  2VFB A;  3Q6L A;  4UU3 A;  3SZJ A;  3VE1 A;  4Y0R A;  2RTJ A;  4M6S A;  3UEV A;  1HQP A;  3RE6 A;  1OPB A;  4AYH A;  1I9H A;  2DM5 A;  3SAO A;  1Z24 A;  4Y59 A;  3VG3 A;  3VHH A;  5LKE A;  2M4L A;  3SZI A;  1AVD A;  1SRH A;  3HWF A;  4NW4 A;  2FKG A;  2WWP A;  2Y32 A;  3AKN A;  4Z2P A;  1SLG B;  3V8U A;  4GH7 A;  5FAZ A;  3ZUI A;  4O9S A;  1D2U A;  4NV8 A;  2HMB A;  1SWK A;  4FBO A;  4ALB A;  4BBO A;  4I3D A;  2GC9 A;  1MX7 A;  3CQR A;  4OS3 A;  4L3R A;  1KT4 A;  4HPA A;  1KL5 A;  4HPD A;  1JV4 A;  4EQA C;  3KZA A;  1IW2 A;  2E4J A;  2OYB O;  3EM0 A;  2A5C A;  1NGL A;  1MEP A;  3BX7 A;  1A3Y A;  1OEK A;  1D3S A;  1A18 A;  2FS6 A;  2XKL A;  1QY1 A;  1X8O A;  3B2I A;  3OBL A;  1JYD A;  2ASN X;  4HPB A;  3HOL A;  3LV4 A;  4JGL A;  5B2A O;  3RBY A;  1UYO X;  1SWG A;  5H9L A;  2Y3F A;  3STK A;  4Z28 A;  3FIQ A;  1ADL A;  1SWR A;  1G85 A;  4ORX A;  2LBA A;  4Z6J A;  1IKE A;  1EUO A;  4OKA A;  1YWD A;  1KT7 A;  4RUN A;  2HZQ A;  2IZG B;  1VWR B;  3APW A;  3QKG A;  4GET A;  3SLO A;  3D95 A;  4AZM A;  1T0V A;  1ERX A;  4QZU A;  1KL4 A;  5D4A A;  1KT3 A;  2OVS A;  5B5F A;  3APU A;  4XMG A;  1PM1 X;  4XMF A;  3HWE A;  5HA0 A;  1LCV A;  4BQU A;  1KQX A;  1SWJ A;  2QOM A;  4EFG A;  3FW5 A;  1VWB B;  1NBX A;  1VPR A;  2QO6 A;  1JQP A;  1T8V A;  1Y55 X;  1O1U A;  2AT0 X;  4AZP A;  3TGC A;  1CBR A;  2IZE B;  2Z4H A;  4I9S A;  4IAX A;  4WHI A;  3ZI8 A;  2CM4 A;  5HZ9 A;  1SMP I;  2OY8 A;  1IKJ A;  1SXY A;  2JMB A;  1KGL A;  3TF6 A;  4A1H A;  2K23 A;  3MVF A;  1SY0 A;  2X56 A;  3P6E A;  4U3Q A;  5LKF A;  3SZH A;  2X34 A;  1ALB A;  4DQ3 A;  5CE4 A;  1SWQ A;  3B2K A;  3WZO A;  4EKV A;  4ZHG A;  5L8N A;  2ACP X;  1NC9 A;  5K06 A;  3WYQ A;  5L3Y A;  1YWB A;  3NP1 A;  3OD9 A;  4N7C A;  1ZND A;  3NX2 A;  2F09 A;  2OFM X;  4JO6 A;  2VFC A;  4K19 A;  1BSY A;  1NP1 A;  3SLT A;  3NQK A;  5HZ5 A;  1S7D A;  5HCC C;  2HNX A;  3VG7 A;  2KTD A;  1Y9L A;  2X8T A;  1RSU B;  2GTL N;  3PPT A;  1E02 A;  5HZQ A;  4ZFX A;  2IZJ A;  3HOE A;  1XKI A;  3SLJ A;  1QQS A;  1SWH A;  3FR5 A;  1LIF A;  1TOU A;  2OVE A;  4D6B A;  5B29 A;  5K67 A;  3PEC A;  3DTQ A;  5EDB A;  4CPE A;  4BX6 B;  3CMP A;  4BX6 A;  2UYW A;  2NNQ A;  4I3B A;  2FGS A;  3N91 A;  3KFF A;  2X45 A;  4YKM A;  3C77 X;  4ORS A;  3VG4 A;  3WOV A;  1DZK A;  1OBP A;  3GE2 A;  3RDS A;  4I6S A;  1VWJ B;  2MWH A;  3RDQ A;  2AT3 X;  1U18 A;  4ZH6 A;  1SXU A;  2ACO A;  1N7Y A;  4YFQ A;  5AEO A;  2W2F A;  3D96 A;  1SRF A;  2A0A A;  1LPJ A;  3VU1 A;  3APX A;  1DZJ A;  1SRG A;  4LKT A;  3F8A A;  1EW3 A;  1ZNH A;  3P6C A;  5EZ2 A;  3RKG A;  3WJD A;  1LDO A;  3WZQ A;  4CPF A;  5B5G A;  1AB0 A;  4YMY A;  4DCB A;  1GX9 A;  2GH7 A;  3DSZ A;  3NX1 A;  4BX7 B;  1I06 A;  1MDC A;  3BSZ E;  4TQ2 A;  2AVI A;  3HK1 A;  4NLI A;  3P6F A;  3WJB A;  1DV9 A;  1R0U A;  2RTQ B;  4U8U M;  5BVS A;  1ZNL A;  3VG2 A;  4YFR A;  1NDJ A;  2OY5 O;  1GKA B;  1N4J A;  1ZRY A;  2RTK A;  1GKA A;  2R73 A;  2BLG A;  4LKP A;  4QYP A;  1ICM A;  2JU8 A;  1IIU A;  1MOY A;  3HTY A;  4Y5D A;  1IFC A;  4IB9 A;  2DJF A;  4O4X A;  4FBR A;  1PTS A;  2RTE B;  1QY0 A;  4O3W A;  5B3M O;  1B8E A;  4YBP A;  5KHP A;  5F1E A;  2FKJ A;  5D48 A;  4HPC A;  4L1N A;  5FQ8 E;  3S60 A;  2IZA A;  5IO7 A;  3MX7 A;  1SWU A;  3UEU A;  1I05 A;  3OE3 A;  3RZY A;  1VWK B;  2OVA A;  2RTR B;  4GGZ A;  4NV7 A;  1GT3 A;  3RDM A;  3WZP A;  4INN A;  2OY7 A;  3WZN A;  2OY1 O;  1OSP O;  4ES7 A;  1S2P A;  1DC9 A;  1GGL A;  2OFA A;  3CBC A;  3PED A;  4WFV A;  1EII A;  2LBV A;  2IZK A;  4ARH A;  2Q39 A;  4AZO A;  2Q9S A;  2OZQ A;  2W2A A;  2JGS A;  4XMH A;  2FHL A;  2KT4 B;  2BS5 A;  1VWL B;  3EBK A;  2BSZ A;  3U0D A;  5D45 A;  4MVE A;  3EBW A;  1BBP A;  4QRL A;  3O19 A;  3TGB A;  2XST A;  1LNM A;  1KL3 A;  1H91 A;  1KT6 A;  2RTI B;  4LQZ A;  4XMD A;  5EDC A;  2Q4N A;  3WXQ A;  4ZHC A;  3QQ2 A;  1EQD A;  2MM3 A;  1ERB A;  2RTB B;  1K24 A;  2BC3 A;  4U46 A;  1KQW A;  1BM5 A;  2X8F A;  3K3L A;  4YDA A;  5B27 A;  3RE5 A;  4GKC A;  1BRP A;  3EYC A;  1GX3 A;  3NBX X;  4GRJ A;  5LJB A;  1EIO A;  2PY1 A;  3FR2 A;  3WJG A;  4AW8 A;  5BVQ A;  3C76 X;  4QZT A;  3ZW0 B;  4BOE A;  4CDE A;  5HZ8 A;  1Y53 X;  4O4O A;  4UU2 A;  1QFV A;  1VWG B;  1X8N A;  2NNE A;  4IB7 A;  4GNY A;  2FT9 A;  1X71 A;  1HBP A;  4GGT A;  5HAE A;  1SWD A;  2R74 A;  3S5V A;  5HTE A;  4PJ2 A;  3FA9 A;  3RDO A;  1RAV A;  4GNW A;  1RLB E;  2O62 A;  5DPQ A;  4ZGF A;  5F2B A;  4ZHD A;  5L8O A;  1QFT A;  3CKF A;  3KQ0 A;  4O3Z A;  3BLG A;  1VWF B;  4WBK A;  1E2T A;  2CZU A;  3EMM A;  1HY2 A;  3F9D A;  3H3I A;  2JW1 A;  2P8G A;  3E3C A;  2X4M A;  2R56 A;  1I04 A;  2ZAI A;  2AMM X;  5JD2 A;  3VHM A;  2IZI A;  3FA7 A;  5IO6 A;  1AEL A;  2A2U A;  5BVT A;  2LB6 A;  1SWA A;  1S44 A;  1WUB A;  1GXA A;  4OEL A;  4ZR2 A;  2ALL X;  4BJ8 A;  2CBR A;  2AT5 X;  4QGV A;  4YVB A;  5B11 O;  2KW1 A;  4Z27 A;  5DG4 A;  1U0X A;  4ON1 A;  3FDC A;  1URE A;  4QQ1 A;  1YP7 A;  3T2W A;  1SWT A;  1SY2 A;  2GTF X;  2IZC B;  1JBH A;  1AQB A;  5L8I A;  1G74 A;  1TW4 A;  4TKJ A;  2OVD A;  5D8J A;  4KC7 A;  4O3X B;  4BX5 B;  4OS0 A;  4BX5 A;  1FJ1 E;  1GM6 A;  1VWA B;  5H9K A;  4BCS A;  4YGG A;  1B56 A;  3AEH A;  1PMP A;  3KVN A;  2F01 A;  3FEN A;  2RN4 A;  3P6G A;  1JJX A;  1FEN A;  2HKD A;  3P6H A;  4O3Y A;  4OEM A;  2ZAG A;  2QO4 A;  1N0S A;  3P24 A;  2ZSC A;  2C1Q A;  2AT6 X;  4GK9 A;  1O8V A;  1AVE A;  5H8T A;  1HXZ A;  2HYS A;  1KZX A;  5FQ7 E;  1GT5 A;  3PQS A;  3STN A;  5KIC A;  4WFU A;  2IZL B;  3RY2 A;  1VYF A;  1DF3 A;  3EW1 A;  4ORR A;  5HZ6 A;  1U17 A;  2FTB A;  5F58 A;  1LFO A;  2WSJ A;  5LJG A;  2RTD B;  1PBO A;  1HMT A;  2AF5 A;  2CBS A;  2JOZ A;  1JJU A;  2UZ2 A;  3UEW A;  4M7M A;  2X46 A;  3PP6 A;  2RCT A;  4Y0S A;  1SLD B;  1SWN A;  4KH8 A;  2I5Z O;  5CHK A;  1KZW A;  4U8U O;  2MF6 A;  4CSB A;  1SWO A;  2GJ5 A;  3MG5 A;  4LZU A;  4GUZ A;  1DFV A;  1BLR A;  4TKB A;  1KFF A;  2I5V O;  2IZD B;  5LJC A;  3FEK A;  1LUQ A;  4QNI A;  5D47 A;  4YBU A;  4CPH B;  1E5P A;  5F6B A;  4BX7 A;  2A5B A;  5EEE A;  4CPH A;  4AZN A;  1UYN X;  3RY1 A;  4Z2V A;  2AT8 X;  3BDR A;  5BYP A;  3BX8 A;  2BHV A;  1JMZ A;  1ZNK A;  2G78 A;  5H9N A;  3VPJ E;  1T68 X;  3WBG A;  2POA A;  4IB8 A;  1OEJ A;  1SY3 A;  4ODD A;  5AJC A;  4D6A A;  3FW4 A;  1E00 A;  3FYF A;  2FWV A;  1UZ2 X;  1STP A;  4C5P A;  2OL6 O;  1MM9 A;  2PI3 O;  1BJ7 A;  4GE1 A;  3SOT A;  1LKE A;  2FS7 A;  2K62 A;  4KC8 A;  4B55 A;  2JU7 A;  1HN2 A;  1EPB A;  2WUT A;  2G79 A;  2MO5 A;  4DQ4 A;  2OFB A;  4GU8 A;  4A8Z A;  1JZU A;  1OBQ A;  1DF8 A;  5IO5 A;  4MIS A;  2C1S A;  3FID A;  3OJY C;  4XMC A;  4NP1 A;  3VGW A;  1NP4 A;  2WQA E;  1IJ8 A;  2IFB A;  4Y0Q A;  1LCZ A;  1JYJ A;  4QGW A;  4HWM A;  4GDA A;  2RD7 C;  2Z4I A;  1EPA A;  1BRQ A;  1FEL A;  1JIW I;  2Y3E A;  3ELX A;  2FRS A;  2QM9 A;  3S26 A;  2DJG A;  1QAB E;  5CSE A;  5B10 O;  4ID2 A;  3PH5 A;  4HFO A;  1VYG A;  4O4U A;  3VHI A;  5EPQ A;  4YFP A;  5JR8 A;  1KXO A;  4CK4 A;  3BRN A;  1W6F A;  4ZHH A;  1OEE A;  2RTA A;  4U9C A;  4RUU A;  3LHN A;  2RTN B;  3B2J A;  4CV7 A;  3FA6 A;  2L5P A;  1IFB A;  2IZH B;  2WEX A;  3Q34 A;  5CYB A;  1CBQ A;  5H9A A;  3WJE A;  3ZQ3 A;  4O4S A;  3F6Z B;  4ZH9 A;  2QO5 A;  4GDZ A;  3STM X;  2FR2 A;  1LID A;  3AKM A;  3VE2 A;  4ORW A;  3S5X A;  4YCH A;  1VWO B;  2CAM A;  1G7N A;  1B4M A;  2CM9 A;  2Q2M A;  2A3F X; 
#chains in the Genus database with same CATH homology
 1MK5 A;  1STR B;  4BJ8 A;  1SWH A;  1SLE B;  5K67 A;  1WBI A;  2FHN X;  3PK2 A;  4BX6 B;  4CPE A;  1HXL A;  4BX6 A;  4YVB A;  1SWC A;  2UYW A;  1SLF B;  4Z27 A;  3FDC A;  1VWM B;  4GGR A;  4Z2O A;  2RTF B;  1SWT A;  2IZC B;  3T2W A;  3WYP A;  2IZF B;  1VWE B;  3RDS A;  1VWJ B;  3RDQ A;  1VWI B;  1STS B;  2OF9 A;  3EW2 A;  1N7Y A;  4BX5 B;  1SRF A;  4BX5 A;  1VWA B;  1N43 A;  2IZB A;  1SRG A;  4BCS A;  1RXH A;  2RTG B;  3X00 A;  1LDO A;  3WZQ A;  4CPF A;  1LCW A;  5B5G A;  2F01 A;  1VWC B;  2GH7 A;  1SWL A;  4BX7 B;  1RXJ A;  2AVI A;  3T2X A;  1SWP A;  1N9Y A;  2ZSC A;  2C1Q A;  1VWH B;  1LDQ A;  1SWF A;  2C4I A;  1AVE A;  2RTQ B;  1HXZ A;  1NDJ A;  4BBO A;  1N4J A;  2RTK A;  4CPI A;  1RST B;  2IZL B;  2RTL A;  3RY2 A;  3SZJ A;  1MOY A;  2RTC B;  2RTJ A;  4Y5D A;  1NQM A;  3EW1 A;  4I60 A;  3RE6 A;  1PTS A;  2WPU A;  2RTE B;  1I9H A;  2RTD B;  1VYO A;  1SWE A;  4Y59 A;  3VHH A;  2UZ2 A;  3SZI A;  1AVD A;  1SRH A;  2G5L A;  1SLD B;  1SWN A;  2Y32 A;  4GD9 A;  5CHK A;  4Z2P A;  5K68 A;  1SLG B;  2IZA A;  2MF6 A;  1SWO A;  1SWU A;  1SWK A;  1VWN B;  3MG5 A;  1Y52 X;  1VWK B;  2RTR B;  1KL5 A;  4GGZ A;  3WZP A;  5IRA A;  3RDM A;  1KFF A;  3WZN A;  2IZD B;  1LUQ A;  2A5C A;  1MEP A;  4CPH B;  2OFA A;  4BX7 A;  4CPH A;  2A5B A;  3WYQ A;  4JNJ A;  2IZK A;  4Z2V A;  3RY1 A;  2JGS A;  1SWG A;  2FHL A;  2Y3F A;  1VWL B;  4Z28 A;  3RDU A;  5IRU A;  1VWP B;  1RXK A;  1SWR A;  2RTM A;  1VWQ B;  1SWS A;  4Z6J A;  1SRI A;  3RDX A;  4OKA A;  1KL3 A;  2IZG B;  1VWR B;  2RTI B;  1STP A;  1MM9 A;  5B5F A;  1KL4 A;  2A8G A;  2RTB B;  2BC3 A;  2OFB A;  1LCV A;  2RTO B;  4JHQ A;  4U46 A;  1DF8 A;  1SWJ A;  3T6L A;  2C1S A;  5IRW A;  1VWB B;  1NBX A;  3RE5 A;  3VGW A;  1Y55 X;  1HQQ A;  1IJ8 A;  1LCZ A;  2IZE B;  1LEL A;  4GDA A;  1Y53 X;  4GJS A;  1SWB A;  1VWG B;  2RTP B;  2Y3E A;  2OF8 A;  1VWD B;  3MM0 A;  5CSE A;  3SZH A;  1SRE A;  4DNE A;  4GGT A;  1SWD A;  3VHI A;  1SWQ A;  1NQN A;  3WZO A;  4EKV A;  4GJV A;  2RTA A;  1NC9 A;  1RAV A;  3RDO A;  5L3Y A;  2RTN B;  5F2B A;  2IZH B;  4JO6 A;  1VWF B;  2QCB A;  2RTH B;  1HY2 A;  4IRW A;  1N9M A;  3VHM A;  5JD2 A;  1VWO B;  2IZI A;  1RSU B;  2CAM A;  3T6F A;  1SRJ A;  2IZJ A;  1SWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...