2IZKA

Streptavidin-glycoluril ph 2.58 i4122 complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
123
structure length
123
Chain Sequence
AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of biotin to streptavidin stabilizes intersubunit salt bridges between Asp61 and His87 at low pH.
pubmed doi rcsb
molecule keywords STREPTAVIDIN
molecule tags Biotin-binding protein
total genus 24
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 1997-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 2izkA00
4CPIA 1VWKB 2BC3A 1SWAA 2OF8A 1KL5A 1VWAB 1SWQA 2ZSCA 2IZIA 1MOYA 2AVIA 2RTNB 2RTOB 1NBXA 4I60A 2C4IA 1RXHA 1N43A 1N9MA 1HY2A 4Z2PA 1VWFB 3RE6A 4EKVA 2RTBB 1SRJA 2MF6A 1RXJA 1VYOA 4DNEA 2IZCB 3EW2A 5JD2A 3WZQA 4BX5A 4Z2VA 1VWCB 2RTEB 2GH7A 1RXKA 1IJ8A 2RTPB 4GGRA 4U46A 1N7YA 3RDQA 1LELA 5B5FA 1SLGB 5CSEA 1MM9A 1SRGA 3RY2A 2UYWA 3VHHA 3WYQA 2RTQB 4JNJA 2IZJA 3EW1A 1N4JA 2OF9A 2RTGB 1NQMA 3T2WA 3VGWA 1NDJA 3RDSA 4Z2OA 5IRWA 1STPA 3T2XA 1SRHA 1VWPB 1SLEB 4OKAA 4Y5DA 1MK5A 3WZNA 1VWQB 4YVBA 3WZOA 2RTAA 2RTFB 1AVEA 1SWFA 3X00A 1WBIA 1KFFA 4CPFA 2OFAA 4Z6JA 1SWJA 2IZFB 2IZLB 1NQNA 1LUQA 2F01A 2RTCB 1HXZA 3VHIA 2RTKA 1SWBA 1VWEB 1SWLA 1SLFB 2RTJA 1VWJB 1Y53X 2C1SA 2FHLA 1SWSA 3RDMA 1VWHB 1SREA 2IZEB 4GDAA 2OFBA 5B5GA 3RDUA 4BX5B 1SRFA 2RTIB 4JO6A 2QCBA 4BX7B 4CPHA 1LCWA 1RAVA 1SRIA 2CAMA 3T6FA 1N9YA 1KL3A 1MEPA 1PTSA 1SWRA 4BCSA 1VWGB 2Y3FA 1SWOA 1DF8A 4BBOA 2IZBA 2RTHB 5K67A 4IRWA 4CPEA 4BX6A 5F2BA 3WYPA 4Z28A 3PK2A 1VWIB 3VHMA 3MM0A 2IZGB 3MG5A 4Y59A 2JGSA 1Y55X 3SZIA 3RY1A 2IZAA 1STRB 2Y32A 1RSTB 1STSB 1SWTA 4GD9A 4GGTA 2A5CA 4GJVA 2IZKA 1LCZA 1Y52X 1HQQA 2RTDB 3SZJA 1SWEA 1SWCA 2FHNX 1SWNA 2WPUA 4GJSA 3RDOA 1SWKA 2A5BA 3RDXA 1KL4A 1VWRB 2Y3EA 1LDOA 2RTMA 3T6LA 2UZ2A 1LCVA 2IZHB 1SWPA 1HXLA 4JHQA 5IRAA 4Z27A 1AVDA 1SWHA 1LDQA 1VWBB 2A8GA 3FDCA 2C1QA 1VWLB 4CPHB 2RTLA 1VWOB 5CHKA 1NC9A 1RSUB 1VWMB 3RE5A 4BX7A 5K68A 2G5LA 1VWNB 2RTRB 4BJ8A 1SWDA 5IRUA 1SWGA 2IZDB 1VWDB 4GGZA 1I9HA 3WZPA 3SZHA 1SWUA 4BX6B 1SLDB 5L3YA
chains in the Genus database with same CATH superfamily
3ZW1A 5EZ2A 2BC3A 1SWAA 2OF8A 4XMCA 1VWAB 2ZSCA 1SWQA 2R73A 3FA7A 1YWAA 2XSTA 4XMDA 2AVIA 1BLRA 3QKGA 3FW5A 5LKEA 1DF3A 3UEWA 4TKJA 4YCEA 1N9MA 4NV7A 5FQ7E 4GNWA 4AZRA 4U3QA 1VWFB 5KHPA 2MF6A 1VYOA 5HZ8A 1X71A 3D4RA 4PSQA 5B3MO 2CM4A 5JD2A 4BX5A 1FE3A 1SXWA 1VWCB 1X8NA 2ZAGA 4NP1A 4Y0SA 4A60A 2LFOA 3APVA 5B29A 1CJ5A 1IJ8A 2RTPB 1AELA 1HBPA 4GGRA 5EDCA 4DCBA 5DG4A 5LJBA 4HPBA 1DZKA 4NLIA 1BSYA 1CBIA 2QO5A 5CSEA 5H9AA 5LJEA 2W2BA 3RY2A 1HQPA 1ZNLA 5D47A 3VHHA 3BU1A 3P6DA 2KW1A 3TGCA 1MDCA 3BRNA 2W2FA 1W6FA 3EW1A 3TGBA 3F8AA 2RTGB 4FQBB 2GTLM 1UYOX 2MO5A 3RDSA 4Z2OA 5LJKA 5IRWA 4ON1A 2K62A 1VWPB 4I3DA 4OKAA 2NNEA 1MK5A 4LKPA 4Y5DA 1PBYA 1SY1A 3CKFA 2RTAA 1X89A 3ZW1B 4C5PA 1EXSA 1KOIA 1WBIA 2HNXA 3FR2A 3UEVA 1YP6A 2IZFB 4ZHDA 3P6EA 4EXZA 4ORRA 2HZQA 4GE1A 1DFVA 3SLOA 3ZQ3A 1SXXA 3EBKA 5L8OA 2GJ5A 2FWVA 3VHIA 1VYGA 1SWBA 2AT5X 1Y9LA 1KT6A 2R74A 3H3IA 5H9LA 2AT3X 2DM5A 3VG6A 4JGLA 4BVMA 1SLFB 5AJBA 5BVSA 1FENA 1D2UA 1VWJB 2C1SA 2FHLA 2FR2A 5HZ6A 4YBPA 1SREA 4GDAA 1U17A 5B5GA 4BX5B 4ZHHA 2OY8A 3PPTA 1AVGI 4CPHA 1W5RA 1IFBA 2AT8X 4GZVA 5LJHA 3U03A 1ZNHA 1KL3A 1MEPA 3RSWA 2FLJA 3HTYA 3KZAA 4IAWA 4I6SA 2OY5O 3PECA 4BX6A 1I05A 1KQWA 4ORUA 3JQOA 4OMWA 1KZWA 2NNDA 3VHMA 3FA8A 4I9SA 1Y9TA 2IZGB 4DQ4A 5B27A 4Y59A 1QABE 5IO7A 2IZAA 1STRB 2OYBO 1SWTA 2G79A 4GD9A 4O4XA 4IB8A 1FJ1E 1BBPA 1MX8A 3P02A 1LCZA 3SZJA 3HWFA 4GU8A 4N7CA 3P6GA 4IB6A 5HCCC 1SWNA 3P6CA 2WPUA 3CMPA 4O4SA 3RDOA 2A5BA 5HWZA 1S44A 1YWBA 2Z4HA 3FLLA 3G7XA 4INNA 3RDXA 3WBGA 2WR6A 3FA6A 2G78A 1JBHA 1EPAA 1YIVA 2ACOA 4RUUA 4HFOA 1JJUA 4JHQA 2A8GA 1VWBB 2FTBA 4ZJ0A 3MX7A 1E5PA 5D45A 2PY1A 1VWLB 2BHVA 4CPHB 3ELZA 3FR5A 1RSUB 2OVDA 1Z24A 2JU3A 1SXYA 5KIDA 4O9SA 3GAQA 1GT1A 3K3LA 4M6SA 2GTLO 1RBPA 2RTRB 4WBKA 5B10O 3ZUOA 4ARHA 5CE4A 1PBOA 1QY0A 5HTDA 5IRUA 2Q2MA 2IZDB 2FGSA 4GGZA 3O2YA 4N7DA 3AEHA 1SWUA 3SZHA 2DJGA 4BX6B 3WJCA 4TKBA 3D95A 3KFGA 1E00A 3PEDA 3Q34A 3VG2A 4CPIA 4HWMA 1CBRA 4QZUA 4HPAA 3WJGA 2OL8O 1TW4A 1NBXA 2AL0X 2C4IA 3PH6A 4ORWA 1IKJA 1IFCA 3WJFA 2A0AA 3PH5A 4NLJA 1EQDA 4ZR2A 3RE6A 4I9RA 4KC7A 1X8UA 4LKTA 1L6MA 3ZWEA 3RZYA 2HYSA 1OEJA 3HWEA 1QFTA 2FT9A 1G85A 4KC8A 1FEMA 4I3CA 3OBLA 5FQ6E 3WZQA 4Z2VA 2GTFX 2GH7A 1RXKA 4NYQA 4QGVA 1G5WA 3CBCA 4MVKA 1K3BA 1TOUA 3RDQA 1LELA 1O8VA 2FR3A 3BS2A 2LBVA 4EEJA 2LBAA 1MM9A 1SRGA 1FELA 2UYWA 1QWDA 3WYQA 2RTQB 3VG5A 4BGFA 2RCQA 2BT9A 5LJDA 4ZHCA 4LZVA 1CRBA 4QAEA 5IO5A 2OF9A 1JJXA 1NQMA 4KCAA 5HA0A 1A3YA 4ZGUA 3VGWA 1NP1A 4ZCBA 4XMGA 2X8TA 1YWCA 1JIWI 2RA6A 2QM9A 3C76X 3T1DA 1ERXA 1SRHA 1SXUA 3OE3A 4YVBA 3WZOA 1AVEA 1SWFA 1FDQA 1LIDA 1KT4A 1OPBA 2AKQA 4BQUA 4ZHGA 1G7NA 4KH8A 1ZRYA 4IB7A 4EQAC 2F01A 2CZTA 5HCDC 4YBUA 3V8UA 1HXZA 2RTKA 4ORYA 1R0UA 1VYFA 5HAEA 1WUBA 3CQNA 2DJFA 1KQXA 2OFRX 1W4TA 2OL7A 2WUTA 2MJIA 2QO6A 4MIRA 3BU9A 3RDMA 5LKFA 4O3YA 2HKDA 4OS0A 3L4RA 4A1HA 1SRFA 2Z4IA 2RTIB 2CZUA 4BX7B 3HWGA 2A13A 1D3SA 5F58A 1S2PA 1A18A 3AKMA 2RN4A 4LQZA 1SRIA 5EDBA 5F1EA 4HPDA 4ZH6A 3T6FA 2I5ZO 1PTSA 5H9KA 1JMXA 1OSPO 1SWOA 1G74A 1DF8A 2HZRA 2RTHB 1OBPA 4A8ZA 5BYPA 4IRWA 1BWYA 2WQAE 1ICMA 4U8UN 5KICA 2AT0X 3ZUIA 4D6AA 1ALBA 3MM0A 2N93A 2KD2A 3B2HA 3MG5A 4Y0RA 2ASNX 1B0OA 3NBXX 1Y55X 3SZIA 2BLGA 2OY1O 3SOTA 2Y32A 1RSTB 1X8PA 3ZW2A 2A5CA 1SMPI 3FA9A 2IZKA 1Y52X 1HQQA 2NP1A 2RTDB 2FHNX 1BSQA 1RLBE 2F09A 1U0XA 1VWRB 1LDOA 2MM3A 3EC5A 4O4OA 2O62A 3T6LA 3UEUA 4ES7A 3OD9A 1YUPA 5K06A 2UZ2A 3O19A 5JR8A 1NP4A 2FS7A 2G8CO 4GH7A 1Y0GA 4OS8A 5L8NA 1EIOA 4YKOA 3FDCA 5CYBA 4QRLA 4Z27A 4M7MA 2RTLA 1VWOB 3TF6A 2JN3A 5D8JA 3ZW0A 2WEXA 3STMX 1ERBA 3SLTA 1GM6A 3PQSA 1N0SA 3KQ0A 4BJ8A 1TOWA 1I9HA 4TLJA 3WZPA 4NYRA 1SY3A 1ZNKA 1SLDB 1E02A 5L3YA 1H91A 2KT4B 4ZFXA 1VWKB 5F7GA 5BVTA 3F6ZB 1IIUA 4K19A 1MOYA 5HBSA 2RTOB 3VE2A 3FYFA 1I78A 3SAOA 1O1VA 3RBYA 4TKHA 1N43A 1P6PA 1HY2A 4Z2PA 3AKNA 2X46A 4R0BA 4L3RA 4YKMA 2FS6A 4IAXA 3BLGA 3D96A 1RXJA 2CBRA 2MWHA 2IFBA 2X34A 4ML7B 3B2JA 1OEEA 4MVLA 1SA8A 2IZCB 4I3BA 3S26A 1PM1X 4XMFA 2RQ0A 2FRSA 4BOEA 2OVAA 4GK9A 2L9CA 3NQKA 1N7YA 4AZPA 2WQ9A 5AEOA 1DV9A 1SLGB 4IB9A 4A1YA 4I95A 3TZSA 2Q4NA 1T68X 4ORSA 4D6BA 4QZTA 2OFMX 4Y0QA 4CDCA 1UYNX 4JNJA 2KTDA 2GC9A 3T2WA 3BSZE 4TNNA 3I0AA 3VU1A 1GKAA 2VFBA 5H9NA 1EI5A 1LIFA 3O22A 1KT5A 4NNTA 3T2XA 3WOVA 1BSOA 4AZMA 3WZNA 4LZUA 1BM5A 3ELXA 4QGWA 3X00A 1KFFA 1QY1A 2OFAA 4KT5A 4CPFA 1SWJA 4Z6JA 1LFOA 2IZLB 5IXGA 1JZUA 1ZNEA 1LNMA 1NQNA 1LUQA 3HOLA 1GT3A 4YH0A 3NR3A 2XKLA 2RTCB 1I4UA 3NPOA 5D4AA 3S60A 1IW2A 4ID2A 1BRQA 3ZW0B 1OBUA 1KT3A 2X8FA 3BX7A 5HTEA 1SWLA 4TQ2A 2RTJA 5DPQA 1SY2A 1QFVA 1VWHB 2IZEB 2OFBA 3NQ3A 4QYPA 3RDUA 3VG3A 5HZ5A 3FENA 4U9CA 2R56A 1ICNA 1T0VA 1LCWA 1E2TA 1LIBA 1X8OA 3NADA 2CAMA 4FBRA 1ADLA 2A2GA 4RUNA 1EALA 4BCSA 3P6HA 3WJBA 2Y3FA 3MVFA 2QOMA 4ZGFA 2IZBA 1JMZA 3ZI8A 3FEPA 2KTSA 4MEEA 5IO6A 1EIIA 2MHDA 5HZQA 4ODDA 4Z28A 3PK2A 1VWIB 3PDFA 4CDEA 2X4MA 1GKAB 1S7DA 4IMNA 5EPQA 2OY7A 4ZH9A 2X55A 2JGSA 2F73A 2WSJA 3IFBA 2L5PA 5HA1A 3CWKA 3RY1A 1STSB 4GGTA 4IBAA 1HN2A 3S5XA 4DQ3A 4QYNA 1XKIA 4YDAA 5B2AO 1UREA 2HLVA 3D97A 4OMXA 4CK4A 3IA8A 4MISA 1SWCA 3WVMA 3WXQA 2JU7A 2OVSA 2P8GA 3FMZA 1YP7A 2FKGA 2CM9A 4NW4A 2EU7X 1O1UA 2Y3EA 4COTA 4YGGA 2RTMA 3B2LA 1EW3A 4FGIB 1I06A 4YGZA 2HMBA 4PJ2A 4FBOA 5F6BA 2ALLX 3E3CA 3SLJA 3AUMO 1DZJA 3NX1A 1JYDA 4YDBA 1HXLA 5IRAA 1AVDA 1I04A 1LDQA 4KIIA 1JYJA 1A57A 3D9WA 2K23A 2LKKA 2PI3O 1NC9A 3PQUA 5CHKA 1VWMB 3RE5A 4U8UO 4GETA 3CKGA 1VWNB 5AQ6A 2W2AA 1PMPA 2Q2PA 3APUA 1LKEA 1KT7A 1GX9A 3HOEA 3BX8A 1SWDA 4CSBA 1SWGA 1BRPA 1VPRA 3PP6A 1VWDB 2Q39A 1BJ7A 4QGXA 5HCEC 1QG5A 3KVNA 2QOSC 3UEXA 4YMYA 2Q9SA 1GT5A 4CV7A 4MVEA 1B4MA 1SY0A 4EFGA 2JMBA 1KL5A 3EM0A 5FENA 5AJCA 2IZIA 3BDRA 2RTNB 5L8IA 4I60A 3MBTA 4GKCA 1RXHA 3B2KA 1E06A 4CDFA 4L1NA 2AH7X 2POAA 4EKVA 3HPEA 3LHNA 1TXLA 2RTBB 1SRJA 3VG7A 3KFHA 1ZNDA 2LB6A 3EW2A 1HMTA 3B2IA 4OEMA 1HMSA 2E4JA 3CR6A 1OEKA 4NNSA 1QQSA 2RTEB 2FKJA 1X8QA 5H8TA 4CDDA 4U46A 4DNEA 4EDEA 3CBSA 2ZAIA 4B55A 5B5FA 4AZOA 4FBVA 1LIEA 4ALOA 1EPBA 3LV4A 1IKEA 1DZPA 2IZJA 4OELA 1CBSA 4O3WA 3NX2A 4ZHFA 1N4JA 1XCAA 2RD7C 5D48A 1GX3A 4XMEA 1MX7A 1NGLA 1NDJA 2LA7A 5B11O 1BEBA 4UU3A 2G7BA 1QY2A 1B56A 1STPA 1PEEA 2OZQA 1MVGA 3HWDA 1MUPA 3LTWA 2L67A 1SLEB 3N91A 3APXA 1ACDA 4GNYA 4O3XB 1VWQB 4OS3A 3QQ2A 2RTFB 3VPJE 1OPAA 3WJDA 1JJJA 1GX8A 1K24A 4AZQA 2BS6A 1EUOA 1TVQA 3NP1A 4WFUA 5FQ8E 2YMSA 2I5VO 2BSZA 2RCTA 2WEWA 2X32A 2YG2A 1GXAA 3C77X 4O4UA 5C0NA 3RWXA 3JS1A 3FELA 1VWEB 3FEKA 2JOZA 4QNIA 4YFPA 2VFCA 5BVQA 1UZ2X 3FW4A 1Y53X 1SWSA 2M4LA 5LJGA 1DZMA 4O3ZA 1OBQA 1ZNGA 1JQPA 2ACPX 2BS5A 3GE2A 2QCBA 3HK1A 4JO6A 4O49A 4U8UM 2L68A 5FAZA 1RAVA 4WFVA 3FIQA 1N9YA 2X45A 3BY0A 4YFQA 3I17A 1SWRA 3EBWA 4YFRA 1JV4A 1VWGB 3UAQA 2A3FX 2ANSA 1KZXA 3OJYC 3KFIA 3JSQA 4BBOA 2AT6X 2QMIA 2AMMX 5K67A 4CPEA 1KXOA 5LJCA 5F2BA 3WYPA 2WWPA 4GUZA 4WHIA 1LF7A 4IMOA 1LICA 2OL6O 2GTLN 3U9PC 3WJEA 4GRJA 3EMMA 3CQRA 2AF5A 2JW1A 1AQBA 1CBQA 4MVIA 2QO4A 4YGHA 4QQ1A 3DTQA 3APWA 3P6FA 2VDFA 3C78X 4GJVA 4AYHA 5FFHA 1HMRA 1LPJA 1A2DA 1SWEA 3FIDA 3S5VA 3STNA 5HZ9A 1GT4A 3U0DA 4GJSA 4ORXA 1SWKA 2CBSA 1KL4A 4HPCA 4XMHA 3RKGA 1HBQA 3NQ9A 3DSZA 1FTPA 1AB0A 3STKA 4YCHA 5F6ZA 3EYCA 1LCVA 2IZHB 1SWPA 2A2UA 2X56A 1YWDA 4UU2A 4NV8A 1SWHA 2NNQA 2C1QA 3Q6LA 4TJZA 1GGLA 3P24A 3VE1A 4AW8A 1U18A 4ALBA 4BX7A 1ML7A 1DC9A 5K68A 2G5LA 1B8EA 3FR4A 5EEEA 3F9DA 2OVEA 2JU8A 3KFFA 4Y0PA 5EEDA 1KGLA 4IABA 4GDZA 3VG4A 2X8SA 3ZZVA 4AZNA 1T8VA 3TGAA
chains in the Genus database with same CATH topology
4CPIA 1VWKB 2BC3A 1SWAA 2OF8A 1KL5A 1VWAB 1SWQA 2ZSCA 2IZIA 1MOYA 2AVIA 2RTNB 2RTOB 1NBXA 4I60A 2C4IA 1RXHA 1N43A 1N9MA 1HY2A 4Z2PA 1VWFB 3RE6A 4EKVA 2RTBB 1SRJA 2MF6A 1RXJA 1VYOA 4DNEA 2IZCB 3EW2A 5JD2A 3WZQA 4BX5A 4Z2VA 1VWCB 2RTEB 2GH7A 1RXKA 1IJ8A 2RTPB 4GGRA 4U46A 1N7YA 3RDQA 1LELA 5B5FA 1SLGB 5CSEA 1MM9A 1SRGA 3RY2A 2UYWA 3VHHA 3WYQA 2RTQB 4JNJA 2IZJA 3EW1A 1N4JA 2OF9A 2RTGB 1NQMA 3T2WA 3VGWA 1NDJA 3RDSA 4Z2OA 5IRWA 1STPA 3T2XA 1SRHA 1VWPB 1SLEB 4OKAA 4Y5DA 1MK5A 3WZNA 1VWQB 4YVBA 3WZOA 2RTAA 2RTFB 1AVEA 1SWFA 3X00A 1WBIA 1KFFA 4CPFA 2OFAA 4Z6JA 1SWJA 2IZFB 2IZLB 1NQNA 1LUQA 2F01A 2RTCB 1HXZA 3VHIA 2RTKA 1SWBA 1VWEB 1SWLA 1SLFB 2RTJA 1VWJB 1Y53X 2C1SA 2FHLA 1SWSA 3RDMA 1VWHB 1SREA 2IZEB 4GDAA 2OFBA 5B5GA 3RDUA 4BX5B 1SRFA 2RTIB 4JO6A 2QCBA 4BX7B 4CPHA 1LCWA 1RAVA 1SRIA 2CAMA 3T6FA 1N9YA 1KL3A 1MEPA 1PTSA 1SWRA 4BCSA 1VWGB 2Y3FA 1SWOA 1DF8A 4BBOA 2IZBA 2RTHB 5K67A 4IRWA 4CPEA 4BX6A 5F2BA 3WYPA 4Z28A 3PK2A 1VWIB 3VHMA 3MM0A 2IZGB 3MG5A 4Y59A 2JGSA 1Y55X 3SZIA 3RY1A 2IZAA 1STRB 2Y32A 1RSTB 1STSB 1SWTA 4GD9A 4GGTA 2A5CA 4GJVA 2IZKA 1LCZA 1Y52X 1HQQA 2RTDB 3SZJA 1SWEA 1SWCA 2FHNX 1SWNA 2WPUA 4GJSA 3RDOA 1SWKA 2A5BA 3RDXA 1KL4A 1VWRB 2Y3EA 1LDOA 2RTMA 3T6LA 2UZ2A 1LCVA 2IZHB 1SWPA 1HXLA 4JHQA 5IRAA 4Z27A 1AVDA 1SWHA 1LDQA 1VWBB 2A8GA 3FDCA 2C1QA 1VWLB 4CPHB 2RTLA 1VWOB 5CHKA 1NC9A 1RSUB 1VWMB 3RE5A 4BX7A 5K68A 2G5LA 1VWNB 2RTRB 4BJ8A 1SWDA 5IRUA 1SWGA 2IZDB 1VWDB 4GGZA 1I9HA 3WZPA 3SZHA 1SWUA 4BX6B 1SLDB 5L3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CPI A;  1VWK B;  2BC3 A;  1SWA A;  2OF8 A;  1KL5 A;  1VWA B;  1SWQ A;  2ZSC A;  2IZI A;  1MOY A;  2AVI A;  2RTN B;  2RTO B;  1NBX A;  4I60 A;  2C4I A;  1RXH A;  1N43 A;  1N9M A;  1HY2 A;  4Z2P A;  1VWF B;  3RE6 A;  4EKV A;  2RTB B;  1SRJ A;  2MF6 A;  1RXJ A;  1VYO A;  4DNE A;  2IZC B;  3EW2 A;  5JD2 A;  3WZQ A;  4BX5 A;  4Z2V A;  1VWC B;  2RTE B;  2GH7 A;  1RXK A;  1IJ8 A;  2RTP B;  4GGR A;  4U46 A;  1N7Y A;  3RDQ A;  1LEL A;  5B5F A;  1SLG B;  5CSE A;  1MM9 A;  1SRG A;  3RY2 A;  2UYW A;  3VHH A;  3WYQ A;  2RTQ B;  4JNJ A;  2IZJ A;  3EW1 A;  1N4J A;  2OF9 A;  2RTG B;  1NQM A;  3T2W A;  3VGW A;  1NDJ A;  3RDS A;  4Z2O A;  5IRW A;  1STP A;  3T2X A;  1SRH A;  1VWP B;  1SLE B;  4OKA A;  4Y5D A;  1MK5 A;  3WZN A;  1VWQ B;  4YVB A;  3WZO A;  2RTA A;  2RTF B;  1AVE A;  1SWF A;  3X00 A;  1WBI A;  1KFF A;  4CPF A;  2OFA A;  4Z6J A;  1SWJ A;  2IZF B;  2IZL B;  1NQN A;  1LUQ A;  2F01 A;  2RTC B;  1HXZ A;  3VHI A;  2RTK A;  1SWB A;  1VWE B;  1SWL A;  1SLF B;  2RTJ A;  1VWJ B;  1Y53 X;  2C1S A;  2FHL A;  1SWS A;  3RDM A;  1VWH B;  1SRE A;  2IZE B;  4GDA A;  2OFB A;  5B5G A;  3RDU A;  4BX5 B;  1SRF A;  2RTI B;  4JO6 A;  2QCB A;  4BX7 B;  4CPH A;  1LCW A;  1RAV A;  1SRI A;  2CAM A;  3T6F A;  1N9Y A;  1KL3 A;  1MEP A;  1PTS A;  1SWR A;  4BCS A;  1VWG B;  2Y3F A;  1SWO A;  1DF8 A;  4BBO A;  2IZB A;  2RTH B;  5K67 A;  4IRW A;  4CPE A;  4BX6 A;  5F2B A;  3WYP A;  4Z28 A;  3PK2 A;  1VWI B;  3VHM A;  3MM0 A;  2IZG B;  3MG5 A;  4Y59 A;  2JGS A;  1Y55 X;  3SZI A;  3RY1 A;  2IZA A;  1STR B;  2Y32 A;  1RST B;  1STS B;  1SWT A;  4GD9 A;  4GGT A;  2A5C A;  4GJV A;  2IZK A;  1LCZ A;  1Y52 X;  1HQQ A;  2RTD B;  3SZJ A;  1SWE A;  1SWC A;  2FHN X;  1SWN A;  2WPU A;  4GJS A;  3RDO A;  1SWK A;  2A5B A;  3RDX A;  1KL4 A;  1VWR B;  2Y3E A;  1LDO A;  2RTM A;  3T6L A;  2UZ2 A;  1LCV A;  2IZH B;  1SWP A;  1HXL A;  4JHQ A;  5IRA A;  4Z27 A;  1AVD A;  1SWH A;  1LDQ A;  1VWB B;  2A8G A;  3FDC A;  2C1Q A;  1VWL B;  4CPH B;  2RTL A;  1VWO B;  5CHK A;  1NC9 A;  1RSU B;  1VWM B;  3RE5 A;  4BX7 A;  5K68 A;  2G5L A;  1VWN B;  2RTR B;  4BJ8 A;  1SWD A;  5IRU A;  1SWG A;  2IZD B;  1VWD B;  4GGZ A;  1I9H A;  3WZP A;  3SZH A;  1SWU A;  4BX6 B;  1SLD B;  5L3Y A; 
#chains in the Genus database with same CATH topology
 3ZW1 A;  5EZ2 A;  2BC3 A;  1SWA A;  2OF8 A;  4XMC A;  1VWA B;  2ZSC A;  1SWQ A;  2R73 A;  3FA7 A;  1YWA A;  2XST A;  4XMD A;  2AVI A;  1BLR A;  3QKG A;  3FW5 A;  5LKE A;  1DF3 A;  3UEW A;  4TKJ A;  4YCE A;  1N9M A;  4NV7 A;  5FQ7 E;  4GNW A;  4AZR A;  4U3Q A;  1VWF B;  5KHP A;  2MF6 A;  1VYO A;  5HZ8 A;  1X71 A;  3D4R A;  4PSQ A;  5B3M O;  2CM4 A;  5JD2 A;  4BX5 A;  1FE3 A;  1SXW A;  1VWC B;  1X8N A;  2ZAG A;  4NP1 A;  4Y0S A;  4A60 A;  2LFO A;  3APV A;  5B29 A;  1CJ5 A;  1IJ8 A;  2RTP B;  1AEL A;  1HBP A;  4GGR A;  5EDC A;  4DCB A;  5DG4 A;  5LJB A;  4HPB A;  1DZK A;  4NLI A;  1BSY A;  1CBI A;  2QO5 A;  5CSE A;  5H9A A;  5LJE A;  2W2B A;  3RY2 A;  1HQP A;  1ZNL A;  5D47 A;  3VHH A;  3BU1 A;  3P6D A;  2KW1 A;  3TGC A;  1MDC A;  3BRN A;  2W2F A;  1W6F A;  3EW1 A;  3TGB A;  3F8A A;  2RTG B;  4FQB B;  2GTL M;  1UYO X;  2MO5 A;  3RDS A;  4Z2O A;  5LJK A;  5IRW A;  4ON1 A;  2K62 A;  1VWP B;  4I3D A;  4OKA A;  2NNE A;  1MK5 A;  4LKP A;  4Y5D A;  1PBY A;  1SY1 A;  3CKF A;  2RTA A;  1X89 A;  3ZW1 B;  4C5P A;  1EXS A;  1KOI A;  1WBI A;  2HNX A;  3FR2 A;  3UEV A;  1YP6 A;  2IZF B;  4ZHD A;  3P6E A;  4EXZ A;  4ORR A;  2HZQ A;  4GE1 A;  1DFV A;  3SLO A;  3ZQ3 A;  1SXX A;  3EBK A;  5L8O A;  2GJ5 A;  2FWV A;  3VHI A;  1VYG A;  1SWB A;  2AT5 X;  1Y9L A;  1KT6 A;  2R74 A;  3H3I A;  5H9L A;  2AT3 X;  2DM5 A;  3VG6 A;  4JGL A;  4BVM A;  1SLF B;  5AJB A;  5BVS A;  1FEN A;  1D2U A;  1VWJ B;  2C1S A;  2FHL A;  2FR2 A;  5HZ6 A;  4YBP A;  1SRE A;  4GDA A;  1U17 A;  5B5G A;  4BX5 B;  4ZHH A;  2OY8 A;  3PPT A;  1AVG I;  4CPH A;  1W5R A;  1IFB A;  2AT8 X;  4GZV A;  5LJH A;  3U03 A;  1ZNH A;  1KL3 A;  1MEP A;  3RSW A;  2FLJ A;  3HTY A;  3KZA A;  4IAW A;  4I6S A;  2OY5 O;  3PEC A;  4BX6 A;  1I05 A;  1KQW A;  4ORU A;  3JQO A;  4OMW A;  1KZW A;  2NND A;  3VHM A;  3FA8 A;  4I9S A;  1Y9T A;  2IZG B;  4DQ4 A;  5B27 A;  4Y59 A;  1QAB E;  5IO7 A;  2IZA A;  1STR B;  2OYB O;  1SWT A;  2G79 A;  4GD9 A;  4O4X A;  4IB8 A;  1FJ1 E;  1BBP A;  1MX8 A;  3P02 A;  1LCZ A;  3SZJ A;  3HWF A;  4GU8 A;  4N7C A;  3P6G A;  4IB6 A;  5HCC C;  1SWN A;  3P6C A;  2WPU A;  3CMP A;  4O4S A;  3RDO A;  2A5B A;  5HWZ A;  1S44 A;  1YWB A;  2Z4H A;  3FLL A;  3G7X A;  4INN A;  3RDX A;  3WBG A;  2WR6 A;  3FA6 A;  2G78 A;  1JBH A;  1EPA A;  1YIV A;  2ACO A;  4RUU A;  4HFO A;  1JJU A;  4JHQ A;  2A8G A;  1VWB B;  2FTB A;  4ZJ0 A;  3MX7 A;  1E5P A;  5D45 A;  2PY1 A;  1VWL B;  2BHV A;  4CPH B;  3ELZ A;  3FR5 A;  1RSU B;  2OVD A;  1Z24 A;  2JU3 A;  1SXY A;  5KID A;  4O9S A;  3GAQ A;  1GT1 A;  3K3L A;  4M6S A;  2GTL O;  1RBP A;  2RTR B;  4WBK A;  5B10 O;  3ZUO A;  4ARH A;  5CE4 A;  1PBO A;  1QY0 A;  5HTD A;  5IRU A;  2Q2M A;  2IZD B;  2FGS A;  4GGZ A;  3O2Y A;  4N7D A;  3AEH A;  1SWU A;  3SZH A;  2DJG A;  4BX6 B;  3WJC A;  4TKB A;  3D95 A;  3KFG A;  1E00 A;  3PED A;  3Q34 A;  3VG2 A;  4CPI A;  4HWM A;  1CBR A;  4QZU A;  4HPA A;  3WJG A;  2OL8 O;  1TW4 A;  1NBX A;  2AL0 X;  2C4I A;  3PH6 A;  4ORW A;  1IKJ A;  1IFC A;  3WJF A;  2A0A A;  3PH5 A;  4NLJ A;  1EQD A;  4ZR2 A;  3RE6 A;  4I9R A;  4KC7 A;  1X8U A;  4LKT A;  1L6M A;  3ZWE A;  3RZY A;  2HYS A;  1OEJ A;  3HWE A;  1QFT A;  2FT9 A;  1G85 A;  4KC8 A;  1FEM A;  4I3C A;  3OBL A;  5FQ6 E;  3WZQ A;  4Z2V A;  2GTF X;  2GH7 A;  1RXK A;  4NYQ A;  4QGV A;  1G5W A;  3CBC A;  4MVK A;  1K3B A;  1TOU A;  3RDQ A;  1LEL A;  1O8V A;  2FR3 A;  3BS2 A;  2LBV A;  4EEJ A;  2LBA A;  1MM9 A;  1SRG A;  1FEL A;  2UYW A;  1QWD A;  3WYQ A;  2RTQ B;  3VG5 A;  4BGF A;  2RCQ A;  2BT9 A;  5LJD A;  4ZHC A;  4LZV A;  1CRB A;  4QAE A;  5IO5 A;  2OF9 A;  1JJX A;  1NQM A;  4KCA A;  5HA0 A;  1A3Y A;  4ZGU A;  3VGW A;  1NP1 A;  4ZCB A;  4XMG A;  2X8T A;  1YWC A;  1JIW I;  2RA6 A;  2QM9 A;  3C76 X;  3T1D A;  1ERX A;  1SRH A;  1SXU A;  3OE3 A;  4YVB A;  3WZO A;  1AVE A;  1SWF A;  1FDQ A;  1LID A;  1KT4 A;  1OPB A;  2AKQ A;  4BQU A;  4ZHG A;  1G7N A;  4KH8 A;  1ZRY A;  4IB7 A;  4EQA C;  2F01 A;  2CZT A;  5HCD C;  4YBU A;  3V8U A;  1HXZ A;  2RTK A;  4ORY A;  1R0U A;  1VYF A;  5HAE A;  1WUB A;  3CQN A;  2DJF A;  1KQX A;  2OFR X;  1W4T A;  2OL7 A;  2WUT A;  2MJI A;  2QO6 A;  4MIR A;  3BU9 A;  3RDM A;  5LKF A;  4O3Y A;  2HKD A;  4OS0 A;  3L4R A;  4A1H A;  1SRF A;  2Z4I A;  2RTI B;  2CZU A;  4BX7 B;  3HWG A;  2A13 A;  1D3S A;  5F58 A;  1S2P A;  1A18 A;  3AKM A;  2RN4 A;  4LQZ A;  1SRI A;  5EDB A;  5F1E A;  4HPD A;  4ZH6 A;  3T6F A;  2I5Z O;  1PTS A;  5H9K A;  1JMX A;  1OSP O;  1SWO A;  1G74 A;  1DF8 A;  2HZR A;  2RTH B;  1OBP A;  4A8Z A;  5BYP A;  4IRW A;  1BWY A;  2WQA E;  1ICM A;  4U8U N;  5KIC A;  2AT0 X;  3ZUI A;  4D6A A;  1ALB A;  3MM0 A;  2N93 A;  2KD2 A;  3B2H A;  3MG5 A;  4Y0R A;  2ASN X;  1B0O A;  3NBX X;  1Y55 X;  3SZI A;  2BLG A;  2OY1 O;  3SOT A;  2Y32 A;  1RST B;  1X8P A;  3ZW2 A;  2A5C A;  1SMP I;  3FA9 A;  2IZK A;  1Y52 X;  1HQQ A;  2NP1 A;  2RTD B;  2FHN X;  1BSQ A;  1RLB E;  2F09 A;  1U0X A;  1VWR B;  1LDO A;  2MM3 A;  3EC5 A;  4O4O A;  2O62 A;  3T6L A;  3UEU A;  4ES7 A;  3OD9 A;  1YUP A;  5K06 A;  2UZ2 A;  3O19 A;  5JR8 A;  1NP4 A;  2FS7 A;  2G8C O;  4GH7 A;  1Y0G A;  4OS8 A;  5L8N A;  1EIO A;  4YKO A;  3FDC A;  5CYB A;  4QRL A;  4Z27 A;  4M7M A;  2RTL A;  1VWO B;  3TF6 A;  2JN3 A;  5D8J A;  3ZW0 A;  2WEX A;  3STM X;  1ERB A;  3SLT A;  1GM6 A;  3PQS A;  1N0S A;  3KQ0 A;  4BJ8 A;  1TOW A;  1I9H A;  4TLJ A;  3WZP A;  4NYR A;  1SY3 A;  1ZNK A;  1SLD B;  1E02 A;  5L3Y A;  1H91 A;  2KT4 B;  4ZFX A;  1VWK B;  5F7G A;  5BVT A;  3F6Z B;  1IIU A;  4K19 A;  1MOY A;  5HBS A;  2RTO B;  3VE2 A;  3FYF A;  1I78 A;  3SAO A;  1O1V A;  3RBY A;  4TKH A;  1N43 A;  1P6P A;  1HY2 A;  4Z2P A;  3AKN A;  2X46 A;  4R0B A;  4L3R A;  4YKM A;  2FS6 A;  4IAX A;  3BLG A;  3D96 A;  1RXJ A;  2CBR A;  2MWH A;  2IFB A;  2X34 A;  4ML7 B;  3B2J A;  1OEE A;  4MVL A;  1SA8 A;  2IZC B;  4I3B A;  3S26 A;  1PM1 X;  4XMF A;  2RQ0 A;  2FRS A;  4BOE A;  2OVA A;  4GK9 A;  2L9C A;  3NQK A;  1N7Y A;  4AZP A;  2WQ9 A;  5AEO A;  1DV9 A;  1SLG B;  4IB9 A;  4A1Y A;  4I95 A;  3TZS A;  2Q4N A;  1T68 X;  4ORS A;  4D6B A;  4QZT A;  2OFM X;  4Y0Q A;  4CDC A;  1UYN X;  4JNJ A;  2KTD A;  2GC9 A;  3T2W A;  3BSZ E;  4TNN A;  3I0A A;  3VU1 A;  1GKA A;  2VFB A;  5H9N A;  1EI5 A;  1LIF A;  3O22 A;  1KT5 A;  4NNT A;  3T2X A;  3WOV A;  1BSO A;  4AZM A;  3WZN A;  4LZU A;  1BM5 A;  3ELX A;  4QGW A;  3X00 A;  1KFF A;  1QY1 A;  2OFA A;  4KT5 A;  4CPF A;  1SWJ A;  4Z6J A;  1LFO A;  2IZL B;  5IXG A;  1JZU A;  1ZNE A;  1LNM A;  1NQN A;  1LUQ A;  3HOL A;  1GT3 A;  4YH0 A;  3NR3 A;  2XKL A;  2RTC B;  1I4U A;  3NPO A;  5D4A A;  3S60 A;  1IW2 A;  4ID2 A;  1BRQ A;  3ZW0 B;  1OBU A;  1KT3 A;  2X8F A;  3BX7 A;  5HTE A;  1SWL A;  4TQ2 A;  2RTJ A;  5DPQ A;  1SY2 A;  1QFV A;  1VWH B;  2IZE B;  2OFB A;  3NQ3 A;  4QYP A;  3RDU A;  3VG3 A;  5HZ5 A;  3FEN A;  4U9C A;  2R56 A;  1ICN A;  1T0V A;  1LCW A;  1E2T A;  1LIB A;  1X8O A;  3NAD A;  2CAM A;  4FBR A;  1ADL A;  2A2G A;  4RUN A;  1EAL A;  4BCS A;  3P6H A;  3WJB A;  2Y3F A;  3MVF A;  2QOM A;  4ZGF A;  2IZB A;  1JMZ A;  3ZI8 A;  3FEP A;  2KTS A;  4MEE A;  5IO6 A;  1EII A;  2MHD A;  5HZQ A;  4ODD A;  4Z28 A;  3PK2 A;  1VWI B;  3PDF A;  4CDE A;  2X4M A;  1GKA B;  1S7D A;  4IMN A;  5EPQ A;  2OY7 A;  4ZH9 A;  2X55 A;  2JGS A;  2F73 A;  2WSJ A;  3IFB A;  2L5P A;  5HA1 A;  3CWK A;  3RY1 A;  1STS B;  4GGT A;  4IBA A;  1HN2 A;  3S5X A;  4DQ3 A;  4QYN A;  1XKI A;  4YDA A;  5B2A O;  1URE A;  2HLV A;  3D97 A;  4OMX A;  4CK4 A;  3IA8 A;  4MIS A;  1SWC A;  3WVM A;  3WXQ A;  2JU7 A;  2OVS A;  2P8G A;  3FMZ A;  1YP7 A;  2FKG A;  2CM9 A;  4NW4 A;  2EU7 X;  1O1U A;  2Y3E A;  4COT A;  4YGG A;  2RTM A;  3B2L A;  1EW3 A;  4FGI B;  1I06 A;  4YGZ A;  2HMB A;  4PJ2 A;  4FBO A;  5F6B A;  2ALL X;  3E3C A;  3SLJ A;  3AUM O;  1DZJ A;  3NX1 A;  1JYD A;  4YDB A;  1HXL A;  5IRA A;  1AVD A;  1I04 A;  1LDQ A;  4KII A;  1JYJ A;  1A57 A;  3D9W A;  2K23 A;  2LKK A;  2PI3 O;  1NC9 A;  3PQU A;  5CHK A;  1VWM B;  3RE5 A;  4U8U O;  4GET A;  3CKG A;  1VWN B;  5AQ6 A;  2W2A A;  1PMP A;  2Q2P A;  3APU A;  1LKE A;  1KT7 A;  1GX9 A;  3HOE A;  3BX8 A;  1SWD A;  4CSB A;  1SWG A;  1BRP A;  1VPR A;  3PP6 A;  1VWD B;  2Q39 A;  1BJ7 A;  4QGX A;  5HCE C;  1QG5 A;  3KVN A;  2QOS C;  3UEX A;  4YMY A;  2Q9S A;  1GT5 A;  4CV7 A;  4MVE A;  1B4M A;  1SY0 A;  4EFG A;  2JMB A;  1KL5 A;  3EM0 A;  5FEN A;  5AJC A;  2IZI A;  3BDR A;  2RTN B;  5L8I A;  4I60 A;  3MBT A;  4GKC A;  1RXH A;  3B2K A;  1E06 A;  4CDF A;  4L1N A;  2AH7 X;  2POA A;  4EKV A;  3HPE A;  3LHN A;  1TXL A;  2RTB B;  1SRJ A;  3VG7 A;  3KFH A;  1ZND A;  2LB6 A;  3EW2 A;  1HMT A;  3B2I A;  4OEM A;  1HMS A;  2E4J A;  3CR6 A;  1OEK A;  4NNS A;  1QQS A;  2RTE B;  2FKJ A;  1X8Q A;  5H8T A;  4CDD A;  4U46 A;  4DNE A;  4EDE A;  3CBS A;  2ZAI A;  4B55 A;  5B5F A;  4AZO A;  4FBV A;  1LIE A;  4ALO A;  1EPB A;  3LV4 A;  1IKE A;  1DZP A;  2IZJ A;  4OEL A;  1CBS A;  4O3W A;  3NX2 A;  4ZHF A;  1N4J A;  1XCA A;  2RD7 C;  5D48 A;  1GX3 A;  4XME A;  1MX7 A;  1NGL A;  1NDJ A;  2LA7 A;  5B11 O;  1BEB A;  4UU3 A;  2G7B A;  1QY2 A;  1B56 A;  1STP A;  1PEE A;  2OZQ A;  1MVG A;  3HWD A;  1MUP A;  3LTW A;  2L67 A;  1SLE B;  3N91 A;  3APX A;  1ACD A;  4GNY A;  4O3X B;  1VWQ B;  4OS3 A;  3QQ2 A;  2RTF B;  3VPJ E;  1OPA A;  3WJD A;  1JJJ A;  1GX8 A;  1K24 A;  4AZQ A;  2BS6 A;  1EUO A;  1TVQ A;  3NP1 A;  4WFU A;  5FQ8 E;  2YMS A;  2I5V O;  2BSZ A;  2RCT A;  2WEW A;  2X32 A;  2YG2 A;  1GXA A;  3C77 X;  4O4U A;  5C0N A;  3RWX A;  3JS1 A;  3FEL A;  1VWE B;  3FEK A;  2JOZ A;  4QNI A;  4YFP A;  2VFC A;  5BVQ A;  1UZ2 X;  3FW4 A;  1Y53 X;  1SWS A;  2M4L A;  5LJG A;  1DZM A;  4O3Z A;  1OBQ A;  1ZNG A;  1JQP A;  2ACP X;  2BS5 A;  3GE2 A;  2QCB A;  3HK1 A;  4JO6 A;  4O49 A;  4U8U M;  2L68 A;  5FAZ A;  1RAV A;  4WFV A;  3FIQ A;  1N9Y A;  2X45 A;  3BY0 A;  4YFQ A;  3I17 A;  1SWR A;  3EBW A;  4YFR A;  1JV4 A;  1VWG B;  3UAQ A;  2A3F X;  2ANS A;  1KZX A;  3OJY C;  3KFI A;  3JSQ A;  4BBO A;  2AT6 X;  2QMI A;  2AMM X;  5K67 A;  4CPE A;  1KXO A;  5LJC A;  5F2B A;  3WYP A;  2WWP A;  4GUZ A;  4WHI A;  1LF7 A;  4IMO A;  1LIC A;  2OL6 O;  2GTL N;  3U9P C;  3WJE A;  4GRJ A;  3EMM A;  3CQR A;  2AF5 A;  2JW1 A;  1AQB A;  1CBQ A;  4MVI A;  2QO4 A;  4YGH A;  4QQ1 A;  3DTQ A;  3APW A;  3P6F A;  2VDF A;  3C78 X;  4GJV A;  4AYH A;  5FFH A;  1HMR A;  1LPJ A;  1A2D A;  1SWE A;  3FID A;  3S5V A;  3STN A;  5HZ9 A;  1GT4 A;  3U0D A;  4GJS A;  4ORX A;  1SWK A;  2CBS A;  1KL4 A;  4HPC A;  4XMH A;  3RKG A;  1HBQ A;  3NQ9 A;  3DSZ A;  1FTP A;  1AB0 A;  3STK A;  4YCH A;  5F6Z A;  3EYC A;  1LCV A;  2IZH B;  1SWP A;  2A2U A;  2X56 A;  1YWD A;  4UU2 A;  4NV8 A;  1SWH A;  2NNQ A;  2C1Q A;  3Q6L A;  4TJZ A;  1GGL A;  3P24 A;  3VE1 A;  4AW8 A;  1U18 A;  4ALB A;  4BX7 A;  1ML7 A;  1DC9 A;  5K68 A;  2G5L A;  1B8E A;  3FR4 A;  5EEE A;  3F9D A;  2OVE A;  2JU8 A;  3KFF A;  4Y0P A;  5EED A;  1KGL A;  4IAB A;  4GDZ A;  3VG4 A;  2X8S A;  3ZZV A;  4AZN A;  1T8V A;  3TGA A; 
#chains in the Genus database with same CATH homology
 4CPI A;  1VWK B;  2BC3 A;  1SWA A;  2OF8 A;  1KL5 A;  1VWA B;  1SWQ A;  2ZSC A;  2IZI A;  1MOY A;  2AVI A;  2RTN B;  2RTO B;  1NBX A;  4I60 A;  2C4I A;  1RXH A;  1N43 A;  1N9M A;  1HY2 A;  4Z2P A;  1VWF B;  3RE6 A;  4EKV A;  2RTB B;  1SRJ A;  2MF6 A;  1RXJ A;  1VYO A;  4DNE A;  2IZC B;  3EW2 A;  5JD2 A;  3WZQ A;  4BX5 A;  4Z2V A;  1VWC B;  2RTE B;  2GH7 A;  1RXK A;  1IJ8 A;  2RTP B;  4GGR A;  4U46 A;  1N7Y A;  3RDQ A;  1LEL A;  5B5F A;  1SLG B;  5CSE A;  1MM9 A;  1SRG A;  3RY2 A;  2UYW A;  3VHH A;  3WYQ A;  2RTQ B;  4JNJ A;  2IZJ A;  3EW1 A;  1N4J A;  2OF9 A;  2RTG B;  1NQM A;  3T2W A;  3VGW A;  1NDJ A;  3RDS A;  4Z2O A;  5IRW A;  1STP A;  3T2X A;  1SRH A;  1VWP B;  1SLE B;  4OKA A;  4Y5D A;  1MK5 A;  3WZN A;  1VWQ B;  4YVB A;  3WZO A;  2RTA A;  2RTF B;  1AVE A;  1SWF A;  3X00 A;  1WBI A;  1KFF A;  4CPF A;  2OFA A;  4Z6J A;  1SWJ A;  2IZF B;  2IZL B;  1NQN A;  1LUQ A;  2F01 A;  2RTC B;  1HXZ A;  3VHI A;  2RTK A;  1SWB A;  1VWE B;  1SWL A;  1SLF B;  2RTJ A;  1VWJ B;  1Y53 X;  2C1S A;  2FHL A;  1SWS A;  3RDM A;  1VWH B;  1SRE A;  2IZE B;  4GDA A;  2OFB A;  5B5G A;  3RDU A;  4BX5 B;  1SRF A;  2RTI B;  4JO6 A;  2QCB A;  4BX7 B;  4CPH A;  1LCW A;  1RAV A;  1SRI A;  2CAM A;  3T6F A;  1N9Y A;  1KL3 A;  1MEP A;  1PTS A;  1SWR A;  4BCS A;  1VWG B;  2Y3F A;  1SWO A;  1DF8 A;  4BBO A;  2IZB A;  2RTH B;  5K67 A;  4IRW A;  4CPE A;  4BX6 A;  5F2B A;  3WYP A;  4Z28 A;  3PK2 A;  1VWI B;  3VHM A;  3MM0 A;  2IZG B;  3MG5 A;  4Y59 A;  2JGS A;  1Y55 X;  3SZI A;  3RY1 A;  2IZA A;  1STR B;  2Y32 A;  1RST B;  1STS B;  1SWT A;  4GD9 A;  4GGT A;  2A5C A;  4GJV A;  2IZK A;  1LCZ A;  1Y52 X;  1HQQ A;  2RTD B;  3SZJ A;  1SWE A;  1SWC A;  2FHN X;  1SWN A;  2WPU A;  4GJS A;  3RDO A;  1SWK A;  2A5B A;  3RDX A;  1KL4 A;  1VWR B;  2Y3E A;  1LDO A;  2RTM A;  3T6L A;  2UZ2 A;  1LCV A;  2IZH B;  1SWP A;  1HXL A;  4JHQ A;  5IRA A;  4Z27 A;  1AVD A;  1SWH A;  1LDQ A;  1VWB B;  2A8G A;  3FDC A;  2C1Q A;  1VWL B;  4CPH B;  2RTL A;  1VWO B;  5CHK A;  1NC9 A;  1RSU B;  1VWM B;  3RE5 A;  4BX7 A;  5K68 A;  2G5L A;  1VWN B;  2RTR B;  4BJ8 A;  1SWD A;  5IRU A;  1SWG A;  2IZD B;  1VWD B;  4GGZ A;  1I9H A;  3WZP A;  3SZH A;  1SWU A;  4BX6 B;  1SLD B;  5L3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...