2J06A

Crystal structure of the rasgap sh3 domain at 1.8 angstrom resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
61
structure length
61
Chain Sequence
MRRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High Resolution Crystal Structures of the P120 Rasgap SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signal transduction
molecule keywords RAS GTPASE-ACTIVATING PROTEIN 1
total genus 13
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2j06A00
2RQVA 2A28A 2ESWA 1JXMA 2HEQA 3VS6A 2O2OA 2LQNA 2L2PA 2DM1A 2K9GA 1WYXA 2GBQA 1W6XA 2LJ3A 5EC7A 4E6RA 1N5ZA 2FRWA 2KXCA 2MIOA 4J9IA 4Z88A 2RQWA 2FEIA 4LUEA 1I1JA 4J9FA 3EG0A 2D1XA 2JS2A 5HCKA 2CH4A 1AZEA 2EGCA 2O9SA 4RTXA 2QDLA 4OMOA 2A08A 2EGEA 2KXDA 1VYUA 1WFWA 1X69A 2HCKA 3EGUA 3REBB 5IHNA 1MUZA 1E7OA 2RPNA 1QKXA 2L3QA 2F2WA 2AZVA 1AWOA 3NHNA 1WXTA 4HVUA 2DRKA 1H92A 1M8MA 2HBWA 1K0XA 2DF6A 2J6OA 4RTUA 5GJWB 1U5SA 2JW4A 4WCIA 3THKA 4AG2C 4KRTA 2CT4A 2ED1A 1SPKA 1X2KA 4OMQA 1E6GA 1JEGA 3A98A 5IXBA 4Y92A 2DVJA 5FWCA 3R6NA 3SHWA 2YUOA 3LH5A 4AG1C 4DEXA 1EFNA 4CC4B 1KIKA 4OMLA 1H3HA 1RLPC 2BZXA 1VA7A 2O31A 2EBPA 1FYNA 2KBTA 2X3WD 1T0JA 2D0NA 3QWYA 4J9BA 1PWTA 1JU5C 4K11A 1UJYA 4LE9A 1K76A 1SHGA 2RQUA 1K1ZA 2GNCA 3TSZA 3FJ5A 1SRLA 1UE9A 1QCFA 1QWFA 2EYXA 1PRMC 1Z9QA 2DJQA 2L3PA 1JXOA 1QWEA 2DRMA 2ENMA 2J7IA 2EKHA 1BBZA 5FWBA 2K7AA 2RQRA 1Y0MA 2EYZA 1AOJA 5IXFA 2ROTA 5FW9A 2KYBA 4ESRA 4AFSC 2C0IA 3EG1A 1U06A 4AFUC 4Z89A 1K9AA 2HSPA 1B07A 3H0IA 3O5ZA 1UTIA 3PVLA 1UJ0A 2DILA 2J6KA 1WDXA 1NEBA 1OPLA 2D8HA 1ZLMA 2BTTA 2LJ0A 4IIMA 1RI9A 1GCQC 3M0SA 2KRSA 2L0AA 1CKBA 2W10A 3I35A 4LN2A 4JPBW 1YP5A 4F14A 1SHFA 2EYWA 1PRLC 2JXBA 4HXJA 4OMNA 3GBQA 1NYGA 3TSWA 1VYVA 2LX7A 3SEMA 4HVWA 1NLPC 4FSSA 1X27A 4J9HA 1HD3A 3VRZA 4D8DA 4LNPA 1BU1A 1X6GA 4JJBA 2O88A 2C0TA 1GBRA 2F2XA 1GCQA 2KYMA 2LZ6B 3H0FA 2KNBB 1OOTA 2J05A 2FRYA 1UG1A 2AKKA 1SEMA 4F16A 2KRNA 2EYYA 1AD5A 2DNUA 1UFFA 1MV3A 1AEYA 3UA6A 2JT4A 1PHTA 4J9CA 1W70A 3PVQA 2CT3A 4RUGA 1NLOC 2PNIA 1BK2A 2P4RA 3JV3A 1S1NA 3VS0A 2CSIA 4RTYA 4OMMA 1YWOA 4J9EA 2YUQA 3I9QA 4LUDA 2DBMA 2DL7A 2EGAA 3M0UA 2K79A 2V1RA 4JJCA 3TVTA 2FPFA 3NMZC 3PE0A 2DL5A 2JMCA 5IHKA 2FPDA 1PNJA 2IIMA 3QWXX 4DEYA 3C0CA 1QKWA 2LNHB 4CC3A 3VS1A 4A63B 1K0SA 1Z9ZA 1RLQC 2NWMA 1AWJA 1YNZA 2ROLA 3UA7A 4IIOA 2GTJA 2GTOA 2HDAA 4J9GA 4JJDA 1TUDA 3U23A 1ZBJA 2KROA 2OJ2A 3ULRB 3CQTA 3M0PA 5I11A 2CUDA 2W0ZA 4F17A 1ZSGA 4X1VA 3VS5A 3M0TA 1WXBA 1M3CA 2RMOA 2VVKA 4ZNXA 1ABQA 3H41A 4GBQA 3VS3A 1X2QA 1W1FA 1Y57A 1CKAA 1WX6A 3IQLA 1M3BA 2DL8A 1MV0B 1B3QA 1GRIA 2RF0A 1ZUKA 1OEBA 1UGVA 2EW3A 2BZYA 5GJVB 2FO0A 1AZGB 1PKSA 2K6DA 2LJ1A 1BB9A 2KT8A 4QT7A 1GFCA 2M51A 2DL4A 2KR3A 1HJDA 2EQIA 1ARKA 1VYTA 3RBBB 1J3TA 1PKTA 1TG0A 2J6FA 2A36A 2PZ1A 1X43A 4M4ZA 5L23A 5I22A 1GCPA 2DE0X 2RQTA 1WI7A 1LCKA 1ZUUA 1AVZC 3NGPA 2AKLA 3EHRA 3REAB 2YUPA 2RN8A 2RNAA 1FMKA 1KFZA 4RTTA 1UHFA 2K3BA 1GFDA 1G83A 2D8JA 2AZSA 5IH2A 2AK5A 4HCKA 2CSQA 4RTZA 2V1QA 2H8HA 4GLMA 3I5SA 3EHQA 1NM7A 3RNJA 1UECA 3VRYA 1NEGA 1QLYA 2K2MA 2ECZA 1WLPB 4AFQC 4R0KA 2KT1A 3UF4A 2NUZA 2KRMA 4D8KA 1JQQA 2OAWA 1ZUYA 1V1CA 2DX1A 2F2VA 2GGRA 4OMPA 2KEAA 1X6BA 3VS4A 4Z8AA 1YN8A 2PTKA 4EIKA 1SRMA 1OPKA 4RTVA 4CC2A 2FG0A 2JS0A 1T3LA 1UHCA 2O9VA 2DYBA 2OI3A 2X3XD 2EVRA 5ECAA 1H8KA 2JTEA 4AFZC 1SSHA 2CDTA 1WXUA 1TUCA 3EG3A 3NPFA 1G2BA 2FPEA 2SEMA 2YUNA 2DA9A 3EG2A 1KJWA 1GBQA 1M30A 2C0OA 2I0NA 3KFVA 1UDLA 1K4US 3H0HA 3UATA 2VWFA 1NYFA 3I5RA 2L3SA 1WA7A 2JMAA 1XOVA 1AWXA 1T3SA 1YWPA 2CUBA 5IHIA 1U3OA 1ZX6A 2EPDA 2LP5A 1OV3A 1HSQA 2G6FX 4ORZA 2LCSA 3VS2A 1GL5A 1IO6A 2MCNA 1M27C 2JM9A 4J9DA 2SRCA 2LMJA 2KGTA 2B86A 2E5KA 1I0CA 4JZ4A 1CSKA 2BZ8A 2DMOA 3VS7A 4CC7A 1RUWA 3M0QA 1E6HA 3M0RA 2M0YA 2YDLA 2YT6A 2MOXA 1A0NB 4HVVA 2DL3A 2DLPA 1T0HA 2GQIA 2CH4W 1M3AA 1AWWA 2KE9A 1ABOA 2VKNA 4RTWA 4JZ3A 1YCSB 1JO8A 1NG2A 2DBKA 2YSQA 2LQWA 2A37A 1KSWA 3ZL7C 2J06A 1WIEA 2ED0A 2JM8A 1UUEA 2CREA 2XMFA 2ABLA 1I07A
chains in the Genus database with same CATH superfamily
2KSSA 2A28A 1TSFA 1JXMA 3VS6A 2KAFA 2V26A 2K4YA 3WVEB 2GBQA 1YHQQ 4JS4A 2LJ3A 1VQPA 1V76A 1YFNA 5EC7A 1VQMQ 4FU6A 3A5ZB 2F5KA 3OSSC 3L2RA 1I1JA 2XICA 2GF7A 2LTOA 3P8HA 3EG0A 4M77C 1LVKA 4M7AA 5HCKA 1AZEA 2EGCA 2RJFA 1YJ9A 2WSFE 4RTXA 3LWHA 3VV0A 4Z02A 4ELZC 2K2VA 2QA4T 1WHMA 2HCKA 3EGUA 3LW5E 2IG0A 1YIJA 2Y90A 2Z0WA 3QG1A 5IHNA 5IN1A 1E7OA 1NPRA 1VQ9A 2CKKA 3G71Q 3CCET 3TEEA 1BIBA 2HBWA 2NUTB 1Q7YC 3CXCA 5GAMf 3JCMh 1TTHB 1KG1A 4DBHA 3QIIA 2J6OA 3I56T 1U5SA 3CCEA 3THKA 4HCBA 4AG2C 2HL3A 4Y91A 2FHDA 1I81A 4OMQA 2A0FB 5IXBA 1YBYA 4Y92A 2DVJA 4J6WA 2G3RA 4AG1C 4M7DC 1EFNA 5HY6A 2QTVA 2CZ7B 5GANj 2QTXA 4A4HA 1RLPC 1X6OA 3JCMd 3CCLA 1FYNA 2X3WD 1RACB 3I55Q 4J9BA 3CC2T 3CCJQ 4LD6A 1UJYA 4LE9A 2RQUA 4XTYA 2GNCA 2QAZA 2NUTA 1QWFA 5I2SA 4BE2A 4M75F 5FLXE 3QDRB 1JXOA 4KBMB 4HCZA 5GAMd 5CR2A 5D6WA 3A8LB 5FWBA 3JB9F 1Y0MA 2C06A 1AOJA 2XDPA 1M9SA 5KYUB 1BKBA 4C92G 1Q7YR 2C0IA 4C0DC 4JLGA 1WGSA 4Z89A 2Y4YA 5HKCA 1K9AA 1B07A 1UJ0A 2DILA 2J6KA 3M57A 1VQ4Q 2E1HA 2BTTA 1AHJB 4IIMA 1GCQC 2L0AA 4VUBA 2OTJT 3E9FA 4TVRA 1YP5A 2EYWA 3CC7Q 1VQKT 3ZFJA 4F7UA 1X27A 2JTMA 1HD3A 2RJEA 4D8DA 3CC2Q 3BFMA 1VQ4T 3GP8A 4JJBA 4N4GA 1GCQA 3QDFA 2COZA 4C5HA 2AKKA 5A2QE 4M7DA 1MV3A 5KCOA 5GAMj 5M9OA 3JCMQ 4BE1A 3OBYA 1NLOC 1WPYA 2KVQG 2V8KA 4M78D 5KCHA 4BACA 1PC0A 1W4SA 4RTYA 1VQMT 3T9NA 3RUXA 4PK4A 4KH0B 3I9QA 4LUDA 3OYDA 4JRKA 4PJOG 2P0KA 1S72A 2K5IA 4JRPA 1HYOA 4Y28E 2K79A 3JCMJ 4M7DB 1M90U 3M4GA 2VGMA 1VQKA 2K3XA 4JLIA 4KH1B 2DL5A 5IHKA 3GIBA 1BIAA 3OY9A 1FMVA 3QWXX 1WHGA 4DEYA 1QKWA 2LNHB 1Z9ZA 3INZA 5D6YA 4F04B 5GAMe 2HBPA 3M9QA 3UA7A 5J39A 3CMAT 1RL2A 3CC2A 1NE8A 7AT1B 1D3BB 3A8GB 1PD0A 1ZBJA 1U8RA 2OJ2A 4HKEA 3ZBDA 4QW2A 3M0PA 2O4XB 2QQ9A 2W0ZA 1YI2T 4F17A 3HSBA 4X1VA 4ZNXA 4M7DF 3VS3A 2M9UA 4IKFA 4C0DB 1Y57A 1CKAA 3A8MB 1WX6A 3HTRA 2QEXT 1TS9A 1OZ3A 1M3BA 3OS5A 5CKHA 3CCMA 1FMWA 1ZUKA 2EW3A 1C0MA 4KGVB 3CC7A 4ZGEB 5A0LA 1K8AC 2F69A 4PFOA 1PKSA 2DZ9A 3X24B 5GANg 3CCRQ 2Y4XA 1BI2A 2EQIA 1ARKA 2CZ0B 3OMGA 4UC4A 1TG0A 4A53A 3EH1A 1X43A 3V7SA 8AT1B 5I22A 1FWZA 1GCPA 2MK5A 3G4SA 3KXTA 1NJIC 1ZSZA 3J80E 1UHFA 1VQ7Q 2K3BA 4ANJA 1GFDA 4M75E 3EGXB 2KI7A 3X20B 1PCXA 2AK5A 2CS7A 4M7AB 4R56A 1UB4A 3M58A 3CC4Q 1YITA 4M7AE 4LDVA 2VGNA 1NM7A 3CMAQ 3SFMA 4KT0E 3UF4A 2FB7A 2VASA 5CAIA 3P8BB 2E12A 4C8QB 2HNIA 3D7SB 1V1CA 1VQ7T 1YHQA 2HSEB 5KYWA 2L3RA 2X4XA 2KEAA 1YN8A 5FRNA 4JRQA 5GMKe 2HD0A 1OPKA 4RTVA 2QG9B 3CCMQ 1Q95G 2FG0A 4N4IA 5FU6C 3MP6A 2JS0A 1UHCA 3M59A 3G6EQ 6AT1B 1H8KA 4OF1A 2JTEA 5CKFA 4AFZC 3C4SA 1G2BA 2FPEA 1Q86C 4DOWA 2PUKB 1GBQA 3JAME 2C0OA 3OYGA 1RAEB 2P4TA 2E65A 2ZPEB 2DXCA 4E7LA 3I56Q 3MEWA 1QVFP 2EQUA 4PNOA 4LDXA 1XOVA 2E3HA 4PJOF 1D0ZA 2JUFA 5FU6B 2E6NA 2MCNA 1VQNQ 2PU9B 4M77D 2LMJA 4C8QD 3E19A 5GMKj 1VQPQ 4JZ4A 2DMOA 4CC7A 1ZBXA 5LJ5j 3M55A 3M0RA 1MMDA 2OTLT 4O6JA 2M0YA 2YDLA 2YT6A 4HVVA 3V7CA 4MZMA 2QQRA 2VKNA 4RTWA 2EJFA 1RAFB 1Q82U 1YCSB 5GAOm 2E41A 5LJ3h 4M78G 4M7DG 4E47A 2A37A 4RG8A 4HCCA 4QKUA 1VQ4A 4X9CA 5LL6S 2XMFA 2ZPHB 2XIDA 4OGEA 1WNLA 3UT1A 4ME7A 2LQNA 2L2PA 4J6YA 4OB2B 2YXYA 1N5ZA 2FRWA 3OBWA 4GY5A 1OYXA 1EIFA 4M75B 3OYYA 3CCST 2MWPA 5AYFA 1WHKA 2O9SA 1Q81U 2QDLA 2A08A 2EGEA 2KXDA 1VYUA 3JCMf 1WFWA 1IREB 5DLQE 1G8XA 4L59A 3CMET 3LX7A 5EG2A 3OYKA 1TWBA 3CC4T 3A8HB 2RPNA 4B9WA 1M1GA 2L3QA 2BE7D 2F2WA 2IVWA 4J6XA 3NHNA 3UDCA 2DRKA 1H92A 3DB4A 3CCLQ 4FT2A 3JCMc 4FSXA 3TQ7P 2LX9A 5D7UA 1X2KA 3A98A 1TU0B 1BYMA 3R6NA 3SHWA 1KHIA 3LH5A 4RMOA 1BI3A 4CC4B 1KIKA 1W2BP 2WACA 1KC8R 4B6MA 1VA7A 2BIVA 2O31A 2EBPA 3CCLT 1OULA 2KBTA 2XHCA 1T0JA 2D0NA 1IGUA 2RM4A 1I4K1 2X35A 4C8QC 1K1ZA 3S3NA 2QK0A 1OX9A 3MEAA 1UGSB 1IHVA 5GAN3 5J26A 2DIQA 1QCFA 1PRMC 2DJQA 2L3PA 4E7SA 1PSFA 1RADB 4HA8A 2MPXC 3JCMV 2J7IA 1OX8A 2E5QA 1D1CA 4M78E 1WZOA 2FL7A 5A0GA 4PJNA 1NBEB 4FYWB 3JCMe 2RO0A 4J5YA 2EYZA 5IXFA 2ROTA 1RAGB 1Q81R 3QZ5B 4ESRA 5KYYB 1MNEA 2PVDB 3CCVA 2HSPA 3H0IA 3O5ZA 2KMTA 3QJYA 3OW2A 2VB6A 3G71T 1OPLA 2D8HA 2LDMA 4PJMA 2EQJA 2YLCA 1RI9A 3SDZA 2KRSA 4LN2A 4FIBA 1VQ9Q 4JPBW 3FDRA 4F14A 4NL3A 5L8RE 1FX7A 1D0XA 1PRLC 4OMNA 3AT1B 4HT8A 1ZA1B 3TSWA 1VYVA 4P5NA 4HVWA 1NLPC 3A8OB 4FSSA 3FC3A 1H641 3DB3A 4BUGA 5I21A 2AT1B 5KYXA 5LJ3j 2D0QB 1GBRA 3OS0A 2MAMA 2KNBB 1N8RC 5CKBA 3LGFA 1VQMA 5CQXA 1TXQA 1SEMA 2EYYA 2K57A 3SB2A 4PLIA 3J7AF 2DERA 2JT4A 3C94A 3V8LA 4XU0A 1N6AA 1QVGS 1XJWB 3CCSA 2LRQA 4C8QA 2PNIA 1VQKQ 2WSEE 3FB9A 5GAOp 1MMGA 4C92E 4E7JA 3KUFA 5KYWB 3VS0A 2CSIA 1ZSZB 4HT9A 4OMMA 4PKCC 2YUQA 1QVGA 3MEVA 2QQBA 1UGPB 3AHUA 1YJNA 1LOJA 4IUUA 1X75C 1VQ9T 4C0GA 3OS2A 1VUBA 4II1A 2H3EB 1VQOQ 4M75A 4XTWA 3CMEA 5IAYA 1K73C 1QMCA 3C0CA 1UGQB 3OYAA 4A63B 4M78B 1RLQC 2QA4A 2DKGA 3UWNA 4C8QF 2RD1A 4BI3A 1K9MU 2GTOA 3G6ET 1B7TA 3U23A 1JB0E 1YJNQ 3CQTA 5I11A 2KDSA 2CUDA 4WF2A 4OB3B 3VS5A 1QVPA 3M0TA 3GOXA 1VQ7A 3EFSA 2E10A 1M3CA 3MP8A 4E7IA 1ABQA 4GBQA 4J83A 3GNGA 1W1FA 1KQSA 3IQLA 2DTOA 2GCXA 1GRIA 3OA6A 2HKNA 2DXTA 3EFOB 1O9SA 5LJ3g 3ER0A 4M78A 2GFUA 4BE0A 1K73U 1AZGB 5KH6A 4OP0A 4FYXB 2DAQA 3VYHB 2JOYA 1D0YA 1BB9A 1C6VX 2DL4A 1VQ5T 4OMFB 3OYMA 1VYTA 3RBBB 1J3TA 1PKTA 2J6FA 2A36A 4A4GA 2DD4A 2QASA 4J7FA 5L23A 1G3TA 1YITQ 2DE0X 1N27A 1K9MR 2RQTA 4FCYA 1WI7A 1LCKA 3PGGA 1AVZC 2AKLA 3EHRA 3H6ZA 2YUPA 4IUTA 4IUPA 2XK0A 2O4XA 1FMKA 4RTTA 1VQLT 2BE9B 3ASKA 2IPOB 3VYGA 5LJ3e 5CKEA 2P84A 2AZSA 5IH2A 1G3YA 4RTZA 2JNGA 1OU8A 2V1QA 4GLMA 3I5SA 4PJOB 1G3SA 5KYYA 1UECA 1NEGA 3L2WA 3X28B 4AFQC 4PJJA 2EQMA 1KC8U 2KRMA 4D8KA 2OAWA 2E64A 4PL6A 2QQSA 3EGXA 1OZ2A 1YI2A 2A7YA 3HKSA 2JN0A 4QQ6A 5GANe 1VQ8T 4C92B 2PTKA 4M7DE 4EIKA 3FRNA 4C92D 5GANh 2X9HA 4DBFA 4CC2A 4KUDK 3X26B 5GAN8 3OYIA 5GAMg 2EVRA 5ECAA 4EPCA 3OYLA 2X51A 5FU7B 1VQ5Q 1TUCA 3NPFA 4M75G 3CCRT 3CXCS 1KJWA 4FM4B 1MGQA 2I0NA 4IUQA 1VQ8Q 1UDLA 3H0HA 2NUPB 3I5RA 3TU4K 1T3SA 4FYYB 1U3OA 2R5AA 3PMIA 3HP9A 2LCSA 2MWOA 1M5Q1 2ZCFB 1M2VB 2LVMA 4CRIA 4J9DA 3RMSA 3MEUA 2EIFA 2RHIA 3JCMX 1IZ6A 4PJOC 1KQ1A 4MZTA 1M1FA 3M0QA 4C0ZA 2XI9A 3LLRA 4X34A 5FRMA 1A0NB 3OW2P 3PIOA 3X25B 3RERA 2QEXQ 4IURA 2CH4W 1M3AA 1VIEA 1ABOA 1K8AR 1NG2A 2DBKA 4JRIA 3MO8A 3A1PA 2J06A 2ED0A 2DEQA 3CCMT 2JM8A 1TUGB 2ABLA 3GPLA 4RCBA 2RQVA 2ESWA 2HEQA 2CZ6B 2O2OA 4XU3A 2DTHA 4F7UF 4C0FA 3JCMW 4E6RA 2EWNA 2KXCA 3L1AA 4ZTFA 2MIOA 1WHLA 2OTJA 3P8DA 4LUEA 4YTLA 4J9FA 1JRIA 3WXMB 2D1XA 3PNWC 1MHNA 2JS2A 1R0CB 3CCQQ 2CH4A 2B8AA 4XTZA 1YI2Q 1M1KC 2DJZA 2OTLA 4BI4A 4OB0B 3CCUT 1N8RU 1X69A 3REBB 3DKMA 3NTIA 4C92C 2KY9A 1VQNT 1IB8A 3RIRA 1QKXA 1AWOA 1RAHB 2AZVA 3CCVQ 2QDYB 1WXTA 1Q81C 1YJNT 2RHXA 4XU2A 5CIUA 1YITT 1K0XA 3CD6T 1SG5A 1XNIA 1SKUB 3QBYA 3PTAA 2VC8A 1X01A 2JW4A 4KRTA 1SPKA 2JZ2A 1C1AA 3BE3A 1E6GA 1UEBA 4KGZB 3CC4A 5FWCA 3EH2A 2YUOA 4C5EA 4DEXA 2M1HA 4E2FB 1KD1C 4V2SA 2CZ1B 4L6V5 2BZXA 1R0BG 5GAOl 2CP6A 1KQSP 3URGA 3PIPA 2M02A 4BDYA 2DIGA 1PWTA 5LJ5g 1WQ7A 1K76A 4JDSA 4LDYA 1ACMB 2K5LA 1VQ8A 1Y07A 4C8QE 4CI0C 4XU1A 3FJ5A 4PJOD 3BY7A 3NTKA 1QWEA 4EMKB 2PVOB 2RK1A 1Y96A 3CCJA 4XTXA 3SWNA 2EKHA 1TOVA 3ME9A 4M77F 5DLOA 1BBZA 2K7AA 2RHYA 3CBOA 2P0QA 2KYBA 1IHWA 4AFSC 1PD1A 2OTLQ 1U06A 1VQLQ 3WVDB 5LJ3f 1SSFA 4JJNK 1UTIA 2BUDA 3PVLA 4DBRA 1YCYA 1QW1A 1VQ6T 3PT9A 1KK7A 3FEOA 1ZLMA 1FXXA 2LJ0A 4M7AF 3DLMA 2RJCA 3HRTA 3M0SA 1ZSZC 5GAOq 2DETA 2YWWA 5KE2A 1SHFA 4M75C 2JXBA 3SWNB 2EYQA 3GBQA 2YRVA 3M56A 2CP2A 2LX7A 5GAN7 3M53A 5DY9A 4LDWA 4J9HA 2RHZA 1NJIR 3VRZA 2XKOC 3C95A 1H3ZA 1OI1A 1BU1A 2GQVA 3DLLA 2C0TA 3HL8A 2F2XA 2LQ8A 4E7HA 2LZ6B 2ZPIB 3CPWP 4N0AC 2J05A 2FRYA 1QVGP 1QVFA 1I5LA 2KRNA 1VQOA 2DNUA 3VUBA 2LCCA 3VU3C 3EFRA 4BD3A 1PHTA 4EMKC 2EQKA 1Q7YU 3QXEB 1N9RA 4RUGA 2LNVA 2LT1A 1SF9A 1BK2A 3JB9I 3OYJA 1D3BA 1YWOA 2DBMA 2AIRB 2R5MA 3HRUA 1B34B 2EGAA 2NLUA 2CP7A 2R57A 4GLKA 1LPLA 3JB9H 3M0UA 1NPPA 2HQEA 1Q82C 1GXIE 5KYXB 2DD5A 2V1RA 4JJCA 1IGQA 3NMZC 2JMCA 2RI5A 2LT4A 1S72Q 1KD1U 1PNJA 2IIMA 1LNXA 1K9MC 1QP3A 4CC3A 1KQSS 3VS1A 1K0SA 1K8AU 3OYCA 2NWMA 3M54A 2EJ9A 2ROLA 2GTJA 4DA4A 4NS5A 2HDAA 2DVEA 4J9GA 2QXFA 1XTDA 2VV5A 4AMCA 3ULRB 1BCOA 2L89A 3OSVA 5HK0A 1M2VA 1VQ5A 3QUIA 1WJSA 3OB9A 3H41A 4QVZA 3RR6A 1X2QA 3BW1A 2FZCB 4J8OA 4MDWA 4QQGA 2JVVA 4XTVA 2ZPBB 1Q86U 5GAMh 2FVUA 5GANd 4M77G 3JCMP 4N0AA 4MZPA 3JB9G 2LQKA 3CCUQ 2K6DA 5LJ5d 1Q82R 2KT8A 1GFCA 2M51A 2K3YA 4C92F 3J81E 4M77E 2QQAA 1M8VA 2PZ1A 5GMKm 4E7KA 1ZUUA 2FZGB 3CBMA 3NGPA 1RABB 4BB7A 8ATCB 2RNAA 1VQOT 1KFZA 1G3WA 3G4SQ 2D8JA 5LJ5e 1NZ9A 2MYSA 4HCKA 3S3MA 2RB6A 5GANf 3EHQA 3HFOA 4M7AC 3VRYA 4NOYA 1PM3A 1WLPB 4R0KA 3Q1JA 3CEYA 5LJ5f 2XD0A 3EGDA 3VJPA 3E2UA 3CCRA 3I55A 2F2VA 3QPHA 2X4WA 3CCQT 3JCMg 2VUBA 3CCUA 4L5GA 1SRMA 3QZ9B 4LD9K 1YJ9T 3MP1A 3G71A 4R55A 2O9VA 3L2UA 1QVFS 2ZZDA 2DYBA 2OI3A 1WJQA 2ATCB 1QQJA 3EG3A 2E70A 2SEMA 2YUNA 3CPWS 5IT9E 3BDLA 1MMNA 2I2LA 5GAN2 3KFVA 3QO3A 1P92A 1K4US 5FU7C 3UATA 3R6OA 2CGHA 2E4HA 1WA7A 2JMAA 1R8OB 5IHIA 1AWXA 1YWPA 4EMHA 2QGGA 4PJOA 1AT1B 1HK9A 3CD6A 2V8JA 4E7ZA 2QA4Q 1JJ2P 2PVGB 3VS2A 2G6FX 3TCJA 3RDVA 2QEXA 1GL5A 1RI0A 1Y7XA 3L2QA 1M27C 2JM9A 1YJWT 2XDBA 3OQ5A 2B86A 2E5KA 1BI1A 2HQXA 5CO7A 3VS7A 5AT1B 3MPUB 1E6HA 1O75A 3PMTA 2MOXA 4ZN1A 2PQWA 2DL3A 3LH0A 1M4ZA 2MF2A 1B34A 4M7DD 4LXCA 1EX4A 4C5GA 2DPPB 3LGLA 5KE3A 1KQ2A 2OTJQ 2F1LA 3I56A 1BCMA 3EG9B 2RK2A 1KSWA 2DTIA 3RMQA 1Y96B 1UUEA 2CREA 4QQDA 2LCLA 3JB9J 4BY6B 2BKDN 1I07A 3G1JA 1I5OB 4A4EA 2RH2A 2RHUA 2DM1A 2K9GA 2QGFB 1WYXA 1PG5B 1WQWA 1W6XA 1VQNA 2V8IA 1VOMA 2XDDA 2M16A 2VYTA 4AT1B 4J9IA 1LJOA 4Z88A 2RQWA 2FEIA 3MCAB 4M7AD 1M90R 2E6ZA 1TH7A 2YLBA 2HKQB 1VQ6A 4OMOA 2OX7A 4KUIA 3SD4A 2D9TA 3CCVT 2FYKA 4JUVA 1EZZB 1YJWQ 2X4YA 3CD6Q 2CP0A 3JRZA 1MUZA 4X9DA 4HVUA 1M8MA 5CQYA 1W2BS 4J7IA 2COWA 2DF6A 4PFZA 4RTUA 5GJWB 3PFSA 4WCIA 1Y71A 2CT4A 2ED1A 1ZHIA 1JEGA 2WSCE 3E1SA 1R77A 4BDZA 4MMLA 2DEUA 3CBPA 2DXUA 4OMLA 1H3HA 5LJ3d 3H9NA 3FIFA 2CP5A 2EAYA 4A4FA 4XAXB 3QWYA 4A54A 3G6EA 2YRCA 3H8ZA 1JU5C 3CXCP 4K11A 1SHGA 3NFCA 5CK9A 3META 3TSZA 1YIJQ 5KYUA 2YRDA 3HHTB 3HPWA 4WTOB 1SRLA 1OU9A 1UE9A 3RKXA 2EYXA 1Z9QA 1U1TA 2DRMA 2ENMA 2DXBA 4B9XA 1F1BB 4M78C 1XQHA 4FW2A 4QVCA 3EAEA 2RQRA 4ZGJB 1UGRB 5FW9A 4OVAA 3V8KA 1YIJT 1JBMA 3HRSA 3EG1A 3TREA 5GMKh 4AFUC 5GAOn 4ELYC 3E9GA 4EMKA 4KGXB 1WDXA 4PJOE 2EJGA 1NEBA 5GAN5 4C5IA 2HZYA 3FLGA 5FROA 1W2BA 3RKYA 1CKBA 2W10A 3I35A 3S6WA 4XQ3A 2QI2A 1VIFA 1D1AA 3OYHA 2ZPFB 5GMKl 4HXJA 3QYHB 1NYGA 3MHXA 3LYIA 2DK3A 3SEMA 1NJIU 3MJXA 5GAN6 4M77A 4M78F 2DO3A 4LNPA 2JTFA 3JB9D 1PSEA 1X6GA 3CC7T 2O88A 4FL6A 4D6WA 2E3IA 5C6SA 3CCEQ 5D6XA 4RKUE 5KYNA 2KYMA 3H0FA 3BDUA 4RG2A 1OOTA 2RI2A 1UG1A 2M0OA 4OGCA 4F16A 4O5VA 1AD5A 2RI3A 3MKDA 1VQ6Q 1UFFA 1AEYA 1WHJA 1QCNA 3UA6A 3OYNA 4J9CA 2CP3A 1W70A 1JJ2S 2HQHA 3PVQA 2CT3A 4ZTJA 1RAIB 2X4JA 2F5TX 2P4RA 3JV3A 1JJ2A 1S1NA 9ATCB 5LJ5h 3CCQA 5C0MA 4J9EA 1YHQT 2NYSA 3QYGB 2DL7A 1D09B 4MDXA 3QHSA 2MI6A 2XG8D 4Q5WA 3JCMb 4MMKA 4N4HA 3TVTA 1KD1R 2FPFA 5J3BA 3PE0A 1KC8C 2VXFA 5CKDA 3RKWA 2FPDA 5CCAA 2JJ9A 2P0PA 2ZGWA 1G5VA 3VUZA 2L8DA 3SWNC 1AWJA 3GF5A 1YNZA 1ZA2B 4IIOA 3VKIA 2HAXA 4FT4A 4JJDA 1TUDA 3NTHA 2KROA 3GLXA 1ZSGA 2NUPA 2DYIA 1WXBA 2AHJB 2RMOA 2VVKA 3CPFA 4F7UB 2DZCA 2DL8A 1MV0B 1B3QA 3G7ZA 2RF0A 1OEBA 1DJ7B 1U1SA 1UGVA 2KQWA 2BZYA 3O8VA 4F7UG 3CPWA 5GJVB 2DFUA 3L42A 4OB1B 2FO0A 4NL2A 4PFPA 2LJ1A 4DOVA 3V7RA 5DM7R 4EDUA 1VQLA 1KHCA 4F7UE 4QT7A 3L2VA 4FYVB 2KR3A 3V8JA 3QSUA 1HJDA 2RA2A 4M4ZA 1D1BA 2ZPGB 3M4YA 4ZN3A 3REAB 1MMAA 2RN8A 4C92A 2HMAA 3RESA 3LWIA 2PUOB 3EFOA 2QYZA 1G83A 1M1KR 1IXDA 4XTUA 1VQPT 2XU8A 3GNFB 2CSQA 3L2ZA 2CYZB 5GMKi 1N8RR 3EG9A 2H8HA 3QKJA 2K5FA 3N5BB 2HL5C 3RNJA 4IUVA 1QLYA 2K2MA 3CCJT 2ECZA 1M2OA 2KT1A 1WHHA 2NUZA 1WJRA 2GFAA 1JQQA 1MNDA 4A4KA 4LDUA 1ZUYA 2DX1A 1I8FA 2ZAEA 2GGRA 2O01E 4OMPA 1X6BA 3VS4A 4Z8AA 4DBQA 2COYA 5CVIA 1T3LA 3CMAA 3G4ST 1QP2A 2X3XD 2LC4A 3UPUA 3OS1A 1SSHA 4M77B 2CDTA 1WXUA 1IRXA 3I55T 1M1KU 1YJWA 2DA9A 3EG2A 1M30A 2FZKB 2RJDA 2EKOA 2VWFA 1NYFA 2L3SA 4ZGDB 4PJLA 2CUBA 2MMPA 1K73R 4JS5A 4FW1A 4ATOA 1ZX6A 4BY6C 2EPDA 2LP5A 1OV3A 1HSQA 2H3JA 4ORZA 2KK4A 1ZQ1A 1M90C 4XK8E 1IO6A 3FJPA 3HFNA 2EFIA 3OW2S 3EGDB 3CMEQ 2SRCA 2A3LA 4PLLA 2KGTA 1YJ9Q 4DQ2A 1RAAB 2R58A 1I0CA 3OYBA 1CSKA 2BZ8A 1HXDA 5I2MA 3ZEHA 1RUWA 5GAOr 4M7AG 4EMGA 2D6FA 4KULA 4C8QG 4QVDA 2L5QA 1N9SA 2YHTA 3KBGA 3C12A 3CCSQ 3M5AA 1QCOA 3F70A 2DLPA 1T0HA 2GQIA 4RCCA 2VXEA 5A0DA 2KE9A 1AWWA 3OMCA 4JZ3A 4BI8B 4M75D 1JO8A 3JSCA 1V29B 5HK3A 2OAUA 2YSQA 3OYEA 2LQWA 1OQKA 3ZL7C 1WIEA 3OYFA 1Q86R 3QJ6A 5GAN4 1BI0A 3S3OA 1S72T
chains in the Genus database with same CATH topology
2RQVA 2A28A 2ESWA 1JXMA 2HEQA 3VS6A 2O2OA 2LQNA 2L2PA 2DM1A 2K9GA 1WYXA 2GBQA 1W6XA 2LJ3A 5EC7A 4E6RA 1N5ZA 2FRWA 2KXCA 2MIOA 4J9IA 4Z88A 2RQWA 2FEIA 4LUEA 1I1JA 4J9FA 3EG0A 2D1XA 2JS2A 5HCKA 2CH4A 1AZEA 2EGCA 2O9SA 4RTXA 2QDLA 4OMOA 2A08A 2EGEA 2KXDA 1VYUA 1WFWA 1X69A 2HCKA 3EGUA 3REBB 5IHNA 1MUZA 1E7OA 2RPNA 1QKXA 2L3QA 2F2WA 2AZVA 1AWOA 3NHNA 1WXTA 4HVUA 2DRKA 1H92A 1M8MA 2HBWA 1K0XA 2DF6A 2J6OA 4RTUA 5GJWB 1U5SA 2JW4A 4WCIA 3THKA 4AG2C 4KRTA 2CT4A 2ED1A 1SPKA 1X2KA 4OMQA 1E6GA 1JEGA 3A98A 5IXBA 4Y92A 2DVJA 5FWCA 3R6NA 3SHWA 2YUOA 3LH5A 4AG1C 4DEXA 1EFNA 4CC4B 1KIKA 4OMLA 1H3HA 1RLPC 2BZXA 1VA7A 2O31A 2EBPA 1FYNA 2KBTA 2X3WD 1T0JA 2D0NA 3QWYA 4J9BA 1PWTA 1JU5C 4K11A 1UJYA 4LE9A 1K76A 1SHGA 2RQUA 1K1ZA 2GNCA 3TSZA 3FJ5A 1SRLA 1UE9A 1QCFA 1QWFA 2EYXA 1PRMC 1Z9QA 2DJQA 2L3PA 1JXOA 1QWEA 2DRMA 2ENMA 2J7IA 2EKHA 1BBZA 5FWBA 2K7AA 2RQRA 1Y0MA 2EYZA 1AOJA 5IXFA 2ROTA 5FW9A 2KYBA 4ESRA 4AFSC 2C0IA 3EG1A 1U06A 4AFUC 4Z89A 1K9AA 2HSPA 1B07A 3H0IA 3O5ZA 1UTIA 3PVLA 1UJ0A 2DILA 2J6KA 1WDXA 1NEBA 1OPLA 2D8HA 1ZLMA 2BTTA 2LJ0A 4IIMA 1RI9A 1GCQC 3M0SA 2KRSA 2L0AA 1CKBA 2W10A 3I35A 4LN2A 4JPBW 1YP5A 4F14A 1SHFA 2EYWA 1PRLC 2JXBA 4HXJA 4OMNA 3GBQA 1NYGA 3TSWA 1VYVA 2LX7A 3SEMA 4HVWA 1NLPC 4FSSA 1X27A 4J9HA 1HD3A 3VRZA 4D8DA 4LNPA 1BU1A 1X6GA 4JJBA 2O88A 2C0TA 1GBRA 2F2XA 1GCQA 2KYMA 2LZ6B 3H0FA 2KNBB 1OOTA 2J05A 2FRYA 1UG1A 2AKKA 1SEMA 4F16A 2KRNA 2EYYA 1AD5A 2DNUA 1UFFA 1MV3A 1AEYA 3UA6A 2JT4A 1PHTA 4J9CA 1W70A 3PVQA 2CT3A 4RUGA 1NLOC 2PNIA 1BK2A 2P4RA 3JV3A 1S1NA 3VS0A 2CSIA 4RTYA 4OMMA 1YWOA 4J9EA 2YUQA 3I9QA 4LUDA 2DBMA 2DL7A 2EGAA 3M0UA 2K79A 2V1RA 4JJCA 3TVTA 2FPFA 3NMZC 3PE0A 2DL5A 2JMCA 5IHKA 2FPDA 1PNJA 2IIMA 3QWXX 4DEYA 3C0CA 1QKWA 2LNHB 4CC3A 3VS1A 4A63B 1K0SA 1Z9ZA 1RLQC 2NWMA 1AWJA 1YNZA 2ROLA 3UA7A 4IIOA 2GTJA 2GTOA 2HDAA 4J9GA 4JJDA 1TUDA 3U23A 1ZBJA 2KROA 2OJ2A 3ULRB 3CQTA 3M0PA 5I11A 2CUDA 2W0ZA 4F17A 1ZSGA 4X1VA 3VS5A 3M0TA 1WXBA 1M3CA 2RMOA 2VVKA 4ZNXA 1ABQA 3H41A 4GBQA 3VS3A 1X2QA 1W1FA 1Y57A 1CKAA 1WX6A 3IQLA 1M3BA 2DL8A 1MV0B 1B3QA 1GRIA 2RF0A 1ZUKA 1OEBA 1UGVA 2EW3A 2BZYA 5GJVB 2FO0A 1AZGB 1PKSA 2K6DA 2LJ1A 1BB9A 2KT8A 4QT7A 1GFCA 2M51A 2DL4A 2KR3A 1HJDA 2EQIA 1ARKA 1VYTA 3RBBB 1J3TA 1PKTA 1TG0A 2J6FA 2A36A 2PZ1A 1X43A 4M4ZA 5L23A 5I22A 1GCPA 2DE0X 2RQTA 1WI7A 1LCKA 1ZUUA 1AVZC 3NGPA 2AKLA 3EHRA 3REAB 2YUPA 2RN8A 2RNAA 1FMKA 1KFZA 4RTTA 1UHFA 2K3BA 1GFDA 1G83A 2D8JA 2AZSA 5IH2A 2AK5A 4HCKA 2CSQA 4RTZA 2V1QA 2H8HA 4GLMA 3I5SA 3EHQA 1NM7A 3RNJA 1UECA 3VRYA 1NEGA 1QLYA 2K2MA 2ECZA 1WLPB 4AFQC 4R0KA 2KT1A 3UF4A 2NUZA 2KRMA 4D8KA 1JQQA 2OAWA 1ZUYA 1V1CA 2DX1A 2F2VA 2GGRA 4OMPA 2KEAA 1X6BA 3VS4A 4Z8AA 1YN8A 2PTKA 4EIKA 1SRMA 1OPKA 4RTVA 4CC2A 2FG0A 2JS0A 1T3LA 1UHCA 2O9VA 2DYBA 2OI3A 2X3XD 2EVRA 5ECAA 1H8KA 2JTEA 4AFZC 1SSHA 2CDTA 1WXUA 1TUCA 3EG3A 3NPFA 1G2BA 2FPEA 2SEMA 2YUNA 2DA9A 3EG2A 1KJWA 1GBQA 1M30A 2C0OA 2I0NA 3KFVA 1UDLA 1K4US 3H0HA 3UATA 2VWFA 1NYFA 3I5RA 2L3SA 1WA7A 2JMAA 1XOVA 1AWXA 1T3SA 1YWPA 2CUBA 5IHIA 1U3OA 1ZX6A 2EPDA 2LP5A 1OV3A 1HSQA 2G6FX 4ORZA 2LCSA 3VS2A 1GL5A 1IO6A 2MCNA 1M27C 2JM9A 4J9DA 2SRCA 2LMJA 2KGTA 2B86A 2E5KA 1I0CA 4JZ4A 1CSKA 2BZ8A 2DMOA 3VS7A 4CC7A 1RUWA 3M0QA 1E6HA 3M0RA 2M0YA 2YDLA 2YT6A 2MOXA 1A0NB 4HVVA 2DL3A 2DLPA 1T0HA 2GQIA 2CH4W 1M3AA 1AWWA 2KE9A 1ABOA 2VKNA 4RTWA 4JZ3A 1YCSB 1JO8A 1NG2A 2DBKA 2YSQA 2LQWA 2A37A 1KSWA 3ZL7C 2J06A 1WIEA 2ED0A 2JM8A 1UUEA 2CREA 2XMFA 2ABLA 1I07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQV A;  2A28 A;  2ESW A;  1JXM A;  2HEQ A;  3VS6 A;  2O2O A;  2LQN A;  2L2P A;  2DM1 A;  2K9G A;  1WYX A;  2GBQ A;  1W6X A;  2LJ3 A;  5EC7 A;  4E6R A;  1N5Z A;  2FRW A;  2KXC A;  2MIO A;  4J9I A;  4Z88 A;  2RQW A;  2FEI A;  4LUE A;  1I1J A;  4J9F A;  3EG0 A;  2D1X A;  2JS2 A;  5HCK A;  2CH4 A;  1AZE A;  2EGC A;  2O9S A;  4RTX A;  2QDL A;  4OMO A;  2A08 A;  2EGE A;  2KXD A;  1VYU A;  1WFW A;  1X69 A;  2HCK A;  3EGU A;  3REB B;  5IHN A;  1MUZ A;  1E7O A;  2RPN A;  1QKX A;  2L3Q A;  2F2W A;  2AZV A;  1AWO A;  3NHN A;  1WXT A;  4HVU A;  2DRK A;  1H92 A;  1M8M A;  2HBW A;  1K0X A;  2DF6 A;  2J6O A;  4RTU A;  5GJW B;  1U5S A;  2JW4 A;  4WCI A;  3THK A;  4AG2 C;  4KRT A;  2CT4 A;  2ED1 A;  1SPK A;  1X2K A;  4OMQ A;  1E6G A;  1JEG A;  3A98 A;  5IXB A;  4Y92 A;  2DVJ A;  5FWC A;  3R6N A;  3SHW A;  2YUO A;  3LH5 A;  4AG1 C;  4DEX A;  1EFN A;  4CC4 B;  1KIK A;  4OML A;  1H3H A;  1RLP C;  2BZX A;  1VA7 A;  2O31 A;  2EBP A;  1FYN A;  2KBT A;  2X3W D;  1T0J A;  2D0N A;  3QWY A;  4J9B A;  1PWT A;  1JU5 C;  4K11 A;  1UJY A;  4LE9 A;  1K76 A;  1SHG A;  2RQU A;  1K1Z A;  2GNC A;  3TSZ A;  3FJ5 A;  1SRL A;  1UE9 A;  1QCF A;  1QWF A;  2EYX A;  1PRM C;  1Z9Q A;  2DJQ A;  2L3P A;  1JXO A;  1QWE A;  2DRM A;  2ENM A;  2J7I A;  2EKH A;  1BBZ A;  5FWB A;  2K7A A;  2RQR A;  1Y0M A;  2EYZ A;  1AOJ A;  5IXF A;  2ROT A;  5FW9 A;  2KYB A;  4ESR A;  4AFS C;  2C0I A;  3EG1 A;  1U06 A;  4AFU C;  4Z89 A;  1K9A A;  2HSP A;  1B07 A;  3H0I A;  3O5Z A;  1UTI A;  3PVL A;  1UJ0 A;  2DIL A;  2J6K A;  1WDX A;  1NEB A;  1OPL A;  2D8H A;  1ZLM A;  2BTT A;  2LJ0 A;  4IIM A;  1RI9 A;  1GCQ C;  3M0S A;  2KRS A;  2L0A A;  1CKB A;  2W10 A;  3I35 A;  4LN2 A;  4JPB W;  1YP5 A;  4F14 A;  1SHF A;  2EYW A;  1PRL C;  2JXB A;  4HXJ A;  4OMN A;  3GBQ A;  1NYG A;  3TSW A;  1VYV A;  2LX7 A;  3SEM A;  4HVW A;  1NLP C;  4FSS A;  1X27 A;  4J9H A;  1HD3 A;  3VRZ A;  4D8D A;  4LNP A;  1BU1 A;  1X6G A;  4JJB A;  2O88 A;  2C0T A;  1GBR A;  2F2X A;  1GCQ A;  2KYM A;  2LZ6 B;  3H0F A;  2KNB B;  1OOT A;  2J05 A;  2FRY A;  1UG1 A;  2AKK A;  1SEM A;  4F16 A;  2KRN A;  2EYY A;  1AD5 A;  2DNU A;  1UFF A;  1MV3 A;  1AEY A;  3UA6 A;  2JT4 A;  1PHT A;  4J9C A;  1W70 A;  3PVQ A;  2CT3 A;  4RUG A;  1NLO C;  2PNI A;  1BK2 A;  2P4R A;  3JV3 A;  1S1N A;  3VS0 A;  2CSI A;  4RTY A;  4OMM A;  1YWO A;  4J9E A;  2YUQ A;  3I9Q A;  4LUD A;  2DBM A;  2DL7 A;  2EGA A;  3M0U A;  2K79 A;  2V1R A;  4JJC A;  3TVT A;  2FPF A;  3NMZ C;  3PE0 A;  2DL5 A;  2JMC A;  5IHK A;  2FPD A;  1PNJ A;  2IIM A;  3QWX X;  4DEY A;  3C0C A;  1QKW A;  2LNH B;  4CC3 A;  3VS1 A;  4A63 B;  1K0S A;  1Z9Z A;  1RLQ C;  2NWM A;  1AWJ A;  1YNZ A;  2ROL A;  3UA7 A;  4IIO A;  2GTJ A;  2GTO A;  2HDA A;  4J9G A;  4JJD A;  1TUD A;  3U23 A;  1ZBJ A;  2KRO A;  2OJ2 A;  3ULR B;  3CQT A;  3M0P A;  5I11 A;  2CUD A;  2W0Z A;  4F17 A;  1ZSG A;  4X1V A;  3VS5 A;  3M0T A;  1WXB A;  1M3C A;  2RMO A;  2VVK A;  4ZNX A;  1ABQ A;  3H41 A;  4GBQ A;  3VS3 A;  1X2Q A;  1W1F A;  1Y57 A;  1CKA A;  1WX6 A;  3IQL A;  1M3B A;  2DL8 A;  1MV0 B;  1B3Q A;  1GRI A;  2RF0 A;  1ZUK A;  1OEB A;  1UGV A;  2EW3 A;  2BZY A;  5GJV B;  2FO0 A;  1AZG B;  1PKS A;  2K6D A;  2LJ1 A;  1BB9 A;  2KT8 A;  4QT7 A;  1GFC A;  2M51 A;  2DL4 A;  2KR3 A;  1HJD A;  2EQI A;  1ARK A;  1VYT A;  3RBB B;  1J3T A;  1PKT A;  1TG0 A;  2J6F A;  2A36 A;  2PZ1 A;  1X43 A;  4M4Z A;  5L23 A;  5I22 A;  1GCP A;  2DE0 X;  2RQT A;  1WI7 A;  1LCK A;  1ZUU A;  1AVZ C;  3NGP A;  2AKL A;  3EHR A;  3REA B;  2YUP A;  2RN8 A;  2RNA A;  1FMK A;  1KFZ A;  4RTT A;  1UHF A;  2K3B A;  1GFD A;  1G83 A;  2D8J A;  2AZS A;  5IH2 A;  2AK5 A;  4HCK A;  2CSQ A;  4RTZ A;  2V1Q A;  2H8H A;  4GLM A;  3I5S A;  3EHQ A;  1NM7 A;  3RNJ A;  1UEC A;  3VRY A;  1NEG A;  1QLY A;  2K2M A;  2ECZ A;  1WLP B;  4AFQ C;  4R0K A;  2KT1 A;  3UF4 A;  2NUZ A;  2KRM A;  4D8K A;  1JQQ A;  2OAW A;  1ZUY A;  1V1C A;  2DX1 A;  2F2V A;  2GGR A;  4OMP A;  2KEA A;  1X6B A;  3VS4 A;  4Z8A A;  1YN8 A;  2PTK A;  4EIK A;  1SRM A;  1OPK A;  4RTV A;  4CC2 A;  2FG0 A;  2JS0 A;  1T3L A;  1UHC A;  2O9V A;  2DYB A;  2OI3 A;  2X3X D;  2EVR A;  5ECA A;  1H8K A;  2JTE A;  4AFZ C;  1SSH A;  2CDT A;  1WXU A;  1TUC A;  3EG3 A;  3NPF A;  1G2B A;  2FPE A;  2SEM A;  2YUN A;  2DA9 A;  3EG2 A;  1KJW A;  1GBQ A;  1M30 A;  2C0O A;  2I0N A;  3KFV A;  1UDL A;  1K4U S;  3H0H A;  3UAT A;  2VWF A;  1NYF A;  3I5R A;  2L3S A;  1WA7 A;  2JMA A;  1XOV A;  1AWX A;  1T3S A;  1YWP A;  2CUB A;  5IHI A;  1U3O A;  1ZX6 A;  2EPD A;  2LP5 A;  1OV3 A;  1HSQ A;  2G6F X;  4ORZ A;  2LCS A;  3VS2 A;  1GL5 A;  1IO6 A;  2MCN A;  1M27 C;  2JM9 A;  4J9D A;  2SRC A;  2LMJ A;  2KGT A;  2B86 A;  2E5K A;  1I0C A;  4JZ4 A;  1CSK A;  2BZ8 A;  2DMO A;  3VS7 A;  4CC7 A;  1RUW A;  3M0Q A;  1E6H A;  3M0R A;  2M0Y A;  2YDL A;  2YT6 A;  2MOX A;  1A0N B;  4HVV A;  2DL3 A;  2DLP A;  1T0H A;  2GQI A;  2CH4 W;  1M3A A;  1AWW A;  2KE9 A;  1ABO A;  2VKN A;  4RTW A;  4JZ3 A;  1YCS B;  1JO8 A;  1NG2 A;  2DBK A;  2YSQ A;  2LQW A;  2A37 A;  1KSW A;  3ZL7 C;  2J06 A;  1WIE A;  2ED0 A;  2JM8 A;  1UUE A;  2CRE A;  2XMF A;  2ABL A;  1I07 A; 
#chains in the Genus database with same CATH topology
 2KSS A;  2A28 A;  1TSF A;  1JXM A;  3VS6 A;  2KAF A;  2V26 A;  2K4Y A;  3WVE B;  2GBQ A;  1YHQ Q;  4JS4 A;  2LJ3 A;  1VQP A;  1V76 A;  1YFN A;  5EC7 A;  1VQM Q;  4FU6 A;  3A5Z B;  2F5K A;  3OSS C;  3L2R A;  1I1J A;  2XIC A;  2GF7 A;  2LTO A;  3P8H A;  3EG0 A;  4M77 C;  1LVK A;  4M7A A;  5HCK A;  1AZE A;  2EGC A;  2RJF A;  1YJ9 A;  2WSF E;  4RTX A;  3LWH A;  3VV0 A;  4Z02 A;  4ELZ C;  2K2V A;  2QA4 T;  1WHM A;  2HCK A;  3EGU A;  3LW5 E;  2IG0 A;  1YIJ A;  2Y90 A;  2Z0W A;  3QG1 A;  5IHN A;  5IN1 A;  1E7O A;  1NPR A;  1VQ9 A;  2CKK A;  3G71 Q;  3CCE T;  3TEE A;  1BIB A;  2HBW A;  2NUT B;  1Q7Y C;  3CXC A;  5GAM f;  3JCM h;  1TTH B;  1KG1 A;  4DBH A;  3QII A;  2J6O A;  3I56 T;  1U5S A;  3CCE A;  3THK A;  4HCB A;  4AG2 C;  2HL3 A;  4Y91 A;  2FHD A;  1I81 A;  4OMQ A;  2A0F B;  5IXB A;  1YBY A;  4Y92 A;  2DVJ A;  4J6W A;  2G3R A;  4AG1 C;  4M7D C;  1EFN A;  5HY6 A;  2QTV A;  2CZ7 B;  5GAN j;  2QTX A;  4A4H A;  1RLP C;  1X6O A;  3JCM d;  3CCL A;  1FYN A;  2X3W D;  1RAC B;  3I55 Q;  4J9B A;  3CC2 T;  3CCJ Q;  4LD6 A;  1UJY A;  4LE9 A;  2RQU A;  4XTY A;  2GNC A;  2QAZ A;  2NUT A;  1QWF A;  5I2S A;  4BE2 A;  4M75 F;  5FLX E;  3QDR B;  1JXO A;  4KBM B;  4HCZ A;  5GAM d;  5CR2 A;  5D6W A;  3A8L B;  5FWB A;  3JB9 F;  1Y0M A;  2C06 A;  1AOJ A;  2XDP A;  1M9S A;  5KYU B;  1BKB A;  4C92 G;  1Q7Y R;  2C0I A;  4C0D C;  4JLG A;  1WGS A;  4Z89 A;  2Y4Y A;  5HKC A;  1K9A A;  1B07 A;  1UJ0 A;  2DIL A;  2J6K A;  3M57 A;  1VQ4 Q;  2E1H A;  2BTT A;  1AHJ B;  4IIM A;  1GCQ C;  2L0A A;  4VUB A;  2OTJ T;  3E9F A;  4TVR A;  1YP5 A;  2EYW A;  3CC7 Q;  1VQK T;  3ZFJ A;  4F7U A;  1X27 A;  2JTM A;  1HD3 A;  2RJE A;  4D8D A;  3CC2 Q;  3BFM A;  1VQ4 T;  3GP8 A;  4JJB A;  4N4G A;  1GCQ A;  3QDF A;  2COZ A;  4C5H A;  2AKK A;  5A2Q E;  4M7D A;  1MV3 A;  5KCO A;  5GAM j;  5M9O A;  3JCM Q;  4BE1 A;  3OBY A;  1NLO C;  1WPY A;  2KVQ G;  2V8K A;  4M78 D;  5KCH A;  4BAC A;  1PC0 A;  1W4S A;  4RTY A;  1VQM T;  3T9N A;  3RUX A;  4PK4 A;  4KH0 B;  3I9Q A;  4LUD A;  3OYD A;  4JRK A;  4PJO G;  2P0K A;  1S72 A;  2K5I A;  4JRP A;  1HYO A;  4Y28 E;  2K79 A;  3JCM J;  4M7D B;  1M90 U;  3M4G A;  2VGM A;  1VQK A;  2K3X A;  4JLI A;  4KH1 B;  2DL5 A;  5IHK A;  3GIB A;  1BIA A;  3OY9 A;  1FMV A;  3QWX X;  1WHG A;  4DEY A;  1QKW A;  2LNH B;  1Z9Z A;  3INZ A;  5D6Y A;  4F04 B;  5GAM e;  2HBP A;  3M9Q A;  3UA7 A;  5J39 A;  3CMA T;  1RL2 A;  3CC2 A;  1NE8 A;  7AT1 B;  1D3B B;  3A8G B;  1PD0 A;  1ZBJ A;  1U8R A;  2OJ2 A;  4HKE A;  3ZBD A;  4QW2 A;  3M0P A;  2O4X B;  2QQ9 A;  2W0Z A;  1YI2 T;  4F17 A;  3HSB A;  4X1V A;  4ZNX A;  4M7D F;  3VS3 A;  2M9U A;  4IKF A;  4C0D B;  1Y57 A;  1CKA A;  3A8M B;  1WX6 A;  3HTR A;  2QEX T;  1TS9 A;  1OZ3 A;  1M3B A;  3OS5 A;  5CKH A;  3CCM A;  1FMW A;  1ZUK A;  2EW3 A;  1C0M A;  4KGV B;  3CC7 A;  4ZGE B;  5A0L A;  1K8A C;  2F69 A;  4PFO A;  1PKS A;  2DZ9 A;  3X24 B;  5GAN g;  3CCR Q;  2Y4X A;  1BI2 A;  2EQI A;  1ARK A;  2CZ0 B;  3OMG A;  4UC4 A;  1TG0 A;  4A53 A;  3EH1 A;  1X43 A;  3V7S A;  8AT1 B;  5I22 A;  1FWZ A;  1GCP A;  2MK5 A;  3G4S A;  3KXT A;  1NJI C;  1ZSZ A;  3J80 E;  1UHF A;  1VQ7 Q;  2K3B A;  4ANJ A;  1GFD A;  4M75 E;  3EGX B;  2KI7 A;  3X20 B;  1PCX A;  2AK5 A;  2CS7 A;  4M7A B;  4R56 A;  1UB4 A;  3M58 A;  3CC4 Q;  1YIT A;  4M7A E;  4LDV A;  2VGN A;  1NM7 A;  3CMA Q;  3SFM A;  4KT0 E;  3UF4 A;  2FB7 A;  2VAS A;  5CAI A;  3P8B B;  2E12 A;  4C8Q B;  2HNI A;  3D7S B;  1V1C A;  1VQ7 T;  1YHQ A;  2HSE B;  5KYW A;  2L3R A;  2X4X A;  2KEA A;  1YN8 A;  5FRN A;  4JRQ A;  5GMK e;  2HD0 A;  1OPK A;  4RTV A;  2QG9 B;  3CCM Q;  1Q95 G;  2FG0 A;  4N4I A;  5FU6 C;  3MP6 A;  2JS0 A;  1UHC A;  3M59 A;  3G6E Q;  6AT1 B;  1H8K A;  4OF1 A;  2JTE A;  5CKF A;  4AFZ C;  3C4S A;  1G2B A;  2FPE A;  1Q86 C;  4DOW A;  2PUK B;  1GBQ A;  3JAM E;  2C0O A;  3OYG A;  1RAE B;  2P4T A;  2E65 A;  2ZPE B;  2DXC A;  4E7L A;  3I56 Q;  3MEW A;  1QVF P;  2EQU A;  4PNO A;  4LDX A;  1XOV A;  2E3H A;  4PJO F;  1D0Z A;  2JUF A;  5FU6 B;  2E6N A;  2MCN A;  1VQN Q;  2PU9 B;  4M77 D;  2LMJ A;  4C8Q D;  3E19 A;  5GMK j;  1VQP Q;  4JZ4 A;  2DMO A;  4CC7 A;  1ZBX A;  5LJ5 j;  3M55 A;  3M0R A;  1MMD A;  2OTL T;  4O6J A;  2M0Y A;  2YDL A;  2YT6 A;  4HVV A;  3V7C A;  4MZM A;  2QQR A;  2VKN A;  4RTW A;  2EJF A;  1RAF B;  1Q82 U;  1YCS B;  5GAO m;  2E41 A;  5LJ3 h;  4M78 G;  4M7D G;  4E47 A;  2A37 A;  4RG8 A;  4HCC A;  4QKU A;  1VQ4 A;  4X9C A;  5LL6 S;  2XMF A;  2ZPH B;  2XID A;  4OGE A;  1WNL A;  3UT1 A;  4ME7 A;  2LQN A;  2L2P A;  4J6Y A;  4OB2 B;  2YXY A;  1N5Z A;  2FRW A;  3OBW A;  4GY5 A;  1OYX A;  1EIF A;  4M75 B;  3OYY A;  3CCS T;  2MWP A;  5AYF A;  1WHK A;  2O9S A;  1Q81 U;  2QDL A;  2A08 A;  2EGE A;  2KXD A;  1VYU A;  3JCM f;  1WFW A;  1IRE B;  5DLQ E;  1G8X A;  4L59 A;  3CME T;  3LX7 A;  5EG2 A;  3OYK A;  1TWB A;  3CC4 T;  3A8H B;  2RPN A;  4B9W A;  1M1G A;  2L3Q A;  2BE7 D;  2F2W A;  2IVW A;  4J6X A;  3NHN A;  3UDC A;  2DRK A;  1H92 A;  3DB4 A;  3CCL Q;  4FT2 A;  3JCM c;  4FSX A;  3TQ7 P;  2LX9 A;  5D7U A;  1X2K A;  3A98 A;  1TU0 B;  1BYM A;  3R6N A;  3SHW A;  1KHI A;  3LH5 A;  4RMO A;  1BI3 A;  4CC4 B;  1KIK A;  1W2B P;  2WAC A;  1KC8 R;  4B6M A;  1VA7 A;  2BIV A;  2O31 A;  2EBP A;  3CCL T;  1OUL A;  2KBT A;  2XHC A;  1T0J A;  2D0N A;  1IGU A;  2RM4 A;  1I4K 1;  2X35 A;  4C8Q C;  1K1Z A;  3S3N A;  2QK0 A;  1OX9 A;  3MEA A;  1UGS B;  1IHV A;  5GAN 3;  5J26 A;  2DIQ A;  1QCF A;  1PRM C;  2DJQ A;  2L3P A;  4E7S A;  1PSF A;  1RAD B;  4HA8 A;  2MPX C;  3JCM V;  2J7I A;  1OX8 A;  2E5Q A;  1D1C A;  4M78 E;  1WZO A;  2FL7 A;  5A0G A;  4PJN A;  1NBE B;  4FYW B;  3JCM e;  2RO0 A;  4J5Y A;  2EYZ A;  5IXF A;  2ROT A;  1RAG B;  1Q81 R;  3QZ5 B;  4ESR A;  5KYY B;  1MNE A;  2PVD B;  3CCV A;  2HSP A;  3H0I A;  3O5Z A;  2KMT A;  3QJY A;  3OW2 A;  2VB6 A;  3G71 T;  1OPL A;  2D8H A;  2LDM A;  4PJM A;  2EQJ A;  2YLC A;  1RI9 A;  3SDZ A;  2KRS A;  4LN2 A;  4FIB A;  1VQ9 Q;  4JPB W;  3FDR A;  4F14 A;  4NL3 A;  5L8R E;  1FX7 A;  1D0X A;  1PRL C;  4OMN A;  3AT1 B;  4HT8 A;  1ZA1 B;  3TSW A;  1VYV A;  4P5N A;  4HVW A;  1NLP C;  3A8O B;  4FSS A;  3FC3 A;  1H64 1;  3DB3 A;  4BUG A;  5I21 A;  2AT1 B;  5KYX A;  5LJ3 j;  2D0Q B;  1GBR A;  3OS0 A;  2MAM A;  2KNB B;  1N8R C;  5CKB A;  3LGF A;  1VQM A;  5CQX A;  1TXQ A;  1SEM A;  2EYY A;  2K57 A;  3SB2 A;  4PLI A;  3J7A F;  2DER A;  2JT4 A;  3C94 A;  3V8L A;  4XU0 A;  1N6A A;  1QVG S;  1XJW B;  3CCS A;  2LRQ A;  4C8Q A;  2PNI A;  1VQK Q;  2WSE E;  3FB9 A;  5GAO p;  1MMG A;  4C92 E;  4E7J A;  3KUF A;  5KYW B;  3VS0 A;  2CSI A;  1ZSZ B;  4HT9 A;  4OMM A;  4PKC C;  2YUQ A;  1QVG A;  3MEV A;  2QQB A;  1UGP B;  3AHU A;  1YJN A;  1LOJ A;  4IUU A;  1X75 C;  1VQ9 T;  4C0G A;  3OS2 A;  1VUB A;  4II1 A;  2H3E B;  1VQO Q;  4M75 A;  4XTW A;  3CME A;  5IAY A;  1K73 C;  1QMC A;  3C0C A;  1UGQ B;  3OYA A;  4A63 B;  4M78 B;  1RLQ C;  2QA4 A;  2DKG A;  3UWN A;  4C8Q F;  2RD1 A;  4BI3 A;  1K9M U;  2GTO A;  3G6E T;  1B7T A;  3U23 A;  1JB0 E;  1YJN Q;  3CQT A;  5I11 A;  2KDS A;  2CUD A;  4WF2 A;  4OB3 B;  3VS5 A;  1QVP A;  3M0T A;  3GOX A;  1VQ7 A;  3EFS A;  2E10 A;  1M3C A;  3MP8 A;  4E7I A;  1ABQ A;  4GBQ A;  4J83 A;  3GNG A;  1W1F A;  1KQS A;  3IQL A;  2DTO A;  2GCX A;  1GRI A;  3OA6 A;  2HKN A;  2DXT A;  3EFO B;  1O9S A;  5LJ3 g;  3ER0 A;  4M78 A;  2GFU A;  4BE0 A;  1K73 U;  1AZG B;  5KH6 A;  4OP0 A;  4FYX B;  2DAQ A;  3VYH B;  2JOY A;  1D0Y A;  1BB9 A;  1C6V X;  2DL4 A;  1VQ5 T;  4OMF B;  3OYM A;  1VYT A;  3RBB B;  1J3T A;  1PKT A;  2J6F A;  2A36 A;  4A4G A;  2DD4 A;  2QAS A;  4J7F A;  5L23 A;  1G3T A;  1YIT Q;  2DE0 X;  1N27 A;  1K9M R;  2RQT A;  4FCY A;  1WI7 A;  1LCK A;  3PGG A;  1AVZ C;  2AKL A;  3EHR A;  3H6Z A;  2YUP A;  4IUT A;  4IUP A;  2XK0 A;  2O4X A;  1FMK A;  4RTT A;  1VQL T;  2BE9 B;  3ASK A;  2IPO B;  3VYG A;  5LJ3 e;  5CKE A;  2P84 A;  2AZS A;  5IH2 A;  1G3Y A;  4RTZ A;  2JNG A;  1OU8 A;  2V1Q A;  4GLM A;  3I5S A;  4PJO B;  1G3S A;  5KYY A;  1UEC A;  1NEG A;  3L2W A;  3X28 B;  4AFQ C;  4PJJ A;  2EQM A;  1KC8 U;  2KRM A;  4D8K A;  2OAW A;  2E64 A;  4PL6 A;  2QQS A;  3EGX A;  1OZ2 A;  1YI2 A;  2A7Y A;  3HKS A;  2JN0 A;  4QQ6 A;  5GAN e;  1VQ8 T;  4C92 B;  2PTK A;  4M7D E;  4EIK A;  3FRN A;  4C92 D;  5GAN h;  2X9H A;  4DBF A;  4CC2 A;  4KUD K;  3X26 B;  5GAN 8;  3OYI A;  5GAM g;  2EVR A;  5ECA A;  4EPC A;  3OYL A;  2X51 A;  5FU7 B;  1VQ5 Q;  1TUC A;  3NPF A;  4M75 G;  3CCR T;  3CXC S;  1KJW A;  4FM4 B;  1MGQ A;  2I0N A;  4IUQ A;  1VQ8 Q;  1UDL A;  3H0H A;  2NUP B;  3I5R A;  3TU4 K;  1T3S A;  4FYY B;  1U3O A;  2R5A A;  3PMI A;  3HP9 A;  2LCS A;  2MWO A;  1M5Q 1;  2ZCF B;  1M2V B;  2LVM A;  4CRI A;  4J9D A;  3RMS A;  3MEU A;  2EIF A;  2RHI A;  3JCM X;  1IZ6 A;  4PJO C;  1KQ1 A;  4MZT A;  1M1F A;  3M0Q A;  4C0Z A;  2XI9 A;  3LLR A;  4X34 A;  5FRM A;  1A0N B;  3OW2 P;  3PIO A;  3X25 B;  3RER A;  2QEX Q;  4IUR A;  2CH4 W;  1M3A A;  1VIE A;  1ABO A;  1K8A R;  1NG2 A;  2DBK A;  4JRI A;  3MO8 A;  3A1P A;  2J06 A;  2ED0 A;  2DEQ A;  3CCM T;  2JM8 A;  1TUG B;  2ABL A;  3GPL A;  4RCB A;  2RQV A;  2ESW A;  2HEQ A;  2CZ6 B;  2O2O A;  4XU3 A;  2DTH A;  4F7U F;  4C0F A;  3JCM W;  4E6R A;  2EWN A;  2KXC A;  3L1A A;  4ZTF A;  2MIO A;  1WHL A;  2OTJ A;  3P8D A;  4LUE A;  4YTL A;  4J9F A;  1JRI A;  3WXM B;  2D1X A;  3PNW C;  1MHN A;  2JS2 A;  1R0C B;  3CCQ Q;  2CH4 A;  2B8A A;  4XTZ A;  1YI2 Q;  1M1K C;  2DJZ A;  2OTL A;  4BI4 A;  4OB0 B;  3CCU T;  1N8R U;  1X69 A;  3REB B;  3DKM A;  3NTI A;  4C92 C;  2KY9 A;  1VQN T;  1IB8 A;  3RIR A;  1QKX A;  1AWO A;  1RAH B;  2AZV A;  3CCV Q;  2QDY B;  1WXT A;  1Q81 C;  1YJN T;  2RHX A;  4XU2 A;  5CIU A;  1YIT T;  1K0X A;  3CD6 T;  1SG5 A;  1XNI A;  1SKU B;  3QBY A;  3PTA A;  2VC8 A;  1X01 A;  2JW4 A;  4KRT A;  1SPK A;  2JZ2 A;  1C1A A;  3BE3 A;  1E6G A;  1UEB A;  4KGZ B;  3CC4 A;  5FWC A;  3EH2 A;  2YUO A;  4C5E A;  4DEX A;  2M1H A;  4E2F B;  1KD1 C;  4V2S A;  2CZ1 B;  4L6V 5;  2BZX A;  1R0B G;  5GAO l;  2CP6 A;  1KQS P;  3URG A;  3PIP A;  2M02 A;  4BDY A;  2DIG A;  1PWT A;  5LJ5 g;  1WQ7 A;  1K76 A;  4JDS A;  4LDY A;  1ACM B;  2K5L A;  1VQ8 A;  1Y07 A;  4C8Q E;  4CI0 C;  4XU1 A;  3FJ5 A;  4PJO D;  3BY7 A;  3NTK A;  1QWE A;  4EMK B;  2PVO B;  2RK1 A;  1Y96 A;  3CCJ A;  4XTX A;  3SWN A;  2EKH A;  1TOV A;  3ME9 A;  4M77 F;  5DLO A;  1BBZ A;  2K7A A;  2RHY A;  3CBO A;  2P0Q A;  2KYB A;  1IHW A;  4AFS C;  1PD1 A;  2OTL Q;  1U06 A;  1VQL Q;  3WVD B;  5LJ3 f;  1SSF A;  4JJN K;  1UTI A;  2BUD A;  3PVL A;  4DBR A;  1YCY A;  1QW1 A;  1VQ6 T;  3PT9 A;  1KK7 A;  3FEO A;  1ZLM A;  1FXX A;  2LJ0 A;  4M7A F;  3DLM A;  2RJC A;  3HRT A;  3M0S A;  1ZSZ C;  5GAO q;  2DET A;  2YWW A;  5KE2 A;  1SHF A;  4M75 C;  2JXB A;  3SWN B;  2EYQ A;  3GBQ A;  2YRV A;  3M56 A;  2CP2 A;  2LX7 A;  5GAN 7;  3M53 A;  5DY9 A;  4LDW A;  4J9H A;  2RHZ A;  1NJI R;  3VRZ A;  2XKO C;  3C95 A;  1H3Z A;  1OI1 A;  1BU1 A;  2GQV A;  3DLL A;  2C0T A;  3HL8 A;  2F2X A;  2LQ8 A;  4E7H A;  2LZ6 B;  2ZPI B;  3CPW P;  4N0A C;  2J05 A;  2FRY A;  1QVG P;  1QVF A;  1I5L A;  2KRN A;  1VQO A;  2DNU A;  3VUB A;  2LCC A;  3VU3 C;  3EFR A;  4BD3 A;  1PHT A;  4EMK C;  2EQK A;  1Q7Y U;  3QXE B;  1N9R A;  4RUG A;  2LNV A;  2LT1 A;  1SF9 A;  1BK2 A;  3JB9 I;  3OYJ A;  1D3B A;  1YWO A;  2DBM A;  2AIR B;  2R5M A;  3HRU A;  1B34 B;  2EGA A;  2NLU A;  2CP7 A;  2R57 A;  4GLK A;  1LPL A;  3JB9 H;  3M0U A;  1NPP A;  2HQE A;  1Q82 C;  1GXI E;  5KYX B;  2DD5 A;  2V1R A;  4JJC A;  1IGQ A;  3NMZ C;  2JMC A;  2RI5 A;  2LT4 A;  1S72 Q;  1KD1 U;  1PNJ A;  2IIM A;  1LNX A;  1K9M C;  1QP3 A;  4CC3 A;  1KQS S;  3VS1 A;  1K0S A;  1K8A U;  3OYC A;  2NWM A;  3M54 A;  2EJ9 A;  2ROL A;  2GTJ A;  4DA4 A;  4NS5 A;  2HDA A;  2DVE A;  4J9G A;  2QXF A;  1XTD A;  2VV5 A;  4AMC A;  3ULR B;  1BCO A;  2L89 A;  3OSV A;  5HK0 A;  1M2V A;  1VQ5 A;  3QUI A;  1WJS A;  3OB9 A;  3H41 A;  4QVZ A;  3RR6 A;  1X2Q A;  3BW1 A;  2FZC B;  4J8O A;  4MDW A;  4QQG A;  2JVV A;  4XTV A;  2ZPB B;  1Q86 U;  5GAM h;  2FVU A;  5GAN d;  4M77 G;  3JCM P;  4N0A A;  4MZP A;  3JB9 G;  2LQK A;  3CCU Q;  2K6D A;  5LJ5 d;  1Q82 R;  2KT8 A;  1GFC A;  2M51 A;  2K3Y A;  4C92 F;  3J81 E;  4M77 E;  2QQA A;  1M8V A;  2PZ1 A;  5GMK m;  4E7K A;  1ZUU A;  2FZG B;  3CBM A;  3NGP A;  1RAB B;  4BB7 A;  8ATC B;  2RNA A;  1VQO T;  1KFZ A;  1G3W A;  3G4S Q;  2D8J A;  5LJ5 e;  1NZ9 A;  2MYS A;  4HCK A;  3S3M A;  2RB6 A;  5GAN f;  3EHQ A;  3HFO A;  4M7A C;  3VRY A;  4NOY A;  1PM3 A;  1WLP B;  4R0K A;  3Q1J A;  3CEY A;  5LJ5 f;  2XD0 A;  3EGD A;  3VJP A;  3E2U A;  3CCR A;  3I55 A;  2F2V A;  3QPH A;  2X4W A;  3CCQ T;  3JCM g;  2VUB A;  3CCU A;  4L5G A;  1SRM A;  3QZ9 B;  4LD9 K;  1YJ9 T;  3MP1 A;  3G71 A;  4R55 A;  2O9V A;  3L2U A;  1QVF S;  2ZZD A;  2DYB A;  2OI3 A;  1WJQ A;  2ATC B;  1QQJ A;  3EG3 A;  2E70 A;  2SEM A;  2YUN A;  3CPW S;  5IT9 E;  3BDL A;  1MMN A;  2I2L A;  5GAN 2;  3KFV A;  3QO3 A;  1P92 A;  1K4U S;  5FU7 C;  3UAT A;  3R6O A;  2CGH A;  2E4H A;  1WA7 A;  2JMA A;  1R8O B;  5IHI A;  1AWX A;  1YWP A;  4EMH A;  2QGG A;  4PJO A;  1AT1 B;  1HK9 A;  3CD6 A;  2V8J A;  4E7Z A;  2QA4 Q;  1JJ2 P;  2PVG B;  3VS2 A;  2G6F X;  3TCJ A;  3RDV A;  2QEX A;  1GL5 A;  1RI0 A;  1Y7X A;  3L2Q A;  1M27 C;  2JM9 A;  1YJW T;  2XDB A;  3OQ5 A;  2B86 A;  2E5K A;  1BI1 A;  2HQX A;  5CO7 A;  3VS7 A;  5AT1 B;  3MPU B;  1E6H A;  1O75 A;  3PMT A;  2MOX A;  4ZN1 A;  2PQW A;  2DL3 A;  3LH0 A;  1M4Z A;  2MF2 A;  1B34 A;  4M7D D;  4LXC A;  1EX4 A;  4C5G A;  2DPP B;  3LGL A;  5KE3 A;  1KQ2 A;  2OTJ Q;  2F1L A;  3I56 A;  1BCM A;  3EG9 B;  2RK2 A;  1KSW A;  2DTI A;  3RMQ A;  1Y96 B;  1UUE A;  2CRE A;  4QQD A;  2LCL A;  3JB9 J;  4BY6 B;  2BKD N;  1I07 A;  3G1J A;  1I5O B;  4A4E A;  2RH2 A;  2RHU A;  2DM1 A;  2K9G A;  2QGF B;  1WYX A;  1PG5 B;  1WQW A;  1W6X A;  1VQN A;  2V8I A;  1VOM A;  2XDD A;  2M16 A;  2VYT A;  4AT1 B;  4J9I A;  1LJO A;  4Z88 A;  2RQW A;  2FEI A;  3MCA B;  4M7A D;  1M90 R;  2E6Z A;  1TH7 A;  2YLB A;  2HKQ B;  1VQ6 A;  4OMO A;  2OX7 A;  4KUI A;  3SD4 A;  2D9T A;  3CCV T;  2FYK A;  4JUV A;  1EZZ B;  1YJW Q;  2X4Y A;  3CD6 Q;  2CP0 A;  3JRZ A;  1MUZ A;  4X9D A;  4HVU A;  1M8M A;  5CQY A;  1W2B S;  4J7I A;  2COW A;  2DF6 A;  4PFZ A;  4RTU A;  5GJW B;  3PFS A;  4WCI A;  1Y71 A;  2CT4 A;  2ED1 A;  1ZHI A;  1JEG A;  2WSC E;  3E1S A;  1R77 A;  4BDZ A;  4MML A;  2DEU A;  3CBP A;  2DXU A;  4OML A;  1H3H A;  5LJ3 d;  3H9N A;  3FIF A;  2CP5 A;  2EAY A;  4A4F A;  4XAX B;  3QWY A;  4A54 A;  3G6E A;  2YRC A;  3H8Z A;  1JU5 C;  3CXC P;  4K11 A;  1SHG A;  3NFC A;  5CK9 A;  3MET A;  3TSZ A;  1YIJ Q;  5KYU A;  2YRD A;  3HHT B;  3HPW A;  4WTO B;  1SRL A;  1OU9 A;  1UE9 A;  3RKX A;  2EYX A;  1Z9Q A;  1U1T A;  2DRM A;  2ENM A;  2DXB A;  4B9X A;  1F1B B;  4M78 C;  1XQH A;  4FW2 A;  4QVC A;  3EAE A;  2RQR A;  4ZGJ B;  1UGR B;  5FW9 A;  4OVA A;  3V8K A;  1YIJ T;  1JBM A;  3HRS A;  3EG1 A;  3TRE A;  5GMK h;  4AFU C;  5GAO n;  4ELY C;  3E9G A;  4EMK A;  4KGX B;  1WDX A;  4PJO E;  2EJG A;  1NEB A;  5GAN 5;  4C5I A;  2HZY A;  3FLG A;  5FRO A;  1W2B A;  3RKY A;  1CKB A;  2W10 A;  3I35 A;  3S6W A;  4XQ3 A;  2QI2 A;  1VIF A;  1D1A A;  3OYH A;  2ZPF B;  5GMK l;  4HXJ A;  3QYH B;  1NYG A;  3MHX A;  3LYI A;  2DK3 A;  3SEM A;  1NJI U;  3MJX A;  5GAN 6;  4M77 A;  4M78 F;  2DO3 A;  4LNP A;  2JTF A;  3JB9 D;  1PSE A;  1X6G A;  3CC7 T;  2O88 A;  4FL6 A;  4D6W A;  2E3I A;  5C6S A;  3CCE Q;  5D6X A;  4RKU E;  5KYN A;  2KYM A;  3H0F A;  3BDU A;  4RG2 A;  1OOT A;  2RI2 A;  1UG1 A;  2M0O A;  4OGC A;  4F16 A;  4O5V A;  1AD5 A;  2RI3 A;  3MKD A;  1VQ6 Q;  1UFF A;  1AEY A;  1WHJ A;  1QCN A;  3UA6 A;  3OYN A;  4J9C A;  2CP3 A;  1W70 A;  1JJ2 S;  2HQH A;  3PVQ A;  2CT3 A;  4ZTJ A;  1RAI B;  2X4J A;  2F5T X;  2P4R A;  3JV3 A;  1JJ2 A;  1S1N A;  9ATC B;  5LJ5 h;  3CCQ A;  5C0M A;  4J9E A;  1YHQ T;  2NYS A;  3QYG B;  2DL7 A;  1D09 B;  4MDX A;  3QHS A;  2MI6 A;  2XG8 D;  4Q5W A;  3JCM b;  4MMK A;  4N4H A;  3TVT A;  1KD1 R;  2FPF A;  5J3B A;  3PE0 A;  1KC8 C;  2VXF A;  5CKD A;  3RKW A;  2FPD A;  5CCA A;  2JJ9 A;  2P0P A;  2ZGW A;  1G5V A;  3VUZ A;  2L8D A;  3SWN C;  1AWJ A;  3GF5 A;  1YNZ A;  1ZA2 B;  4IIO A;  3VKI A;  2HAX A;  4FT4 A;  4JJD A;  1TUD A;  3NTH A;  2KRO A;  3GLX A;  1ZSG A;  2NUP A;  2DYI A;  1WXB A;  2AHJ B;  2RMO A;  2VVK A;  3CPF A;  4F7U B;  2DZC A;  2DL8 A;  1MV0 B;  1B3Q A;  3G7Z A;  2RF0 A;  1OEB A;  1DJ7 B;  1U1S A;  1UGV A;  2KQW A;  2BZY A;  3O8V A;  4F7U G;  3CPW A;  5GJV B;  2DFU A;  3L42 A;  4OB1 B;  2FO0 A;  4NL2 A;  4PFP A;  2LJ1 A;  4DOV A;  3V7R A;  5DM7 R;  4EDU A;  1VQL A;  1KHC A;  4F7U E;  4QT7 A;  3L2V A;  4FYV B;  2KR3 A;  3V8J A;  3QSU A;  1HJD A;  2RA2 A;  4M4Z A;  1D1B A;  2ZPG B;  3M4Y A;  4ZN3 A;  3REA B;  1MMA A;  2RN8 A;  4C92 A;  2HMA A;  3RES A;  3LWI A;  2PUO B;  3EFO A;  2QYZ A;  1G83 A;  1M1K R;  1IXD A;  4XTU A;  1VQP T;  2XU8 A;  3GNF B;  2CSQ A;  3L2Z A;  2CYZ B;  5GMK i;  1N8R R;  3EG9 A;  2H8H A;  3QKJ A;  2K5F A;  3N5B B;  2HL5 C;  3RNJ A;  4IUV A;  1QLY A;  2K2M A;  3CCJ T;  2ECZ A;  1M2O A;  2KT1 A;  1WHH A;  2NUZ A;  1WJR A;  2GFA A;  1JQQ A;  1MND A;  4A4K A;  4LDU A;  1ZUY A;  2DX1 A;  1I8F A;  2ZAE A;  2GGR A;  2O01 E;  4OMP A;  1X6B A;  3VS4 A;  4Z8A A;  4DBQ A;  2COY A;  5CVI A;  1T3L A;  3CMA A;  3G4S T;  1QP2 A;  2X3X D;  2LC4 A;  3UPU A;  3OS1 A;  1SSH A;  4M77 B;  2CDT A;  1WXU A;  1IRX A;  3I55 T;  1M1K U;  1YJW A;  2DA9 A;  3EG2 A;  1M30 A;  2FZK B;  2RJD A;  2EKO A;  2VWF A;  1NYF A;  2L3S A;  4ZGD B;  4PJL A;  2CUB A;  2MMP A;  1K73 R;  4JS5 A;  4FW1 A;  4ATO A;  1ZX6 A;  4BY6 C;  2EPD A;  2LP5 A;  1OV3 A;  1HSQ A;  2H3J A;  4ORZ A;  2KK4 A;  1ZQ1 A;  1M90 C;  4XK8 E;  1IO6 A;  3FJP A;  3HFN A;  2EFI A;  3OW2 S;  3EGD B;  3CME Q;  2SRC A;  2A3L A;  4PLL A;  2KGT A;  1YJ9 Q;  4DQ2 A;  1RAA B;  2R58 A;  1I0C A;  3OYB A;  1CSK A;  2BZ8 A;  1HXD A;  5I2M A;  3ZEH A;  1RUW A;  5GAO r;  4M7A G;  4EMG A;  2D6F A;  4KUL A;  4C8Q G;  4QVD A;  2L5Q A;  1N9S A;  2YHT A;  3KBG A;  3C12 A;  3CCS Q;  3M5A A;  1QCO A;  3F70 A;  2DLP A;  1T0H A;  2GQI A;  4RCC A;  2VXE A;  5A0D A;  2KE9 A;  1AWW A;  3OMC A;  4JZ3 A;  4BI8 B;  4M75 D;  1JO8 A;  3JSC A;  1V29 B;  5HK3 A;  2OAU A;  2YSQ A;  3OYE A;  2LQW A;  1OQK A;  3ZL7 C;  1WIE A;  3OYF A;  1Q86 R;  3QJ6 A;  5GAN 4;  1BI0 A;  3S3O A;  1S72 T; 
#chains in the Genus database with same CATH homology
 2RQV A;  2A28 A;  2ESW A;  1JXM A;  2HEQ A;  3VS6 A;  2O2O A;  2LQN A;  2L2P A;  2DM1 A;  2K9G A;  1WYX A;  2GBQ A;  1W6X A;  2LJ3 A;  5EC7 A;  4E6R A;  1N5Z A;  2FRW A;  2KXC A;  2MIO A;  4J9I A;  4Z88 A;  2RQW A;  2FEI A;  4LUE A;  1I1J A;  4J9F A;  3EG0 A;  2D1X A;  2JS2 A;  5HCK A;  2CH4 A;  1AZE A;  2EGC A;  2O9S A;  4RTX A;  2QDL A;  4OMO A;  2A08 A;  2EGE A;  2KXD A;  1VYU A;  1WFW A;  1X69 A;  2HCK A;  3EGU A;  3REB B;  5IHN A;  1MUZ A;  1E7O A;  2RPN A;  1QKX A;  2L3Q A;  2F2W A;  2AZV A;  1AWO A;  3NHN A;  1WXT A;  4HVU A;  2DRK A;  1H92 A;  1M8M A;  2HBW A;  1K0X A;  2DF6 A;  2J6O A;  4RTU A;  5GJW B;  1U5S A;  2JW4 A;  4WCI A;  3THK A;  4AG2 C;  4KRT A;  2CT4 A;  2ED1 A;  1SPK A;  1X2K A;  4OMQ A;  1E6G A;  1JEG A;  3A98 A;  5IXB A;  4Y92 A;  2DVJ A;  5FWC A;  3R6N A;  3SHW A;  2YUO A;  3LH5 A;  4AG1 C;  4DEX A;  1EFN A;  4CC4 B;  1KIK A;  4OML A;  1H3H A;  1RLP C;  2BZX A;  1VA7 A;  2O31 A;  2EBP A;  1FYN A;  2KBT A;  2X3W D;  1T0J A;  2D0N A;  3QWY A;  4J9B A;  1PWT A;  1JU5 C;  4K11 A;  1UJY A;  4LE9 A;  1K76 A;  1SHG A;  2RQU A;  1K1Z A;  2GNC A;  3TSZ A;  3FJ5 A;  1SRL A;  1UE9 A;  1QCF A;  1QWF A;  2EYX A;  1PRM C;  1Z9Q A;  2DJQ A;  2L3P A;  1JXO A;  1QWE A;  2DRM A;  2ENM A;  2J7I A;  2EKH A;  1BBZ A;  5FWB A;  2K7A A;  2RQR A;  1Y0M A;  2EYZ A;  1AOJ A;  5IXF A;  2ROT A;  5FW9 A;  2KYB A;  4ESR A;  4AFS C;  2C0I A;  3EG1 A;  1U06 A;  4AFU C;  4Z89 A;  1K9A A;  2HSP A;  1B07 A;  3H0I A;  3O5Z A;  1UTI A;  3PVL A;  1UJ0 A;  2DIL A;  2J6K A;  1WDX A;  1NEB A;  1OPL A;  2D8H A;  1ZLM A;  2BTT A;  2LJ0 A;  4IIM A;  1RI9 A;  1GCQ C;  3M0S A;  2KRS A;  2L0A A;  1CKB A;  2W10 A;  3I35 A;  4LN2 A;  4JPB W;  1YP5 A;  4F14 A;  1SHF A;  2EYW A;  1PRL C;  2JXB A;  4HXJ A;  4OMN A;  3GBQ A;  1NYG A;  3TSW A;  1VYV A;  2LX7 A;  3SEM A;  4HVW A;  1NLP C;  4FSS A;  1X27 A;  4J9H A;  1HD3 A;  3VRZ A;  4D8D A;  4LNP A;  1BU1 A;  1X6G A;  4JJB A;  2O88 A;  2C0T A;  1GBR A;  2F2X A;  1GCQ A;  2KYM A;  2LZ6 B;  3H0F A;  2KNB B;  1OOT A;  2J05 A;  2FRY A;  1UG1 A;  2AKK A;  1SEM A;  4F16 A;  2KRN A;  2EYY A;  1AD5 A;  2DNU A;  1UFF A;  1MV3 A;  1AEY A;  3UA6 A;  2JT4 A;  1PHT A;  4J9C A;  1W70 A;  3PVQ A;  2CT3 A;  4RUG A;  1NLO C;  2PNI A;  1BK2 A;  2P4R A;  3JV3 A;  1S1N A;  3VS0 A;  2CSI A;  4RTY A;  4OMM A;  1YWO A;  4J9E A;  2YUQ A;  3I9Q A;  4LUD A;  2DBM A;  2DL7 A;  2EGA A;  3M0U A;  2K79 A;  2V1R A;  4JJC A;  3TVT A;  2FPF A;  3NMZ C;  3PE0 A;  2DL5 A;  2JMC A;  5IHK A;  2FPD A;  1PNJ A;  2IIM A;  3QWX X;  4DEY A;  3C0C A;  1QKW A;  2LNH B;  4CC3 A;  3VS1 A;  4A63 B;  1K0S A;  1Z9Z A;  1RLQ C;  2NWM A;  1AWJ A;  1YNZ A;  2ROL A;  3UA7 A;  4IIO A;  2GTJ A;  2GTO A;  2HDA A;  4J9G A;  4JJD A;  1TUD A;  3U23 A;  1ZBJ A;  2KRO A;  2OJ2 A;  3ULR B;  3CQT A;  3M0P A;  5I11 A;  2CUD A;  2W0Z A;  4F17 A;  1ZSG A;  4X1V A;  3VS5 A;  3M0T A;  1WXB A;  1M3C A;  2RMO A;  2VVK A;  4ZNX A;  1ABQ A;  3H41 A;  4GBQ A;  3VS3 A;  1X2Q A;  1W1F A;  1Y57 A;  1CKA A;  1WX6 A;  3IQL A;  1M3B A;  2DL8 A;  1MV0 B;  1B3Q A;  1GRI A;  2RF0 A;  1ZUK A;  1OEB A;  1UGV A;  2EW3 A;  2BZY A;  5GJV B;  2FO0 A;  1AZG B;  1PKS A;  2K6D A;  2LJ1 A;  1BB9 A;  2KT8 A;  4QT7 A;  1GFC A;  2M51 A;  2DL4 A;  2KR3 A;  1HJD A;  2EQI A;  1ARK A;  1VYT A;  3RBB B;  1J3T A;  1PKT A;  1TG0 A;  2J6F A;  2A36 A;  2PZ1 A;  1X43 A;  4M4Z A;  5L23 A;  5I22 A;  1GCP A;  2DE0 X;  2RQT A;  1WI7 A;  1LCK A;  1ZUU A;  1AVZ C;  3NGP A;  2AKL A;  3EHR A;  3REA B;  2YUP A;  2RN8 A;  2RNA A;  1FMK A;  1KFZ A;  4RTT A;  1UHF A;  2K3B A;  1GFD A;  1G83 A;  2D8J A;  2AZS A;  5IH2 A;  2AK5 A;  4HCK A;  2CSQ A;  4RTZ A;  2V1Q A;  2H8H A;  4GLM A;  3I5S A;  3EHQ A;  1NM7 A;  3RNJ A;  1UEC A;  3VRY A;  1NEG A;  1QLY A;  2K2M A;  2ECZ A;  1WLP B;  4AFQ C;  4R0K A;  2KT1 A;  3UF4 A;  2NUZ A;  2KRM A;  4D8K A;  1JQQ A;  2OAW A;  1ZUY A;  1V1C A;  2DX1 A;  2F2V A;  2GGR A;  4OMP A;  2KEA A;  1X6B A;  3VS4 A;  4Z8A A;  1YN8 A;  2PTK A;  4EIK A;  1SRM A;  1OPK A;  4RTV A;  4CC2 A;  2FG0 A;  2JS0 A;  1T3L A;  1UHC A;  2O9V A;  2DYB A;  2OI3 A;  2X3X D;  2EVR A;  5ECA A;  1H8K A;  2JTE A;  4AFZ C;  1SSH A;  2CDT A;  1WXU A;  1TUC A;  3EG3 A;  3NPF A;  1G2B A;  2FPE A;  2SEM A;  2YUN A;  2DA9 A;  3EG2 A;  1KJW A;  1GBQ A;  1M30 A;  2C0O A;  2I0N A;  3KFV A;  1UDL A;  1K4U S;  3H0H A;  3UAT A;  2VWF A;  1NYF A;  3I5R A;  2L3S A;  1WA7 A;  2JMA A;  1XOV A;  1AWX A;  1T3S A;  1YWP A;  2CUB A;  5IHI A;  1U3O A;  1ZX6 A;  2EPD A;  2LP5 A;  1OV3 A;  1HSQ A;  2G6F X;  4ORZ A;  2LCS A;  3VS2 A;  1GL5 A;  1IO6 A;  2MCN A;  1M27 C;  2JM9 A;  4J9D A;  2SRC A;  2LMJ A;  2KGT A;  2B86 A;  2E5K A;  1I0C A;  4JZ4 A;  1CSK A;  2BZ8 A;  2DMO A;  3VS7 A;  4CC7 A;  1RUW A;  3M0Q A;  1E6H A;  3M0R A;  2M0Y A;  2YDL A;  2YT6 A;  2MOX A;  1A0N B;  4HVV A;  2DL3 A;  2DLP A;  1T0H A;  2GQI A;  2CH4 W;  1M3A A;  1AWW A;  2KE9 A;  1ABO A;  2VKN A;  4RTW A;  4JZ3 A;  1YCS B;  1JO8 A;  1NG2 A;  2DBK A;  2YSQ A;  2LQW A;  2A37 A;  1KSW A;  3ZL7 C;  2J06 A;  1WIE A;  2ED0 A;  2JM8 A;  1UUE A;  2CRE A;  2XMF A;  2ABL A;  1I07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...