2J06A

Crystal structure of the rasgap sh3 domain at 1.8 angstrom resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
61
structure length
61
Chain Sequence
b'MRRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RAS GTPASE-ACTIVATING PROTEIN 1
publication title High Resolution Crystal Structures of the P120 Rasgap SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signal transduction
total genus 13
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2j06A00
2LQNA 4Z88A 4J9IA 2F2XA 3VRZA 4K11A 2KE9A 1Z9QA 2AKLA 2D8HA 3TVTA 2P4RA 4CC4B 1AWXA 4AFZC 2FEIA 2YUNA 4LNPA 4JPBW 2ECZA 2GGRA 1WLPB 1X2QA 3IQLA 4LE9A 1JXOA 4OMQA 2YUPA 3REBB 2L3QA 2RF0A 1ZUKA 2J6OA 4Z89A 4J9GA 1WXUA 2DVJA 1WI7A 1A0NB 4DEXA 1QWFA 4Y92A 1AOJA 3U23A 4J9BA 1RLPC 4JJDA 2D0NA 2LP5A 3VS3A 5I22A 2DL7A 4RTWA 2J05A 2J7IA 2JM8A 2MIOA 4JJCA 1K4US 3EGUA 4ORZA 5EC7A 1T3LA 1T0HA 3VS5A 2G6FX 1GL5A 4ESRA 5FWCA 4AFSC 3EG3A 1GRIA 2CSIA 2EW3A 1PNJA 2MCNA 1WX6A 3LH5A 1CSKA 2DL3A 2EGAA 2NUZA 3H0HA 2CUBA 3UF4A 2J6KA 1YNZA 1B07A 1I07A 2K6DA 2DNUA 3UA7A 3C0CA 3NGPA 2HEQA 2DX1A 4CC7A 4AG2C 2ED1A 1ZLMA 4LUEA 2AZVA 2EYZA 3M0TA 2A08A 2ABLA 2V1RA 1WXTA 2BZYA 4RTZA 1SPKA 1T3SA 2O88A 2KNBB 1W6XA 1CKBA 2JM9A 2RQUA 2ED0A 1WIEA 2NWMA 2D1XA 2YUOA 3PE0A 1Y57A 1OOTA 1JEGA 2LNHB 1FMKA 2YDLA 2MOXA 2K9GA 1GCQA 1SRMA 4OMPA 1ZUUA 1BU1A 1X2KA 1WDXA 2EBPA 2X3WD 1WFWA 5FWBA 2O9VA 1YCSB 1X6GA 4D8KA 3TSZA 1IO6A 2KT1A 3H0FA 5IXFA 1UJ0A 4HCKA 3I5SA 2LQWA 1MUZA 2DILA 1PKTA 4RTYA 1M3BA 4E6RA 1M3AA 2CREA 3VS2A 1RLQC 2I0NA 4HXJA 2KRSA 1U3OA 2ENMA 1G2BA 4J9CA 2JT4A 2DRMA 2LJ1A 4IIOA 1MV3A 3VS0A 2HSPA 1G83A 2BZ8A 1SSHA 2C0OA 1CKAA 2FG0A 3R6NA 1UE9A 1AVZC 1RI9A 1KIKA 1NG2A 1JQQA 2CUDA 1OPLA 2AKKA 2E5KA 1U5SA 1NEBA 2KT8A 3JV3A 4ZNXA 1WYXA 3EHQA 1JXMA 1AD5A 1SHGA 4JZ4A 2DBMA 2DJQA 2EVRA 4D8DA 3PVLA 1UHCA 3NMZC 2RN8A 5IHIA 1SHFA 2RPNA 2FPEA 2YSQA 4OMNA 2FRYA 2ROLA 4IIMA 1TG0A 1TUDA 2L0AA 4F17A 4WCIA 2DMOA 2AZSA 4LN2A 2L2PA 5GJWB 2O9SA 2OI3A 2HBWA 2DA9A 1AWJA 1NYGA 2XMFA 4J9DA 1ZBJA 2PZ1A 1SRLA 1TUCA 2EYWA 2BTTA 3EG1A 3VRYA 2KYMA 1E7OA 4LUDA 4GLMA 2JS0A 1QWEA 2D8JA 3FJ5A 4RTUA 2SRCA 1U06A 2AK5A 2LJ0A 3EG0A 2DE0X 4KRTA 1QCFA 1E6HA 1M27C 2BZXA 2ESWA 4JZ3A 3M0UA 2FRWA 3REAB 1X69A 1VYTA 2CDTA 1GFCA 4HVWA 2GTOA 2K2MA 3M0SA 2YT6A 1AZEA 2HCKA 4RTVA 2PTKA 1WXBA 5FW9A 4CC2A 1N5ZA 1ZX6A 2PNIA 2OJ2A 1XOVA 3SEMA 2DYBA 3VS6A 2EYYA 1OEBA 2YUQA 1I0CA 1BBZA 1HSQA 1EFNA 5ECAA 3A98A 2RQTA 1PKSA 3H41A 4RTXA 1ARKA 1GCQC 1OPKA 2DLPA 1GBQA 2DL4A 1WA7A 1KFZA 5HCKA 2EYXA 2JXBA 1QKWA 2KR3A 2FPDA 1UUEA 2LZ6B 1SEMA 1UHFA 1H92A 1YWOA 1VYUA 4AG1C 2CH4A 4EIKA 2ROTA 2F2WA 4J9HA 1BK2A 2JMCA 1NLPC 3GBQA 3I35A 4OMLA 2O31A 1ZUYA 1UTIA 4R0KA 1J3TA 3PVQA 1UG1A 2SEMA 2DM1A 4HVUA 1NYFA 1K0XA 3VS7A 4FSSA 2FPFA 2J6FA 1HJDA 2B86A 3QWYA 5GJVB 2C0TA 1AWOA 1HD3A 3M0RA 2C0IA 2RQVA 1QKXA 4F16A 2RNAA 2KGTA 1AEYA 4J9EA 2KRMA 2OAWA 1ABOA 2K79A 1ABQA 1NLOC 1M30A 5IXBA 2O2OA 4HVVA 1AWWA 3UATA 4M4ZA 1RUWA 2DRKA 2A28A 2RQRA 1UDLA 2EGEA 2LJ3A 3M0PA 1FYNA 3THKA 3UA6A 1W70A 4F14A 2VVKA 1QLYA 2RMOA 4QT7A 1K76A 3RBBB 2L3SA 1X43A 3VS1A 1K9AA 1NEGA 2JMAA 2M0YA 2LX7A 2EQIA 4GBQA 1MV0B 3ZL7C 4AFQC 1H3HA 1K0SA 2X3XD 2JTEA 4RUGA 1JO8A 2CH4W 1K1ZA 3SHWA 2F2VA 5I11A 1X27A 2VKNA 1KSWA 1YN8A 2DBKA 1GCPA 1T0JA 2JS2A 1ZSGA 2VWFA 1AZGB 1B3QA 2CT4A 3EG2A 1LCKA 1S1NA 1BB9A 1X6BA 2IIMA 1NM7A 1I1JA 2EGCA 3TSWA 2EKHA 2KROA 2JW4A 1GBRA 4OMMA 2KEAA 2RQWA 4RTTA 1GFDA 2KBTA 3M0QA 1V1CA 1JU5C 1E6GA 1VYVA 2CSQA 2W0ZA 2GQIA 2K7AA 1UGVA 2DF6A 1YWPA 1H8KA 3H0IA 2K3BA 5IHNA 2W10A 1PHTA 2M51A 3ULRB 1Z9ZA 1UJYA 2FO0A 2QDLA 2GBQA 2CT3A 3EHRA 4AFUC 1PRLC 3I5RA 2H8HA 1UECA 5IHKA 1YP5A 2LCSA 2A36A 4CC3A 1OV3A 2L3PA 2DL5A 2LMJA 3I9QA 2EPDA 3NHNA 4A63B 3CQTA 2A37A 1UFFA 2HDAA 1KJWA 2KXDA 4OMOA 1PRMC 2V1QA 4JJBA 4Z8AA 1M3CA 2KRNA 3O5ZA 4X1VA 2KXCA 4DEYA 1M8MA 3NPFA 3KFVA 3VS4A 5L23A 2KYBA 1VA7A 4J9FA 2GTJA 5IH2A 2J06A 3RNJA 2GNCA 1Y0MA 1PWTA 3QWXX 1W1FA 2DL8A
chains in the Genus database with same CATH superfamily
3VYHB 3VRZA 2RHZA 3L42A 4C8QC 2X4YA 4K11A 1RAIB 2KE9A 3CCRA 1TTHB 1AWXA 4AFZC 3EFSA 2DJZA 2VUBA 2HSEB 4JPBW 2ECZA 1G3TA 1WLPB 3CCLT 3IQLA 2YUPA 3OYLA 1ZUKA 2DD5A 4ELYC 1LPLA 4B6MA 1M90C 3OMCA 3OB9A 3FC3A 5GAOm 2DYIA 3T9NA 1RLPC 4JJDA 1RAAB 3AT1B 3FDRA 3VS3A 5I22A 2AHJB 4J7FA 3SB2A 3C94A 2P0PA 2DL7A 1RL2A 4N4GA 5GAMg 3JCMJ 4JJCA 5CKEA 5GMKl 3CC7Q 2OTLA 3A1PA 1D09B 4M75E 5FWCA 4XTZA 1AHJB 4QQGA 2XICA 2YRVA 1EZZB 3PMTA 3LH5A 1CSKA 1JJ2S 3MKDA 2EGAA 2JJ9A 3H0HA 3CC2A 2CUBA 2K6DA 5M9OA 4PK4A 5DLQE 3FB9A 1VQ5A 3NTIA 2ZPIB 3CBPA 4AG2C 4BD3A 2CP5A 1Q7YU 4M7DE 3G7ZA 4RTZA 2COYA 4IUUA 2NUTA 2JM9A 2ZPFB 3OYIA 1OOTA 1FMKA 2YDLA 2K9GA 1I81A 1YI2Q 4F7UE 8AT1B 1BCOA 4DQ2A 1GXIE 4OGCA 4OF1A 1YFNA 5LJ3f 4PJNA 2R5AA 4C92D 2EBPA 2X3WD 5GAN5 1OX8A 4ZTFA 3A5ZB 1VQ6Q 3S3NA 1IO6A 4M75G 1Q7YC 2Y90A 4LXCA 1MUZA 2DILA 1PKTA 4FYYB 4C0DC 3FEOA 4N0AA 2EAYA 1VQMA 1M3BA 2CREA 2WSEE 3G6EQ 1IREB 4BE2A 2QQSA 2MPXC 3CPWP 4J9CA 2DRMA 4WF2A 2LJ1A 1MV3A 3BY7A 1SSHA 5GAOq 4M7DG 4C8QD 4IUPA 4KUDK 1NZ9A 3HP9A 4RG2A 2X4XA 4Z02A 3M54A 3OYJA 1NG2A 1JQQA 3VJPA 2RK2A 2QI2A 1K73U 1Q7YR 1G3WA 1NEBA 3N5BB 1VIEA 3E9GA 1H641 3JCMW 1SHGA 4C92B 2A7YA 5LJ5g 2EVRA 4M78C 2RA2A 4RCCA 2QQAA 2A3LA 3NMZC 1KQSP 1S72Q 1SHFA 2RPNA 3RKXA 3F70A 4E7ZA 3L1AA 1OI1A 3NTHA 5KYYB 1TG0A 3MCAB 4M78F 3EGDB 2XHCA 2E64A 3PIOA 1B34A 2AZSA 2OI3A 2HBWA 3QZ5B 2JTFA 3CCVT 3CXCS 1K73C 4C5HA 2BTTA 3EG1A 3VRYA 2QQ9A 1WPYA 3VU3C 1ZSZB 5LJ3d 2BE9B 1QWEA 2PU9B 3M4YA 3SWNA 2D8JA 3FJ5A 3E1SA 1WHMA 5LJ3e 4C8QB 1KHIA 2AK5A 3TEEA 2QGFB 2DE0X 1QCFA 3WXMB 2ESWA 4JZ3A 5KYXB 1YJWQ 1QVGS 2LCLA 4A4GA 1F1BB 1VYTA 2EQUA 4C0ZA 1DJ7B 2GQVA 2RI2A 2PNIA 2OJ2A 1VQ4A 1VQ8T 3CCJQ 1PSFA 2DXBA 3MP8A 2EWNA 4XU1A 3CCMA 2EYYA 1K73R 4UC4A 2KK4A 2YUQA 5KYUA 1BBZA 1EFNA 1X6OA 3GOXA 3H41A 4RTXA 4L6V5 4JDSA 2DLPA 1GBQA 3QSUA 3E9FA 3EH2A 2LQKA 4EMGA 1KQ2A 2XU8A 2M16A 2KR3A 1YWOA 2DTIA 4OP0A 2ROTA 2E70A 2F2WA 3E2UA 2JMCA 5GMKj 4XAXB 2X9HA 3I35A 3M55A 3OSSC 4OMLA 1QVFA 2HBPA 1ZUYA 4FW2A 2P0KA 3PVQA 4C8QE 1UG1A 3CC4Q 3CC7T 1W2BA 2DM1A 3VS7A 3OYNA 2FPFA 4E7HA 2EJFA 4BUGA 2C0TA 2EIFA 2CP7A 5FRMA 1AWOA 2OTJQ 3ZBDA 5CKBA 2RM4A 3JB9J 4F16A 3J80E 2GCXA 2K79A 4KGVB 1M30A 4M78D 4DBFA 5GAMf 1QMCA 4C92G 3CCEA 1MHNA 1QVPA 2RQRA 1I5OB 3TU4K 4M75C 4JUVA 3VYGA 2X4WA 2RMOA 4QT7A 5FROA 1K76A 2L3SA 3V7SA 5KYWA 4M75F 3M57A 2JMAA 3JRZA 4QVZA 2XG8D 3FRNA 5CO7A 2JTEA 3META 2M1HA 2QA4A 4BE0A 1YN8A 3WVDB 3QKJA 2DEUA 1T0JA 4M7DC 5GANj 2LQ8A 4ZGEB 3L2ZA 1NM7A 4C8QG 3DLMA 4M7DF 2EKHA 2KROA 2JW4A 5C6SA 2RQWA 2ZPHB 4RTTA 3CC2T 4E7SA 3OYDA 5GAN4 1QP3A 3M0QA 2CP3A 2NUPA 1Y7XA 1R8OB 1UGPB 3PFSA 1VYVA 1VQ5T 1XNIA 4M78B 4ANJA 4F7UF 3A8GB 3H9NA 1R0CB 1G5VA 3RMSA 5LJ3g 5GMKh 1Z9ZA 2GBQA 2CT3A 5GAN6 1JBMA 2L8DA 2PVOB 1N9RA 2H8HA 1N9SA 3CMAQ 4KULA 2LCSA 2HKQB 5CVIA 4MMKA 2EPDA 1I8FA 1YITA 3M53A 2HDAA 1B7TA 1MMDA 4Z8AA 1M3CA 2KVQG 3KXTA 3NPFA 3KFVA 5L23A 1VA7A 1V29B 4HCZA 5IH2A 1RAHB 2HQEA 1WHLA 1Y0MA 3QWXX 1W1FA 1YHQA 2LQNA 4Z88A 2C06A 4J9IA 2F2XA 5GAOr 1QCOA 3L2VA 2P4RA 4CC4B 4LNPA 2RHIA 2D0QB 4LE9A 1JXOA 4HKEA 5LJ5f 3REBB 3OS1A 2J6OA 4Z89A 4J9GA 1WXUA 2DVJA 3OA6A 1NPPA 1O9SA 2Z0WA 3JB9I 4IKFA 3DKMA 1QWFA 3ME9A 4J6XA 3QXEB 4M75A 5GANh 3M58A 3MJXA 3OQ5A 1R77A 2CP0A 2M02A 3OMGA 3JCMV 1U1SA 1YBYA 2J05A 2J7IA 2MIOA 1YITQ 3EGUA 2GFUA 4ORZA 3VS5A 2G6FX 4E2FB 2QEXA 2R58A 1WJSA 4AFSC 3GNGA 3EG3A 4BDYA 3EG9A 3JCMh 4BI4A 2EW3A 3CCJT 1UGRB 3L2QA 2NUZA 1OX9A 3UF4A 2J6KA 3R6OA 1Q81R 5A0LA 3C95A 3P8DA 2IPOB 4M7DA 2CZ6B 1Q86U 2QK0A 2LNVA 2DNUA 3UA7A 4EMHA 2E3IA 5IT9E 3NGPA 2HEQA 4Q5WA 4CC7A 1ZLMA 3M0TA 1WXTA 3PIPA 1JJ2P 4BI3A 1AT1B 1CKBA 3CCVQ 2MWOA 2NWMA 1VQOA 1VQKA 3CEYA 4M77B 1JEGA 2EFIA 2MOXA 1D1CA 1IGUA 4FL6A 1SRMA 5CQXA 2PQWA 2EJ9A 1X2KA 4M78G 1V76A 1WDXA 3CCSA 1Q86C 3P8HA 1RABB 3BFMA 3HRTA 5FWBA 2O9VA 3OW2A 1RAFB 4C92F 1QVFS 2AT1B 3V7CA 3H0FA 3LX7A 1VQ4T 3MP1A 1W2BS 1KD1U 3EH1A 2PVGB 1M90U 2OTJT 5LJ5d 3CCMT 3QBYA 5GAMh 4C5IA 4BB7A 5CR2A 1M3AA 3DLLA 3EAEA 5A0GA 2CKKA 2VGNA 3BDUA 1ZSZC 4HXJA 2RD1A 5D7UA 4P5NA 2L89A 4FU6A 1U3OA 1TXQA 1FMWA 2ENMA 4RMOA 3VS0A 2HSPA 1QP2A 2DXCA 4EMKB 1CKAA 2Y4XA 1Q86R 3PTAA 3OYMA 2HD0A 1VQOQ 4F7UB 4C8QF 4PFZA 5CAIA 1KIKA 1H3ZA 3CPWA 5FU7B 2E5KA 1U5SA 2QQRA 2BIVA 1KD1C 3CCUA 1WYXA 3EHQA 3LLRA 2Y4YA 3G71A 4B9XA 1AD5A 1VQ9A 2DBMA 4M77E 3TQ7P 2VGMA 3PVLA 3G4SA 2RN8A 4OMNA 5GAOl 4JJNK 1TOVA 1N8RC 2FRYA 4IIMA 4MMLA 4EPCA 2L0AA 4F17A 3SDZA 2DMOA 4DBQA 2E41A 4E47A 2L2PA 2JVVA 4II1A 1AWJA 4J9DA 4IUTA 2PZ1A 1SRLA 1X75C 3ASKA 3MO8A 4XTUA 2KYMA 2G3RA 4QVCA 2DEQA 3CCET 4LUDA 2WSCE 1KD1R 2DZCA 4GLMA 1M90R 3QPHA 2PUOB 4GLKA 3CCRQ 1FMVA 1NJIU 2LJ0A 2V26A 2QGGA 2YRCA 3CMAT 3X28B 4LDXA 3CXCP 3OBYA 3REAB 3OYCA 2E4HA 2CDTA 2GTOA 2VC8A 3I56A 2LC4A 1WXBA 3X26B 2RI5A 1N5ZA 1ZX6A 4YTLA 2QA4T 2FZKB 2DYBA 3SEMA 4C92A 3VUBA 3BDLA 3QDRB 1PM3A 3VKIA 4AMCA 1QVGP 2VYTA 5GAOn 3C4SA 1I0CA 3V8JA 2OTLQ 4PJLA 2GF7A 5CK9A 5KYYA 4WTOB 5DM7R 1NJIC 3EGDA 1GCQC 2JOYA 3LH0A 1OZ3A 3RDVA 1OPKA 2NYSA 1MNEA 3CC2Q 2DL4A 1D0YA 5LJ5h 4JRQA 2KAFA 3C12A 1WHJA 1VQ5Q 4LD9K 1G3SA 1TWBA 2X35A 2EYXA 3EGXB 1ZSZA 1YIJA 1QKWA 2FL7A 3S6WA 2FPDA 4R56A 2LZ6B 3G1JA 2K3XA 3CCQA 4A4EA 1VYUA 4AG1C 4C8QA 1NLPC 4X34A 1UEBA 5KYXA 3QYGB 3GBQA 2BKDN 4JS5A 2RK1A 4MZMA 2VB6A 1YITT 1J3TA 2EQKA 5IN1A 4PJOD 2SEMA 2HL3A 1NJIR 2CYZB 5D6WA 4HVUA 1IGQA 1LOJA 4F7UG 1HJDA 2MYSA 1HD3A 1IHWA 3M0RA 2C0IA 3JAME 1QKXA 1AEYA 3JSCA 1ABOA 1NLOC 2KY9A 3RR6A 2A28A 3O8VA 1OZ2A 2OX7A 2FZCB 1YJ9A 5DY9A 1VQMQ 4A53A 1QLYA 4XTYA 3RBBB 3GNFB 1X43A 3VS1A 4A4FA 2JNGA 4GBQA 3TCJA 5GMKi 4RUGA 4J83A 1M9SA 1JO8A 2CH4W 4C0FA 3SHWA 5I11A 3NFCA 5CIUA 1TSFA 1U1TA 1GCPA 4E7LA 1I5LA 4FYWB 5AT1B 1S1NA 3OYYA 3MEUA 1VQPA 1PD1A 2QEXT 4PJOB 3OW2S 3TSWA 3JCMb 4J6WA 1GBRA 3RMQA 1M4ZA 4OMMA 4OGEA 4GY5A 5AYFA 1GFDA 3L2UA 1JU5C 1BCMA 2I2LA 2ZCFB 2EKOA 9ATCB 2QASA 2GQIA 2K7AA 2LTOA 1YWPA 2K57A 3HRUA 2K3BA 1VUBA 2W10A 1PHTA 2M51A 2QDLA 3PT9A 1VQLA 3EHRA 4OB1B 5KE3A 1ZHIA 3I5RA 1VQOT 5IHKA 4DBHA 3V8LA 1D3BB 1OV3A 2L3PA 3GLXA 3NHNA 1HK9A 3Q1JA 3MEVA 3VV0A 1Y71A 1UFFA 1FWZA 4OMOA 4MZTA 2V1QA 4JJBA 4LDYA 3CCST 4FW1A 4X1VA 2KXCA 4C5EA 3M59A 2YHTA 5L8RE 2H3EB 1LJOA 1HYOA 3M5AA 3RNJA 1VQNA 3OYHA 3CCLA 4MDXA 4BY6C 2DXUA 1VQ4Q 4OMFB 1D0XA 1HXDA 3UWNA 1JRIA 2H3JA 1P92A 2AKLA 2D8HA 3TVTA 4DA4A 3OBWA 4PJOE 3CCMQ 2FEIA 4RKUE 4ZTJA 2GGRA 1TS9A 1X2QA 4M78A 4M77C 2KDSA 2YWWA 3ZFJA 2L3QA 2QYZA 2RF0A 1WQ7A 4OB3B 1JB0E 3JB9H 2K5LA 3CCRT 1WI7A 4M77F 1A0NB 4DEXA 4Y92A 1AOJA 1XQHA 3U23A 2LRQA 2PVDB 4J9BA 3X25B 2D0NA 2LP5A 4KH1B 5A2QE 5CCAA 4M7AD 3OYBA 2HAXA 4J7IA 2K5IA 2RO0A 5EC7A 3CCUT 1T0HA 5LJ3h 4L59A 4ESRA 1GRIA 2CSIA 1PNJA 1QQJA 1WNLA 1WX6A 2DL3A 2YLBA 3G4ST 4ZN1A 1B07A 3ZEHA 1VQNQ 2OTLT 2V8IA 3C0CA 5LL6S 3H8ZA 1IHVA 2HZYA 3LGLA 3FIFA 4NOYA 2DX1A 1KQ1A 2RI3A 4EMKC 2A08A 2ABLA 4ME7A 2BZYA 1SPKA 1T3SA 2O4XB 2O88A 2F69A 4PJOG 2F1LA 2D9TA 5GAOp 5FU7C 2ED0A 1WIEA 2LDMA 5HK3A 2YUOA 1BI0A 3PE0A 3CCEQ 4C5GA 3S3MA 2LNHB 5J39A 4JRPA 4XTWA 1OU8A 4PNOA 3RERA 2DIGA 1ACMB 5IAYA 3I55A 1BU1A 2X51A 4M7AB 1D0ZA 2QG9B 1YCSB 3M56A 1X6GA 3E19A 2KT1A 1UJ0A 1PC0A 4HCKA 3OYEA 2QA4Q 2XDDA 3I5SA 2XKOC 2LCCA 4BI8B 2RJDA 5KYNA 1Y96B 3OYGA 4Y28E 4O6JA 2CZ1B 3VS2A 1RLQC 2KRSA 1K8AU 1QVFP 3RUXA 1PG5B 4V2SA 1G2BA 2JT4A 2XDBA 4NL3A 2DERA 2VXEA 2XIDA 5I2MA 3MP6A 2B8AA 1W2BP 1G83A 2BZ8A 1VQMT 2C0OA 4J6YA 2FG0A 1UE9A 1AVZC 1RADB 1RI9A 2CGHA 5GAMj 1OPLA 3CCQT 4M77A 4MDWA 1OULA 2X4JA 4M77D 2L3RA 3UPUA 3JV3A 4ZNXA 2EJGA 1JXMA 1FXXA 4IUQA 4JZ4A 4VUBA 2M9UA 2E1HA 2MWPA 2DJQA 1WJRA 4DOVA 1K8AC 1UHCA 5IHIA 1KK7A 4ZGJB 4XQ3A 2COZA 3CMEA 5J26A 5HK0A 4A54A 1C6VX 2MK5A 4WCIA 4M7AE 3MPUB 2O9SA 2DA9A 3BW1A 2CZ7B 2ATCB 2DK3A 1YHQQ 3MEAA 3QYHB 1N27A 4L5GA 2JS0A 5GAN3 4NL2A 1YJ9T 4RTUA 4BY6B 1U06A 4EMKA 2HNIA 3JCMc 3EG0A 4FIBA 4F7UA 2BZXA 2HL5C 3M0UA 2E3HA 2E10A 4FYXB 1X69A 1UGQB 1GFCA 4HVWA 3M0SA 1WQWA 1AZEA 4RTVA 3QZ9B 2V8KA 4DBRA 5FW9A 1TU0B 4LDWA 2DZ9A 3JB9F 3VS6A 4XU2A 5GANg 1VQPT 3BE3A 5ECAA 4D6WA 3CMEQ 2QEXQ 2WSFE 1KC8U 4JLIA 3D7SB 1M8VA 4TVRA 8ATCB 2ZZDA 3CBMA 2XD0A 1ZBXA 2E6NA 5CKFA 4M7AG 3A8HB 3OS0A 2DXTA 2AIRB 3M9QA 2RB6A 5HCKA 4PLIA 4XTVA 2JXBA 4XTXA 2RJEA 3QUIA 1UUEA 3CC7A 2DTHA 3EFOB 1VQLT 4EIKA 2GFAA 5DLOA 3HHTB 1N8RU 3SFMA 4N4HA 1BK2A 1WHGA 1XJWB 5LJ5j 2LT1A 1VQKQ 1ZQ1A 2O31A 1KC8C 4PJOC 2DAQA 4R0KA 2E65A 3L2RA 3LW5E 4Y91A 2P0QA 4PJOF 3QWYA 5GJVB 3CCSQ 4AT1B 3V7RA 4QW2A 4BDZA 1C0MA 2RQVA 1M2VB 2RNAA 1VQNT 2KGTA 2KRMA 1ABQA 5IXBA 4HVVA 1AWWA 4M4ZA 4E7KA 1UDLA 3M0PA 3UA6A 5GMKm 1YI2A 1IZ6A 2E5QA 2DIQA 1VQ7A 1VIFA 1WJQA 2HMAA 4RG8A 1KQSA 4HCBA 2VVKA 1KC8R 2D6FA 3EGXA 1MV0B 2LT4A 4LDVA 2P84A 2X3XD 4E7JA 1VQ6A 4ATOA 1K1ZA 4FSXA 3URGA 1X27A 2VKNA 6AT1B 2QTXA 2V8JA 1M1FA 2XK0A 2VWFA 5CQYA 3EG2A 2L5QA 4PKCC 1BB9A 1X6BA 2IIMA 2BUDA 3G6EA 2EGCA 1N8RR 5J3BA 3CCUQ 3SWNC 2ZPEB 2RJCA 4BACA 4XU3A 3G71Q 3JB9D 2K2VA 4JRIA 4B9WA 5GAN8 1TH7A 1VQ9Q 1V1CA 1SF9A 4M77G 2CZ0B 1E6GA 3G4SQ 1BYMA 2ZGWA 2RHYA 3HFNA 1UGVA 2K5FA 3OW2P 1H8KA 1Y07A 5KCOA 3CD6A 2DTOA 1VQ7Q 3ULRB 2A0FB 5HKCA 1UJYA 2FO0A 2RHXA 4AFUC 2CP6A 1K9MU 1YP5A 4CC3A 2A36A 2DO3A 3FJPA 2DL5A 2LMJA 1S72A 2KMTA 1IB8A 3CQTA 3I55T 1TUGB 1KJWA 2KXDA 4OB2B 2DVEA 3OSVA 4QQ6A 3O5ZA 4KH0B 4DEYA 4A4KA 3SD4A 2MMPA 3VS4A 4J9FA 2GTJA 3HL8A 2J06A 3I56Q 2IVWA 5CKDA 4PJOA 3QHSA 2DL8A 1ZA2B 4BE1A 1Z9QA 5CKHA 1K9MC 1BI1A 1MGQA 3PNWC 2YUNA 1RAEB 4FYVB 2NUTB 1MMNA 2DD4A 1YJWA 1YHQT 1PD0A 4OMQA 3CD6Q 1KHCA 1MNDA 1QCNA 4IURA 2QXFA 3TREA 3LWIA 4FCYA 2FB7A 1RACB 5A0DA 3CPFA 3CCJA 1YJNA 4E7IA 4M7AC 4XK8E 1IRXA 3OS5A 1D3BA 4J8OA 2IG0A 4RTWA 1YIJQ 4X9CA 2R57A 2JM8A 3OYAA 1K4US 4PLLA 7AT1B 3CCQQ 5FU6C 1T3LA 4M7AF 1GL5A 3QG1A 5GAN7 2MCNA 2FZGB 1K9MR 4EDUA 3LGFA 2CP2A 1YNZA 1BKBA 4QKUA 1I07A 2VV5A 3CMET 4ZGDB 1IXDA 1BI3A 1N6AA 1O75A 4KT0E 2ED1A 1LNXA 4LUEA 2AZVA 2EYZA 3MHXA 5LJ3j 2V1RA 1Q95G 4KUIA 4QQDA 2KNBB 1VOMA 1BIBA 1W6XA 2DPPB 2RQUA 4JS4A 3HPWA 3QO3A 2D1XA 5D6XA 5GANf 1Y57A 1WHKA 2RH2A 3CC4A 5FRNA 1YJ9Q 3INZA 1GCQA 4OMPA 1NPRA 4NS5A 2QTVA 1ZUUA 1YJNQ 3PGGA 3P8BB 4KGXB 2YRDA 2NLUA 3KUFA 1QW1A 1I4K1 2OTJA 3GIBA 3LWHA 3ER0A 1VQKT 3QJ6A 1WFWA 3M4GA 3JCMf 1NBEB 3PMIA 2QQBA 4JLGA 3CPWS 4D8KA 3TSZA 3QIIA 4C92E 5IXFA 1WZOA 2F5KA 2DETA 2LQWA 2M0OA 2JUFA 4RTYA 1B34B 1SKUB 3HRSA 5GMKe 4E6RA 1VQPQ 1YCYA 1M1GA 3HTRA 2I0NA 2PUKB 1M1KU 4IUVA 1WGSA 3X20B 3SWNB 4IIOA 2O4XA 2FVUA 3R6NA 1NE8A 4C0GA 3X24B 5I21A 1KQSS 3JB9G 2CUDA 2AKKA 4QVDA 4R55A 2HQHA 1BIAA 1G8XA 5GAN2 1X01A 1BI2A 2KT8A 4N4IA 1ZA1B 1VQLQ 4A4HA 1M5Q1 5C0MA 3A8OB 2MI6A 1LVKA 1SG5A 1M1KC 4M7AA 4HA8A 2FHDA 4D8DA 2KQWA 3J81E 2E6ZA 1MMAA 5KYUB 2FPEA 2YSQA 2MF2A 2ROLA 4F04B 3G71T 1TUDA 3UT1A 2HKNA 4DOWA 3J7AF 1VQ9T 3HSBA 1Y96A 4CI0C 4LN2A 5GANd 5GJWB 1PSEA 2BE7D 4C0DB 1NYGA 2XMFA 1Q82U 2DFUA 4ELZC 3NTKA 1ZBJA 5GANe 2K3YA 3MEWA 3FLGA 3JCMX 3CCLQ 1TUCA 2EYWA 3CMAA 4FT4A 1E7OA 2KI7A 3OS2A 4KGZB 2RJFA 4PL6A 1YI2T 1VQ7T 3JCMd 2F5TX 2SRCA 2LX9A 4KRTA 1OU9A 3H6ZA 3JCMe 1E6HA 2P4TA 1M27C 1M1KR 1R0BG 3DB3A 2DKGA 2QDYB 2FRWA 3CBOA 1XTDA 1VQ6T 2K2MA 2YT6A 2ZPBB 2HCKA 4XU0A 4HCCA 2PTKA 1M2OA 2ZPGB 4ZN3A 4CC2A 1JJ2A 4FM4B 1XOVA 1W4SA 5FLXE 1Q82C 2EQMA 2LVMA 2JTMA 5EG2A 3A8MB 4O5VA 2QAZA 3RESA 1MMGA 1OEBA 3OYFA 3I56T 3G6ET 1HSQA 3A98A 1PCXA 3DB4A 2RQTA 1PKSA 2EQJA 1WHHA 5FU6B 1ARKA 4PFPA 1SSFA 3LYIA 4OB0B 4LDUA 1WA7A 5KE2A 1OQKA 1KFZA 2YXYA 3QDFA 5KYWB 1Q81U 1UB4A 4KBMB 3CD6T 1SEMA 1UHFA 3QJYA 1H92A 3WVEB 2CH4A 3S3OA 1Q82R 4J9HA 2R5MA 1EIFA 4RCBA 3RKYA 5GAMd 2XI9A 1UTIA 1YIJT 1S72T 4X9DA 5GAMe 5I2SA 3L2WA 2KSSA 1OYXA 1NYFA 1K0XA 3JCMQ 3I55Q 4FSSA 2J6FA 2CS7A 2E12A 2B86A 2EYQA 2NUPB 1EX4A 1Q81C 3CCVA 4J9EA 2OAWA 2O2OA 3UATA 1RUWA 2DRKA 2EGEA 2LJ3A 1FYNA 3THKA 1W70A 3OY9A 2JN0A 3GPLA 1KG1A 4M78E 4F14A 2RHUA 4M75D 2WACA 2VASA 1YJWT 4LD6A 1K9AA 1NEGA 2M0YA 2LX7A 2EQIA 3GF5A 3RKWA 3ZL7C 4AFQC 1H3HA 1K0SA 3EFOA 1RAGB 3V8KA 2F2VA 1YJNT 2O01E 1KSWA 3A8LB 1VQ8A 2DBKA 2JS2A 1K8AR 1ZSGA 1AZGB 1B3QA 2CT4A 4PFOA 1LCKA 4M7DD 2YLCA 1I1JA 1FX7A 4J5YA 5KCHA 3HKSA 2KEAA 2KBTA 3CXCA 2COWA 3JCMP 1M2VA 1D1BA 2VXFA 3UDCA 2ZAEA 2FYKA 2CSQA 2W0ZA 5D6YA 1RI0A 3EFRA 4PJJA 2DF6A 3H0IA 2K4YA 4MZPA 3GP8A 1G3YA 5IHNA 1U8RA 1C1AA 2MAMA 4C92C 4OVAA 3JCMg 3RIRA 4M75B 4PJMA 1QVGA 3AHUA 4FT2A 1PRLC 3HFOA 1UECA 3I9QA 3KBGA 3CC4T 4A63B 1UGSB 1D1AA 4CRIA 2A37A 2JZ2A 2OAUA 5KH6A 1PRMC 3EG9B 3OYKA 2KRNA 1VQ8Q 4N0AC 3VUZA 1M8MA 5HY6A 2KYBA 5LJ5e 2XDPA 4M7DB 2GNCA 4HT9A 4JRKA 4HT8A 1PWTA 2HQXA
chains in the Genus database with same CATH topology
2LQNA 4Z88A 4J9IA 2F2XA 3VRZA 4K11A 2KE9A 1Z9QA 2AKLA 2D8HA 3TVTA 2P4RA 4CC4B 1AWXA 4AFZC 2FEIA 2YUNA 4LNPA 4JPBW 2ECZA 2GGRA 1WLPB 1X2QA 3IQLA 4LE9A 1JXOA 4OMQA 2YUPA 3REBB 2L3QA 2RF0A 1ZUKA 2J6OA 4Z89A 4J9GA 1WXUA 2DVJA 1WI7A 1A0NB 4DEXA 1QWFA 4Y92A 1AOJA 3U23A 4J9BA 1RLPC 4JJDA 2D0NA 2LP5A 3VS3A 5I22A 2DL7A 4RTWA 2J05A 2J7IA 2JM8A 2MIOA 4JJCA 1K4US 3EGUA 4ORZA 5EC7A 1T3LA 1T0HA 3VS5A 2G6FX 1GL5A 4ESRA 5FWCA 4AFSC 3EG3A 1GRIA 2CSIA 2EW3A 1PNJA 2MCNA 1WX6A 3LH5A 1CSKA 2DL3A 2EGAA 2NUZA 3H0HA 2CUBA 3UF4A 2J6KA 1YNZA 1B07A 1I07A 2K6DA 2DNUA 3UA7A 3C0CA 3NGPA 2HEQA 2DX1A 4CC7A 4AG2C 2ED1A 1ZLMA 4LUEA 2AZVA 2EYZA 3M0TA 2A08A 2ABLA 2V1RA 1WXTA 2BZYA 4RTZA 1SPKA 1T3SA 2O88A 2KNBB 1W6XA 1CKBA 2JM9A 2RQUA 2ED0A 1WIEA 2NWMA 2D1XA 2YUOA 3PE0A 1Y57A 1OOTA 1JEGA 2LNHB 1FMKA 2YDLA 2MOXA 2K9GA 1GCQA 1SRMA 4OMPA 1ZUUA 1BU1A 1X2KA 1WDXA 2EBPA 2X3WD 1WFWA 5FWBA 2O9VA 1YCSB 1X6GA 4D8KA 3TSZA 1IO6A 2KT1A 3H0FA 5IXFA 1UJ0A 4HCKA 3I5SA 2LQWA 1MUZA 2DILA 1PKTA 4RTYA 1M3BA 4E6RA 1M3AA 2CREA 3VS2A 1RLQC 2I0NA 4HXJA 2KRSA 1U3OA 2ENMA 1G2BA 4J9CA 2JT4A 2DRMA 2LJ1A 4IIOA 1MV3A 3VS0A 2HSPA 1G83A 2BZ8A 1SSHA 2C0OA 1CKAA 2FG0A 3R6NA 1UE9A 1AVZC 1RI9A 1KIKA 1NG2A 1JQQA 2CUDA 1OPLA 2AKKA 2E5KA 1U5SA 1NEBA 2KT8A 3JV3A 4ZNXA 1WYXA 3EHQA 1JXMA 1AD5A 1SHGA 4JZ4A 2DBMA 2DJQA 2EVRA 4D8DA 3PVLA 1UHCA 3NMZC 2RN8A 5IHIA 1SHFA 2RPNA 2FPEA 2YSQA 4OMNA 2FRYA 2ROLA 4IIMA 1TG0A 1TUDA 2L0AA 4F17A 4WCIA 2DMOA 2AZSA 4LN2A 2L2PA 5GJWB 2O9SA 2OI3A 2HBWA 2DA9A 1AWJA 1NYGA 2XMFA 4J9DA 1ZBJA 2PZ1A 1SRLA 1TUCA 2EYWA 2BTTA 3EG1A 3VRYA 2KYMA 1E7OA 4LUDA 4GLMA 2JS0A 1QWEA 2D8JA 3FJ5A 4RTUA 2SRCA 1U06A 2AK5A 2LJ0A 3EG0A 2DE0X 4KRTA 1QCFA 1E6HA 1M27C 2BZXA 2ESWA 4JZ3A 3M0UA 2FRWA 3REAB 1X69A 1VYTA 2CDTA 1GFCA 4HVWA 2GTOA 2K2MA 3M0SA 2YT6A 1AZEA 2HCKA 4RTVA 2PTKA 1WXBA 5FW9A 4CC2A 1N5ZA 1ZX6A 2PNIA 2OJ2A 1XOVA 3SEMA 2DYBA 3VS6A 2EYYA 1OEBA 2YUQA 1I0CA 1BBZA 1HSQA 1EFNA 5ECAA 3A98A 2RQTA 1PKSA 3H41A 4RTXA 1ARKA 1GCQC 1OPKA 2DLPA 1GBQA 2DL4A 1WA7A 1KFZA 5HCKA 2EYXA 2JXBA 1QKWA 2KR3A 2FPDA 1UUEA 2LZ6B 1SEMA 1UHFA 1H92A 1YWOA 1VYUA 4AG1C 2CH4A 4EIKA 2ROTA 2F2WA 4J9HA 1BK2A 2JMCA 1NLPC 3GBQA 3I35A 4OMLA 2O31A 1ZUYA 1UTIA 4R0KA 1J3TA 3PVQA 1UG1A 2SEMA 2DM1A 4HVUA 1NYFA 1K0XA 3VS7A 4FSSA 2FPFA 2J6FA 1HJDA 2B86A 3QWYA 5GJVB 2C0TA 1AWOA 1HD3A 3M0RA 2C0IA 2RQVA 1QKXA 4F16A 2RNAA 2KGTA 1AEYA 4J9EA 2KRMA 2OAWA 1ABOA 2K79A 1ABQA 1NLOC 1M30A 5IXBA 2O2OA 4HVVA 1AWWA 3UATA 4M4ZA 1RUWA 2DRKA 2A28A 2RQRA 1UDLA 2EGEA 2LJ3A 3M0PA 1FYNA 3THKA 3UA6A 1W70A 4F14A 2VVKA 1QLYA 2RMOA 4QT7A 1K76A 3RBBB 2L3SA 1X43A 3VS1A 1K9AA 1NEGA 2JMAA 2M0YA 2LX7A 2EQIA 4GBQA 1MV0B 3ZL7C 4AFQC 1H3HA 1K0SA 2X3XD 2JTEA 4RUGA 1JO8A 2CH4W 1K1ZA 3SHWA 2F2VA 5I11A 1X27A 2VKNA 1KSWA 1YN8A 2DBKA 1GCPA 1T0JA 2JS2A 1ZSGA 2VWFA 1AZGB 1B3QA 2CT4A 3EG2A 1LCKA 1S1NA 1BB9A 1X6BA 2IIMA 1NM7A 1I1JA 2EGCA 3TSWA 2EKHA 2KROA 2JW4A 1GBRA 4OMMA 2KEAA 2RQWA 4RTTA 1GFDA 2KBTA 3M0QA 1V1CA 1JU5C 1E6GA 1VYVA 2CSQA 2W0ZA 2GQIA 2K7AA 1UGVA 2DF6A 1YWPA 1H8KA 3H0IA 2K3BA 5IHNA 2W10A 1PHTA 2M51A 3ULRB 1Z9ZA 1UJYA 2FO0A 2QDLA 2GBQA 2CT3A 3EHRA 4AFUC 1PRLC 3I5RA 2H8HA 1UECA 5IHKA 1YP5A 2LCSA 2A36A 4CC3A 1OV3A 2L3PA 2DL5A 2LMJA 3I9QA 2EPDA 3NHNA 4A63B 3CQTA 2A37A 1UFFA 2HDAA 1KJWA 2KXDA 4OMOA 1PRMC 2V1QA 4JJBA 4Z8AA 1M3CA 2KRNA 3O5ZA 4X1VA 2KXCA 4DEYA 1M8MA 3NPFA 3KFVA 3VS4A 5L23A 2KYBA 1VA7A 4J9FA 2GTJA 5IH2A 2J06A 3RNJA 2GNCA 1Y0MA 1PWTA 3QWXX 1W1FA 2DL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQN A;  4Z88 A;  4J9I A;  2F2X A;  3VRZ A;  4K11 A;  2KE9 A;  1Z9Q A;  2AKL A;  2D8H A;  3TVT A;  2P4R A;  4CC4 B;  1AWX A;  4AFZ C;  2FEI A;  2YUN A;  4LNP A;  4JPB W;  2ECZ A;  2GGR A;  1WLP B;  1X2Q A;  3IQL A;  4LE9 A;  1JXO A;  4OMQ A;  2YUP A;  3REB B;  2L3Q A;  2RF0 A;  1ZUK A;  2J6O A;  4Z89 A;  4J9G A;  1WXU A;  2DVJ A;  1WI7 A;  1A0N B;  4DEX A;  1QWF A;  4Y92 A;  1AOJ A;  3U23 A;  4J9B A;  1RLP C;  4JJD A;  2D0N A;  2LP5 A;  3VS3 A;  5I22 A;  2DL7 A;  4RTW A;  2J05 A;  2J7I A;  2JM8 A;  2MIO A;  4JJC A;  1K4U S;  3EGU A;  4ORZ A;  5EC7 A;  1T3L A;  1T0H A;  3VS5 A;  2G6F X;  1GL5 A;  4ESR A;  5FWC A;  4AFS C;  3EG3 A;  1GRI A;  2CSI A;  2EW3 A;  1PNJ A;  2MCN A;  1WX6 A;  3LH5 A;  1CSK A;  2DL3 A;  2EGA A;  2NUZ A;  3H0H A;  2CUB A;  3UF4 A;  2J6K A;  1YNZ A;  1B07 A;  1I07 A;  2K6D A;  2DNU A;  3UA7 A;  3C0C A;  3NGP A;  2HEQ A;  2DX1 A;  4CC7 A;  4AG2 C;  2ED1 A;  1ZLM A;  4LUE A;  2AZV A;  2EYZ A;  3M0T A;  2A08 A;  2ABL A;  2V1R A;  1WXT A;  2BZY A;  4RTZ A;  1SPK A;  1T3S A;  2O88 A;  2KNB B;  1W6X A;  1CKB A;  2JM9 A;  2RQU A;  2ED0 A;  1WIE A;  2NWM A;  2D1X A;  2YUO A;  3PE0 A;  1Y57 A;  1OOT A;  1JEG A;  2LNH B;  1FMK A;  2YDL A;  2MOX A;  2K9G A;  1GCQ A;  1SRM A;  4OMP A;  1ZUU A;  1BU1 A;  1X2K A;  1WDX A;  2EBP A;  2X3W D;  1WFW A;  5FWB A;  2O9V A;  1YCS B;  1X6G A;  4D8K A;  3TSZ A;  1IO6 A;  2KT1 A;  3H0F A;  5IXF A;  1UJ0 A;  4HCK A;  3I5S A;  2LQW A;  1MUZ A;  2DIL A;  1PKT A;  4RTY A;  1M3B A;  4E6R A;  1M3A A;  2CRE A;  3VS2 A;  1RLQ C;  2I0N A;  4HXJ A;  2KRS A;  1U3O A;  2ENM A;  1G2B A;  4J9C A;  2JT4 A;  2DRM A;  2LJ1 A;  4IIO A;  1MV3 A;  3VS0 A;  2HSP A;  1G83 A;  2BZ8 A;  1SSH A;  2C0O A;  1CKA A;  2FG0 A;  3R6N A;  1UE9 A;  1AVZ C;  1RI9 A;  1KIK A;  1NG2 A;  1JQQ A;  2CUD A;  1OPL A;  2AKK A;  2E5K A;  1U5S A;  1NEB A;  2KT8 A;  3JV3 A;  4ZNX A;  1WYX A;  3EHQ A;  1JXM A;  1AD5 A;  1SHG A;  4JZ4 A;  2DBM A;  2DJQ A;  2EVR A;  4D8D A;  3PVL A;  1UHC A;  3NMZ C;  2RN8 A;  5IHI A;  1SHF A;  2RPN A;  2FPE A;  2YSQ A;  4OMN A;  2FRY A;  2ROL A;  4IIM A;  1TG0 A;  1TUD A;  2L0A A;  4F17 A;  4WCI A;  2DMO A;  2AZS A;  4LN2 A;  2L2P A;  5GJW B;  2O9S A;  2OI3 A;  2HBW A;  2DA9 A;  1AWJ A;  1NYG A;  2XMF A;  4J9D A;  1ZBJ A;  2PZ1 A;  1SRL A;  1TUC A;  2EYW A;  2BTT A;  3EG1 A;  3VRY A;  2KYM A;  1E7O A;  4LUD A;  4GLM A;  2JS0 A;  1QWE A;  2D8J A;  3FJ5 A;  4RTU A;  2SRC A;  1U06 A;  2AK5 A;  2LJ0 A;  3EG0 A;  2DE0 X;  4KRT A;  1QCF A;  1E6H A;  1M27 C;  2BZX A;  2ESW A;  4JZ3 A;  3M0U A;  2FRW A;  3REA B;  1X69 A;  1VYT A;  2CDT A;  1GFC A;  4HVW A;  2GTO A;  2K2M A;  3M0S A;  2YT6 A;  1AZE A;  2HCK A;  4RTV A;  2PTK A;  1WXB A;  5FW9 A;  4CC2 A;  1N5Z A;  1ZX6 A;  2PNI A;  2OJ2 A;  1XOV A;  3SEM A;  2DYB A;  3VS6 A;  2EYY A;  1OEB A;  2YUQ A;  1I0C A;  1BBZ A;  1HSQ A;  1EFN A;  5ECA A;  3A98 A;  2RQT A;  1PKS A;  3H41 A;  4RTX A;  1ARK A;  1GCQ C;  1OPK A;  2DLP A;  1GBQ A;  2DL4 A;  1WA7 A;  1KFZ A;  5HCK A;  2EYX A;  2JXB A;  1QKW A;  2KR3 A;  2FPD A;  1UUE A;  2LZ6 B;  1SEM A;  1UHF A;  1H92 A;  1YWO A;  1VYU A;  4AG1 C;  2CH4 A;  4EIK A;  2ROT A;  2F2W A;  4J9H A;  1BK2 A;  2JMC A;  1NLP C;  3GBQ A;  3I35 A;  4OML A;  2O31 A;  1ZUY A;  1UTI A;  4R0K A;  1J3T A;  3PVQ A;  1UG1 A;  2SEM A;  2DM1 A;  4HVU A;  1NYF A;  1K0X A;  3VS7 A;  4FSS A;  2FPF A;  2J6F A;  1HJD A;  2B86 A;  3QWY A;  5GJV B;  2C0T A;  1AWO A;  1HD3 A;  3M0R A;  2C0I A;  2RQV A;  1QKX A;  4F16 A;  2RNA A;  2KGT A;  1AEY A;  4J9E A;  2KRM A;  2OAW A;  1ABO A;  2K79 A;  1ABQ A;  1NLO C;  1M30 A;  5IXB A;  2O2O A;  4HVV A;  1AWW A;  3UAT A;  4M4Z A;  1RUW A;  2DRK A;  2A28 A;  2RQR A;  1UDL A;  2EGE A;  2LJ3 A;  3M0P A;  1FYN A;  3THK A;  3UA6 A;  1W70 A;  4F14 A;  2VVK A;  1QLY A;  2RMO A;  4QT7 A;  1K76 A;  3RBB B;  2L3S A;  1X43 A;  3VS1 A;  1K9A A;  1NEG A;  2JMA A;  2M0Y A;  2LX7 A;  2EQI A;  4GBQ A;  1MV0 B;  3ZL7 C;  4AFQ C;  1H3H A;  1K0S A;  2X3X D;  2JTE A;  4RUG A;  1JO8 A;  2CH4 W;  1K1Z A;  3SHW A;  2F2V A;  5I11 A;  1X27 A;  2VKN A;  1KSW A;  1YN8 A;  2DBK A;  1GCP A;  1T0J A;  2JS2 A;  1ZSG A;  2VWF A;  1AZG B;  1B3Q A;  2CT4 A;  3EG2 A;  1LCK A;  1S1N A;  1BB9 A;  1X6B A;  2IIM A;  1NM7 A;  1I1J A;  2EGC A;  3TSW A;  2EKH A;  2KRO A;  2JW4 A;  1GBR A;  4OMM A;  2KEA A;  2RQW A;  4RTT A;  1GFD A;  2KBT A;  3M0Q A;  1V1C A;  1JU5 C;  1E6G A;  1VYV A;  2CSQ A;  2W0Z A;  2GQI A;  2K7A A;  1UGV A;  2DF6 A;  1YWP A;  1H8K A;  3H0I A;  2K3B A;  5IHN A;  2W10 A;  1PHT A;  2M51 A;  3ULR B;  1Z9Z A;  1UJY A;  2FO0 A;  2QDL A;  2GBQ A;  2CT3 A;  3EHR A;  4AFU C;  1PRL C;  3I5R A;  2H8H A;  1UEC A;  5IHK A;  1YP5 A;  2LCS A;  2A36 A;  4CC3 A;  1OV3 A;  2L3P A;  2DL5 A;  2LMJ A;  3I9Q A;  2EPD A;  3NHN A;  4A63 B;  3CQT A;  2A37 A;  1UFF A;  2HDA A;  1KJW A;  2KXD A;  4OMO A;  1PRM C;  2V1Q A;  4JJB A;  4Z8A A;  1M3C A;  2KRN A;  3O5Z A;  4X1V A;  2KXC A;  4DEY A;  1M8M A;  3NPF A;  3KFV A;  3VS4 A;  5L23 A;  2KYB A;  1VA7 A;  4J9F A;  2GTJ A;  5IH2 A;  2J06 A;  3RNJ A;  2GNC A;  1Y0M A;  1PWT A;  3QWX X;  1W1F A;  2DL8 A; 
#chains in the Genus database with same CATH topology
 3VYH B;  3VRZ A;  2RHZ A;  3L42 A;  4C8Q C;  2X4Y A;  4K11 A;  1RAI B;  2KE9 A;  3CCR A;  1TTH B;  1AWX A;  4AFZ C;  3EFS A;  2DJZ A;  2VUB A;  2HSE B;  4JPB W;  2ECZ A;  1G3T A;  1WLP B;  3CCL T;  3IQL A;  2YUP A;  3OYL A;  1ZUK A;  2DD5 A;  4ELY C;  1LPL A;  4B6M A;  1M90 C;  3OMC A;  3OB9 A;  3FC3 A;  5GAO m;  2DYI A;  3T9N A;  1RLP C;  4JJD A;  1RAA B;  3AT1 B;  3FDR A;  3VS3 A;  5I22 A;  2AHJ B;  4J7F A;  3SB2 A;  3C94 A;  2P0P A;  2DL7 A;  1RL2 A;  4N4G A;  5GAM g;  3JCM J;  4JJC A;  5CKE A;  5GMK l;  3CC7 Q;  2OTL A;  3A1P A;  1D09 B;  4M75 E;  5FWC A;  4XTZ A;  1AHJ B;  4QQG A;  2XIC A;  2YRV A;  1EZZ B;  3PMT A;  3LH5 A;  1CSK A;  1JJ2 S;  3MKD A;  2EGA A;  2JJ9 A;  3H0H A;  3CC2 A;  2CUB A;  2K6D A;  5M9O A;  4PK4 A;  5DLQ E;  3FB9 A;  1VQ5 A;  3NTI A;  2ZPI B;  3CBP A;  4AG2 C;  4BD3 A;  2CP5 A;  1Q7Y U;  4M7D E;  3G7Z A;  4RTZ A;  2COY A;  4IUU A;  2NUT A;  2JM9 A;  2ZPF B;  3OYI A;  1OOT A;  1FMK A;  2YDL A;  2K9G A;  1I81 A;  1YI2 Q;  4F7U E;  8AT1 B;  1BCO A;  4DQ2 A;  1GXI E;  4OGC A;  4OF1 A;  1YFN A;  5LJ3 f;  4PJN A;  2R5A A;  4C92 D;  2EBP A;  2X3W D;  5GAN 5;  1OX8 A;  4ZTF A;  3A5Z B;  1VQ6 Q;  3S3N A;  1IO6 A;  4M75 G;  1Q7Y C;  2Y90 A;  4LXC A;  1MUZ A;  2DIL A;  1PKT A;  4FYY B;  4C0D C;  3FEO A;  4N0A A;  2EAY A;  1VQM A;  1M3B A;  2CRE A;  2WSE E;  3G6E Q;  1IRE B;  4BE2 A;  2QQS A;  2MPX C;  3CPW P;  4J9C A;  2DRM A;  4WF2 A;  2LJ1 A;  1MV3 A;  3BY7 A;  1SSH A;  5GAO q;  4M7D G;  4C8Q D;  4IUP A;  4KUD K;  1NZ9 A;  3HP9 A;  4RG2 A;  2X4X A;  4Z02 A;  3M54 A;  3OYJ A;  1NG2 A;  1JQQ A;  3VJP A;  2RK2 A;  2QI2 A;  1K73 U;  1Q7Y R;  1G3W A;  1NEB A;  3N5B B;  1VIE A;  3E9G A;  1H64 1;  3JCM W;  1SHG A;  4C92 B;  2A7Y A;  5LJ5 g;  2EVR A;  4M78 C;  2RA2 A;  4RCC A;  2QQA A;  2A3L A;  3NMZ C;  1KQS P;  1S72 Q;  1SHF A;  2RPN A;  3RKX A;  3F70 A;  4E7Z A;  3L1A A;  1OI1 A;  3NTH A;  5KYY B;  1TG0 A;  3MCA B;  4M78 F;  3EGD B;  2XHC A;  2E64 A;  3PIO A;  1B34 A;  2AZS A;  2OI3 A;  2HBW A;  3QZ5 B;  2JTF A;  3CCV T;  3CXC S;  1K73 C;  4C5H A;  2BTT A;  3EG1 A;  3VRY A;  2QQ9 A;  1WPY A;  3VU3 C;  1ZSZ B;  5LJ3 d;  2BE9 B;  1QWE A;  2PU9 B;  3M4Y A;  3SWN A;  2D8J A;  3FJ5 A;  3E1S A;  1WHM A;  5LJ3 e;  4C8Q B;  1KHI A;  2AK5 A;  3TEE A;  2QGF B;  2DE0 X;  1QCF A;  3WXM B;  2ESW A;  4JZ3 A;  5KYX B;  1YJW Q;  1QVG S;  2LCL A;  4A4G A;  1F1B B;  1VYT A;  2EQU A;  4C0Z A;  1DJ7 B;  2GQV A;  2RI2 A;  2PNI A;  2OJ2 A;  1VQ4 A;  1VQ8 T;  3CCJ Q;  1PSF A;  2DXB A;  3MP8 A;  2EWN A;  4XU1 A;  3CCM A;  2EYY A;  1K73 R;  4UC4 A;  2KK4 A;  2YUQ A;  5KYU A;  1BBZ A;  1EFN A;  1X6O A;  3GOX A;  3H41 A;  4RTX A;  4L6V 5;  4JDS A;  2DLP A;  1GBQ A;  3QSU A;  3E9F A;  3EH2 A;  2LQK A;  4EMG A;  1KQ2 A;  2XU8 A;  2M16 A;  2KR3 A;  1YWO A;  2DTI A;  4OP0 A;  2ROT A;  2E70 A;  2F2W A;  3E2U A;  2JMC A;  5GMK j;  4XAX B;  2X9H A;  3I35 A;  3M55 A;  3OSS C;  4OML A;  1QVF A;  2HBP A;  1ZUY A;  4FW2 A;  2P0K A;  3PVQ A;  4C8Q E;  1UG1 A;  3CC4 Q;  3CC7 T;  1W2B A;  2DM1 A;  3VS7 A;  3OYN A;  2FPF A;  4E7H A;  2EJF A;  4BUG A;  2C0T A;  2EIF A;  2CP7 A;  5FRM A;  1AWO A;  2OTJ Q;  3ZBD A;  5CKB A;  2RM4 A;  3JB9 J;  4F16 A;  3J80 E;  2GCX A;  2K79 A;  4KGV B;  1M30 A;  4M78 D;  4DBF A;  5GAM f;  1QMC A;  4C92 G;  3CCE A;  1MHN A;  1QVP A;  2RQR A;  1I5O B;  3TU4 K;  4M75 C;  4JUV A;  3VYG A;  2X4W A;  2RMO A;  4QT7 A;  5FRO A;  1K76 A;  2L3S A;  3V7S A;  5KYW A;  4M75 F;  3M57 A;  2JMA A;  3JRZ A;  4QVZ A;  2XG8 D;  3FRN A;  5CO7 A;  2JTE A;  3MET A;  2M1H A;  2QA4 A;  4BE0 A;  1YN8 A;  3WVD B;  3QKJ A;  2DEU A;  1T0J A;  4M7D C;  5GAN j;  2LQ8 A;  4ZGE B;  3L2Z A;  1NM7 A;  4C8Q G;  3DLM A;  4M7D F;  2EKH A;  2KRO A;  2JW4 A;  5C6S A;  2RQW A;  2ZPH B;  4RTT A;  3CC2 T;  4E7S A;  3OYD A;  5GAN 4;  1QP3 A;  3M0Q A;  2CP3 A;  2NUP A;  1Y7X A;  1R8O B;  1UGP B;  3PFS A;  1VYV A;  1VQ5 T;  1XNI A;  4M78 B;  4ANJ A;  4F7U F;  3A8G B;  3H9N A;  1R0C B;  1G5V A;  3RMS A;  5LJ3 g;  5GMK h;  1Z9Z A;  2GBQ A;  2CT3 A;  5GAN 6;  1JBM A;  2L8D A;  2PVO B;  1N9R A;  2H8H A;  1N9S A;  3CMA Q;  4KUL A;  2LCS A;  2HKQ B;  5CVI A;  4MMK A;  2EPD A;  1I8F A;  1YIT A;  3M53 A;  2HDA A;  1B7T A;  1MMD A;  4Z8A A;  1M3C A;  2KVQ G;  3KXT A;  3NPF A;  3KFV A;  5L23 A;  1VA7 A;  1V29 B;  4HCZ A;  5IH2 A;  1RAH B;  2HQE A;  1WHL A;  1Y0M A;  3QWX X;  1W1F A;  1YHQ A;  2LQN A;  4Z88 A;  2C06 A;  4J9I A;  2F2X A;  5GAO r;  1QCO A;  3L2V A;  2P4R A;  4CC4 B;  4LNP A;  2RHI A;  2D0Q B;  4LE9 A;  1JXO A;  4HKE A;  5LJ5 f;  3REB B;  3OS1 A;  2J6O A;  4Z89 A;  4J9G A;  1WXU A;  2DVJ A;  3OA6 A;  1NPP A;  1O9S A;  2Z0W A;  3JB9 I;  4IKF A;  3DKM A;  1QWF A;  3ME9 A;  4J6X A;  3QXE B;  4M75 A;  5GAN h;  3M58 A;  3MJX A;  3OQ5 A;  1R77 A;  2CP0 A;  2M02 A;  3OMG A;  3JCM V;  1U1S A;  1YBY A;  2J05 A;  2J7I A;  2MIO A;  1YIT Q;  3EGU A;  2GFU A;  4ORZ A;  3VS5 A;  2G6F X;  4E2F B;  2QEX A;  2R58 A;  1WJS A;  4AFS C;  3GNG A;  3EG3 A;  4BDY A;  3EG9 A;  3JCM h;  4BI4 A;  2EW3 A;  3CCJ T;  1UGR B;  3L2Q A;  2NUZ A;  1OX9 A;  3UF4 A;  2J6K A;  3R6O A;  1Q81 R;  5A0L A;  3C95 A;  3P8D A;  2IPO B;  4M7D A;  2CZ6 B;  1Q86 U;  2QK0 A;  2LNV A;  2DNU A;  3UA7 A;  4EMH A;  2E3I A;  5IT9 E;  3NGP A;  2HEQ A;  4Q5W A;  4CC7 A;  1ZLM A;  3M0T A;  1WXT A;  3PIP A;  1JJ2 P;  4BI3 A;  1AT1 B;  1CKB A;  3CCV Q;  2MWO A;  2NWM A;  1VQO A;  1VQK A;  3CEY A;  4M77 B;  1JEG A;  2EFI A;  2MOX A;  1D1C A;  1IGU A;  4FL6 A;  1SRM A;  5CQX A;  2PQW A;  2EJ9 A;  1X2K A;  4M78 G;  1V76 A;  1WDX A;  3CCS A;  1Q86 C;  3P8H A;  1RAB B;  3BFM A;  3HRT A;  5FWB A;  2O9V A;  3OW2 A;  1RAF B;  4C92 F;  1QVF S;  2AT1 B;  3V7C A;  3H0F A;  3LX7 A;  1VQ4 T;  3MP1 A;  1W2B S;  1KD1 U;  3EH1 A;  2PVG B;  1M90 U;  2OTJ T;  5LJ5 d;  3CCM T;  3QBY A;  5GAM h;  4C5I A;  4BB7 A;  5CR2 A;  1M3A A;  3DLL A;  3EAE A;  5A0G A;  2CKK A;  2VGN A;  3BDU A;  1ZSZ C;  4HXJ A;  2RD1 A;  5D7U A;  4P5N A;  2L89 A;  4FU6 A;  1U3O A;  1TXQ A;  1FMW A;  2ENM A;  4RMO A;  3VS0 A;  2HSP A;  1QP2 A;  2DXC A;  4EMK B;  1CKA A;  2Y4X A;  1Q86 R;  3PTA A;  3OYM A;  2HD0 A;  1VQO Q;  4F7U B;  4C8Q F;  4PFZ A;  5CAI A;  1KIK A;  1H3Z A;  3CPW A;  5FU7 B;  2E5K A;  1U5S A;  2QQR A;  2BIV A;  1KD1 C;  3CCU A;  1WYX A;  3EHQ A;  3LLR A;  2Y4Y A;  3G71 A;  4B9X A;  1AD5 A;  1VQ9 A;  2DBM A;  4M77 E;  3TQ7 P;  2VGM A;  3PVL A;  3G4S A;  2RN8 A;  4OMN A;  5GAO l;  4JJN K;  1TOV A;  1N8R C;  2FRY A;  4IIM A;  4MML A;  4EPC A;  2L0A A;  4F17 A;  3SDZ A;  2DMO A;  4DBQ A;  2E41 A;  4E47 A;  2L2P A;  2JVV A;  4II1 A;  1AWJ A;  4J9D A;  4IUT A;  2PZ1 A;  1SRL A;  1X75 C;  3ASK A;  3MO8 A;  4XTU A;  2KYM A;  2G3R A;  4QVC A;  2DEQ A;  3CCE T;  4LUD A;  2WSC E;  1KD1 R;  2DZC A;  4GLM A;  1M90 R;  3QPH A;  2PUO B;  4GLK A;  3CCR Q;  1FMV A;  1NJI U;  2LJ0 A;  2V26 A;  2QGG A;  2YRC A;  3CMA T;  3X28 B;  4LDX A;  3CXC P;  3OBY A;  3REA B;  3OYC A;  2E4H A;  2CDT A;  2GTO A;  2VC8 A;  3I56 A;  2LC4 A;  1WXB A;  3X26 B;  2RI5 A;  1N5Z A;  1ZX6 A;  4YTL A;  2QA4 T;  2FZK B;  2DYB A;  3SEM A;  4C92 A;  3VUB A;  3BDL A;  3QDR B;  1PM3 A;  3VKI A;  4AMC A;  1QVG P;  2VYT A;  5GAO n;  3C4S A;  1I0C A;  3V8J A;  2OTL Q;  4PJL A;  2GF7 A;  5CK9 A;  5KYY A;  4WTO B;  5DM7 R;  1NJI C;  3EGD A;  1GCQ C;  2JOY A;  3LH0 A;  1OZ3 A;  3RDV A;  1OPK A;  2NYS A;  1MNE A;  3CC2 Q;  2DL4 A;  1D0Y A;  5LJ5 h;  4JRQ A;  2KAF A;  3C12 A;  1WHJ A;  1VQ5 Q;  4LD9 K;  1G3S A;  1TWB A;  2X35 A;  2EYX A;  3EGX B;  1ZSZ A;  1YIJ A;  1QKW A;  2FL7 A;  3S6W A;  2FPD A;  4R56 A;  2LZ6 B;  3G1J A;  2K3X A;  3CCQ A;  4A4E A;  1VYU A;  4AG1 C;  4C8Q A;  1NLP C;  4X34 A;  1UEB A;  5KYX A;  3QYG B;  3GBQ A;  2BKD N;  4JS5 A;  2RK1 A;  4MZM A;  2VB6 A;  1YIT T;  1J3T A;  2EQK A;  5IN1 A;  4PJO D;  2SEM A;  2HL3 A;  1NJI R;  2CYZ B;  5D6W A;  4HVU A;  1IGQ A;  1LOJ A;  4F7U G;  1HJD A;  2MYS A;  1HD3 A;  1IHW A;  3M0R A;  2C0I A;  3JAM E;  1QKX A;  1AEY A;  3JSC A;  1ABO A;  1NLO C;  2KY9 A;  3RR6 A;  2A28 A;  3O8V A;  1OZ2 A;  2OX7 A;  2FZC B;  1YJ9 A;  5DY9 A;  1VQM Q;  4A53 A;  1QLY A;  4XTY A;  3RBB B;  3GNF B;  1X43 A;  3VS1 A;  4A4F A;  2JNG A;  4GBQ A;  3TCJ A;  5GMK i;  4RUG A;  4J83 A;  1M9S A;  1JO8 A;  2CH4 W;  4C0F A;  3SHW A;  5I11 A;  3NFC A;  5CIU A;  1TSF A;  1U1T A;  1GCP A;  4E7L A;  1I5L A;  4FYW B;  5AT1 B;  1S1N A;  3OYY A;  3MEU A;  1VQP A;  1PD1 A;  2QEX T;  4PJO B;  3OW2 S;  3TSW A;  3JCM b;  4J6W A;  1GBR A;  3RMQ A;  1M4Z A;  4OMM A;  4OGE A;  4GY5 A;  5AYF A;  1GFD A;  3L2U A;  1JU5 C;  1BCM A;  2I2L A;  2ZCF B;  2EKO A;  9ATC B;  2QAS A;  2GQI A;  2K7A A;  2LTO A;  1YWP A;  2K57 A;  3HRU A;  2K3B A;  1VUB A;  2W10 A;  1PHT A;  2M51 A;  2QDL A;  3PT9 A;  1VQL A;  3EHR A;  4OB1 B;  5KE3 A;  1ZHI A;  3I5R A;  1VQO T;  5IHK A;  4DBH A;  3V8L A;  1D3B B;  1OV3 A;  2L3P A;  3GLX A;  3NHN A;  1HK9 A;  3Q1J A;  3MEV A;  3VV0 A;  1Y71 A;  1UFF A;  1FWZ A;  4OMO A;  4MZT A;  2V1Q A;  4JJB A;  4LDY A;  3CCS T;  4FW1 A;  4X1V A;  2KXC A;  4C5E A;  3M59 A;  2YHT A;  5L8R E;  2H3E B;  1LJO A;  1HYO A;  3M5A A;  3RNJ A;  1VQN A;  3OYH A;  3CCL A;  4MDX A;  4BY6 C;  2DXU A;  1VQ4 Q;  4OMF B;  1D0X A;  1HXD A;  3UWN A;  1JRI A;  2H3J A;  1P92 A;  2AKL A;  2D8H A;  3TVT A;  4DA4 A;  3OBW A;  4PJO E;  3CCM Q;  2FEI A;  4RKU E;  4ZTJ A;  2GGR A;  1TS9 A;  1X2Q A;  4M78 A;  4M77 C;  2KDS A;  2YWW A;  3ZFJ A;  2L3Q A;  2QYZ A;  2RF0 A;  1WQ7 A;  4OB3 B;  1JB0 E;  3JB9 H;  2K5L A;  3CCR T;  1WI7 A;  4M77 F;  1A0N B;  4DEX A;  4Y92 A;  1AOJ A;  1XQH A;  3U23 A;  2LRQ A;  2PVD B;  4J9B A;  3X25 B;  2D0N A;  2LP5 A;  4KH1 B;  5A2Q E;  5CCA A;  4M7A D;  3OYB A;  2HAX A;  4J7I A;  2K5I A;  2RO0 A;  5EC7 A;  3CCU T;  1T0H A;  5LJ3 h;  4L59 A;  4ESR A;  1GRI A;  2CSI A;  1PNJ A;  1QQJ A;  1WNL A;  1WX6 A;  2DL3 A;  2YLB A;  3G4S T;  4ZN1 A;  1B07 A;  3ZEH A;  1VQN Q;  2OTL T;  2V8I A;  3C0C A;  5LL6 S;  3H8Z A;  1IHV A;  2HZY A;  3LGL A;  3FIF A;  4NOY A;  2DX1 A;  1KQ1 A;  2RI3 A;  4EMK C;  2A08 A;  2ABL A;  4ME7 A;  2BZY A;  1SPK A;  1T3S A;  2O4X B;  2O88 A;  2F69 A;  4PJO G;  2F1L A;  2D9T A;  5GAO p;  5FU7 C;  2ED0 A;  1WIE A;  2LDM A;  5HK3 A;  2YUO A;  1BI0 A;  3PE0 A;  3CCE Q;  4C5G A;  3S3M A;  2LNH B;  5J39 A;  4JRP A;  4XTW A;  1OU8 A;  4PNO A;  3RER A;  2DIG A;  1ACM B;  5IAY A;  3I55 A;  1BU1 A;  2X51 A;  4M7A B;  1D0Z A;  2QG9 B;  1YCS B;  3M56 A;  1X6G A;  3E19 A;  2KT1 A;  1UJ0 A;  1PC0 A;  4HCK A;  3OYE A;  2QA4 Q;  2XDD A;  3I5S A;  2XKO C;  2LCC A;  4BI8 B;  2RJD A;  5KYN A;  1Y96 B;  3OYG A;  4Y28 E;  4O6J A;  2CZ1 B;  3VS2 A;  1RLQ C;  2KRS A;  1K8A U;  1QVF P;  3RUX A;  1PG5 B;  4V2S A;  1G2B A;  2JT4 A;  2XDB A;  4NL3 A;  2DER A;  2VXE A;  2XID A;  5I2M A;  3MP6 A;  2B8A A;  1W2B P;  1G83 A;  2BZ8 A;  1VQM T;  2C0O A;  4J6Y A;  2FG0 A;  1UE9 A;  1AVZ C;  1RAD B;  1RI9 A;  2CGH A;  5GAM j;  1OPL A;  3CCQ T;  4M77 A;  4MDW A;  1OUL A;  2X4J A;  4M77 D;  2L3R A;  3UPU A;  3JV3 A;  4ZNX A;  2EJG A;  1JXM A;  1FXX A;  4IUQ A;  4JZ4 A;  4VUB A;  2M9U A;  2E1H A;  2MWP A;  2DJQ A;  1WJR A;  4DOV A;  1K8A C;  1UHC A;  5IHI A;  1KK7 A;  4ZGJ B;  4XQ3 A;  2COZ A;  3CME A;  5J26 A;  5HK0 A;  4A54 A;  1C6V X;  2MK5 A;  4WCI A;  4M7A E;  3MPU B;  2O9S A;  2DA9 A;  3BW1 A;  2CZ7 B;  2ATC B;  2DK3 A;  1YHQ Q;  3MEA A;  3QYH B;  1N27 A;  4L5G A;  2JS0 A;  5GAN 3;  4NL2 A;  1YJ9 T;  4RTU A;  4BY6 B;  1U06 A;  4EMK A;  2HNI A;  3JCM c;  3EG0 A;  4FIB A;  4F7U A;  2BZX A;  2HL5 C;  3M0U A;  2E3H A;  2E10 A;  4FYX B;  1X69 A;  1UGQ B;  1GFC A;  4HVW A;  3M0S A;  1WQW A;  1AZE A;  4RTV A;  3QZ9 B;  2V8K A;  4DBR A;  5FW9 A;  1TU0 B;  4LDW A;  2DZ9 A;  3JB9 F;  3VS6 A;  4XU2 A;  5GAN g;  1VQP T;  3BE3 A;  5ECA A;  4D6W A;  3CME Q;  2QEX Q;  2WSF E;  1KC8 U;  4JLI A;  3D7S B;  1M8V A;  4TVR A;  8ATC B;  2ZZD A;  3CBM A;  2XD0 A;  1ZBX A;  2E6N A;  5CKF A;  4M7A G;  3A8H B;  3OS0 A;  2DXT A;  2AIR B;  3M9Q A;  2RB6 A;  5HCK A;  4PLI A;  4XTV A;  2JXB A;  4XTX A;  2RJE A;  3QUI A;  1UUE A;  3CC7 A;  2DTH A;  3EFO B;  1VQL T;  4EIK A;  2GFA A;  5DLO A;  3HHT B;  1N8R U;  3SFM A;  4N4H A;  1BK2 A;  1WHG A;  1XJW B;  5LJ5 j;  2LT1 A;  1VQK Q;  1ZQ1 A;  2O31 A;  1KC8 C;  4PJO C;  2DAQ A;  4R0K A;  2E65 A;  3L2R A;  3LW5 E;  4Y91 A;  2P0Q A;  4PJO F;  3QWY A;  5GJV B;  3CCS Q;  4AT1 B;  3V7R A;  4QW2 A;  4BDZ A;  1C0M A;  2RQV A;  1M2V B;  2RNA A;  1VQN T;  2KGT A;  2KRM A;  1ABQ A;  5IXB A;  4HVV A;  1AWW A;  4M4Z A;  4E7K A;  1UDL A;  3M0P A;  3UA6 A;  5GMK m;  1YI2 A;  1IZ6 A;  2E5Q A;  2DIQ A;  1VQ7 A;  1VIF A;  1WJQ A;  2HMA A;  4RG8 A;  1KQS A;  4HCB A;  2VVK A;  1KC8 R;  2D6F A;  3EGX A;  1MV0 B;  2LT4 A;  4LDV A;  2P84 A;  2X3X D;  4E7J A;  1VQ6 A;  4ATO A;  1K1Z A;  4FSX A;  3URG A;  1X27 A;  2VKN A;  6AT1 B;  2QTX A;  2V8J A;  1M1F A;  2XK0 A;  2VWF A;  5CQY A;  3EG2 A;  2L5Q A;  4PKC C;  1BB9 A;  1X6B A;  2IIM A;  2BUD A;  3G6E A;  2EGC A;  1N8R R;  5J3B A;  3CCU Q;  3SWN C;  2ZPE B;  2RJC A;  4BAC A;  4XU3 A;  3G71 Q;  3JB9 D;  2K2V A;  4JRI A;  4B9W A;  5GAN 8;  1TH7 A;  1VQ9 Q;  1V1C A;  1SF9 A;  4M77 G;  2CZ0 B;  1E6G A;  3G4S Q;  1BYM A;  2ZGW A;  2RHY A;  3HFN A;  1UGV A;  2K5F A;  3OW2 P;  1H8K A;  1Y07 A;  5KCO A;  3CD6 A;  2DTO A;  1VQ7 Q;  3ULR B;  2A0F B;  5HKC A;  1UJY A;  2FO0 A;  2RHX A;  4AFU C;  2CP6 A;  1K9M U;  1YP5 A;  4CC3 A;  2A36 A;  2DO3 A;  3FJP A;  2DL5 A;  2LMJ A;  1S72 A;  2KMT A;  1IB8 A;  3CQT A;  3I55 T;  1TUG B;  1KJW A;  2KXD A;  4OB2 B;  2DVE A;  3OSV A;  4QQ6 A;  3O5Z A;  4KH0 B;  4DEY A;  4A4K A;  3SD4 A;  2MMP A;  3VS4 A;  4J9F A;  2GTJ A;  3HL8 A;  2J06 A;  3I56 Q;  2IVW A;  5CKD A;  4PJO A;  3QHS A;  2DL8 A;  1ZA2 B;  4BE1 A;  1Z9Q A;  5CKH A;  1K9M C;  1BI1 A;  1MGQ A;  3PNW C;  2YUN A;  1RAE B;  4FYV B;  2NUT B;  1MMN A;  2DD4 A;  1YJW A;  1YHQ T;  1PD0 A;  4OMQ A;  3CD6 Q;  1KHC A;  1MND A;  1QCN A;  4IUR A;  2QXF A;  3TRE A;  3LWI A;  4FCY A;  2FB7 A;  1RAC B;  5A0D A;  3CPF A;  3CCJ A;  1YJN A;  4E7I A;  4M7A C;  4XK8 E;  1IRX A;  3OS5 A;  1D3B A;  4J8O A;  2IG0 A;  4RTW A;  1YIJ Q;  4X9C A;  2R57 A;  2JM8 A;  3OYA A;  1K4U S;  4PLL A;  7AT1 B;  3CCQ Q;  5FU6 C;  1T3L A;  4M7A F;  1GL5 A;  3QG1 A;  5GAN 7;  2MCN A;  2FZG B;  1K9M R;  4EDU A;  3LGF A;  2CP2 A;  1YNZ A;  1BKB A;  4QKU A;  1I07 A;  2VV5 A;  3CME T;  4ZGD B;  1IXD A;  1BI3 A;  1N6A A;  1O75 A;  4KT0 E;  2ED1 A;  1LNX A;  4LUE A;  2AZV A;  2EYZ A;  3MHX A;  5LJ3 j;  2V1R A;  1Q95 G;  4KUI A;  4QQD A;  2KNB B;  1VOM A;  1BIB A;  1W6X A;  2DPP B;  2RQU A;  4JS4 A;  3HPW A;  3QO3 A;  2D1X A;  5D6X A;  5GAN f;  1Y57 A;  1WHK A;  2RH2 A;  3CC4 A;  5FRN A;  1YJ9 Q;  3INZ A;  1GCQ A;  4OMP A;  1NPR A;  4NS5 A;  2QTV A;  1ZUU A;  1YJN Q;  3PGG A;  3P8B B;  4KGX B;  2YRD A;  2NLU A;  3KUF A;  1QW1 A;  1I4K 1;  2OTJ A;  3GIB A;  3LWH A;  3ER0 A;  1VQK T;  3QJ6 A;  1WFW A;  3M4G A;  3JCM f;  1NBE B;  3PMI A;  2QQB A;  4JLG A;  3CPW S;  4D8K A;  3TSZ A;  3QII A;  4C92 E;  5IXF A;  1WZO A;  2F5K A;  2DET A;  2LQW A;  2M0O A;  2JUF A;  4RTY A;  1B34 B;  1SKU B;  3HRS A;  5GMK e;  4E6R A;  1VQP Q;  1YCY A;  1M1G A;  3HTR A;  2I0N A;  2PUK B;  1M1K U;  4IUV A;  1WGS A;  3X20 B;  3SWN B;  4IIO A;  2O4X A;  2FVU A;  3R6N A;  1NE8 A;  4C0G A;  3X24 B;  5I21 A;  1KQS S;  3JB9 G;  2CUD A;  2AKK A;  4QVD A;  4R55 A;  2HQH A;  1BIA A;  1G8X A;  5GAN 2;  1X01 A;  1BI2 A;  2KT8 A;  4N4I A;  1ZA1 B;  1VQL Q;  4A4H A;  1M5Q 1;  5C0M A;  3A8O B;  2MI6 A;  1LVK A;  1SG5 A;  1M1K C;  4M7A A;  4HA8 A;  2FHD A;  4D8D A;  2KQW A;  3J81 E;  2E6Z A;  1MMA A;  5KYU B;  2FPE A;  2YSQ A;  2MF2 A;  2ROL A;  4F04 B;  3G71 T;  1TUD A;  3UT1 A;  2HKN A;  4DOW A;  3J7A F;  1VQ9 T;  3HSB A;  1Y96 A;  4CI0 C;  4LN2 A;  5GAN d;  5GJW B;  1PSE A;  2BE7 D;  4C0D B;  1NYG A;  2XMF A;  1Q82 U;  2DFU A;  4ELZ C;  3NTK A;  1ZBJ A;  5GAN e;  2K3Y A;  3MEW A;  3FLG A;  3JCM X;  3CCL Q;  1TUC A;  2EYW A;  3CMA A;  4FT4 A;  1E7O A;  2KI7 A;  3OS2 A;  4KGZ B;  2RJF A;  4PL6 A;  1YI2 T;  1VQ7 T;  3JCM d;  2F5T X;  2SRC A;  2LX9 A;  4KRT A;  1OU9 A;  3H6Z A;  3JCM e;  1E6H A;  2P4T A;  1M27 C;  1M1K R;  1R0B G;  3DB3 A;  2DKG A;  2QDY B;  2FRW A;  3CBO A;  1XTD A;  1VQ6 T;  2K2M A;  2YT6 A;  2ZPB B;  2HCK A;  4XU0 A;  4HCC A;  2PTK A;  1M2O A;  2ZPG B;  4ZN3 A;  4CC2 A;  1JJ2 A;  4FM4 B;  1XOV A;  1W4S A;  5FLX E;  1Q82 C;  2EQM A;  2LVM A;  2JTM A;  5EG2 A;  3A8M B;  4O5V A;  2QAZ A;  3RES A;  1MMG A;  1OEB A;  3OYF A;  3I56 T;  3G6E T;  1HSQ A;  3A98 A;  1PCX A;  3DB4 A;  2RQT A;  1PKS A;  2EQJ A;  1WHH A;  5FU6 B;  1ARK A;  4PFP A;  1SSF A;  3LYI A;  4OB0 B;  4LDU A;  1WA7 A;  5KE2 A;  1OQK A;  1KFZ A;  2YXY A;  3QDF A;  5KYW B;  1Q81 U;  1UB4 A;  4KBM B;  3CD6 T;  1SEM A;  1UHF A;  3QJY A;  1H92 A;  3WVE B;  2CH4 A;  3S3O A;  1Q82 R;  4J9H A;  2R5M A;  1EIF A;  4RCB A;  3RKY A;  5GAM d;  2XI9 A;  1UTI A;  1YIJ T;  1S72 T;  4X9D A;  5GAM e;  5I2S A;  3L2W A;  2KSS A;  1OYX A;  1NYF A;  1K0X A;  3JCM Q;  3I55 Q;  4FSS A;  2J6F A;  2CS7 A;  2E12 A;  2B86 A;  2EYQ A;  2NUP B;  1EX4 A;  1Q81 C;  3CCV A;  4J9E A;  2OAW A;  2O2O A;  3UAT A;  1RUW A;  2DRK A;  2EGE A;  2LJ3 A;  1FYN A;  3THK A;  1W70 A;  3OY9 A;  2JN0 A;  3GPL A;  1KG1 A;  4M78 E;  4F14 A;  2RHU A;  4M75 D;  2WAC A;  2VAS A;  1YJW T;  4LD6 A;  1K9A A;  1NEG A;  2M0Y A;  2LX7 A;  2EQI A;  3GF5 A;  3RKW A;  3ZL7 C;  4AFQ C;  1H3H A;  1K0S A;  3EFO A;  1RAG B;  3V8K A;  2F2V A;  1YJN T;  2O01 E;  1KSW A;  3A8L B;  1VQ8 A;  2DBK A;  2JS2 A;  1K8A R;  1ZSG A;  1AZG B;  1B3Q A;  2CT4 A;  4PFO A;  1LCK A;  4M7D D;  2YLC A;  1I1J A;  1FX7 A;  4J5Y A;  5KCH A;  3HKS A;  2KEA A;  2KBT A;  3CXC A;  2COW A;  3JCM P;  1M2V A;  1D1B A;  2VXF A;  3UDC A;  2ZAE A;  2FYK A;  2CSQ A;  2W0Z A;  5D6Y A;  1RI0 A;  3EFR A;  4PJJ A;  2DF6 A;  3H0I A;  2K4Y A;  4MZP A;  3GP8 A;  1G3Y A;  5IHN A;  1U8R A;  1C1A A;  2MAM A;  4C92 C;  4OVA A;  3JCM g;  3RIR A;  4M75 B;  4PJM A;  1QVG A;  3AHU A;  4FT2 A;  1PRL C;  3HFO A;  1UEC A;  3I9Q A;  3KBG A;  3CC4 T;  4A63 B;  1UGS B;  1D1A A;  4CRI A;  2A37 A;  2JZ2 A;  2OAU A;  5KH6 A;  1PRM C;  3EG9 B;  3OYK A;  2KRN A;  1VQ8 Q;  4N0A C;  3VUZ A;  1M8M A;  5HY6 A;  2KYB A;  5LJ5 e;  2XDP A;  4M7D B;  2GNC A;  4HT9 A;  4JRK A;  4HT8 A;  1PWT A;  2HQX A; 
#chains in the Genus database with same CATH homology
 2LQN A;  4Z88 A;  4J9I A;  2F2X A;  3VRZ A;  4K11 A;  2KE9 A;  1Z9Q A;  2AKL A;  2D8H A;  3TVT A;  2P4R A;  4CC4 B;  1AWX A;  4AFZ C;  2FEI A;  2YUN A;  4LNP A;  4JPB W;  2ECZ A;  2GGR A;  1WLP B;  1X2Q A;  3IQL A;  4LE9 A;  1JXO A;  4OMQ A;  2YUP A;  3REB B;  2L3Q A;  2RF0 A;  1ZUK A;  2J6O A;  4Z89 A;  4J9G A;  1WXU A;  2DVJ A;  1WI7 A;  1A0N B;  4DEX A;  1QWF A;  4Y92 A;  1AOJ A;  3U23 A;  4J9B A;  1RLP C;  4JJD A;  2D0N A;  2LP5 A;  3VS3 A;  5I22 A;  2DL7 A;  4RTW A;  2J05 A;  2J7I A;  2JM8 A;  2MIO A;  4JJC A;  1K4U S;  3EGU A;  4ORZ A;  5EC7 A;  1T3L A;  1T0H A;  3VS5 A;  2G6F X;  1GL5 A;  4ESR A;  5FWC A;  4AFS C;  3EG3 A;  1GRI A;  2CSI A;  2EW3 A;  1PNJ A;  2MCN A;  1WX6 A;  3LH5 A;  1CSK A;  2DL3 A;  2EGA A;  2NUZ A;  3H0H A;  2CUB A;  3UF4 A;  2J6K A;  1YNZ A;  1B07 A;  1I07 A;  2K6D A;  2DNU A;  3UA7 A;  3C0C A;  3NGP A;  2HEQ A;  2DX1 A;  4CC7 A;  4AG2 C;  2ED1 A;  1ZLM A;  4LUE A;  2AZV A;  2EYZ A;  3M0T A;  2A08 A;  2ABL A;  2V1R A;  1WXT A;  2BZY A;  4RTZ A;  1SPK A;  1T3S A;  2O88 A;  2KNB B;  1W6X A;  1CKB A;  2JM9 A;  2RQU A;  2ED0 A;  1WIE A;  2NWM A;  2D1X A;  2YUO A;  3PE0 A;  1Y57 A;  1OOT A;  1JEG A;  2LNH B;  1FMK A;  2YDL A;  2MOX A;  2K9G A;  1GCQ A;  1SRM A;  4OMP A;  1ZUU A;  1BU1 A;  1X2K A;  1WDX A;  2EBP A;  2X3W D;  1WFW A;  5FWB A;  2O9V A;  1YCS B;  1X6G A;  4D8K A;  3TSZ A;  1IO6 A;  2KT1 A;  3H0F A;  5IXF A;  1UJ0 A;  4HCK A;  3I5S A;  2LQW A;  1MUZ A;  2DIL A;  1PKT A;  4RTY A;  1M3B A;  4E6R A;  1M3A A;  2CRE A;  3VS2 A;  1RLQ C;  2I0N A;  4HXJ A;  2KRS A;  1U3O A;  2ENM A;  1G2B A;  4J9C A;  2JT4 A;  2DRM A;  2LJ1 A;  4IIO A;  1MV3 A;  3VS0 A;  2HSP A;  1G83 A;  2BZ8 A;  1SSH A;  2C0O A;  1CKA A;  2FG0 A;  3R6N A;  1UE9 A;  1AVZ C;  1RI9 A;  1KIK A;  1NG2 A;  1JQQ A;  2CUD A;  1OPL A;  2AKK A;  2E5K A;  1U5S A;  1NEB A;  2KT8 A;  3JV3 A;  4ZNX A;  1WYX A;  3EHQ A;  1JXM A;  1AD5 A;  1SHG A;  4JZ4 A;  2DBM A;  2DJQ A;  2EVR A;  4D8D A;  3PVL A;  1UHC A;  3NMZ C;  2RN8 A;  5IHI A;  1SHF A;  2RPN A;  2FPE A;  2YSQ A;  4OMN A;  2FRY A;  2ROL A;  4IIM A;  1TG0 A;  1TUD A;  2L0A A;  4F17 A;  4WCI A;  2DMO A;  2AZS A;  4LN2 A;  2L2P A;  5GJW B;  2O9S A;  2OI3 A;  2HBW A;  2DA9 A;  1AWJ A;  1NYG A;  2XMF A;  4J9D A;  1ZBJ A;  2PZ1 A;  1SRL A;  1TUC A;  2EYW A;  2BTT A;  3EG1 A;  3VRY A;  2KYM A;  1E7O A;  4LUD A;  4GLM A;  2JS0 A;  1QWE A;  2D8J A;  3FJ5 A;  4RTU A;  2SRC A;  1U06 A;  2AK5 A;  2LJ0 A;  3EG0 A;  2DE0 X;  4KRT A;  1QCF A;  1E6H A;  1M27 C;  2BZX A;  2ESW A;  4JZ3 A;  3M0U A;  2FRW A;  3REA B;  1X69 A;  1VYT A;  2CDT A;  1GFC A;  4HVW A;  2GTO A;  2K2M A;  3M0S A;  2YT6 A;  1AZE A;  2HCK A;  4RTV A;  2PTK A;  1WXB A;  5FW9 A;  4CC2 A;  1N5Z A;  1ZX6 A;  2PNI A;  2OJ2 A;  1XOV A;  3SEM A;  2DYB A;  3VS6 A;  2EYY A;  1OEB A;  2YUQ A;  1I0C A;  1BBZ A;  1HSQ A;  1EFN A;  5ECA A;  3A98 A;  2RQT A;  1PKS A;  3H41 A;  4RTX A;  1ARK A;  1GCQ C;  1OPK A;  2DLP A;  1GBQ A;  2DL4 A;  1WA7 A;  1KFZ A;  5HCK A;  2EYX A;  2JXB A;  1QKW A;  2KR3 A;  2FPD A;  1UUE A;  2LZ6 B;  1SEM A;  1UHF A;  1H92 A;  1YWO A;  1VYU A;  4AG1 C;  2CH4 A;  4EIK A;  2ROT A;  2F2W A;  4J9H A;  1BK2 A;  2JMC A;  1NLP C;  3GBQ A;  3I35 A;  4OML A;  2O31 A;  1ZUY A;  1UTI A;  4R0K A;  1J3T A;  3PVQ A;  1UG1 A;  2SEM A;  2DM1 A;  4HVU A;  1NYF A;  1K0X A;  3VS7 A;  4FSS A;  2FPF A;  2J6F A;  1HJD A;  2B86 A;  3QWY A;  5GJV B;  2C0T A;  1AWO A;  1HD3 A;  3M0R A;  2C0I A;  2RQV A;  1QKX A;  4F16 A;  2RNA A;  2KGT A;  1AEY A;  4J9E A;  2KRM A;  2OAW A;  1ABO A;  2K79 A;  1ABQ A;  1NLO C;  1M30 A;  5IXB A;  2O2O A;  4HVV A;  1AWW A;  3UAT A;  4M4Z A;  1RUW A;  2DRK A;  2A28 A;  2RQR A;  1UDL A;  2EGE A;  2LJ3 A;  3M0P A;  1FYN A;  3THK A;  3UA6 A;  1W70 A;  4F14 A;  2VVK A;  1QLY A;  2RMO A;  4QT7 A;  1K76 A;  3RBB B;  2L3S A;  1X43 A;  3VS1 A;  1K9A A;  1NEG A;  2JMA A;  2M0Y A;  2LX7 A;  2EQI A;  4GBQ A;  1MV0 B;  3ZL7 C;  4AFQ C;  1H3H A;  1K0S A;  2X3X D;  2JTE A;  4RUG A;  1JO8 A;  2CH4 W;  1K1Z A;  3SHW A;  2F2V A;  5I11 A;  1X27 A;  2VKN A;  1KSW A;  1YN8 A;  2DBK A;  1GCP A;  1T0J A;  2JS2 A;  1ZSG A;  2VWF A;  1AZG B;  1B3Q A;  2CT4 A;  3EG2 A;  1LCK A;  1S1N A;  1BB9 A;  1X6B A;  2IIM A;  1NM7 A;  1I1J A;  2EGC A;  3TSW A;  2EKH A;  2KRO A;  2JW4 A;  1GBR A;  4OMM A;  2KEA A;  2RQW A;  4RTT A;  1GFD A;  2KBT A;  3M0Q A;  1V1C A;  1JU5 C;  1E6G A;  1VYV A;  2CSQ A;  2W0Z A;  2GQI A;  2K7A A;  1UGV A;  2DF6 A;  1YWP A;  1H8K A;  3H0I A;  2K3B A;  5IHN A;  2W10 A;  1PHT A;  2M51 A;  3ULR B;  1Z9Z A;  1UJY A;  2FO0 A;  2QDL A;  2GBQ A;  2CT3 A;  3EHR A;  4AFU C;  1PRL C;  3I5R A;  2H8H A;  1UEC A;  5IHK A;  1YP5 A;  2LCS A;  2A36 A;  4CC3 A;  1OV3 A;  2L3P A;  2DL5 A;  2LMJ A;  3I9Q A;  2EPD A;  3NHN A;  4A63 B;  3CQT A;  2A37 A;  1UFF A;  2HDA A;  1KJW A;  2KXD A;  4OMO A;  1PRM C;  2V1Q A;  4JJB A;  4Z8A A;  1M3C A;  2KRN A;  3O5Z A;  4X1V A;  2KXC A;  4DEY A;  1M8M A;  3NPF A;  3KFV A;  3VS4 A;  5L23 A;  2KYB A;  1VA7 A;  4J9F A;  2GTJ A;  5IH2 A;  2J06 A;  3RNJ A;  2GNC A;  1Y0M A;  1PWT A;  3QWX X;  1W1F A;  2DL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...