2J06A

Crystal structure of the rasgap sh3 domain at 1.8 angstrom resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
61
structure length
61
Chain Sequence
b'MRRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RAS GTPASE-ACTIVATING PROTEIN 1
publication title High Resolution Crystal Structures of the P120 Rasgap SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signal transduction
total genus 13
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2j06A00
2KROA 3NPFA 3M0PA 3UA7A 3TSWA 5L23A 3VRZA 1UTIA 2FPFA 1KSWA 2RQWA 2JXBA 2BZXA 1BU1A 1HJDA 1SEMA 4HVVA 2GNCA 3PVQA 4LN2A 1GRIA 2LQNA 1CKBA 1PRLC 2KRNA 1WDXA 1WXTA 2A08A 1JEGA 2RMOA 1RUWA 2C0OA 1E6HA 1WLPB 2EYZA 3EG0A 1WX6A 3M0UA 2YUPA 1W1FA 1UJ0A 1TUCA 1J3TA 2LZ6B 1K1ZA 2EBPA 2ABLA 1QWEA 4OMNA 2ROLA 3VS6A 2FPEA 1PNJA 3I5SA 3EGUA 2LJ0A 4JZ4A 1SHGA 2FEIA 3VRYA 1BK2A 1UHCA 3ULRB 5IXBA 4F16A 1VYTA 1VYVA 1YWOA 2AKKA 1GL5A 1BB9A 1T3SA 2J6OA 2KYMA 5IH2A 2DM1A 2NWMA 1T0HA 2J05A 2KT8A 1NLPC 4JPBW 1V1CA 1OEBA 2KRMA 1UFFA 2CH4A 2KXCA 2GTJA 3H41A 1K4US 4RTYA 1AWWA 2D0NA 4DEYA 4LE9A 2EVRA 2KNBB 1H92A 2L0AA 1PHTA 1Y57A 2GGRA 1SRMA 4QT7A 2FG0A 4HVWA 1UG1A 4E6RA 3H0HA 1M3AA 4OMMA 1GCPA 3SHWA 2L3SA 1RLQC 2KEAA 2MIOA 2RF0A 2BZYA 1AOJA 2RQVA 3VS0A 1I07A 2CUBA 1PRMC 2EYXA 1E6GA 2PZ1A 2KR3A 1SPKA 4OMLA 2CSIA 1EFNA 3EG1A 3I35A 1UECA 2DNUA 1OV3A 2HEQA 2DRKA 2F2XA 2DL5A 2ROTA 3EHRA 4F14A 4K11A 3FJ5A 2C0IA 3EG2A 2JW4A 1HD3A 4AFUC 2J6KA 3VS4A 1PKSA 1QWFA 3VS2A 5ECAA 2KRSA 1ZX6A 2O9VA 2EKHA 1S1NA 2ENMA 2DILA 3CQTA 4RTUA 4RTWA 2K6DA 4GBQA 2G6FX 1IO6A 4AFSC 1WYXA 5IHNA 1UE9A 2A37A 4KRTA 4FSSA 4JJDA 2LNHB 4LUEA 2CSQA 4J9EA 4OMQA 2KYBA 4IIOA 2L3PA 2O9SA 1A0NB 1K9AA 1N5ZA 2AZSA 2O31A 1Z9QA 2L2PA 4JZ3A 1MV0B 1VYUA 1ZSGA 3TSZA 1YCSB 1K0XA 4Z8AA 2GBQA 1BBZA 3NHNA 4J9CA 2DE0X 2SEMA 1X2KA 2D8HA 4Z89A 1M3CA 1UUEA 2JM8A 1ZUKA 3H0FA 1YP5A 1OPKA 2GQIA 2DJQA 2CT4A 2VKNA 1X43A 3UATA 5I11A 2JTEA 3R6NA 2K7AA 5GJWB 4Z88A 2JS2A 1PKTA 1ZLMA 1AVZC 2F2WA 1T0JA 1U06A 1X69A 4CC2A 2BZ8A 5GJVB 1QCFA 2K9GA 1JXMA 4ORZA 1SRLA 3UA6A 1U3OA 1GFDA 4J9HA 2J7IA 4LUDA 1ABOA 2ECZA 1QLYA 4JJBA 2DMOA 1ZUUA 1VA7A 4F17A 3EG3A 5IXFA 1KJWA 1MV3A 1KFZA 2GTOA 2FO0A 2JM9A 1JQQA 2F2VA 4HVUA 2L3QA 1CKAA 2DA9A 1H8KA 2LJ1A 2DBKA 5HCKA 2X3WD 4EIKA 3C0CA 2JT4A 4HXJA 3NGPA 2XMFA 2LJ3A 3IQLA 4LNPA 4CC3A 4ESRA 1GFCA 4A63B 2YUQA 2ESWA 2OJ2A 2M51A 5FW9A 1NYGA 2CT3A 2RQRA 2FRYA 1K76A 1UGVA 2OAWA 1AEYA 4ZNXA 2LCSA 2EYWA 2EQIA 3VS7A 5FWCA 2HCKA 1I1JA 1ABQA 2IIMA 1W70A 3VS5A 3SEMA 4GLMA 1WFWA 4RTTA 1MUZA 3M0TA 3I9QA 3JV3A 2J6FA 4J9DA 4CC7A 2I0NA 4J9FA 2K2MA 2EYYA 2JS0A 1OOTA 1HSQA 1NYFA 2LQWA 2KE9A 4DEXA 2VWFA 2YUNA 1T3LA 1OPLA 3M0SA 1NEGA 2JMAA 2VVKA 1B3QA 3REBB 1RI9A 2YUOA 1ZUYA 3KFVA 2ED1A 2EPDA 2LP5A 4OMPA 4AG2C 2DL4A 2CH4W 4R0KA 3LH5A 2YDLA 4HCKA 4J9BA 3GBQA 2AZVA 3PE0A 1Z9ZA 2W0ZA 1M3BA 3RBBB 1K0SA 2KGTA 1PWTA 1YWPA 3RNJA 1NG2A 1G83A 1M27C 1Y0MA 2H8HA 1GCQA 2K3BA 1FYNA 4J9GA 2X3XD 1AZGB 2A28A 4OMOA 4RTVA 4JJCA 1JU5C 4J9IA 1WIEA 1ZBJA 1CSKA 1GBRA 4D8KA 1FMKA 2QDLA 5IHIA 4AFQC 2EGEA 2DX1A 3QWXX 3M0QA 1B07A 1YN8A 2KXDA 1AWOA 1GCQC 2DL3A 2O2OA 1AWXA 5IHKA 1W6XA 4WCIA 2KBTA 4D8DA 1UHFA 2A36A 2V1QA 2M0YA 1X27A 2YSQA 4CC4B 2DL7A 2FRWA 2DF6A 3O5ZA 2RPNA 2DL8A 2D1XA 1WI7A 5EC7A 4AG1C 2EW3A 2PNIA 2DVJA 1NEBA 4RTXA 2J06A 1TUDA 2O88A 4IIMA 1WXBA 1E7OA 2DLPA 2EGAA 2HSPA 2YT6A 1UDLA 4M4ZA 2AKLA 5I22A 2OI3A 2D8JA 1AWJA 1GBQA 1TG0A 1NM7A 2MOXA 2DYBA 1X6BA 2E5KA 2RQUA 3ZL7C 1SSHA 3TVTA 2MCNA 1QKWA 2K79A 2ED0A 4RTZA 1KIKA 1G2BA 1JO8A 1M30A 3NMZC 3VS3A 2P4RA 2RQTA 2BTTA 1JXOA 1U5SA 3M0RA 2PTKA 1XOVA 4AFZC 1SHFA 1X2QA 1WXUA 2RN8A 4RUGA 3H0IA 1WA7A 1ARKA 3EHQA 2DBMA 2DRMA 2LMJA 3UF4A 1I0CA 3REAB 3VS1A 1H3HA 2EGCA 3I5RA 1LCKA 2AK5A 3U23A 2CDTA 2RNAA 3PVLA 2HBWA 5FWBA 4Y92A 2B86A 1NLOC 3QWYA 2SRCA 2KT1A 3A98A 2JMCA 1YNZA 1X6GA 1UJYA 2CREA 2CUDA 4X1VA 2NUZA 3THKA 1AD5A 1M8MA 1QKXA 2C0TA 1AZEA 2HDAA 2V1RA 2FPDA 2W10A 2LX7A 1RLPC
chains in the Genus database with same CATH superfamily
3H8ZA 2KROA 3NPFA 3VRZA 4PL6A 4BE1A 4HT9A 2JXBA 4FIBA 3QUIA 1OZ3A 5KYXA 3CPWP 4BDZA 1Q7YC 2JOYA 1NZ9A 5KCOA 4ZGDB 1Y71A 1SEMA 2GNCA 5GANf 4LN2A 1GRIA 3RUXA 5CVIA 5IT9E 4J6YA 2KMTA 4JLIA 2A08A 4FYYB 2C0OA 3MKDA 2P4TA 1D09B 3DB4A 4M7DE 3EG0A 1WX6A 3OYLA 1TUCA 3CCUA 1OU9A 1VQ9A 3CD6Q 2QA4T 1WZOA 4B9XA 3OYIA 4M7AE 4PNOA 2RHZA 2ROLA 3ASKA 1PNJA 4F7UF 4JZ4A 5CKHA 3VRYA 1UHCA 4F16A 1VQ8T 1VYVA 1C6VX 3M5AA 2VGMA 2KT8A 2RHYA 3LWIA 1VQ4T 2AT1B 1U8RA 2GCXA 2RHXA 2DKGA 2F1LA 2Y4XA 2R5MA 3FB9A 2D0NA 4LE9A 2KNBB 1H92A 1PHTA 4OB1B 3CCRA 2GGRA 2O4XA 3P8DA 4QT7A 4BD3A 5GAOr 2QA4Q 1VQLT 1UG1A 3CBPA 4LDXA 4E6RA 4ELZC 4PLLA 5KYXB 4KH0B 1GCPA 4C5EA 1JJ2P 1RLQC 2RF0A 4IKFA 2BZYA 3VS0A 2CUBA 4IURA 1E6GA 5GAN2 2X4JA 4BI3A 2H3JA 2CSIA 2BIVA 3EG1A 1VQ8Q 1UECA 2DNUA 2HEQA 4BI4A 2F2XA 3JCMP 3N5BB 3S3MA 3EHRA 1NJIU 1B34A 2RK2A 2RJDA 3EFRA 4AFUC 1VQ4Q 2YRCA 3OW2A 3V8LA 5GAMg 1VQ6A 4KGVB 1ZX6A 3LH0A 3CCLT 2EKHA 2DILA 3HPWA 4B6MA 3PNWC 2Y90A 2OTJA 2G3RA 2OAUA 5I21A 1UE9A 4M7DB 1M90U 3MP1A 4FSSA 1VQLQ 2LNHB 1WNLA 3BDLA 4IIOA 2L3PA 4KH1B 2AZSA 2O31A 2L3RA 3QHSA 1ZSGA 4A54A 1HK9A 2D9TA 1ZA2B 4HCCA 1K0XA 4Z8AA 2GBQA 5GANe 2YHTA 4E7ZA 3CMET 1QW1A 4J9CA 2SEMA 3OYKA 1UUEA 2JM8A 3CPWS 3H0FA 3NTHA 1OULA 1Q7YU 4ZTFA 2EQKA 2R5AA 3EFSA 3MO8A 4D6WA 3MEUA 2O4XB 2CT4A 1D3BA 3UATA 2E70A 3R6NA 2K3XA 4CRIA 1RI0A 2DIQA 5GJWB 3M54A 3L1AA 3CCLQ 2DVEA 4FW1A 3BDUA 4CC2A 1YIJT 4ZGEB 3LYIA 2MWPA 1BCOA 4C8QA 4NS5A 5J3BA 1TSFA 3GNGA 2ZPFB 4ZN1A 3CC4A 4ZTJA 1ABOA 2ECZA 2LDMA 2F5TX 2HL3A 1KFZA 4FT4A 3QDFA 4PFOA 4HVUA 1JRIA 3CCMT 3NTIA 1BI1A 1B34B 3M56A 2D0QB 4C8QC 4BDYA 3JCMg 4KUDK 3CMEQ 3OYAA 3GNFB 1KQSP 1WHJA 4KULA 2ZZDA 4QQ6A 3OS0A 5FW9A 3DB3A 2CT3A 3CCVT 2RQRA 2FRYA 4Y91A 4XAXB 2JTFA 1K76A 1VQ7Q 1MNEA 4M78E 4HA8A 4J83A 2HCKA 2LRQA 4M7DF 3E1SA 1YIJQ 1VOMA 2Z0WA 1YJNA 4C92C 5GAN3 4J9DA 4CC7A 4C0FA 5HKCA 4J9FA 2LNVA 1VQOT 2CZ7B 2EYYA 3I56A 2VYTA 4M7AF 3BW1A 2LQWA 1WHLA 4C5GA 2O01E 3CCMQ 5GMKm 3V7SA 3VYGA 4N4GA 3REBB 2YUOA 3SDZA 3KFVA 2ED1A 3RKWA 3CCQT 4R0KA 3LH5A 4OP0A 4PJNA 3URGA 4J9BA 3GBQA 4JJNK 1OX9A 3G4SA 1Z9ZA 2W0ZA 1M3BA 2QYZA 4C8QB 5GAMf 3A1PA 2LT1A 5LJ5e 3CCVQ 2KGTA 5FU7C 1NG2A 4OGEA 3T9NA 3J81E 2QEXQ 4ANJA 2X3XD 1AZGB 4RTVA 2NYSA 3V7CA 2CZ6B 1VQOQ 4M7DG 4D8KA 1LPLA 3OYGA 3I55A 3P8BB 4AFQC 1D0YA 1LVKA 3M0QA 4V2SA 1YN8A 4AT1B 4EMGA 1AWOA 2O2OA 1AWXA 4WCIA 2EYQA 3E19A 2QTXA 3JCMV 2A36A 2V1QA 2VXFA 2CZ1B 4M7AG 2DF6A 3TCJA 1N9SA 2COWA 1WI7A 3CCQQ 2LTOA 3S3NA 1P92A 1D1AA 4L59A 5KYWA 2HQHA 3A8GB 1TUDA 3SWNC 1QCOA 1YJ9T 2DLPA 3PIPA 2EGAA 3OB9A 1VQMA 5LJ3j 2HSPA 1KD1R 3M53A 4M4ZA 1AWJA 3JCMQ 5GAOm 2RQUA 3ZL7C 3QYGB 1I81A 1G2BA 4L6V5 4PJOG 3PIOA 5D6XA 3ER0A 8ATCB 4UC4A 2Y4YA 2MAMA 4BUGA 2ATCB 4AFZC 1SHFA 1ACMB 2E3HA 2ZPIB 4CI0C 1WA7A 1M4ZA 3EHQA 1VQPA 4QQGA 2LMJA 2MPXC 1H3HA 4OB0B 1SF9A 1LCKA 3OBYA 3VU3C 1VQKT 1D0XA 2RNAA 2L8DA 4E47A 5FWBA 2HBWA 1KQSS 1QMCA 3H9NA 4Y92A 4C8QD 1YJ9Q 3CMAT 1NLOC 1Q86R 5KE2A 3CCEA 3G71T 1YNZA 2LQ8A 2RA2A 1QVGP 3CCRT 1DJ7B 2NUZA 1AD5A 1YBYA 1QKXA 2V8KA 2HDAA 1G3YA 1Q86C 1GXIE 4OB2B 2M16A 2E10A 3JCMh 1UTIA 3EG9A 2C06A 2BZXA 1IGQA 1K8AR 5KYWB 1BU1A 4XK8E 3MPUB 1M2VA 5KYUA 4C0GA 5GAMe 2LQNA 1VQKQ 1K8AC 1YFNA 3A5ZB 1E6HA 4PLIA 1VQ6T 3CMAQ 4JS5A 3UT1A 1WLPB 1TS9A 3FIFA 3G71Q 2YUPA 1W1FA 4MMKA 3HRTA 3CCRQ 1QP2A 5LJ3g 1QQJA 3INZA 1ZHIA 1W2BP 3JB9I 2P0QA 4Q5WA 2E1HA 3CC7T 1RAHB 2RHUA 3EGUA 1TUGB 2LJ0A 5I2MA 3C4SA 4ZGJB 3ULRB 2CP5A 1VYTA 3AHUA 1OI1A 1YWOA 2WSFE 5GMKj 2DZ9A 2DM1A 2MYSA 2NWMA 1D0ZA 3OYFA 1QVPA 1T0HA 2J05A 4YTLA 4EMHA 1V1CA 1OEBA 1FXXA 1G3TA 2KRMA 1UFFA 1OYXA 4XTZA 1M1FA 1WGSA 1EIFA 1K4US 4EPCA 2RJEA 2HMAA 1VQ6Q 2DETA 1Y57A 1SRMA 2FG0A 1QVFA 2RH2A 5CO7A 3H0HA 4M78G 3QJ6A 3SHWA 2YLCA 2KEAA 1I5OB 2DK3A 4FM4B 1M2VB 2RQVA 3PMIA 3FLGA 1RABB 1I07A 5CIUA 1PRMC 5KYUB 3CC7Q 2EYXA 2PZ1A 4N4IA 5GAN6 2EJFA 2CP3A 2DRKA 4M75A 3VYHB 2PVDB 1W4SA 4JLGA 3EG2A 4FW2A 4PJJA 2DD4A 1HD3A 3JB9F 1H3ZA 2R57A 1YJWT 5ECAA 1YI2A 2KRSA 2FYKA 1YITT 3R6OA 4XU2A 2ENMA 3LWHA 3JB9D 1R0CB 4M75C 2K6DA 4ELYC 4GBQA 3WVEB 1TWBA 4OF1A 5LL6S 5IHNA 2XICA 3HFOA 2A37A 2KI7A 3LW5E 1SKUB 1VQNA 2E65A 2CSQA 4OMQA 1QVGS 2QQBA 2DAQA 1K9AA 1N5ZA 5A0DA 3G6EQ 1RADB 1D1CA 3CC2T 4FU6A 1YCSB 2RK1A 1Q86U 3CXCA 1M8VA 1M3CA 1Q82R 3LGLA 4N4HA 2RO0A 2JVVA 2NUPA 2HZYA 2VKNA 1X43A 3TU4K 1YJWQ 2K7AA 1KQ2A 1Q82C 4PFPA 1YITQ 4DOVA 1PKTA 2F2WA 1AVZC 1T0JA 1KC8R 1FX7A 5GJVB 1K8AU 5KH6A 3ZBDA 2QASA 4RMOA 2K4YA 3ZFJA 4ORZA 1SRLA 2L89A 2OTLA 2J7IA 3EH2A 2DD5A 1VA7A 3SD4A 3HKSA 3EG3A 1KJWA 3MHXA 2COYA 1W2BS 1XQHA 3L2ZA 1KC8C 2PVGB 4DOWA 2VC8A 2FO0A 1JQQA 2F2VA 2XKOC 3CC2Q 4JRIA 3OS1A 1BI3A 2DA9A 1H8KA 4FT2A 5HCKA 2RB6A 4EIKA 3A8LB 1S72A 4C0DC 1PSEA 2XMFA 2LJ3A 3VUZA 4LNPA 4CC3A 3VUBA 4A63B 2OJ2A 5J26A 1NYGA 5FU6C 5DY9A 1LJOA 3M57A 4JS4A 2E4HA 1AEYA 1UGVA 2LCSA 4E7IA 3FJPA 2EYWA 3VS7A 3RKXA 5LJ3h 2YRVA 5FWCA 1X6OA 4IUUA 4BE2A 1ABQA 1Q95G 5HK3A 3SEMA 4LDVA 2MF2A 2BE9B 4F7UG 2I0NA 2LC4A 3QBYA 3OS5A 2JS0A 5CQYA 1NPPA 2KE9A 4DEXA 3OS2A 1HYOA 1T3LA 7AT1B 3M0SA 4JRQA 1NEGA 2QAZA 3EGXA 3FRNA 3MJXA 1BIBA 2VVKA 3J80E 1B3QA 2MWOA 2NUPB 3QZ9B 5LJ5f 2XDPA 3GPLA 3QO3A 2BE7D 1XJWB 2EPDA 4OMPA 2CH4W 4ZN3A 2YLBA 2YDLA 3WXMB 3HTRA 1IGUA 4QVZA 4PJOC 2PUKB 3GF5A 5GAOq 4C0DB 1YWPA 2VV5A 4E7JA 5GAN7 1M27C 1GCQA 5GAN8 2K3BA 1N27A 4A4FA 2E64A 4J9GA 4FL6A 2F69A 3X24B 2QQSA 3A8MB 4C8QE 4JJCA 2XHCA 1BI0A 3TEEA 4A4HA 4B9WA 1ZBJA 2PUOB 5AT1B 5L8RE 1OU8A 2QDLA 5IHIA 1IB8A 2DX1A 3KUFA 4M75D 4DBRA 1GCQC 2JNGA 2EJ9A 2JZ2A 5HK0A 4DBFA 4OB3B 1XNIA 1X27A 4XTWA 4XTUA 4OGCA 2DL8A 4AG1C 2FZKB 2EW3A 1RAIB 2DVJA 3QG1A 6AT1B 5C6SA 2O88A 1ZSZC 4Z02A 4E7HA 4IIMA 5CR2A 1VQ5T 5CKFA 3S3OA 2KDSA 2AKLA 4J6WA 4A4KA 1TG0A 1NM7A 2MOXA 2CYZB 2DYBA 3Q1JA 4C92A 1RAFB 1Q82U 1SSHA 1QKWA 2FB7A 1LNXA 2ED0A 4M77A 2RD1A 1TTHB 2BTTA 1JXOA 1MGQA 5IAYA 1XOVA 2DFUA 4J7FA 2L5QA 3CD6A 2XIDA 1KC8U 2KVQG 2VUBA 3OSVA 5GMKh 1WHKA 2DBMA 3UF4A 5D6YA 2NUTA 3VS1A 4M77C 4PKCC 1KK7A 1UGRB 4QKUA 4XTYA 2B86A 3OW2P 1JJ2S 1VQ5Q 3A98A 1I5LA 1X6GA 3OYYA 4LDUA 1B7TA 2CUDA 2COZA 1D3BB 3THKA 1M8MA 3C94A 4RKUE 2DXUA 2V1RA 3HP9A 4PJLA 3CCJT 2RJCA 3GLXA 3EFOA 2FPFA 4C5HA 3L2UA 2FZCB 1N6AA 2LX9A 2K5FA 1HJDA 2QA4A 3UDCA 4BB7A 4BE0A 1TOVA 3PVQA 3OYCA 2X4YA 1O9SA 1PRLC 1Y7XA 1SG5A 2ZPGB 2KRNA 1WDXA 4M78C 1WPYA 4KGXB 1PSFA 4E2FB 3NFCA 1JEGA 2RMOA 3SWNA 2DXCA 3M58A 3F70A 4C92B 1BI2A 1VQ8A 5GANj 3HSBA 3M0UA 1UJ0A 1J3TA 2LZ6B 1R0BG 3X26B 3M4YA 1K1ZA 1M5Q1 4KGZB 4PJOD 2ABLA 4R56A 1M1GA 1QWEA 1JBMA 4OMNA 3QIIA 2QI2A 2E41A 3VS6A 3CCJQ 2X35A 1SHGA 5CQXA 2NUTB 5IXBA 1GL5A 3PFSA 1BB9A 3CCSA 5GANd 1T3SA 1VQLA 2J6OA 5IH2A 3CCUT 2EQMA 3RR6A 1VQ9T 1OQKA 5FU7B 1NLPC 1Q81R 5GMKl 3V8KA 2KXCA 1KD1C 2GTJA 2K5LA 4IUPA 5AYFA 2X9HA 1WHMA 4RTYA 4DEYA 5GMKi 3JCMf 2L0AA 2EWNA 3EFOB 4LDWA 4HVWA 2FVUA 4C8QF 3A8HB 4XTVA 1M3AA 3LLRA 4OMMA 2MIOA 1ZBXA 1K9MR 5D6WA 1ZQ1A 2DJZA 3CCLA 1MHNA 5I2SA 4OMLA 3QSUA 1EFNA 3I35A 4JRKA 1IHWA 3SWNB 4R55A 1S72T 1K9MC 3CCUQ 3X28B 2XDDA 2DL5A 2FZGB 4F14A 4K11A 1VQ9Q 1PG5B 3FJ5A 4C92F 4P5NA 4J8OA 2J6KA 3VS4A 3OYNA 1UB4A 2LCLA 1PM3A 1QWFA 3G7ZA 3VS2A 3OQ5A 2ZPEB 1I8FA 1X75C 4C92D 1S1NA 5CKDA 3GIBA 3CQTA 1OX8A 4RTUA 4M77D 3CBOA 1IO6A 1WYXA 1G3SA 3C12A 4KRTA 2E6ZA 4JJDA 4XU0A 4LUEA 4J9EA 2KYBA 2AIRB 1HXDA 3OYDA 2O9SA 1VQ7A 1A0NB 1NPRA 1WJRA 2L2PA 4JZ3A 1MV0B 1VYUA 2DXBA 3TSZA 5GAOn 3CPWA 1YIJA 4C8QG 3EH1A 4O6JA 4ATOA 2QDYB 3NHNA 2HQXA 2DE0X 1X2KA 2D8HA 4FCYA 5KYYA 4Z89A 2OTJT 1VUBA 1ZUKA 1S72Q 2ZAEA 4DQ2A 2D6FA 5HY6A 2GFUA 1BIAA 2P0PA 2H3EB 5I11A 3O8VA 1WHHA 5LJ5d 2JS2A 3DKMA 4RCBA 3PGGA 1U06A 1QCFA 1O75A 1JXMA 4XQ3A 3G1JA 2MK5A 4OMFB 1FMWA 4M78D 3RESA 2E6NA 3AT1B 3HFNA 3CCVA 1QLYA 4JJBA 1KHCA 1ZUUA 2HNIA 2GTOA 4FSXA 2JM9A 2QEXA 1LOJA 3NTKA 3HRSA 3ZEHA 2HAXA 3C0CA 1NBEB 1NJIR 4HKEA 3EG9B 3V8JA 2GFAA 2E3IA 4M75E 3IQLA 2OTJQ 1GFCA 2YUQA 1VQOA 2ESWA 2M51A 4EDUA 3GP8A 3CC4T 3JCMe 2XD0A 4FYXB 4Y28E 2EQIA 5DLQE 2A7YA 1I1JA 3ME9A 1N9RA 1SSFA 3VS5A 1KD1U 2PU9B 2DTHA 2HKNA 4GLMA 1WFWA 4RTTA 2R58A 1MMDA 2VB6A 4RG2A 2K2MA 1RL2A 1OOTA 1NYFA 1YHQA 5KYYB 5C0MA 2YUNA 1OPLA 4LDYA 2DTIA 2YRDA 2JMAA 2VXEA 2X4XA 1N8RR 3RKYA 2EJGA 1RI9A 2LVMA 2QQ9A 4X34A 2RJFA 4J6XA 3E9GA 1YJNT 2LP5A 4AG2C 1Q7YR 2DL4A 3OYBA 2I2LA 2HBPA 4HCKA 5FLXE 2AZVA 1N8RC 3CC4Q 5FRNA 3I56T 1K9MU 1K0SA 4HT8A 1PWTA 3RNJA 3C95A 3OSSC 2EKOA 5M9OA 3E9FA 1FYNA 3KXTA 2PVOB 2A28A 3LGFA 1U1SA 4OMOA 3PTAA 3VV0A 3DLMA 5FROA 2RI2A 5GAMj 1JU5C 2X51A 2MMPA 1WQWA 1GBRA 1R8OB 1YJ9A 1IHVA 3G4ST 1FMKA 2V8IA 4QVCA 3MEWA 3QWXX 1B07A 4JUVA 2DL3A 3OY9A 1W6XA 3L2RA 1UHFA 5LJ3f 2YSQA 3OYEA 3HHTB 4CC4B 3UWNA 3JB9G 3O5ZA 3MP8A 3JSCA 1YJNQ 3QZ5B 5EC7A 2WACA 2NLUA 2PNIA 2V8JA 1NEBA 5GAMd 1IRXA 3I56Q 4M75B 3OYMA 4M7DA 3I55T 3OMCA 3J7AF 2YT6A 2CP0A 3UPUA 1UDLA 3P8HA 5GANh 2EAYA 3GOXA 5I22A 3MP6A 2OI3A 2D8JA 3QPHA 9ATCB 4PK4A 1X6BA 4M7AA 1MMGA 1QVFP 5EG2A 1VQKA 4RTZA 1KIKA 1R77A 2GQVA 2ZCFB 2YXYA 1JO8A 1PC0A 1M30A 4M7DC 2P4RA 3G4SQ 2RQTA 3CMAA 4WF2A 4PJOE 2PTKA 3G71A 3HRUA 1V29B 1VQMT 1X2QA 1AHJB 2RN8A 3H0IA 5CKBA 5CKEA 1KQSA 2RHIA 3CCST 3QKJA 4L5GA 4M7AC 5A0LA 3FEOA 3REAB 3I5RA 2CDTA 3FDRA 3VKIA 2JN0A 2F5KA 4PJOA 1BCMA 4NL3A 3I55Q 4QQDA 2QGGA 3JCMJ 3CEYA 4F04B 2FL7A 1UJYA 2CREA 2C0TA 1VQPT 2FPDA 2W10A 5KYNA 2E5QA 3M0PA 4ME7A 3TSWA 3UA7A 2QXFA 5L23A 1D1BA 3JCMd 1K73R 1KSWA 2RQWA 1VQMQ 1WHGA 1IZ6A 3EAEA 3CCET 1MNDA 3BFMA 4HVVA 5FU6B 3CXCP 5A0GA 3CCSQ 4J7IA 1FMVA 2KAFA 1CKBA 4M75F 2XG8D 1K73C 3V7RA 3HL8A 1WXTA 3CC7A 4TVRA 4BI8B 3TREA 1RUWA 1ZSZA 3JCMb 2P84A 4M7AB 2DEQA 2EYZA 1M9SA 1N8RU 2QGFB 5J39A 1WJQA 2HD0A 4X9CA 4EMKA 1VQPQ 3OA6A 2EBPA 4C92E 1M1KR 4M77E 1VQ7T 2FPEA 3RDVA 3I5SA 4NOYA 5LJ3e 5LJ5h 2LCCA 2FEIA 4WTOB 1BK2A 2DO3A 5FRMA 1YCYA 2A3LA 2AKKA 3CCEQ 3OBWA 2KYMA 4EMKC 4PJOB 1M1KC 3MEAA 2XDBA 2K3YA 3L2QA 3EGXB 4IUTA 1PD1A 4BY6C 4JPBW 4JDSA 3M59A 3G6EA 2KK4A 1WJSA 2CH4A 2X4WA 3SFMA 3JB9H 1ZA1B 3H41A 3DLLA 2VASA 1AWWA 2EVRA 5D7UA 4M75G 3X25B 2JTMA 3M9QA 3VJPA 2ZPBB 2L3SA 1YJWA 1AOJA 1G3WA 3PMTA 4MZTA 1QVFS 3H6ZA 1YITA 1F1BB 2KR3A 2AHJB 4LXCA 1SPKA 2QEXT 2K2VA 2ZPHB 1KQ1A 2CGHA 2K5IA 1OV3A 2M9UA 2M1HA 1ZSZB 3QJYA 2ROTA 1FWZA 4M7DD 1G5VA 2C0IA 4IUQA 2JW4A 4PFZA 1Y96A 4MZMA 3CC2A 1PKSA 4M78A 1EZZB 3RMQA 4EMKB 1XTDA 2XK0A 3QXEB 2O9VA 1QVGA 4M7AD 4BY6B 2HL5C 2XI9A 2QTVA 4RTWA 3S6WA 4QW2A 2G6FX 4AFSC 2M02A 2XU8A 5IN1A 4GY5A 1YHQT 1VIFA 1Z9QA 1KG1A 1RAAB 3LX7A 3E2UA 4X9DA 2KSSA 4PJOF 1YI2T 4KUIA 4M77B 1BBZA 3L2VA 1I4K1 2EIFA 2RI5A 3PT9A 1YP5A 1OPKA 2GQIA 1RACB 4O5VA 2DJQA 4PJMA 1VQNT 1UGSB 1VQ4A 3CXCS 4KBMB 3OYHA 5A2QE 2JTEA 5DLOA 2JJ9A 4Z88A 4JRPA 1K73U 4RG8A 2WSEE 4DA4A 1ZLMA 1X69A 1TH7A 2BZ8A 2K9GA 1WQ7A 5GMKe 1W2BA 1UGQB 5GAN4 3UA6A 1U3OA 1GFDA 4J9HA 5GAMh 4LUDA 4E7LA 1UEBA 4A4GA 2DMOA 4C0ZA 4F17A 4DBQA 2DIGA 5IXFA 4MDXA 1MV3A 4LD9K 1YHQQ 4KT0E 2WSCE 4HCZA 2L3QA 1CKAA 2DERA 2DZCA 1C0MA 5CAIA 1AT1B 2LJ1A 3EGDA 2DBKA 3SB2A 1YI2Q 2X3WD 1Y96B 4M78B 2JT4A 4HXJA 3NGPA 1Q81C 3JCMc 4QVDA 4ESRA 2CZ0B 4IUVA 1H641 2HQEA 3CBMA 2OTLT 1M2OA 1VQNQ 2EQUA 4NL2A 2QK0A 1M1KU 2OAWA 4BACA 4ZNXA 1EX4A 2CP2A 8AT1B 3CPFA 5LJ3d 4A53A 5KCHA 2IIMA 1W70A 4OVAA 1MUZA 3M0TA 3I9QA 3JV3A 4XTXA 5CK9A 2J6FA 1NE8A 4AMCA 4J5YA 1HSQA 3MEVA 2VGNA 4F7UE 2VWFA 4XU3A 4FYWB 4M77F 2DPPB 1G8XA 2B8AA 1BKBA 4RCCA 4XU1A 3KBGA 1TU0B 1PD0A 2KQWA 3CMEA 1ZUYA 2DTOA 3A8OB 2CS7A 2QQRA 3OW2S 4II1A 1QCNA 5CCAA 3META 5GANg 4FYVB 4F7UA 3PE0A 2M0OA 2EFIA 2OTLQ 1Y07A 2CP7A 1PCXA 3TQ7P 2JUFA 3RBBB 5GAN5 2IG0A 3M55A 2MI6A 3BY7A 4C5IA 2YWWA 5LJ5j 1RAEB 1G83A 1Y0MA 5GAOl 2H8HA 2BUDA 2FHDA 1RAGB 4MDWA 3RIRA 1IXDA 3M4GA 3EGDB 4J9IA 2LT4A 1WIEA 1CSKA 2ZGWA 3BE3A 1BYMA 1MMNA 1VQ5A 2EGEA 1OZ2A 3CCMA 3RMSA 2KXDA 4M78F 3FC3A 5IHKA 2KBTA 4D8DA 2M0YA 4C92G 2DL7A 2FRWA 3OMGA 2RPNA 2LQKA 4M77G 2E12A 2D1XA 4N0AA 3MCAB 4RTXA 2J06A 1IREB 2HSEB 1WXBA 1C1AA 1E7OA 4DBHA 3JCMW 2IVWA 2PQWA 3JCMX 4E7SA 1V76A 1GBQA 3JB9J 2E5KA 2RI3A 1KHIA 1X01A 2BKDN 3TVTA 2MCNA 2V26A 4N0AC 5DM7R 2K79A 3QDRB 3WVDB 3L2WA 3VS3A 3NMZC 4A4EA 2IPOB 2K57A 1U5SA 3M0RA 1TXQA 1NJIC 2CKKA 1WXUA 4F7UB 4E7KA 4RUGA 3QYHB 2QG9B 1ARKA 2DXTA 2P0KA 1M90R 3CCQA 3RERA 5KE3A 2DRMA 2RM4A 1QP3A 1I0CA 4MZPA 2EGCA 1JJ2A 4MMLA 2AK5A 3U23A 3CCJA 1VIEA 2CP6A 3JAME 4GLKA 2KY9A 3G6ET 3PVLA 3L42A 1Q81U 2HKQB 5GAOp 2QQAA 3QWYA 1JB0E 1M90C 2SRCA 1U1TA 1UGPB 2KT1A 2JMCA 2A0FB 2DYIA 2OX7A 3D7SB 2EQJA 3OYJA 4X1VA 3CD6T 1MMAA 5LJ5g 4HCBA 4VUBA 2DEUA 1AZEA 3JRZA 2GF7A 3X20B 2LX7A 1RLPC 4LD6A
chains in the Genus database with same CATH topology
2KROA 3NPFA 3M0PA 3UA7A 3TSWA 5L23A 3VRZA 1UTIA 2FPFA 1KSWA 2RQWA 2JXBA 2BZXA 1BU1A 1HJDA 1SEMA 4HVVA 2GNCA 3PVQA 4LN2A 1GRIA 2LQNA 1CKBA 1PRLC 2KRNA 1WDXA 1WXTA 2A08A 1JEGA 2RMOA 1RUWA 2C0OA 1E6HA 1WLPB 2EYZA 3EG0A 1WX6A 3M0UA 2YUPA 1W1FA 1UJ0A 1TUCA 1J3TA 2LZ6B 1K1ZA 2EBPA 2ABLA 1QWEA 4OMNA 2ROLA 3VS6A 2FPEA 1PNJA 3I5SA 3EGUA 2LJ0A 4JZ4A 1SHGA 2FEIA 3VRYA 1BK2A 1UHCA 3ULRB 5IXBA 4F16A 1VYTA 1VYVA 1YWOA 2AKKA 1GL5A 1BB9A 1T3SA 2J6OA 2KYMA 5IH2A 2DM1A 2NWMA 1T0HA 2J05A 2KT8A 1NLPC 4JPBW 1V1CA 1OEBA 2KRMA 1UFFA 2CH4A 2KXCA 2GTJA 3H41A 1K4US 4RTYA 1AWWA 2D0NA 4DEYA 4LE9A 2EVRA 2KNBB 1H92A 2L0AA 1PHTA 1Y57A 2GGRA 1SRMA 4QT7A 2FG0A 4HVWA 1UG1A 4E6RA 3H0HA 1M3AA 4OMMA 1GCPA 3SHWA 2L3SA 1RLQC 2KEAA 2MIOA 2RF0A 2BZYA 1AOJA 2RQVA 3VS0A 1I07A 2CUBA 1PRMC 2EYXA 1E6GA 2PZ1A 2KR3A 1SPKA 4OMLA 2CSIA 1EFNA 3EG1A 3I35A 1UECA 2DNUA 1OV3A 2HEQA 2DRKA 2F2XA 2DL5A 2ROTA 3EHRA 4F14A 4K11A 3FJ5A 2C0IA 3EG2A 2JW4A 1HD3A 4AFUC 2J6KA 3VS4A 1PKSA 1QWFA 3VS2A 5ECAA 2KRSA 1ZX6A 2O9VA 2EKHA 1S1NA 2ENMA 2DILA 3CQTA 4RTUA 4RTWA 2K6DA 4GBQA 2G6FX 1IO6A 4AFSC 1WYXA 5IHNA 1UE9A 2A37A 4KRTA 4FSSA 4JJDA 2LNHB 4LUEA 2CSQA 4J9EA 4OMQA 2KYBA 4IIOA 2L3PA 2O9SA 1A0NB 1K9AA 1N5ZA 2AZSA 2O31A 1Z9QA 2L2PA 4JZ3A 1MV0B 1VYUA 1ZSGA 3TSZA 1YCSB 1K0XA 4Z8AA 2GBQA 1BBZA 3NHNA 4J9CA 2DE0X 2SEMA 1X2KA 2D8HA 4Z89A 1M3CA 1UUEA 2JM8A 1ZUKA 3H0FA 1YP5A 1OPKA 2GQIA 2DJQA 2CT4A 2VKNA 1X43A 3UATA 5I11A 2JTEA 3R6NA 2K7AA 5GJWB 4Z88A 2JS2A 1PKTA 1ZLMA 1AVZC 2F2WA 1T0JA 1U06A 1X69A 4CC2A 2BZ8A 5GJVB 1QCFA 2K9GA 1JXMA 4ORZA 1SRLA 3UA6A 1U3OA 1GFDA 4J9HA 2J7IA 4LUDA 1ABOA 2ECZA 1QLYA 4JJBA 2DMOA 1ZUUA 1VA7A 4F17A 3EG3A 5IXFA 1KJWA 1MV3A 1KFZA 2GTOA 2FO0A 2JM9A 1JQQA 2F2VA 4HVUA 2L3QA 1CKAA 2DA9A 1H8KA 2LJ1A 2DBKA 5HCKA 2X3WD 4EIKA 3C0CA 2JT4A 4HXJA 3NGPA 2XMFA 2LJ3A 3IQLA 4LNPA 4CC3A 4ESRA 1GFCA 4A63B 2YUQA 2ESWA 2OJ2A 2M51A 5FW9A 1NYGA 2CT3A 2RQRA 2FRYA 1K76A 1UGVA 2OAWA 1AEYA 4ZNXA 2LCSA 2EYWA 2EQIA 3VS7A 5FWCA 2HCKA 1I1JA 1ABQA 2IIMA 1W70A 3VS5A 3SEMA 4GLMA 1WFWA 4RTTA 1MUZA 3M0TA 3I9QA 3JV3A 2J6FA 4J9DA 4CC7A 2I0NA 4J9FA 2K2MA 2EYYA 2JS0A 1OOTA 1HSQA 1NYFA 2LQWA 2KE9A 4DEXA 2VWFA 2YUNA 1T3LA 1OPLA 3M0SA 1NEGA 2JMAA 2VVKA 1B3QA 3REBB 1RI9A 2YUOA 1ZUYA 3KFVA 2ED1A 2EPDA 2LP5A 4OMPA 4AG2C 2DL4A 2CH4W 4R0KA 3LH5A 2YDLA 4HCKA 4J9BA 3GBQA 2AZVA 3PE0A 1Z9ZA 2W0ZA 1M3BA 3RBBB 1K0SA 2KGTA 1PWTA 1YWPA 3RNJA 1NG2A 1G83A 1M27C 1Y0MA 2H8HA 1GCQA 2K3BA 1FYNA 4J9GA 2X3XD 1AZGB 2A28A 4OMOA 4RTVA 4JJCA 1JU5C 4J9IA 1WIEA 1ZBJA 1CSKA 1GBRA 4D8KA 1FMKA 2QDLA 5IHIA 4AFQC 2EGEA 2DX1A 3QWXX 3M0QA 1B07A 1YN8A 2KXDA 1AWOA 1GCQC 2DL3A 2O2OA 1AWXA 5IHKA 1W6XA 4WCIA 2KBTA 4D8DA 1UHFA 2A36A 2V1QA 2M0YA 1X27A 2YSQA 4CC4B 2DL7A 2FRWA 2DF6A 3O5ZA 2RPNA 2DL8A 2D1XA 1WI7A 5EC7A 4AG1C 2EW3A 2PNIA 2DVJA 1NEBA 4RTXA 2J06A 1TUDA 2O88A 4IIMA 1WXBA 1E7OA 2DLPA 2EGAA 2HSPA 2YT6A 1UDLA 4M4ZA 2AKLA 5I22A 2OI3A 2D8JA 1AWJA 1GBQA 1TG0A 1NM7A 2MOXA 2DYBA 1X6BA 2E5KA 2RQUA 3ZL7C 1SSHA 3TVTA 2MCNA 1QKWA 2K79A 2ED0A 4RTZA 1KIKA 1G2BA 1JO8A 1M30A 3NMZC 3VS3A 2P4RA 2RQTA 2BTTA 1JXOA 1U5SA 3M0RA 2PTKA 1XOVA 4AFZC 1SHFA 1X2QA 1WXUA 2RN8A 4RUGA 3H0IA 1WA7A 1ARKA 3EHQA 2DBMA 2DRMA 2LMJA 3UF4A 1I0CA 3REAB 3VS1A 1H3HA 2EGCA 3I5RA 1LCKA 2AK5A 3U23A 2CDTA 2RNAA 3PVLA 2HBWA 5FWBA 4Y92A 2B86A 1NLOC 3QWYA 2SRCA 2KT1A 3A98A 2JMCA 1YNZA 1X6GA 1UJYA 2CREA 2CUDA 4X1VA 2NUZA 3THKA 1AD5A 1M8MA 1QKXA 2C0TA 1AZEA 2HDAA 2V1RA 2FPDA 2W10A 2LX7A 1RLPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRO A;  3NPF A;  3M0P A;  3UA7 A;  3TSW A;  5L23 A;  3VRZ A;  1UTI A;  2FPF A;  1KSW A;  2RQW A;  2JXB A;  2BZX A;  1BU1 A;  1HJD A;  1SEM A;  4HVV A;  2GNC A;  3PVQ A;  4LN2 A;  1GRI A;  2LQN A;  1CKB A;  1PRL C;  2KRN A;  1WDX A;  1WXT A;  2A08 A;  1JEG A;  2RMO A;  1RUW A;  2C0O A;  1E6H A;  1WLP B;  2EYZ A;  3EG0 A;  1WX6 A;  3M0U A;  2YUP A;  1W1F A;  1UJ0 A;  1TUC A;  1J3T A;  2LZ6 B;  1K1Z A;  2EBP A;  2ABL A;  1QWE A;  4OMN A;  2ROL A;  3VS6 A;  2FPE A;  1PNJ A;  3I5S A;  3EGU A;  2LJ0 A;  4JZ4 A;  1SHG A;  2FEI A;  3VRY A;  1BK2 A;  1UHC A;  3ULR B;  5IXB A;  4F16 A;  1VYT A;  1VYV A;  1YWO A;  2AKK A;  1GL5 A;  1BB9 A;  1T3S A;  2J6O A;  2KYM A;  5IH2 A;  2DM1 A;  2NWM A;  1T0H A;  2J05 A;  2KT8 A;  1NLP C;  4JPB W;  1V1C A;  1OEB A;  2KRM A;  1UFF A;  2CH4 A;  2KXC A;  2GTJ A;  3H41 A;  1K4U S;  4RTY A;  1AWW A;  2D0N A;  4DEY A;  4LE9 A;  2EVR A;  2KNB B;  1H92 A;  2L0A A;  1PHT A;  1Y57 A;  2GGR A;  1SRM A;  4QT7 A;  2FG0 A;  4HVW A;  1UG1 A;  4E6R A;  3H0H A;  1M3A A;  4OMM A;  1GCP A;  3SHW A;  2L3S A;  1RLQ C;  2KEA A;  2MIO A;  2RF0 A;  2BZY A;  1AOJ A;  2RQV A;  3VS0 A;  1I07 A;  2CUB A;  1PRM C;  2EYX A;  1E6G A;  2PZ1 A;  2KR3 A;  1SPK A;  4OML A;  2CSI A;  1EFN A;  3EG1 A;  3I35 A;  1UEC A;  2DNU A;  1OV3 A;  2HEQ A;  2DRK A;  2F2X A;  2DL5 A;  2ROT A;  3EHR A;  4F14 A;  4K11 A;  3FJ5 A;  2C0I A;  3EG2 A;  2JW4 A;  1HD3 A;  4AFU C;  2J6K A;  3VS4 A;  1PKS A;  1QWF A;  3VS2 A;  5ECA A;  2KRS A;  1ZX6 A;  2O9V A;  2EKH A;  1S1N A;  2ENM A;  2DIL A;  3CQT A;  4RTU A;  4RTW A;  2K6D A;  4GBQ A;  2G6F X;  1IO6 A;  4AFS C;  1WYX A;  5IHN A;  1UE9 A;  2A37 A;  4KRT A;  4FSS A;  4JJD A;  2LNH B;  4LUE A;  2CSQ A;  4J9E A;  4OMQ A;  2KYB A;  4IIO A;  2L3P A;  2O9S A;  1A0N B;  1K9A A;  1N5Z A;  2AZS A;  2O31 A;  1Z9Q A;  2L2P A;  4JZ3 A;  1MV0 B;  1VYU A;  1ZSG A;  3TSZ A;  1YCS B;  1K0X A;  4Z8A A;  2GBQ A;  1BBZ A;  3NHN A;  4J9C A;  2DE0 X;  2SEM A;  1X2K A;  2D8H A;  4Z89 A;  1M3C A;  1UUE A;  2JM8 A;  1ZUK A;  3H0F A;  1YP5 A;  1OPK A;  2GQI A;  2DJQ A;  2CT4 A;  2VKN A;  1X43 A;  3UAT A;  5I11 A;  2JTE A;  3R6N A;  2K7A A;  5GJW B;  4Z88 A;  2JS2 A;  1PKT A;  1ZLM A;  1AVZ C;  2F2W A;  1T0J A;  1U06 A;  1X69 A;  4CC2 A;  2BZ8 A;  5GJV B;  1QCF A;  2K9G A;  1JXM A;  4ORZ A;  1SRL A;  3UA6 A;  1U3O A;  1GFD A;  4J9H A;  2J7I A;  4LUD A;  1ABO A;  2ECZ A;  1QLY A;  4JJB A;  2DMO A;  1ZUU A;  1VA7 A;  4F17 A;  3EG3 A;  5IXF A;  1KJW A;  1MV3 A;  1KFZ A;  2GTO A;  2FO0 A;  2JM9 A;  1JQQ A;  2F2V A;  4HVU A;  2L3Q A;  1CKA A;  2DA9 A;  1H8K A;  2LJ1 A;  2DBK A;  5HCK A;  2X3W D;  4EIK A;  3C0C A;  2JT4 A;  4HXJ A;  3NGP A;  2XMF A;  2LJ3 A;  3IQL A;  4LNP A;  4CC3 A;  4ESR A;  1GFC A;  4A63 B;  2YUQ A;  2ESW A;  2OJ2 A;  2M51 A;  5FW9 A;  1NYG A;  2CT3 A;  2RQR A;  2FRY A;  1K76 A;  1UGV A;  2OAW A;  1AEY A;  4ZNX A;  2LCS A;  2EYW A;  2EQI A;  3VS7 A;  5FWC A;  2HCK A;  1I1J A;  1ABQ A;  2IIM A;  1W70 A;  3VS5 A;  3SEM A;  4GLM A;  1WFW A;  4RTT A;  1MUZ A;  3M0T A;  3I9Q A;  3JV3 A;  2J6F A;  4J9D A;  4CC7 A;  2I0N A;  4J9F A;  2K2M A;  2EYY A;  2JS0 A;  1OOT A;  1HSQ A;  1NYF A;  2LQW A;  2KE9 A;  4DEX A;  2VWF A;  2YUN A;  1T3L A;  1OPL A;  3M0S A;  1NEG A;  2JMA A;  2VVK A;  1B3Q A;  3REB B;  1RI9 A;  2YUO A;  1ZUY A;  3KFV A;  2ED1 A;  2EPD A;  2LP5 A;  4OMP A;  4AG2 C;  2DL4 A;  2CH4 W;  4R0K A;  3LH5 A;  2YDL A;  4HCK A;  4J9B A;  3GBQ A;  2AZV A;  3PE0 A;  1Z9Z A;  2W0Z A;  1M3B A;  3RBB B;  1K0S A;  2KGT A;  1PWT A;  1YWP A;  3RNJ A;  1NG2 A;  1G83 A;  1M27 C;  1Y0M A;  2H8H A;  1GCQ A;  2K3B A;  1FYN A;  4J9G A;  2X3X D;  1AZG B;  2A28 A;  4OMO A;  4RTV A;  4JJC A;  1JU5 C;  4J9I A;  1WIE A;  1ZBJ A;  1CSK A;  1GBR A;  4D8K A;  1FMK A;  2QDL A;  5IHI A;  4AFQ C;  2EGE A;  2DX1 A;  3QWX X;  3M0Q A;  1B07 A;  1YN8 A;  2KXD A;  1AWO A;  1GCQ C;  2DL3 A;  2O2O A;  1AWX A;  5IHK A;  1W6X A;  4WCI A;  2KBT A;  4D8D A;  1UHF A;  2A36 A;  2V1Q A;  2M0Y A;  1X27 A;  2YSQ A;  4CC4 B;  2DL7 A;  2FRW A;  2DF6 A;  3O5Z A;  2RPN A;  2DL8 A;  2D1X A;  1WI7 A;  5EC7 A;  4AG1 C;  2EW3 A;  2PNI A;  2DVJ A;  1NEB A;  4RTX A;  2J06 A;  1TUD A;  2O88 A;  4IIM A;  1WXB A;  1E7O A;  2DLP A;  2EGA A;  2HSP A;  2YT6 A;  1UDL A;  4M4Z A;  2AKL A;  5I22 A;  2OI3 A;  2D8J A;  1AWJ A;  1GBQ A;  1TG0 A;  1NM7 A;  2MOX A;  2DYB A;  1X6B A;  2E5K A;  2RQU A;  3ZL7 C;  1SSH A;  3TVT A;  2MCN A;  1QKW A;  2K79 A;  2ED0 A;  4RTZ A;  1KIK A;  1G2B A;  1JO8 A;  1M30 A;  3NMZ C;  3VS3 A;  2P4R A;  2RQT A;  2BTT A;  1JXO A;  1U5S A;  3M0R A;  2PTK A;  1XOV A;  4AFZ C;  1SHF A;  1X2Q A;  1WXU A;  2RN8 A;  4RUG A;  3H0I A;  1WA7 A;  1ARK A;  3EHQ A;  2DBM A;  2DRM A;  2LMJ A;  3UF4 A;  1I0C A;  3REA B;  3VS1 A;  1H3H A;  2EGC A;  3I5R A;  1LCK A;  2AK5 A;  3U23 A;  2CDT A;  2RNA A;  3PVL A;  2HBW A;  5FWB A;  4Y92 A;  2B86 A;  1NLO C;  3QWY A;  2SRC A;  2KT1 A;  3A98 A;  2JMC A;  1YNZ A;  1X6G A;  1UJY A;  2CRE A;  2CUD A;  4X1V A;  2NUZ A;  3THK A;  1AD5 A;  1M8M A;  1QKX A;  2C0T A;  1AZE A;  2HDA A;  2V1R A;  2FPD A;  2W10 A;  2LX7 A;  1RLP C; 
#chains in the Genus database with same CATH topology
 3H8Z A;  2KRO A;  3NPF A;  3VRZ A;  4PL6 A;  4BE1 A;  4HT9 A;  2JXB A;  4FIB A;  3QUI A;  1OZ3 A;  5KYX A;  3CPW P;  4BDZ A;  1Q7Y C;  2JOY A;  1NZ9 A;  5KCO A;  4ZGD B;  1Y71 A;  1SEM A;  2GNC A;  5GAN f;  4LN2 A;  1GRI A;  3RUX A;  5CVI A;  5IT9 E;  4J6Y A;  2KMT A;  4JLI A;  2A08 A;  4FYY B;  2C0O A;  3MKD A;  2P4T A;  1D09 B;  3DB4 A;  4M7D E;  3EG0 A;  1WX6 A;  3OYL A;  1TUC A;  3CCU A;  1OU9 A;  1VQ9 A;  3CD6 Q;  2QA4 T;  1WZO A;  4B9X A;  3OYI A;  4M7A E;  4PNO A;  2RHZ A;  2ROL A;  3ASK A;  1PNJ A;  4F7U F;  4JZ4 A;  5CKH A;  3VRY A;  1UHC A;  4F16 A;  1VQ8 T;  1VYV A;  1C6V X;  3M5A A;  2VGM A;  2KT8 A;  2RHY A;  3LWI A;  1VQ4 T;  2AT1 B;  1U8R A;  2GCX A;  2RHX A;  2DKG A;  2F1L A;  2Y4X A;  2R5M A;  3FB9 A;  2D0N A;  4LE9 A;  2KNB B;  1H92 A;  1PHT A;  4OB1 B;  3CCR A;  2GGR A;  2O4X A;  3P8D A;  4QT7 A;  4BD3 A;  5GAO r;  2QA4 Q;  1VQL T;  1UG1 A;  3CBP A;  4LDX A;  4E6R A;  4ELZ C;  4PLL A;  5KYX B;  4KH0 B;  1GCP A;  4C5E A;  1JJ2 P;  1RLQ C;  2RF0 A;  4IKF A;  2BZY A;  3VS0 A;  2CUB A;  4IUR A;  1E6G A;  5GAN 2;  2X4J A;  4BI3 A;  2H3J A;  2CSI A;  2BIV A;  3EG1 A;  1VQ8 Q;  1UEC A;  2DNU A;  2HEQ A;  4BI4 A;  2F2X A;  3JCM P;  3N5B B;  3S3M A;  3EHR A;  1NJI U;  1B34 A;  2RK2 A;  2RJD A;  3EFR A;  4AFU C;  1VQ4 Q;  2YRC A;  3OW2 A;  3V8L A;  5GAM g;  1VQ6 A;  4KGV B;  1ZX6 A;  3LH0 A;  3CCL T;  2EKH A;  2DIL A;  3HPW A;  4B6M A;  3PNW C;  2Y90 A;  2OTJ A;  2G3R A;  2OAU A;  5I21 A;  1UE9 A;  4M7D B;  1M90 U;  3MP1 A;  4FSS A;  1VQL Q;  2LNH B;  1WNL A;  3BDL A;  4IIO A;  2L3P A;  4KH1 B;  2AZS A;  2O31 A;  2L3R A;  3QHS A;  1ZSG A;  4A54 A;  1HK9 A;  2D9T A;  1ZA2 B;  4HCC A;  1K0X A;  4Z8A A;  2GBQ A;  5GAN e;  2YHT A;  4E7Z A;  3CME T;  1QW1 A;  4J9C A;  2SEM A;  3OYK A;  1UUE A;  2JM8 A;  3CPW S;  3H0F A;  3NTH A;  1OUL A;  1Q7Y U;  4ZTF A;  2EQK A;  2R5A A;  3EFS A;  3MO8 A;  4D6W A;  3MEU A;  2O4X B;  2CT4 A;  1D3B A;  3UAT A;  2E70 A;  3R6N A;  2K3X A;  4CRI A;  1RI0 A;  2DIQ A;  5GJW B;  3M54 A;  3L1A A;  3CCL Q;  2DVE A;  4FW1 A;  3BDU A;  4CC2 A;  1YIJ T;  4ZGE B;  3LYI A;  2MWP A;  1BCO A;  4C8Q A;  4NS5 A;  5J3B A;  1TSF A;  3GNG A;  2ZPF B;  4ZN1 A;  3CC4 A;  4ZTJ A;  1ABO A;  2ECZ A;  2LDM A;  2F5T X;  2HL3 A;  1KFZ A;  4FT4 A;  3QDF A;  4PFO A;  4HVU A;  1JRI A;  3CCM T;  3NTI A;  1BI1 A;  1B34 B;  3M56 A;  2D0Q B;  4C8Q C;  4BDY A;  3JCM g;  4KUD K;  3CME Q;  3OYA A;  3GNF B;  1KQS P;  1WHJ A;  4KUL A;  2ZZD A;  4QQ6 A;  3OS0 A;  5FW9 A;  3DB3 A;  2CT3 A;  3CCV T;  2RQR A;  2FRY A;  4Y91 A;  4XAX B;  2JTF A;  1K76 A;  1VQ7 Q;  1MNE A;  4M78 E;  4HA8 A;  4J83 A;  2HCK A;  2LRQ A;  4M7D F;  3E1S A;  1YIJ Q;  1VOM A;  2Z0W A;  1YJN A;  4C92 C;  5GAN 3;  4J9D A;  4CC7 A;  4C0F A;  5HKC A;  4J9F A;  2LNV A;  1VQO T;  2CZ7 B;  2EYY A;  3I56 A;  2VYT A;  4M7A F;  3BW1 A;  2LQW A;  1WHL A;  4C5G A;  2O01 E;  3CCM Q;  5GMK m;  3V7S A;  3VYG A;  4N4G A;  3REB B;  2YUO A;  3SDZ A;  3KFV A;  2ED1 A;  3RKW A;  3CCQ T;  4R0K A;  3LH5 A;  4OP0 A;  4PJN A;  3URG A;  4J9B A;  3GBQ A;  4JJN K;  1OX9 A;  3G4S A;  1Z9Z A;  2W0Z A;  1M3B A;  2QYZ A;  4C8Q B;  5GAM f;  3A1P A;  2LT1 A;  5LJ5 e;  3CCV Q;  2KGT A;  5FU7 C;  1NG2 A;  4OGE A;  3T9N A;  3J81 E;  2QEX Q;  4ANJ A;  2X3X D;  1AZG B;  4RTV A;  2NYS A;  3V7C A;  2CZ6 B;  1VQO Q;  4M7D G;  4D8K A;  1LPL A;  3OYG A;  3I55 A;  3P8B B;  4AFQ C;  1D0Y A;  1LVK A;  3M0Q A;  4V2S A;  1YN8 A;  4AT1 B;  4EMG A;  1AWO A;  2O2O A;  1AWX A;  4WCI A;  2EYQ A;  3E19 A;  2QTX A;  3JCM V;  2A36 A;  2V1Q A;  2VXF A;  2CZ1 B;  4M7A G;  2DF6 A;  3TCJ A;  1N9S A;  2COW A;  1WI7 A;  3CCQ Q;  2LTO A;  3S3N A;  1P92 A;  1D1A A;  4L59 A;  5KYW A;  2HQH A;  3A8G B;  1TUD A;  3SWN C;  1QCO A;  1YJ9 T;  2DLP A;  3PIP A;  2EGA A;  3OB9 A;  1VQM A;  5LJ3 j;  2HSP A;  1KD1 R;  3M53 A;  4M4Z A;  1AWJ A;  3JCM Q;  5GAO m;  2RQU A;  3ZL7 C;  3QYG B;  1I81 A;  1G2B A;  4L6V 5;  4PJO G;  3PIO A;  5D6X A;  3ER0 A;  8ATC B;  4UC4 A;  2Y4Y A;  2MAM A;  4BUG A;  2ATC B;  4AFZ C;  1SHF A;  1ACM B;  2E3H A;  2ZPI B;  4CI0 C;  1WA7 A;  1M4Z A;  3EHQ A;  1VQP A;  4QQG A;  2LMJ A;  2MPX C;  1H3H A;  4OB0 B;  1SF9 A;  1LCK A;  3OBY A;  3VU3 C;  1VQK T;  1D0X A;  2RNA A;  2L8D A;  4E47 A;  5FWB A;  2HBW A;  1KQS S;  1QMC A;  3H9N A;  4Y92 A;  4C8Q D;  1YJ9 Q;  3CMA T;  1NLO C;  1Q86 R;  5KE2 A;  3CCE A;  3G71 T;  1YNZ A;  2LQ8 A;  2RA2 A;  1QVG P;  3CCR T;  1DJ7 B;  2NUZ A;  1AD5 A;  1YBY A;  1QKX A;  2V8K A;  2HDA A;  1G3Y A;  1Q86 C;  1GXI E;  4OB2 B;  2M16 A;  2E10 A;  3JCM h;  1UTI A;  3EG9 A;  2C06 A;  2BZX A;  1IGQ A;  1K8A R;  5KYW B;  1BU1 A;  4XK8 E;  3MPU B;  1M2V A;  5KYU A;  4C0G A;  5GAM e;  2LQN A;  1VQK Q;  1K8A C;  1YFN A;  3A5Z B;  1E6H A;  4PLI A;  1VQ6 T;  3CMA Q;  4JS5 A;  3UT1 A;  1WLP B;  1TS9 A;  3FIF A;  3G71 Q;  2YUP A;  1W1F A;  4MMK A;  3HRT A;  3CCR Q;  1QP2 A;  5LJ3 g;  1QQJ A;  3INZ A;  1ZHI A;  1W2B P;  3JB9 I;  2P0Q A;  4Q5W A;  2E1H A;  3CC7 T;  1RAH B;  2RHU A;  3EGU A;  1TUG B;  2LJ0 A;  5I2M A;  3C4S A;  4ZGJ B;  3ULR B;  2CP5 A;  1VYT A;  3AHU A;  1OI1 A;  1YWO A;  2WSF E;  5GMK j;  2DZ9 A;  2DM1 A;  2MYS A;  2NWM A;  1D0Z A;  3OYF A;  1QVP A;  1T0H A;  2J05 A;  4YTL A;  4EMH A;  1V1C A;  1OEB A;  1FXX A;  1G3T A;  2KRM A;  1UFF A;  1OYX A;  4XTZ A;  1M1F A;  1WGS A;  1EIF A;  1K4U S;  4EPC A;  2RJE A;  2HMA A;  1VQ6 Q;  2DET A;  1Y57 A;  1SRM A;  2FG0 A;  1QVF A;  2RH2 A;  5CO7 A;  3H0H A;  4M78 G;  3QJ6 A;  3SHW A;  2YLC A;  2KEA A;  1I5O B;  2DK3 A;  4FM4 B;  1M2V B;  2RQV A;  3PMI A;  3FLG A;  1RAB B;  1I07 A;  5CIU A;  1PRM C;  5KYU B;  3CC7 Q;  2EYX A;  2PZ1 A;  4N4I A;  5GAN 6;  2EJF A;  2CP3 A;  2DRK A;  4M75 A;  3VYH B;  2PVD B;  1W4S A;  4JLG A;  3EG2 A;  4FW2 A;  4PJJ A;  2DD4 A;  1HD3 A;  3JB9 F;  1H3Z A;  2R57 A;  1YJW T;  5ECA A;  1YI2 A;  2KRS A;  2FYK A;  1YIT T;  3R6O A;  4XU2 A;  2ENM A;  3LWH A;  3JB9 D;  1R0C B;  4M75 C;  2K6D A;  4ELY C;  4GBQ A;  3WVE B;  1TWB A;  4OF1 A;  5LL6 S;  5IHN A;  2XIC A;  3HFO A;  2A37 A;  2KI7 A;  3LW5 E;  1SKU B;  1VQN A;  2E65 A;  2CSQ A;  4OMQ A;  1QVG S;  2QQB A;  2DAQ A;  1K9A A;  1N5Z A;  5A0D A;  3G6E Q;  1RAD B;  1D1C A;  3CC2 T;  4FU6 A;  1YCS B;  2RK1 A;  1Q86 U;  3CXC A;  1M8V A;  1M3C A;  1Q82 R;  3LGL A;  4N4H A;  2RO0 A;  2JVV A;  2NUP A;  2HZY A;  2VKN A;  1X43 A;  3TU4 K;  1YJW Q;  2K7A A;  1KQ2 A;  1Q82 C;  4PFP A;  1YIT Q;  4DOV A;  1PKT A;  2F2W A;  1AVZ C;  1T0J A;  1KC8 R;  1FX7 A;  5GJV B;  1K8A U;  5KH6 A;  3ZBD A;  2QAS A;  4RMO A;  2K4Y A;  3ZFJ A;  4ORZ A;  1SRL A;  2L89 A;  2OTL A;  2J7I A;  3EH2 A;  2DD5 A;  1VA7 A;  3SD4 A;  3HKS A;  3EG3 A;  1KJW A;  3MHX A;  2COY A;  1W2B S;  1XQH A;  3L2Z A;  1KC8 C;  2PVG B;  4DOW A;  2VC8 A;  2FO0 A;  1JQQ A;  2F2V A;  2XKO C;  3CC2 Q;  4JRI A;  3OS1 A;  1BI3 A;  2DA9 A;  1H8K A;  4FT2 A;  5HCK A;  2RB6 A;  4EIK A;  3A8L B;  1S72 A;  4C0D C;  1PSE A;  2XMF A;  2LJ3 A;  3VUZ A;  4LNP A;  4CC3 A;  3VUB A;  4A63 B;  2OJ2 A;  5J26 A;  1NYG A;  5FU6 C;  5DY9 A;  1LJO A;  3M57 A;  4JS4 A;  2E4H A;  1AEY A;  1UGV A;  2LCS A;  4E7I A;  3FJP A;  2EYW A;  3VS7 A;  3RKX A;  5LJ3 h;  2YRV A;  5FWC A;  1X6O A;  4IUU A;  4BE2 A;  1ABQ A;  1Q95 G;  5HK3 A;  3SEM A;  4LDV A;  2MF2 A;  2BE9 B;  4F7U G;  2I0N A;  2LC4 A;  3QBY A;  3OS5 A;  2JS0 A;  5CQY A;  1NPP A;  2KE9 A;  4DEX A;  3OS2 A;  1HYO A;  1T3L A;  7AT1 B;  3M0S A;  4JRQ A;  1NEG A;  2QAZ A;  3EGX A;  3FRN A;  3MJX A;  1BIB A;  2VVK A;  3J80 E;  1B3Q A;  2MWO A;  2NUP B;  3QZ9 B;  5LJ5 f;  2XDP A;  3GPL A;  3QO3 A;  2BE7 D;  1XJW B;  2EPD A;  4OMP A;  2CH4 W;  4ZN3 A;  2YLB A;  2YDL A;  3WXM B;  3HTR A;  1IGU A;  4QVZ A;  4PJO C;  2PUK B;  3GF5 A;  5GAO q;  4C0D B;  1YWP A;  2VV5 A;  4E7J A;  5GAN 7;  1M27 C;  1GCQ A;  5GAN 8;  2K3B A;  1N27 A;  4A4F A;  2E64 A;  4J9G A;  4FL6 A;  2F69 A;  3X24 B;  2QQS A;  3A8M B;  4C8Q E;  4JJC A;  2XHC A;  1BI0 A;  3TEE A;  4A4H A;  4B9W A;  1ZBJ A;  2PUO B;  5AT1 B;  5L8R E;  1OU8 A;  2QDL A;  5IHI A;  1IB8 A;  2DX1 A;  3KUF A;  4M75 D;  4DBR A;  1GCQ C;  2JNG A;  2EJ9 A;  2JZ2 A;  5HK0 A;  4DBF A;  4OB3 B;  1XNI A;  1X27 A;  4XTW A;  4XTU A;  4OGC A;  2DL8 A;  4AG1 C;  2FZK B;  2EW3 A;  1RAI B;  2DVJ A;  3QG1 A;  6AT1 B;  5C6S A;  2O88 A;  1ZSZ C;  4Z02 A;  4E7H A;  4IIM A;  5CR2 A;  1VQ5 T;  5CKF A;  3S3O A;  2KDS A;  2AKL A;  4J6W A;  4A4K A;  1TG0 A;  1NM7 A;  2MOX A;  2CYZ B;  2DYB A;  3Q1J A;  4C92 A;  1RAF B;  1Q82 U;  1SSH A;  1QKW A;  2FB7 A;  1LNX A;  2ED0 A;  4M77 A;  2RD1 A;  1TTH B;  2BTT A;  1JXO A;  1MGQ A;  5IAY A;  1XOV A;  2DFU A;  4J7F A;  2L5Q A;  3CD6 A;  2XID A;  1KC8 U;  2KVQ G;  2VUB A;  3OSV A;  5GMK h;  1WHK A;  2DBM A;  3UF4 A;  5D6Y A;  2NUT A;  3VS1 A;  4M77 C;  4PKC C;  1KK7 A;  1UGR B;  4QKU A;  4XTY A;  2B86 A;  3OW2 P;  1JJ2 S;  1VQ5 Q;  3A98 A;  1I5L A;  1X6G A;  3OYY A;  4LDU A;  1B7T A;  2CUD A;  2COZ A;  1D3B B;  3THK A;  1M8M A;  3C94 A;  4RKU E;  2DXU A;  2V1R A;  3HP9 A;  4PJL A;  3CCJ T;  2RJC A;  3GLX A;  3EFO A;  2FPF A;  4C5H A;  3L2U A;  2FZC B;  1N6A A;  2LX9 A;  2K5F A;  1HJD A;  2QA4 A;  3UDC A;  4BB7 A;  4BE0 A;  1TOV A;  3PVQ A;  3OYC A;  2X4Y A;  1O9S A;  1PRL C;  1Y7X A;  1SG5 A;  2ZPG B;  2KRN A;  1WDX A;  4M78 C;  1WPY A;  4KGX B;  1PSF A;  4E2F B;  3NFC A;  1JEG A;  2RMO A;  3SWN A;  2DXC A;  3M58 A;  3F70 A;  4C92 B;  1BI2 A;  1VQ8 A;  5GAN j;  3HSB A;  3M0U A;  1UJ0 A;  1J3T A;  2LZ6 B;  1R0B G;  3X26 B;  3M4Y A;  1K1Z A;  1M5Q 1;  4KGZ B;  4PJO D;  2ABL A;  4R56 A;  1M1G A;  1QWE A;  1JBM A;  4OMN A;  3QII A;  2QI2 A;  2E41 A;  3VS6 A;  3CCJ Q;  2X35 A;  1SHG A;  5CQX A;  2NUT B;  5IXB A;  1GL5 A;  3PFS A;  1BB9 A;  3CCS A;  5GAN d;  1T3S A;  1VQL A;  2J6O A;  5IH2 A;  3CCU T;  2EQM A;  3RR6 A;  1VQ9 T;  1OQK A;  5FU7 B;  1NLP C;  1Q81 R;  5GMK l;  3V8K A;  2KXC A;  1KD1 C;  2GTJ A;  2K5L A;  4IUP A;  5AYF A;  2X9H A;  1WHM A;  4RTY A;  4DEY A;  5GMK i;  3JCM f;  2L0A A;  2EWN A;  3EFO B;  4LDW A;  4HVW A;  2FVU A;  4C8Q F;  3A8H B;  4XTV A;  1M3A A;  3LLR A;  4OMM A;  2MIO A;  1ZBX A;  1K9M R;  5D6W A;  1ZQ1 A;  2DJZ A;  3CCL A;  1MHN A;  5I2S A;  4OML A;  3QSU A;  1EFN A;  3I35 A;  4JRK A;  1IHW A;  3SWN B;  4R55 A;  1S72 T;  1K9M C;  3CCU Q;  3X28 B;  2XDD A;  2DL5 A;  2FZG B;  4F14 A;  4K11 A;  1VQ9 Q;  1PG5 B;  3FJ5 A;  4C92 F;  4P5N A;  4J8O A;  2J6K A;  3VS4 A;  3OYN A;  1UB4 A;  2LCL A;  1PM3 A;  1QWF A;  3G7Z A;  3VS2 A;  3OQ5 A;  2ZPE B;  1I8F A;  1X75 C;  4C92 D;  1S1N A;  5CKD A;  3GIB A;  3CQT A;  1OX8 A;  4RTU A;  4M77 D;  3CBO A;  1IO6 A;  1WYX A;  1G3S A;  3C12 A;  4KRT A;  2E6Z A;  4JJD A;  4XU0 A;  4LUE A;  4J9E A;  2KYB A;  2AIR B;  1HXD A;  3OYD A;  2O9S A;  1VQ7 A;  1A0N B;  1NPR A;  1WJR A;  2L2P A;  4JZ3 A;  1MV0 B;  1VYU A;  2DXB A;  3TSZ A;  5GAO n;  3CPW A;  1YIJ A;  4C8Q G;  3EH1 A;  4O6J A;  4ATO A;  2QDY B;  3NHN A;  2HQX A;  2DE0 X;  1X2K A;  2D8H A;  4FCY A;  5KYY A;  4Z89 A;  2OTJ T;  1VUB A;  1ZUK A;  1S72 Q;  2ZAE A;  4DQ2 A;  2D6F A;  5HY6 A;  2GFU A;  1BIA A;  2P0P A;  2H3E B;  5I11 A;  3O8V A;  1WHH A;  5LJ5 d;  2JS2 A;  3DKM A;  4RCB A;  3PGG A;  1U06 A;  1QCF A;  1O75 A;  1JXM A;  4XQ3 A;  3G1J A;  2MK5 A;  4OMF B;  1FMW A;  4M78 D;  3RES A;  2E6N A;  3AT1 B;  3HFN A;  3CCV A;  1QLY A;  4JJB A;  1KHC A;  1ZUU A;  2HNI A;  2GTO A;  4FSX A;  2JM9 A;  2QEX A;  1LOJ A;  3NTK A;  3HRS A;  3ZEH A;  2HAX A;  3C0C A;  1NBE B;  1NJI R;  4HKE A;  3EG9 B;  3V8J A;  2GFA A;  2E3I A;  4M75 E;  3IQL A;  2OTJ Q;  1GFC A;  2YUQ A;  1VQO A;  2ESW A;  2M51 A;  4EDU A;  3GP8 A;  3CC4 T;  3JCM e;  2XD0 A;  4FYX B;  4Y28 E;  2EQI A;  5DLQ E;  2A7Y A;  1I1J A;  3ME9 A;  1N9R A;  1SSF A;  3VS5 A;  1KD1 U;  2PU9 B;  2DTH A;  2HKN A;  4GLM A;  1WFW A;  4RTT A;  2R58 A;  1MMD A;  2VB6 A;  4RG2 A;  2K2M A;  1RL2 A;  1OOT A;  1NYF A;  1YHQ A;  5KYY B;  5C0M A;  2YUN A;  1OPL A;  4LDY A;  2DTI A;  2YRD A;  2JMA A;  2VXE A;  2X4X A;  1N8R R;  3RKY A;  2EJG A;  1RI9 A;  2LVM A;  2QQ9 A;  4X34 A;  2RJF A;  4J6X A;  3E9G A;  1YJN T;  2LP5 A;  4AG2 C;  1Q7Y R;  2DL4 A;  3OYB A;  2I2L A;  2HBP A;  4HCK A;  5FLX E;  2AZV A;  1N8R C;  3CC4 Q;  5FRN A;  3I56 T;  1K9M U;  1K0S A;  4HT8 A;  1PWT A;  3RNJ A;  3C95 A;  3OSS C;  2EKO A;  5M9O A;  3E9F A;  1FYN A;  3KXT A;  2PVO B;  2A28 A;  3LGF A;  1U1S A;  4OMO A;  3PTA A;  3VV0 A;  3DLM A;  5FRO A;  2RI2 A;  5GAM j;  1JU5 C;  2X51 A;  2MMP A;  1WQW A;  1GBR A;  1R8O B;  1YJ9 A;  1IHV A;  3G4S T;  1FMK A;  2V8I A;  4QVC A;  3MEW A;  3QWX X;  1B07 A;  4JUV A;  2DL3 A;  3OY9 A;  1W6X A;  3L2R A;  1UHF A;  5LJ3 f;  2YSQ A;  3OYE A;  3HHT B;  4CC4 B;  3UWN A;  3JB9 G;  3O5Z A;  3MP8 A;  3JSC A;  1YJN Q;  3QZ5 B;  5EC7 A;  2WAC A;  2NLU A;  2PNI A;  2V8J A;  1NEB A;  5GAM d;  1IRX A;  3I56 Q;  4M75 B;  3OYM A;  4M7D A;  3I55 T;  3OMC A;  3J7A F;  2YT6 A;  2CP0 A;  3UPU A;  1UDL A;  3P8H A;  5GAN h;  2EAY A;  3GOX A;  5I22 A;  3MP6 A;  2OI3 A;  2D8J A;  3QPH A;  9ATC B;  4PK4 A;  1X6B A;  4M7A A;  1MMG A;  1QVF P;  5EG2 A;  1VQK A;  4RTZ A;  1KIK A;  1R77 A;  2GQV A;  2ZCF B;  2YXY A;  1JO8 A;  1PC0 A;  1M30 A;  4M7D C;  2P4R A;  3G4S Q;  2RQT A;  3CMA A;  4WF2 A;  4PJO E;  2PTK A;  3G71 A;  3HRU A;  1V29 B;  1VQM T;  1X2Q A;  1AHJ B;  2RN8 A;  3H0I A;  5CKB A;  5CKE A;  1KQS A;  2RHI A;  3CCS T;  3QKJ A;  4L5G A;  4M7A C;  5A0L A;  3FEO A;  3REA B;  3I5R A;  2CDT A;  3FDR A;  3VKI A;  2JN0 A;  2F5K A;  4PJO A;  1BCM A;  4NL3 A;  3I55 Q;  4QQD A;  2QGG A;  3JCM J;  3CEY A;  4F04 B;  2FL7 A;  1UJY A;  2CRE A;  2C0T A;  1VQP T;  2FPD A;  2W10 A;  5KYN A;  2E5Q A;  3M0P A;  4ME7 A;  3TSW A;  3UA7 A;  2QXF A;  5L23 A;  1D1B A;  3JCM d;  1K73 R;  1KSW A;  2RQW A;  1VQM Q;  1WHG A;  1IZ6 A;  3EAE A;  3CCE T;  1MND A;  3BFM A;  4HVV A;  5FU6 B;  3CXC P;  5A0G A;  3CCS Q;  4J7I A;  1FMV A;  2KAF A;  1CKB A;  4M75 F;  2XG8 D;  1K73 C;  3V7R A;  3HL8 A;  1WXT A;  3CC7 A;  4TVR A;  4BI8 B;  3TRE A;  1RUW A;  1ZSZ A;  3JCM b;  2P84 A;  4M7A B;  2DEQ A;  2EYZ A;  1M9S A;  1N8R U;  2QGF B;  5J39 A;  1WJQ A;  2HD0 A;  4X9C A;  4EMK A;  1VQP Q;  3OA6 A;  2EBP A;  4C92 E;  1M1K R;  4M77 E;  1VQ7 T;  2FPE A;  3RDV A;  3I5S A;  4NOY A;  5LJ3 e;  5LJ5 h;  2LCC A;  2FEI A;  4WTO B;  1BK2 A;  2DO3 A;  5FRM A;  1YCY A;  2A3L A;  2AKK A;  3CCE Q;  3OBW A;  2KYM A;  4EMK C;  4PJO B;  1M1K C;  3MEA A;  2XDB A;  2K3Y A;  3L2Q A;  3EGX B;  4IUT A;  1PD1 A;  4BY6 C;  4JPB W;  4JDS A;  3M59 A;  3G6E A;  2KK4 A;  1WJS A;  2CH4 A;  2X4W A;  3SFM A;  3JB9 H;  1ZA1 B;  3H41 A;  3DLL A;  2VAS A;  1AWW A;  2EVR A;  5D7U A;  4M75 G;  3X25 B;  2JTM A;  3M9Q A;  3VJP A;  2ZPB B;  2L3S A;  1YJW A;  1AOJ A;  1G3W A;  3PMT A;  4MZT A;  1QVF S;  3H6Z A;  1YIT A;  1F1B B;  2KR3 A;  2AHJ B;  4LXC A;  1SPK A;  2QEX T;  2K2V A;  2ZPH B;  1KQ1 A;  2CGH A;  2K5I A;  1OV3 A;  2M9U A;  2M1H A;  1ZSZ B;  3QJY A;  2ROT A;  1FWZ A;  4M7D D;  1G5V A;  2C0I A;  4IUQ A;  2JW4 A;  4PFZ A;  1Y96 A;  4MZM A;  3CC2 A;  1PKS A;  4M78 A;  1EZZ B;  3RMQ A;  4EMK B;  1XTD A;  2XK0 A;  3QXE B;  2O9V A;  1QVG A;  4M7A D;  4BY6 B;  2HL5 C;  2XI9 A;  2QTV A;  4RTW A;  3S6W A;  4QW2 A;  2G6F X;  4AFS C;  2M02 A;  2XU8 A;  5IN1 A;  4GY5 A;  1YHQ T;  1VIF A;  1Z9Q A;  1KG1 A;  1RAA B;  3LX7 A;  3E2U A;  4X9D A;  2KSS A;  4PJO F;  1YI2 T;  4KUI A;  4M77 B;  1BBZ A;  3L2V A;  1I4K 1;  2EIF A;  2RI5 A;  3PT9 A;  1YP5 A;  1OPK A;  2GQI A;  1RAC B;  4O5V A;  2DJQ A;  4PJM A;  1VQN T;  1UGS B;  1VQ4 A;  3CXC S;  4KBM B;  3OYH A;  5A2Q E;  2JTE A;  5DLO A;  2JJ9 A;  4Z88 A;  4JRP A;  1K73 U;  4RG8 A;  2WSE E;  4DA4 A;  1ZLM A;  1X69 A;  1TH7 A;  2BZ8 A;  2K9G A;  1WQ7 A;  5GMK e;  1W2B A;  1UGQ B;  5GAN 4;  3UA6 A;  1U3O A;  1GFD A;  4J9H A;  5GAM h;  4LUD A;  4E7L A;  1UEB A;  4A4G A;  2DMO A;  4C0Z A;  4F17 A;  4DBQ A;  2DIG A;  5IXF A;  4MDX A;  1MV3 A;  4LD9 K;  1YHQ Q;  4KT0 E;  2WSC E;  4HCZ A;  2L3Q A;  1CKA A;  2DER A;  2DZC A;  1C0M A;  5CAI A;  1AT1 B;  2LJ1 A;  3EGD A;  2DBK A;  3SB2 A;  1YI2 Q;  2X3W D;  1Y96 B;  4M78 B;  2JT4 A;  4HXJ A;  3NGP A;  1Q81 C;  3JCM c;  4QVD A;  4ESR A;  2CZ0 B;  4IUV A;  1H64 1;  2HQE A;  3CBM A;  2OTL T;  1M2O A;  1VQN Q;  2EQU A;  4NL2 A;  2QK0 A;  1M1K U;  2OAW A;  4BAC A;  4ZNX A;  1EX4 A;  2CP2 A;  8AT1 B;  3CPF A;  5LJ3 d;  4A53 A;  5KCH A;  2IIM A;  1W70 A;  4OVA A;  1MUZ A;  3M0T A;  3I9Q A;  3JV3 A;  4XTX A;  5CK9 A;  2J6F A;  1NE8 A;  4AMC A;  4J5Y A;  1HSQ A;  3MEV A;  2VGN A;  4F7U E;  2VWF A;  4XU3 A;  4FYW B;  4M77 F;  2DPP B;  1G8X A;  2B8A A;  1BKB A;  4RCC A;  4XU1 A;  3KBG A;  1TU0 B;  1PD0 A;  2KQW A;  3CME A;  1ZUY A;  2DTO A;  3A8O B;  2CS7 A;  2QQR A;  3OW2 S;  4II1 A;  1QCN A;  5CCA A;  3MET A;  5GAN g;  4FYV B;  4F7U A;  3PE0 A;  2M0O A;  2EFI A;  2OTL Q;  1Y07 A;  2CP7 A;  1PCX A;  3TQ7 P;  2JUF A;  3RBB B;  5GAN 5;  2IG0 A;  3M55 A;  2MI6 A;  3BY7 A;  4C5I A;  2YWW A;  5LJ5 j;  1RAE B;  1G83 A;  1Y0M A;  5GAO l;  2H8H A;  2BUD A;  2FHD A;  1RAG B;  4MDW A;  3RIR A;  1IXD A;  3M4G A;  3EGD B;  4J9I A;  2LT4 A;  1WIE A;  1CSK A;  2ZGW A;  3BE3 A;  1BYM A;  1MMN A;  1VQ5 A;  2EGE A;  1OZ2 A;  3CCM A;  3RMS A;  2KXD A;  4M78 F;  3FC3 A;  5IHK A;  2KBT A;  4D8D A;  2M0Y A;  4C92 G;  2DL7 A;  2FRW A;  3OMG A;  2RPN A;  2LQK A;  4M77 G;  2E12 A;  2D1X A;  4N0A A;  3MCA B;  4RTX A;  2J06 A;  1IRE B;  2HSE B;  1WXB A;  1C1A A;  1E7O A;  4DBH A;  3JCM W;  2IVW A;  2PQW A;  3JCM X;  4E7S A;  1V76 A;  1GBQ A;  3JB9 J;  2E5K A;  2RI3 A;  1KHI A;  1X01 A;  2BKD N;  3TVT A;  2MCN A;  2V26 A;  4N0A C;  5DM7 R;  2K79 A;  3QDR B;  3WVD B;  3L2W A;  3VS3 A;  3NMZ C;  4A4E A;  2IPO B;  2K57 A;  1U5S A;  3M0R A;  1TXQ A;  1NJI C;  2CKK A;  1WXU A;  4F7U B;  4E7K A;  4RUG A;  3QYH B;  2QG9 B;  1ARK A;  2DXT A;  2P0K A;  1M90 R;  3CCQ A;  3RER A;  5KE3 A;  2DRM A;  2RM4 A;  1QP3 A;  1I0C A;  4MZP A;  2EGC A;  1JJ2 A;  4MML A;  2AK5 A;  3U23 A;  3CCJ A;  1VIE A;  2CP6 A;  3JAM E;  4GLK A;  2KY9 A;  3G6E T;  3PVL A;  3L42 A;  1Q81 U;  2HKQ B;  5GAO p;  2QQA A;  3QWY A;  1JB0 E;  1M90 C;  2SRC A;  1U1T A;  1UGP B;  2KT1 A;  2JMC A;  2A0F B;  2DYI A;  2OX7 A;  3D7S B;  2EQJ A;  3OYJ A;  4X1V A;  3CD6 T;  1MMA A;  5LJ5 g;  4HCB A;  4VUB A;  2DEU A;  1AZE A;  3JRZ A;  2GF7 A;  3X20 B;  2LX7 A;  1RLP C;  4LD6 A; 
#chains in the Genus database with same CATH homology
 2KRO A;  3NPF A;  3M0P A;  3UA7 A;  3TSW A;  5L23 A;  3VRZ A;  1UTI A;  2FPF A;  1KSW A;  2RQW A;  2JXB A;  2BZX A;  1BU1 A;  1HJD A;  1SEM A;  4HVV A;  2GNC A;  3PVQ A;  4LN2 A;  1GRI A;  2LQN A;  1CKB A;  1PRL C;  2KRN A;  1WDX A;  1WXT A;  2A08 A;  1JEG A;  2RMO A;  1RUW A;  2C0O A;  1E6H A;  1WLP B;  2EYZ A;  3EG0 A;  1WX6 A;  3M0U A;  2YUP A;  1W1F A;  1UJ0 A;  1TUC A;  1J3T A;  2LZ6 B;  1K1Z A;  2EBP A;  2ABL A;  1QWE A;  4OMN A;  2ROL A;  3VS6 A;  2FPE A;  1PNJ A;  3I5S A;  3EGU A;  2LJ0 A;  4JZ4 A;  1SHG A;  2FEI A;  3VRY A;  1BK2 A;  1UHC A;  3ULR B;  5IXB A;  4F16 A;  1VYT A;  1VYV A;  1YWO A;  2AKK A;  1GL5 A;  1BB9 A;  1T3S A;  2J6O A;  2KYM A;  5IH2 A;  2DM1 A;  2NWM A;  1T0H A;  2J05 A;  2KT8 A;  1NLP C;  4JPB W;  1V1C A;  1OEB A;  2KRM A;  1UFF A;  2CH4 A;  2KXC A;  2GTJ A;  3H41 A;  1K4U S;  4RTY A;  1AWW A;  2D0N A;  4DEY A;  4LE9 A;  2EVR A;  2KNB B;  1H92 A;  2L0A A;  1PHT A;  1Y57 A;  2GGR A;  1SRM A;  4QT7 A;  2FG0 A;  4HVW A;  1UG1 A;  4E6R A;  3H0H A;  1M3A A;  4OMM A;  1GCP A;  3SHW A;  2L3S A;  1RLQ C;  2KEA A;  2MIO A;  2RF0 A;  2BZY A;  1AOJ A;  2RQV A;  3VS0 A;  1I07 A;  2CUB A;  1PRM C;  2EYX A;  1E6G A;  2PZ1 A;  2KR3 A;  1SPK A;  4OML A;  2CSI A;  1EFN A;  3EG1 A;  3I35 A;  1UEC A;  2DNU A;  1OV3 A;  2HEQ A;  2DRK A;  2F2X A;  2DL5 A;  2ROT A;  3EHR A;  4F14 A;  4K11 A;  3FJ5 A;  2C0I A;  3EG2 A;  2JW4 A;  1HD3 A;  4AFU C;  2J6K A;  3VS4 A;  1PKS A;  1QWF A;  3VS2 A;  5ECA A;  2KRS A;  1ZX6 A;  2O9V A;  2EKH A;  1S1N A;  2ENM A;  2DIL A;  3CQT A;  4RTU A;  4RTW A;  2K6D A;  4GBQ A;  2G6F X;  1IO6 A;  4AFS C;  1WYX A;  5IHN A;  1UE9 A;  2A37 A;  4KRT A;  4FSS A;  4JJD A;  2LNH B;  4LUE A;  2CSQ A;  4J9E A;  4OMQ A;  2KYB A;  4IIO A;  2L3P A;  2O9S A;  1A0N B;  1K9A A;  1N5Z A;  2AZS A;  2O31 A;  1Z9Q A;  2L2P A;  4JZ3 A;  1MV0 B;  1VYU A;  1ZSG A;  3TSZ A;  1YCS B;  1K0X A;  4Z8A A;  2GBQ A;  1BBZ A;  3NHN A;  4J9C A;  2DE0 X;  2SEM A;  1X2K A;  2D8H A;  4Z89 A;  1M3C A;  1UUE A;  2JM8 A;  1ZUK A;  3H0F A;  1YP5 A;  1OPK A;  2GQI A;  2DJQ A;  2CT4 A;  2VKN A;  1X43 A;  3UAT A;  5I11 A;  2JTE A;  3R6N A;  2K7A A;  5GJW B;  4Z88 A;  2JS2 A;  1PKT A;  1ZLM A;  1AVZ C;  2F2W A;  1T0J A;  1U06 A;  1X69 A;  4CC2 A;  2BZ8 A;  5GJV B;  1QCF A;  2K9G A;  1JXM A;  4ORZ A;  1SRL A;  3UA6 A;  1U3O A;  1GFD A;  4J9H A;  2J7I A;  4LUD A;  1ABO A;  2ECZ A;  1QLY A;  4JJB A;  2DMO A;  1ZUU A;  1VA7 A;  4F17 A;  3EG3 A;  5IXF A;  1KJW A;  1MV3 A;  1KFZ A;  2GTO A;  2FO0 A;  2JM9 A;  1JQQ A;  2F2V A;  4HVU A;  2L3Q A;  1CKA A;  2DA9 A;  1H8K A;  2LJ1 A;  2DBK A;  5HCK A;  2X3W D;  4EIK A;  3C0C A;  2JT4 A;  4HXJ A;  3NGP A;  2XMF A;  2LJ3 A;  3IQL A;  4LNP A;  4CC3 A;  4ESR A;  1GFC A;  4A63 B;  2YUQ A;  2ESW A;  2OJ2 A;  2M51 A;  5FW9 A;  1NYG A;  2CT3 A;  2RQR A;  2FRY A;  1K76 A;  1UGV A;  2OAW A;  1AEY A;  4ZNX A;  2LCS A;  2EYW A;  2EQI A;  3VS7 A;  5FWC A;  2HCK A;  1I1J A;  1ABQ A;  2IIM A;  1W70 A;  3VS5 A;  3SEM A;  4GLM A;  1WFW A;  4RTT A;  1MUZ A;  3M0T A;  3I9Q A;  3JV3 A;  2J6F A;  4J9D A;  4CC7 A;  2I0N A;  4J9F A;  2K2M A;  2EYY A;  2JS0 A;  1OOT A;  1HSQ A;  1NYF A;  2LQW A;  2KE9 A;  4DEX A;  2VWF A;  2YUN A;  1T3L A;  1OPL A;  3M0S A;  1NEG A;  2JMA A;  2VVK A;  1B3Q A;  3REB B;  1RI9 A;  2YUO A;  1ZUY A;  3KFV A;  2ED1 A;  2EPD A;  2LP5 A;  4OMP A;  4AG2 C;  2DL4 A;  2CH4 W;  4R0K A;  3LH5 A;  2YDL A;  4HCK A;  4J9B A;  3GBQ A;  2AZV A;  3PE0 A;  1Z9Z A;  2W0Z A;  1M3B A;  3RBB B;  1K0S A;  2KGT A;  1PWT A;  1YWP A;  3RNJ A;  1NG2 A;  1G83 A;  1M27 C;  1Y0M A;  2H8H A;  1GCQ A;  2K3B A;  1FYN A;  4J9G A;  2X3X D;  1AZG B;  2A28 A;  4OMO A;  4RTV A;  4JJC A;  1JU5 C;  4J9I A;  1WIE A;  1ZBJ A;  1CSK A;  1GBR A;  4D8K A;  1FMK A;  2QDL A;  5IHI A;  4AFQ C;  2EGE A;  2DX1 A;  3QWX X;  3M0Q A;  1B07 A;  1YN8 A;  2KXD A;  1AWO A;  1GCQ C;  2DL3 A;  2O2O A;  1AWX A;  5IHK A;  1W6X A;  4WCI A;  2KBT A;  4D8D A;  1UHF A;  2A36 A;  2V1Q A;  2M0Y A;  1X27 A;  2YSQ A;  4CC4 B;  2DL7 A;  2FRW A;  2DF6 A;  3O5Z A;  2RPN A;  2DL8 A;  2D1X A;  1WI7 A;  5EC7 A;  4AG1 C;  2EW3 A;  2PNI A;  2DVJ A;  1NEB A;  4RTX A;  2J06 A;  1TUD A;  2O88 A;  4IIM A;  1WXB A;  1E7O A;  2DLP A;  2EGA A;  2HSP A;  2YT6 A;  1UDL A;  4M4Z A;  2AKL A;  5I22 A;  2OI3 A;  2D8J A;  1AWJ A;  1GBQ A;  1TG0 A;  1NM7 A;  2MOX A;  2DYB A;  1X6B A;  2E5K A;  2RQU A;  3ZL7 C;  1SSH A;  3TVT A;  2MCN A;  1QKW A;  2K79 A;  2ED0 A;  4RTZ A;  1KIK A;  1G2B A;  1JO8 A;  1M30 A;  3NMZ C;  3VS3 A;  2P4R A;  2RQT A;  2BTT A;  1JXO A;  1U5S A;  3M0R A;  2PTK A;  1XOV A;  4AFZ C;  1SHF A;  1X2Q A;  1WXU A;  2RN8 A;  4RUG A;  3H0I A;  1WA7 A;  1ARK A;  3EHQ A;  2DBM A;  2DRM A;  2LMJ A;  3UF4 A;  1I0C A;  3REA B;  3VS1 A;  1H3H A;  2EGC A;  3I5R A;  1LCK A;  2AK5 A;  3U23 A;  2CDT A;  2RNA A;  3PVL A;  2HBW A;  5FWB A;  4Y92 A;  2B86 A;  1NLO C;  3QWY A;  2SRC A;  2KT1 A;  3A98 A;  2JMC A;  1YNZ A;  1X6G A;  1UJY A;  2CRE A;  2CUD A;  4X1V A;  2NUZ A;  3THK A;  1AD5 A;  1M8M A;  1QKX A;  2C0T A;  1AZE A;  2HDA A;  2V1R A;  2FPD A;  2W10 A;  2LX7 A;  1RLP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...