2J06A

Crystal structure of the rasgap sh3 domain at 1.8 angstrom resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
61
structure length
61
Chain Sequence
MRRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RAS GTPASE-ACTIVATING PROTEIN 1
publication title High Resolution Crystal Structures of the P120 Rasgap SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signal transduction
total genus 13
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2j06A00
2AZVA 2K6DA 1E6GA 3VS0A 2LJ1A 4CC7A 2A08A 2JT4A 1IO6A 3RBBB 1N5ZA 1M3BA 2YUQA 4AFQC 2K2MA 1ZUKA 2K7AA 1QCFA 3KFVA 2PZ1A 1VYUA 2YUOA 2JS0A 2MOXA 2ED0A 4WCIA 5IH2A 1I1JA 4OMQA 1AVZC 4JJBA 1RUWA 1QKWA 3UA6A 2LCSA 3VS4A 4LNPA 2ENMA 1G83A 2J6FA 2CT4A 2KEAA 1UDLA 2BZYA 4OMPA 2KE9A 3VS5A 1AWJA 2LQNA 1VYTA 2EW3A 2DRMA 2EBPA 1A0NB 1WXTA 3NMZC 2PTKA 1NLPC 1HSQA 2LZ6B 1K0SA 4AG1C 1AWXA 2OAWA 2YT6A 1W6XA 2J05A 1T3LA 4RTWA 1ABOA 1B3QA 2M0YA 2EYXA 4HVVA 2ABLA 2JMAA 2DX1A 1UHCA 1OPLA 4F16A 1NEGA 1MUZA 2RNAA 4JZ4A 4CC2A 2V1RA 1UUEA 2L0AA 5GJVB 1YWPA 1HJDA 2C0OA 3I5RA 1ZX6A 1ARKA 2FEIA 3QWYA 3A98A 2AKKA 1S1NA 2KXCA 3R6NA 3M0RA 1QKXA 3M0SA 2NWMA 1UG1A 1ZUUA 2AK5A 4J9HA 2D8HA 1UE9A 1EFNA 2DBKA 2JM8A 1X6BA 2HDAA 4KRTA 4CC3A 1LCKA 2P4RA 1YNZA 2RQRA 2CUDA 2FPFA 2KXDA 1YCSB 2VWFA 2DL4A 3THKA 2DL8A 2LX7A 3PE0A 4RTZA 3REAB 1X2QA 1SEMA 4HVWA 4M4ZA 1UJYA 4J9GA 5IHNA 2J6KA 4HCKA 1UGVA 1RLPC 4RTTA 3C0CA 4AFSC 4GBQA 2KRMA 2DMOA 4J9DA 2LQWA 4OMMA 2DYBA 1SHGA 1X43A 1TG0A 2ECZA 1ABQA 1G2BA 2A37A 3VS3A 1PRLC 2LJ3A 2L3QA 3JV3A 4JPBW 3TSZA 1GCQA 2RQTA 1I07A 1V1CA 2J6OA 1M8MA 2FPDA 1I0CA 1QWFA 2JW4A 2O88A 4HXJA 2FRYA 4JJDA 3ZL7C 2LNHB 4D8DA 2W10A 5I22A 3PVQA 5HCKA 2D0NA 1QWEA 2KR3A 2KRNA 1NYGA 2F2VA 2FRWA 1T0JA 1KIKA 2X3XD 4J9EA 2O2OA 2HSPA 2L2PA 1SHFA 2J06A 3M0TA 3CQTA 1B07A 3EHQA 4JZ3A 2YUNA 1OV3A 1WA7A 4AFUC 2KGTA 3ULRB 1YN8A 4RTXA 1AWOA 5FWCA 1ZSGA 5FW9A 2AZSA 3O5ZA 3UF4A 5I11A 1FMKA 4ORZA 1QLYA 1UJ0A 2DJQA 4RTVA 1CSKA 2FG0A 4F14A 1AZEA 1WXUA 1WXBA 2DILA 3EG2A 1AWWA 2KT1A 1MV3A 1SPKA 1M27C 3UATA 2CSQA 1U06A 1SRLA 1K1ZA 1RI9A 2EKHA 2KYBA 1M3AA 1J3TA 2EGAA 3H41A 1Y0MA 2DRKA 2D1XA 2C0IA 3EGUA 3PVLA 4J9BA 3VS1A 2LP5A 1NLOC 1CKAA 1SSHA 1XOVA 2KNBB 1OPKA 4IIMA 1TUCA 2QDLA 2JM9A 2B86A 1UTIA 2JMCA 1TUDA 5IHKA 1JEGA 2CH4A 2LMJA 3H0FA 2DL5A 2DNUA 5IHIA 1JXOA 2DE0X 2X3WD 2EVRA 3EHRA 5FWBA 1PNJA 1WIEA 3EG0A 1ZLMA 2XMFA 4RUGA 2HCKA 4AFZC 3NPFA 1RLQC 1WFWA 4RTUA 2NUZA 1PKSA 1UECA 2V1QA 4Y92A 1AOJA 1Z9ZA 2ROTA 1WDXA 3VS7A 4DEXA 4Z8AA 1Z9QA 2F2WA 2YDLA 1H8KA 2BZXA 1X69A 1PWTA 2J7IA 1BB9A 4ZNXA 2BTTA 3REBB 2FO0A 4CC4B 1X6GA 2LJ0A 1H3HA 1K0XA 1JU5C 2FPEA 2GTJA 4LE9A 4FSSA 4ESRA 2MIOA 1UHFA 1E7OA 1KSWA 3TVTA 1K9AA 1M30A 3UA7A 2ESWA 3VS2A 2EYWA 4J9CA 2CREA 2IIMA 2K3BA 4OMOA 2PNIA 1H92A 2CDTA 2E5KA 5IXFA 2EGEA 2HEQA 1GCPA 4X1VA 3NGPA 1WX6A 2O9SA 2EYYA 4E6RA 1ZBJA 3SHWA 1ZUYA 4D8KA 1X27A 2I0NA 4LUDA 1AEYA 2CSIA 1GBQA 4IIOA 2G6FX 2DL3A 2YUPA 3VRYA 1HD3A 1U3OA 4RTYA 2F2XA 3VRZA 2DF6A 2K9GA 1FYNA 2KBTA 1KJWA 1YWOA 2AKLA 1OEBA 1PHTA 2CH4W 1JO8A 1U5SA 4AG2C 3VS6A 3QWXX 1NYFA 2SRCA 3H0IA 3NHNA 2A28A 2KT8A 2ED1A 2DVJA 2HBWA 2KRSA 2MCNA 2GNCA 2YSQA 5L23A 3EG3A 2DL7A 2H8HA 3LH5A 2OJ2A 3FJ5A 1W1FA 1K4US 4GLMA 2VVKA 2D8JA 4EIKA 2KROA 1UFFA 1Y57A 1W70A 2JTEA 4HVUA 3IQLA 1X2KA 3TSWA 2W0ZA 4JJCA 2GTOA 5IXBA 2A36A 2RMOA 2L3PA 3EG1A 2RQVA 2O9VA 4J9IA 3SEMA 2VKNA 4K11A 4A63B 4QT7A 1GCQC 4LUEA 1PKTA 1T0HA 4LN2A 1GFCA 1VYVA 1YP5A 2EGCA 2GBQA 1PRMC 1AZGB 5GJWB 1VA7A 3M0PA 4R0KA 2C0TA 1T3SA 2DA9A 2DBMA 1BK2A 3M0QA 4OMLA 4DEYA 1M3CA 1WLPB 4F17A 3M0UA 1WYXA 5EC7A 2SEMA 1GRIA 1SRMA 2RQUA 1NG2A 3H0HA 2RF0A 1K76A 2EQIA 2RQWA 4Z88A 5ECAA 1BU1A 4OMNA 2ROLA 1GBRA 1WI7A 2EPDA 2DM1A 2M51A 4Z89A 1MV0B 3RNJA 1E6HA 2CT3A 2JXBA 2GQIA 1CKBA 2KYMA 3I5SA 2GGRA 1OOTA 2JS2A 1BBZA 2EYZA 1NM7A 1KFZA 2RN8A 1GFDA 1GL5A 1AD5A 2O31A 2RPNA 3GBQA 3U23A 4J9FA 1NEBA 2CUBA 2DLPA 2L3SA 1JXMA 2OI3A 3I35A 2K79A 3I9QA 1JQQA 2BZ8A
chains in the Genus database with same CATH superfamily
1Y96A 2K6DA 1VQOQ 3OYKA 1KC8C 1I5LA 3I55T 2JT4A 1IO6A 3RBBB 2RI2A 1QVFP 4FT4A 2YUQA 4PJLA 2RJEA 4PJMA 4AFQC 3JB9G 1K73R 1JJ2P 1ZUKA 2K7AA 1Y96B 4A4KA 3X26B 1VQ7T 1PSEA 2YUOA 2JS0A 3HRSA 4WCIA 4OMQA 1VQMT 2F69A 1RUWA 1YJNA 2H3JA 2RHXA 2WSEE 1G83A 5A0GA 1IRXA 3JRZA 1M1GA 2K3YA 3MEWA 1ACMB 2K3XA 1AWJA 5CCAA 1M90U 1VQ4T 3V8JA 2A0FB 2LRQA 1A0NB 1WXTA 1YCYA 1HSQA 1K0SA 1MMGA 2OAWA 5KCOA 2E70A 3JCMd 2LCCA 1KD1U 2DVEA 4ZGEB 3CPWS 2K2VA 3EH1A 4OGEA 2J05A 1ABOA 2M0YA 4HVVA 2LC4A 2ABLA 2QQAA 2PUOB 3RKWA 1OPLA 2FYKA 2JNGA 3CCMA 4M77F 2RNAA 4JJNK 3QJYA 1M90C 1VIEA 4IUVA 2CP5A 2C0OA 2FEIA 1BCMA 2L5QA 5GMKm 3RDVA 1YI2A 1KD1C 2D6FA 1QKXA 4XU1A 3RR6A 1PD1A 1UG1A 2MPXC 3OSVA 4KULA 1EFNA 4A53A 3GP8A 2XDBA 1X6BA 2HDAA 3JCMg 1RAIB 2DD5A 4C8QF 2DJZA 2RQRA 2DYIA 2CUDA 2FPFA 1YCSB 3OW2S 4VUBA 3CCEA 4RTZA 1X2QA 2JVVA 2ZPEB 2VASA 2PVDB 2F5KA 2HAXA 5IHNA 1UGVA 1RLPC 4ZTFA 4BI3A 4GBQA 2DXBA 2DMOA 4BUGA 4IUTA 3JB9F 2DPPB 2QEXT 1VOMA 2K5IA 4DOVA 1S72A 4HCCA 1NBEB 3NTKA 2OTJT 2RQTA 1V1CA 3CCVA 2FPDA 3CBOA 5KYYA 2M16A 1QWFA 2JW4A 4JRQA 4HXJA 2RHYA 3M4GA 4D8DA 1YJ9T 2DXUA 4M7AA 5HCKA 3UDCA 3CCLQ 3G6EQ 1XNIA 5KYYB 2FRWA 2QGGA 5D7UA 2XK0A 4WF2A 4M7AB 1TS9A 1SHFA 4RG2A 1I8FA 5GAN4 1QP3A 3CQTA 4C5GA 4ZN1A 3LGFA 3CCMQ 2V8IA 3GLXA 1QVGS 1W2BP 2F1LA 4O6JA 3BY7A 4AFUC 3QYHB 1YN8A 4RTXA 1ZSGA 4O5VA 3PT9A 1YJWT 1FMKA 3L2UA 2Y4YA 1UJ0A 2R58A 3GNFB 4F14A 3CCQA 4Y28E 2DILA 2XIDA 1MV3A 3F70A 1YI2Q 2CSQA 4Z02A 2M0OA 4E47A 2VXFA 1M3AA 4KH0B 4XTWA 2D1XA 5CR2A 3EGUA 5FLXE 1NLOC 1SSHA 3PTAA 5GAMd 1UTIA 2JMCA 5LJ3e 2HMAA 2LMJA 2DL5A 3KXTA 2M1HA 4YTLA 1R77A 1WIEA 5D6YA 3UWNA 1ZLMA 1QQJA 2XMFA 1QP2A 1ZSZA 1R8OB 4C0DC 1S72Q 3G71T 4C0FA 4OB3B 4NL2A 1PKSA 2EQMA 1M90R 2M02A 3CXCP 3HRUA 2QTVA 2XI9A 3PMTA 2ROTA 3GPLA 1N6AA 1ZSZB 1G8XA 3CCVQ 1M4ZA 1VQNA 2DAQA 4FYXB 1EIFA 4M75D 2J7IA 1V29B 1K0XA 5GAMg 2ATCB 2FPEA 1QMCA 2GTJA 3JCMf 2QA4A 4X9CA 4FSSA 2MIOA 2MMPA 4LD6A 2LX9A 1K9AA 1M30A 2E1HA 1IHWA 1KHCA 2E41A 3E9FA 2CREA 5GAN8 2E12A 4C5EA 1H92A 4IKFA 1VQOT 1QVFA 5D6XA 3G1JA 1GCPA 4M77D 4X1VA 3CCQQ 4RCBA 4BE1A 3PNWC 1ZBJA 5GAOp 1ZUYA 4N0AA 1X27A 4WTOB 1VQ9A 2CSIA 2DFUA 1TTHB 1MGQA 5GAOq 2G6FX 5J3BA 2YUPA 3URGA 4L6V5 3VRZA 2AKLA 1BIBA 1OEBA 4FW2A 4AG2C 1VQKA 5J26A 2SRCA 5GMKl 4JS4A 4M78C 2A28A 1M5Q1 2KRSA 2MCNA 2GNCA 3EG3A 2DL7A 3EFOA 2DTIA 3NFCA 3QDFA 1VQLQ 1K4US 3RMQA 4GLMA 2VVKA 1FX7A 3QJ6A 1K9MU 4EIKA 2KROA 1Y57A 2JTEA 4E7SA 3EFOB 4OP0A 4QVCA 5GMKh 5IXBA 3MEUA 2BKDN 5GAMj 3EGXA 2X4WA 3SDZA 2EQKA 3SEMA 1YHQA 2VKNA 1YJWA 5DM7R 3WVEB 1VQNQ 1PKTA 1WJSA 4LN2A 1VYVA 1YP5A 4JDSA 3EGXB 3NTIA 3TU4K 1VA7A 4R0KA 3LGLA 1T3SA 5FRNA 4OB1B 1K9MC 2QA4Q 5IN1A 3M0QA 2RJCA 4EDUA 5EC7A 3CCJQ 1WHKA 1GRIA 1M8VA 1NG2A 1QCNA 3META 5KE3A 3CCSA 3QDRB 1GBRA 1WI7A 2M51A 4AMCA 1TUGB 2JXBA 3C12A 2GGRA 2JS2A 1D0ZA 1VQ9Q 3DKMA 3JB9J 2RN8A 1GL5A 3OYEA 1AD5A 4C92C 2X4YA 4XTXA 1Y71A 4J9FA 1F1BB 3WXMB 1YJNT 1RL2A 4F7UG 1VQKQ 2CS7A 8ATCB 1ZQ1A 3I9QA 3M53A 4CC7A 4IUPA 2A08A 1NPPA 4E7KA 3SWNA 2RHUA 5GAMf 4OVAA 1I81A 1PCXA 3C95A 3KFVA 2PZ1A 3SWNB 1WHLA 3G6ET 4EMHA 5IH2A 1I1JA 1AVZC 1W2BA 1D1BA 2DZCA 3OMGA 4M7AD 1YHQQ 2NUPA 3CCMT 4BI8B 2ENMA 4L59A 1FWZA 2J6FA 3FB9A 2CT4A 1C6VX 3HFOA 2KEAA 4XU2A 3EAEA 2DRMA 3FEOA 3RIRA 2NUPB 3OYMA 3NMZC 2Y4XA 4M75G 3M59A 3CC7A 2ZGWA 3A8GB 3OBWA 4PFZA 1YI2T 2RO0A 3SFMA 4N4IA 3OA6A 5FU6B 3M58A 3CCSQ 2JMAA 4M77C 4F16A 4PJOA 4JZ4A 4EMKA 2KK4A 2RH2A 3L2VA 1D3BA 2V1RA 1ZA1B 1UUEA 4PJOB 3A8HB 4M77G 3CCET 2VXEA 1O9SA 2L8DA 1HJDA 1ARKA 1ZX6A 5LJ3h 2K4YA 3QWYA 5CKEA 4X34A 4EMKB 1MMDA 4JRIA 4EMGA 1D1AA 5A0LA 2NWMA 5LJ5g 3M56A 4RCCA 2CP0A 4XU0A 2AK5A 4J9HA 2KI7A 3CXCA 4C8QC 4KRTA 3JCMJ 1S72T 1UGPB 3CBMA 4BDZA 2P4RA 1KHIA 1OQKA 3OBYA 3CCVT 4KUIA 2DEUA 1K9MR 2DL4A 3ZBDA 3J81E 3V7SA 3JCMX 3LH0A 4HVWA 2JUFA 2VV5A 1G3WA 2J6KA 4QQDA 1C0MA 5KH6A 3QSUA 2E4HA 4RTTA 3FRNA 2KRMA 1YITQ 2LQWA 2DYBA 4L5GA 1D0YA 2VC8A 1ABQA 1G2BA 3VS3A 2LJ3A 3EGDA 3JV3A 4XTUA 3TSZA 4ZGDB 3CCQT 1I0CA 4J6YA 4Q5WA 4JJDA 3ZL7C 2LT1A 3CC7Q 3HRTA 4QW2A 4BE0A 3EGDB 1QWEA 1H641 1U8RA 1OZ3A 3OYCA 1LPLA 2VB6A 2KAFA 1T0JA 3C4SA 2O2OA 3FIFA 4CI0C 5LJ5j 4TVRA 4M75F 4M7DA 6AT1B 2KGTA 4DBFA 4GLKA 2GF7A 1OU9A 3E9GA 2LCLA 4M7DB 1CSKA 2FG0A 1AZEA 3V8LA 4DBHA 1WXUA 1QVFS 3UATA 2E3HA 3CCLA 3QPHA 5GMKe 3G6EA 2EKOA 3RMSA 5HK3A 2EKHA 3MCAB 2KYBA 1J3TA 2IG0A 5FU7B 4DOWA 1Y0MA 4J9BA 2AHJB 3X20B 2Y90A 5LJ3d 1VQNT 1OPKA 4E7ZA 3M5AA 3CMEA 2JM9A 4XTVA 4OMFB 2QGFB 3H0FA 2DNUA 5CIUA 2DE0X 2QA4T 5FRMA 3EHRA 4N4HA 3V7CA 4FYVB 4E7LA 4RUGA 3CCJT 1KQSP 3P8DA 3VJPA 4IURA 1OU8A 1RLQC 4RTUA 2NUZA 5A2QE 4M7AG 1SKUB 1UECA 2HBPA 3VYHB 1WHHA 1YIJA 3E1SA 5GAN7 1AOJA 3CPFA 1TOVA 4Z8AA 1Z9QA 3FJPA 2YDLA 3T9NA 4NL3A 2BZXA 1X69A 5LJ5f 2CGHA 1WHGA 2FZKB 1G5VA 1PWTA 1VQ9T 4KGXB 3VU3C 2BTTA 1X6GA 2YRDA 3H6ZA 2DIQA 1H3HA 2IPOB 2DTOA 4LE9A 3ASKA 3P8HA 2E5QA 1WJRA 5GANh 1EZZB 4E7HA 1KSWA 4II1A 3TVTA 2FB7A 3UA7A 1PC0A 3WVDB 4RMOA 3VS2A 3X25B 1VQKT 2EYWA 3QZ9B 1FXXA 2IIMA 2K3BA 3SB2A 3V8KA 2PNIA 4N4GA 4X9DA 5IXFA 2EGEA 4NOYA 4QQ6A 3VUZA 3SHWA 4PJOE 2HKQB 3Q1JA 3PIOA 1Q81U 2R5AA 3OYLA 2QDYB 1M1FA 1B34A 4IIOA 3A8OB 2MI6A 2BE7D 1WZOA 2PQWA 3JSCA 2F2XA 1FYNA 1ZSZC 1B34B 1KJWA 1NZ9A 2KBTA 3QUIA 4JRKA 1Q95G 5CKFA 1YHQT 3KUFA 3GF5A 3CMEQ 3JB9I 2KT8A 1RAEB 5AT1B 2H8HA 2VGMA 2YRCA 2OJ2A 3CC4A 1W1FA 5CVIA 1Q81C 1G3SA 7AT1B 4FYWB 3LWIA 4BY6B 1LJOA 4HVUA 1VQ5Q 3IQLA 1D09B 3L42A 4JJCA 2A36A 2EAYA 2RMOA 3JB9H 4MMLA 2L3PA 3LWHA 3CCST 3DB4A 1YIJQ 5L8RE 4J9IA 3FC3A 1IGUA 4A63B 4QT7A 4J5YA 1W2BS 1GCQC 1GFCA 2JTFA 4A4GA 1VQLA 5GJWB 1AZGB 4ZN3A 1WHMA 3HKSA 1NPRA 4PJOD 5KYWA 2HZYA 4M7AF 2VYTA 2RD1A 1TWBA 4OMLA 4DEYA 1M3CA 3OYGA 1ZA2B 3L2WA 5KYWB 2RQUA 4LDVA 5GAN6 2EQIA 4Z88A 4LXCA 5ECAA 8AT1B 2HQXA 4OMNA 3OYDA 1TH7A 3OYYA 2DM1A 4Z89A 1MV0B 2VGNA 2CT3A 1CKBA 3I5SA 5KCHA 5C6SA 4M7DE 1MNEA 1KFZA 1HXDA 2EJGA 3S3MA 2FL7A 2QQRA 2O31A 2RPNA 1G3YA 3CCJA 2JJ9A 2ZPHB 2CUBA 2XDDA 3I35A 3HHTB 5DLQE 1JJ2A 2ZPFB 2DEQA 2AZVA 3VS0A 2LJ1A 3A8MB 3CXCS 5D6WA 1N5ZA 3CC4Q 4XQ3A 5FROA 3BE3A 2DKGA 3VYGA 2K2MA 3CC7T 3JCMQ 3TCJA 1M2OA 1TSFA 3ZEHA 2P0QA 2CP7A 2MOXA 2ED0A 1PD0A 2GFUA 3EH2A 4JJBA 1UEBA 1QKWA 3UA6A 3VS4A 2YWWA 4LNPA 1WNLA 4J7FA 1OX8A 2OTLQ 1IREB 4JLIA 1UDLA 3HPWA 1D0XA 2BZYA 4ATOA 2QXFA 2LQNA 3CCRA 1VYTA 4KGZB 2EBPA 4C0DB 4M7DD 2LZ6B 2M9UA 2RA2A 1AWXA 2EQUA 4RTWA 2EQJA 1B3QA 1SSFA 2JZ2A 2DETA 2EYXA 2NYSA 3G4SQ 4FCYA 2DX1A 2I2LA 2XKOC 5CKHA 3QYGB 3MO8A 1NEGA 1NJIU 1MUZA 3ME9A 3DLLA 3CCUA 4CC2A 3M9QA 2B8AA 1Q81R 2L0AA 4XU3A 5GJVB 4PFOA 4ZGJB 3SWNC 3A98A 3BDUA 5CO7A 3BW1A 1S1NA 2KXCA 3R6NA 2LNVA 3VKIA 1KQSA 3QXEB 2QQSA 4BI4A 4QQGA 4JUVA 2DBKA 4R56A 2JM8A 1O75A 1N8RU 4DA4A 4CC3A 1LCKA 2OAUA 5KYUA 1NJIC 1VQ8A 4M78A 4HT8A 2LVMA 2VWFA 4EPCA 5KYUB 3KBGA 2DL8A 2MYSA 2LX7A 3PE0A 3HL8A 3REAB 5GANe 1SEMA 2EIFA 1UJYA 4M78B 4D6WA 5IAYA 2ZZDA 4HCKA 5GAOn 1UB4A 3DLMA 2KDSA 3C0CA 1Y07A 4A4EA 1OX9A 5IT9E 1N8RC 1X43A 1TG0A 2VUBA 4KGVB 3EFRA 2ECZA 2RK1A 4MDWA 4F04B 3OYFA 3CCRQ 2QEXQ 2L3QA 3MEVA 1U1SA 4E2FB 1I07A 2O88A 2FRYA 4PJJA 2COYA 3CCLT 2X51A 4RKUE 3MHXA 2HKNA 5I22A 3OS0A 3OSSC 4PJOG 2KRNA 2QG9B 2GQVA 2F2VA 4GY5A 1KIKA 1YITA 1U1TA 4M75C 2HSPA 2RJFA 3M0TA 2DO3A 1FMWA 2E3IA 3CCUQ 1OV3A 2E6NA 1WA7A 2PUKB 1OI1A 3ULRB 2GFAA 1BI2A 2XHCA 3CEYA 1AWOA 5FWCA 1Q7YR 1BIAA 2AZSA 3O5ZA 3INZA 3UF4A 3CMET 5I11A 1K8AU 4ORZA 1QLYA 2DJQA 4RTVA 1IB8A 1EX4A 3VV0A 2FZCB 1WXBA 2KT1A 4PJNA 3RUXA 3JCMP 3QG1A 3SD4A 4BB7A 4F7UA 3OS2A 1P92A 1X01A 4C92A 4DBQA 2LT4A 2EGAA 3H41A 4F7UB 2C0IA 1YIJT 2RM4A 1VQ8Q 2HD0A 4C92B 1BI3A 3JCMh 1CKAA 4KBMB 3CMAA 1SG5A 4JLGA 2QDLA 1K8AC 2B86A 2LQKA 1TUDA 3TEEA 1JEGA 2RI5A 4J83A 3S3OA 2YHTA 2FVUA 1OULA 3MP8A 3MP6A 4J8OA 2COWA 2X3WD 5GAOr 3L1AA 4LD9K 5FWBA 4BD3A 1PNJA 3L2RA 2HCKA 2RB6A 4AFZC 3MKDA 2KVQG 2ZPIB 2RJDA 1AHJB 1Y7XA 2DXCA 2V1QA 4AT1B 4Y92A 1Z9ZA 2QQ9A 1WDXA 2F2WA 2BIVA 1H8KA 3BDLA 1Q86C 4MDXA 4PNOA 5J39A 4CC4B 3FDRA 3X28B 4B9XA 1JU5C 4ESRA 1UHFA 3TREA 1E7OA 1NJIR 1PM3A 2H3EB 2ESWA 4PJOF 4M77A 2CDTA 3HFNA 2MAMA 4PFPA 1AT1B 3NGPA 3CC4T 1WX6A 2O9SA 1MMAA 2EYYA 4CRIA 4E6RA 3CD6A 4M77B 2O4XA 2FZGB 4LUDA 4A4HA 2L89A 3CPWP 1GBQA 2EJFA 4OB0B 2XDPA 3HP9A 2DL3A 1HD3A 1N8RR 1VQPA 2WACA 5GAN5 2O4XB 4DQ2A 3PFSA 1DJ7B 5GMKj 1YWOA 3QBYA 4A54A 4XTYA 1VQ6A 1U5SA 3VS6A 3CMAQ 1NYFA 4C8QA 2RHIA 3H0IA 3NHNA 2OTLT 2CZ0B 1VQLT 3E2UA 2YSQA 5L23A 1JJ2S 3QIIA 4KH1B 4OGCA 3LH5A 3ZFJA 1BYMA 2BUDA 2DTHA 3FJ5A 4FSXA 1FMVA 4C8QB 2CP3A 3M57A 4PK4A 3OYIA 1WHJA 4OB2B 4MZPA 3J7AF 3V7RA 4FW1A 4M78E 1UFFA 2LTOA 5I21A 4BACA 5LJ5e 1RI0A 3G4ST 3S6WA 4PLLA 5AYFA 2R5MA 1ZBXA 4K11A 3QKJA 2CYZB 3OW2P 2EGCA 3H9NA 3M0PA 4M7AC 5A0DA 4BE2A 4XK8E 5CQYA 4C0GA 2K5LA 2XU8A 1VQ5A 1BK2A 1WLPB 3M0UA 5GAMh 3L2ZA 1SF9A 1M1KU 1SRMA 4FU6A 2RF0A 4FT2A 1K76A 2RQWA 1BU1A 4M7DF 1K8AR 2HL3A 3C94A 2EPDA 1N27A 4HCZA 1WGSA 1IZ6A 3RNJA 1E6HA 1R0CB 3CD6Q 2CZ6B 5CK9A 3UPUA 4J6XA 4BY6C 1X6OA 1OOTA 5LJ3g 1NM7A 1UGQB 5KYNA 1YBYA 2DK3A 2IVWA 3OB9A 2QK0A 1GFDA 3CC2A 2CP6A 2F5TX 2P4TA 2YXYA 1VQPQ 4M78D 4FM4B 1VIFA 5I2SA 1QVPA 3U23A 5C0MA 5KE2A 2DLPA 1QVGP 1M1KC 4LDWA 1VQ6Q 4F7UE 1KQSS 1YJNQ 2K79A 4C92E 1E6GA 1Q86R 3PMIA 3CCRT 2D0QB 1M3BA 3RKXA 1QCFA 1RADB 2ZPBB 3JCMV 1OZ2A 1VYUA 4JS5A 3I56A 3EG9A 4E7JA 3L2QA 3PGGA 1IXDA 1VUBA 1I5OB 4HCBA 1V76A 1XJWB 3O8VA 4P5NA 2HQEA 2EJ9A 2LCSA 5GAOl 1Q82U 3EG9B 3CCUT 1KC8R 4OMPA 2KE9A 3MP1A 3VS5A 3I55A 2EW3A 2GCXA 9ATCB 4BDYA 3E19A 2PTKA 3JCMb 1NLPC 2KMTA 3OMCA 3UT1A 4M75E 4AG1C 2YT6A 1VQ7A 2X4JA 5LJ3j 1JBMA 1TU0B 4C0ZA 1WPYA 1W6XA 1T3LA 4LDUA 2P0PA 3JCMe 3QHSA 1VQMA 2E64A 2L3RA 1UHCA 3JCMc 2A3LA 2OTLA 4B6MA 1BI0A 1Q82C 5EG2A 2DIGA 1VQ8T 1LVKA 4C92D 1MNDA 3HTRA 3RKYA 4N0AC 1YWPA 1BCOA 3MPUB 2QASA 5I2MA 5CAIA 1KK7A 3M54A 1VQ4A 4M77E 4JRPA 3CC2Q 3I5RA 5DY9A 3OYHA 3GNGA 2AKKA 3CCEQ 3M0RA 1NE8A 3M0SA 3JAME 1ZUUA 2K5FA 2D8HA 3G4SA 3FLGA 3OYBA 1UE9A 4XTZA 4MMKA 4OF1A 3OS1A 4DBRA 2YRVA 1JRIA 3ER0A 1YNZA 1Q7YU 4XAXB 2A7YA 5GANd 4LDYA 2EWNA 1G3TA 2KXDA 3MEAA 3TQ7P 1X75C 5GAN3 3THKA 4C8QE 5GAN2 3I56Q 4M4ZA 1MMNA 1KD1R 4J7IA 4J9GA 1YITT 2AT1B 1M2VA 4AFSC 3M4YA 3JCMW 4J9DA 1RAAB 4OMMA 1SHGA 5LJ3f 2A37A 1QW1A 1WJQA 3HSBA 1PSFA 3H8ZA 2RHZA 1PRLC 1M2VB 3I55Q 1Q7YC 4JPBW 2KQWA 1GCQA 2J6OA 4E7IA 1M8MA 4KT0E 3CPWA 2LNHB 2W10A 1VQ7Q 3PVQA 1B7TA 2D0NA 4FYYB 2MF2A 2KR3A 1M1KR 2YLBA 2LQ8A 1NYGA 5GANg 2X3XD 4J9EA 1VQMQ 2PVGB 2L2PA 2J06A 2XICA 4ME7A 3GIBA 1B07A 3EHQA 2DD4A 4JZ3A 2YUNA 2ZCFB 1HYOA 2ZAEA 4PKCC 2QEXA 3CMAT 5FW9A 2WSCE 2OTJA 2FHDA 1VQ4Q 2Z0WA 4FL6A 2DZ9A 1WQ7A 1AWWA 3EG2A 1SPKA 1RAGB 1M27C 3N5BB 4C8QD 3A1PA 1U06A 1YJ9A 4KUDK 1SRLA 1K1ZA 3M55A 2G3RA 1OYXA 2QQBA 1RI9A 5LJ5h 1BKBA 4M78G 4PLIA 2AIRB 4C5IA 3OYAA 2KSSA 2DRKA 1XTDA 3PVLA 2NUTA 3J80E 5KYXA 3OY9A 3VS1A 2LP5A 3OW2A 1IHVA 1XOVA 2KNBB 3PIPA 4IIMA 1TUCA 4J6WA 4NS5A 4MZTA 3JB9D 2E10A 2NUTB 2YLCA 3LLRA 5KYXB 5IHKA 5M9OA 3X24B 2CH4A 5GAMe 2V8JA 5IHIA 4LDXA 1JXOA 1K73U 2EVRA 2CZ1B 1QCOA 1I4K1 1Q82R 3EG0A 4ELYC 2E6ZA 2X35A 2JN0A 3NPFA 5GANj 2HQHA 1WFWA 1LNXA 3VUBA 4M7AE 3VS7A 4DEXA 2DXTA 3CD6T 5FU6C 3D7SB 1M9SA 2NLUA 4QVZA 1BB9A 4ZNXA 4RG8A 2QAZA 3REBB 2FO0A 2LJ0A 2HSEB 1VQPT 4ELZC 4V2SA 4HT9A 4UC4A 1K73C 3AHUA 1QVGA 1KQ2A 2E65A 5LL6S 3DB3A 1RAHB 4PJOC 1R0BG 5GMKi 1VQ6T 2KY9A 3QZ5B 4EMKC 4J9CA 2HNIA 2COZA 3G71A 1N9SA 4OMOA 2V26A 2OTJQ 2E5KA 3OYNA 3QO3A 2MWOA 4FIBA 2HEQA 3OS5A 4C92G 1W4SA 2CZ7B 5CKDA 2PVOB 4D8KA 1HK9A 4HA8A 1YJ9Q 2I0NA 1AEYA 1IGQA 1PG5B 1N9RA 2RI3A 3VRYA 2QTXA 1U3OA 4RTYA 2DF6A 2K9GA 2DERA 1PHTA 2MWPA 1JO8A 2CH4W 3QWXX 2QYZA 5HKCA 1MHNA 2EYQA 1YJWQ 2ED1A 2DVJA 2HBWA 1KQ1A 1VQOA 3A8LB 4M78F 2PU9B 1KG1A 5GANf 3AT1B 1VQ5T 2LDMA 5LJ5d 1ZHIA 2D8JA 4IUQA 2HL5C 2C06A 4ANJA 2MK5A 1W70A 1X2KA 4Y91A 3TSWA 2W0ZA 5HK0A 4QKUA 5CKBA 3P8BB 2GTOA 2D9TA 1D1CA 1H3ZA 2RK2A 1RAFB 3EG1A 3LX7A 4A4FA 2RQVA 2O9VA 3GOXA 1RABB 3MJXA 2BE9B 2JOYA 2R57A 4LUEA 1T0HA 2ZPGB 3RERA 1BI1A 2WSFE 4QVDA 1Q86U 5GAOm 4HKEA 1UGSB 2GBQA 4ZTJA 1PRMC 2QI2A 2C0TA 1GXIE 2X9HA 3G7ZA 5CQXA 3CC2T 2DA9A 2CP2A 2DBMA 2O01E 2K57A 2XG8D 2P84A 4F17A 3LW5E 3OQ5A 5HY6A 2OX7A 4C5HA 1WYXA 1D3BB 2SEMA 1JB0E 4M7DC 3H0HA 2CKKA 3NTHA 4M75A 3G71Q 1YFNA 2V8KA 3BFMA 3CBPA 3LYIA 2ROLA 4R55A 1KC8U 3S3NA 2GQIA 2KYMA 3A5ZB 2P0KA 4M75B 1TXQA 4M7DG 1UGRB 1BBZA 2EYZA 1RACB 4IUUA 5FU7C 2XD0A 4PL6A 5DLOA 2EFIA 3I56T 3OYJA 4MZMA 4B9WA 2X4XA 4C8QG 1XQHA 4F7UF 3GBQA 1WQWA 4C92F 1C1AA 3R6OA 1NEBA 1LOJA 2L3SA 1JXMA 2OI3A 2JTMA 3EFSA 1JQQA 2BZ8A 3RESA
chains in the Genus database with same CATH topology
2AZVA 2K6DA 1E6GA 3VS0A 2LJ1A 4CC7A 2A08A 2JT4A 1IO6A 3RBBB 1N5ZA 1M3BA 2YUQA 4AFQC 2K2MA 1ZUKA 2K7AA 1QCFA 3KFVA 2PZ1A 1VYUA 2YUOA 2JS0A 2MOXA 2ED0A 4WCIA 5IH2A 1I1JA 4OMQA 1AVZC 4JJBA 1RUWA 1QKWA 3UA6A 2LCSA 3VS4A 4LNPA 2ENMA 1G83A 2J6FA 2CT4A 2KEAA 1UDLA 2BZYA 4OMPA 2KE9A 3VS5A 1AWJA 2LQNA 1VYTA 2EW3A 2DRMA 2EBPA 1A0NB 1WXTA 3NMZC 2PTKA 1NLPC 1HSQA 2LZ6B 1K0SA 4AG1C 1AWXA 2OAWA 2YT6A 1W6XA 2J05A 1T3LA 4RTWA 1ABOA 1B3QA 2M0YA 2EYXA 4HVVA 2ABLA 2JMAA 2DX1A 1UHCA 1OPLA 4F16A 1NEGA 1MUZA 2RNAA 4JZ4A 4CC2A 2V1RA 1UUEA 2L0AA 5GJVB 1YWPA 1HJDA 2C0OA 3I5RA 1ZX6A 1ARKA 2FEIA 3QWYA 3A98A 2AKKA 1S1NA 2KXCA 3R6NA 3M0RA 1QKXA 3M0SA 2NWMA 1UG1A 1ZUUA 2AK5A 4J9HA 2D8HA 1UE9A 1EFNA 2DBKA 2JM8A 1X6BA 2HDAA 4KRTA 4CC3A 1LCKA 2P4RA 1YNZA 2RQRA 2CUDA 2FPFA 2KXDA 1YCSB 2VWFA 2DL4A 3THKA 2DL8A 2LX7A 3PE0A 4RTZA 3REAB 1X2QA 1SEMA 4HVWA 4M4ZA 1UJYA 4J9GA 5IHNA 2J6KA 4HCKA 1UGVA 1RLPC 4RTTA 3C0CA 4AFSC 4GBQA 2KRMA 2DMOA 4J9DA 2LQWA 4OMMA 2DYBA 1SHGA 1X43A 1TG0A 2ECZA 1ABQA 1G2BA 2A37A 3VS3A 1PRLC 2LJ3A 2L3QA 3JV3A 4JPBW 3TSZA 1GCQA 2RQTA 1I07A 1V1CA 2J6OA 1M8MA 2FPDA 1I0CA 1QWFA 2JW4A 2O88A 4HXJA 2FRYA 4JJDA 3ZL7C 2LNHB 4D8DA 2W10A 5I22A 3PVQA 5HCKA 2D0NA 1QWEA 2KR3A 2KRNA 1NYGA 2F2VA 2FRWA 1T0JA 1KIKA 2X3XD 4J9EA 2O2OA 2HSPA 2L2PA 1SHFA 2J06A 3M0TA 3CQTA 1B07A 3EHQA 4JZ3A 2YUNA 1OV3A 1WA7A 4AFUC 2KGTA 3ULRB 1YN8A 4RTXA 1AWOA 5FWCA 1ZSGA 5FW9A 2AZSA 3O5ZA 3UF4A 5I11A 1FMKA 4ORZA 1QLYA 1UJ0A 2DJQA 4RTVA 1CSKA 2FG0A 4F14A 1AZEA 1WXUA 1WXBA 2DILA 3EG2A 1AWWA 2KT1A 1MV3A 1SPKA 1M27C 3UATA 2CSQA 1U06A 1SRLA 1K1ZA 1RI9A 2EKHA 2KYBA 1M3AA 1J3TA 2EGAA 3H41A 1Y0MA 2DRKA 2D1XA 2C0IA 3EGUA 3PVLA 4J9BA 3VS1A 2LP5A 1NLOC 1CKAA 1SSHA 1XOVA 2KNBB 1OPKA 4IIMA 1TUCA 2QDLA 2JM9A 2B86A 1UTIA 2JMCA 1TUDA 5IHKA 1JEGA 2CH4A 2LMJA 3H0FA 2DL5A 2DNUA 5IHIA 1JXOA 2DE0X 2X3WD 2EVRA 3EHRA 5FWBA 1PNJA 1WIEA 3EG0A 1ZLMA 2XMFA 4RUGA 2HCKA 4AFZC 3NPFA 1RLQC 1WFWA 4RTUA 2NUZA 1PKSA 1UECA 2V1QA 4Y92A 1AOJA 1Z9ZA 2ROTA 1WDXA 3VS7A 4DEXA 4Z8AA 1Z9QA 2F2WA 2YDLA 1H8KA 2BZXA 1X69A 1PWTA 2J7IA 1BB9A 4ZNXA 2BTTA 3REBB 2FO0A 4CC4B 1X6GA 2LJ0A 1H3HA 1K0XA 1JU5C 2FPEA 2GTJA 4LE9A 4FSSA 4ESRA 2MIOA 1UHFA 1E7OA 1KSWA 3TVTA 1K9AA 1M30A 3UA7A 2ESWA 3VS2A 2EYWA 4J9CA 2CREA 2IIMA 2K3BA 4OMOA 2PNIA 1H92A 2CDTA 2E5KA 5IXFA 2EGEA 2HEQA 1GCPA 4X1VA 3NGPA 1WX6A 2O9SA 2EYYA 4E6RA 1ZBJA 3SHWA 1ZUYA 4D8KA 1X27A 2I0NA 4LUDA 1AEYA 2CSIA 1GBQA 4IIOA 2G6FX 2DL3A 2YUPA 3VRYA 1HD3A 1U3OA 4RTYA 2F2XA 3VRZA 2DF6A 2K9GA 1FYNA 2KBTA 1KJWA 1YWOA 2AKLA 1OEBA 1PHTA 2CH4W 1JO8A 1U5SA 4AG2C 3VS6A 3QWXX 1NYFA 2SRCA 3H0IA 3NHNA 2A28A 2KT8A 2ED1A 2DVJA 2HBWA 2KRSA 2MCNA 2GNCA 2YSQA 5L23A 3EG3A 2DL7A 2H8HA 3LH5A 2OJ2A 3FJ5A 1W1FA 1K4US 4GLMA 2VVKA 2D8JA 4EIKA 2KROA 1UFFA 1Y57A 1W70A 2JTEA 4HVUA 3IQLA 1X2KA 3TSWA 2W0ZA 4JJCA 2GTOA 5IXBA 2A36A 2RMOA 2L3PA 3EG1A 2RQVA 2O9VA 4J9IA 3SEMA 2VKNA 4K11A 4A63B 4QT7A 1GCQC 4LUEA 1PKTA 1T0HA 4LN2A 1GFCA 1VYVA 1YP5A 2EGCA 2GBQA 1PRMC 1AZGB 5GJWB 1VA7A 3M0PA 4R0KA 2C0TA 1T3SA 2DA9A 2DBMA 1BK2A 3M0QA 4OMLA 4DEYA 1M3CA 1WLPB 4F17A 3M0UA 1WYXA 5EC7A 2SEMA 1GRIA 1SRMA 2RQUA 1NG2A 3H0HA 2RF0A 1K76A 2EQIA 2RQWA 4Z88A 5ECAA 1BU1A 4OMNA 2ROLA 1GBRA 1WI7A 2EPDA 2DM1A 2M51A 4Z89A 1MV0B 3RNJA 1E6HA 2CT3A 2JXBA 2GQIA 1CKBA 2KYMA 3I5SA 2GGRA 1OOTA 2JS2A 1BBZA 2EYZA 1NM7A 1KFZA 2RN8A 1GFDA 1GL5A 1AD5A 2O31A 2RPNA 3GBQA 3U23A 4J9FA 1NEBA 2CUBA 2DLPA 2L3SA 1JXMA 2OI3A 3I35A 2K79A 3I9QA 1JQQA 2BZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AZV A;  2K6D A;  1E6G A;  3VS0 A;  2LJ1 A;  4CC7 A;  2A08 A;  2JT4 A;  1IO6 A;  3RBB B;  1N5Z A;  1M3B A;  2YUQ A;  4AFQ C;  2K2M A;  1ZUK A;  2K7A A;  1QCF A;  3KFV A;  2PZ1 A;  1VYU A;  2YUO A;  2JS0 A;  2MOX A;  2ED0 A;  4WCI A;  5IH2 A;  1I1J A;  4OMQ A;  1AVZ C;  4JJB A;  1RUW A;  1QKW A;  3UA6 A;  2LCS A;  3VS4 A;  4LNP A;  2ENM A;  1G83 A;  2J6F A;  2CT4 A;  2KEA A;  1UDL A;  2BZY A;  4OMP A;  2KE9 A;  3VS5 A;  1AWJ A;  2LQN A;  1VYT A;  2EW3 A;  2DRM A;  2EBP A;  1A0N B;  1WXT A;  3NMZ C;  2PTK A;  1NLP C;  1HSQ A;  2LZ6 B;  1K0S A;  4AG1 C;  1AWX A;  2OAW A;  2YT6 A;  1W6X A;  2J05 A;  1T3L A;  4RTW A;  1ABO A;  1B3Q A;  2M0Y A;  2EYX A;  4HVV A;  2ABL A;  2JMA A;  2DX1 A;  1UHC A;  1OPL A;  4F16 A;  1NEG A;  1MUZ A;  2RNA A;  4JZ4 A;  4CC2 A;  2V1R A;  1UUE A;  2L0A A;  5GJV B;  1YWP A;  1HJD A;  2C0O A;  3I5R A;  1ZX6 A;  1ARK A;  2FEI A;  3QWY A;  3A98 A;  2AKK A;  1S1N A;  2KXC A;  3R6N A;  3M0R A;  1QKX A;  3M0S A;  2NWM A;  1UG1 A;  1ZUU A;  2AK5 A;  4J9H A;  2D8H A;  1UE9 A;  1EFN A;  2DBK A;  2JM8 A;  1X6B A;  2HDA A;  4KRT A;  4CC3 A;  1LCK A;  2P4R A;  1YNZ A;  2RQR A;  2CUD A;  2FPF A;  2KXD A;  1YCS B;  2VWF A;  2DL4 A;  3THK A;  2DL8 A;  2LX7 A;  3PE0 A;  4RTZ A;  3REA B;  1X2Q A;  1SEM A;  4HVW A;  4M4Z A;  1UJY A;  4J9G A;  5IHN A;  2J6K A;  4HCK A;  1UGV A;  1RLP C;  4RTT A;  3C0C A;  4AFS C;  4GBQ A;  2KRM A;  2DMO A;  4J9D A;  2LQW A;  4OMM A;  2DYB A;  1SHG A;  1X43 A;  1TG0 A;  2ECZ A;  1ABQ A;  1G2B A;  2A37 A;  3VS3 A;  1PRL C;  2LJ3 A;  2L3Q A;  3JV3 A;  4JPB W;  3TSZ A;  1GCQ A;  2RQT A;  1I07 A;  1V1C A;  2J6O A;  1M8M A;  2FPD A;  1I0C A;  1QWF A;  2JW4 A;  2O88 A;  4HXJ A;  2FRY A;  4JJD A;  3ZL7 C;  2LNH B;  4D8D A;  2W10 A;  5I22 A;  3PVQ A;  5HCK A;  2D0N A;  1QWE A;  2KR3 A;  2KRN A;  1NYG A;  2F2V A;  2FRW A;  1T0J A;  1KIK A;  2X3X D;  4J9E A;  2O2O A;  2HSP A;  2L2P A;  1SHF A;  2J06 A;  3M0T A;  3CQT A;  1B07 A;  3EHQ A;  4JZ3 A;  2YUN A;  1OV3 A;  1WA7 A;  4AFU C;  2KGT A;  3ULR B;  1YN8 A;  4RTX A;  1AWO A;  5FWC A;  1ZSG A;  5FW9 A;  2AZS A;  3O5Z A;  3UF4 A;  5I11 A;  1FMK A;  4ORZ A;  1QLY A;  1UJ0 A;  2DJQ A;  4RTV A;  1CSK A;  2FG0 A;  4F14 A;  1AZE A;  1WXU A;  1WXB A;  2DIL A;  3EG2 A;  1AWW A;  2KT1 A;  1MV3 A;  1SPK A;  1M27 C;  3UAT A;  2CSQ A;  1U06 A;  1SRL A;  1K1Z A;  1RI9 A;  2EKH A;  2KYB A;  1M3A A;  1J3T A;  2EGA A;  3H41 A;  1Y0M A;  2DRK A;  2D1X A;  2C0I A;  3EGU A;  3PVL A;  4J9B A;  3VS1 A;  2LP5 A;  1NLO C;  1CKA A;  1SSH A;  1XOV A;  2KNB B;  1OPK A;  4IIM A;  1TUC A;  2QDL A;  2JM9 A;  2B86 A;  1UTI A;  2JMC A;  1TUD A;  5IHK A;  1JEG A;  2CH4 A;  2LMJ A;  3H0F A;  2DL5 A;  2DNU A;  5IHI A;  1JXO A;  2DE0 X;  2X3W D;  2EVR A;  3EHR A;  5FWB A;  1PNJ A;  1WIE A;  3EG0 A;  1ZLM A;  2XMF A;  4RUG A;  2HCK A;  4AFZ C;  3NPF A;  1RLQ C;  1WFW A;  4RTU A;  2NUZ A;  1PKS A;  1UEC A;  2V1Q A;  4Y92 A;  1AOJ A;  1Z9Z A;  2ROT A;  1WDX A;  3VS7 A;  4DEX A;  4Z8A A;  1Z9Q A;  2F2W A;  2YDL A;  1H8K A;  2BZX A;  1X69 A;  1PWT A;  2J7I A;  1BB9 A;  4ZNX A;  2BTT A;  3REB B;  2FO0 A;  4CC4 B;  1X6G A;  2LJ0 A;  1H3H A;  1K0X A;  1JU5 C;  2FPE A;  2GTJ A;  4LE9 A;  4FSS A;  4ESR A;  2MIO A;  1UHF A;  1E7O A;  1KSW A;  3TVT A;  1K9A A;  1M30 A;  3UA7 A;  2ESW A;  3VS2 A;  2EYW A;  4J9C A;  2CRE A;  2IIM A;  2K3B A;  4OMO A;  2PNI A;  1H92 A;  2CDT A;  2E5K A;  5IXF A;  2EGE A;  2HEQ A;  1GCP A;  4X1V A;  3NGP A;  1WX6 A;  2O9S A;  2EYY A;  4E6R A;  1ZBJ A;  3SHW A;  1ZUY A;  4D8K A;  1X27 A;  2I0N A;  4LUD A;  1AEY A;  2CSI A;  1GBQ A;  4IIO A;  2G6F X;  2DL3 A;  2YUP A;  3VRY A;  1HD3 A;  1U3O A;  4RTY A;  2F2X A;  3VRZ A;  2DF6 A;  2K9G A;  1FYN A;  2KBT A;  1KJW A;  1YWO A;  2AKL A;  1OEB A;  1PHT A;  2CH4 W;  1JO8 A;  1U5S A;  4AG2 C;  3VS6 A;  3QWX X;  1NYF A;  2SRC A;  3H0I A;  3NHN A;  2A28 A;  2KT8 A;  2ED1 A;  2DVJ A;  2HBW A;  2KRS A;  2MCN A;  2GNC A;  2YSQ A;  5L23 A;  3EG3 A;  2DL7 A;  2H8H A;  3LH5 A;  2OJ2 A;  3FJ5 A;  1W1F A;  1K4U S;  4GLM A;  2VVK A;  2D8J A;  4EIK A;  2KRO A;  1UFF A;  1Y57 A;  1W70 A;  2JTE A;  4HVU A;  3IQL A;  1X2K A;  3TSW A;  2W0Z A;  4JJC A;  2GTO A;  5IXB A;  2A36 A;  2RMO A;  2L3P A;  3EG1 A;  2RQV A;  2O9V A;  4J9I A;  3SEM A;  2VKN A;  4K11 A;  4A63 B;  4QT7 A;  1GCQ C;  4LUE A;  1PKT A;  1T0H A;  4LN2 A;  1GFC A;  1VYV A;  1YP5 A;  2EGC A;  2GBQ A;  1PRM C;  1AZG B;  5GJW B;  1VA7 A;  3M0P A;  4R0K A;  2C0T A;  1T3S A;  2DA9 A;  2DBM A;  1BK2 A;  3M0Q A;  4OML A;  4DEY A;  1M3C A;  1WLP B;  4F17 A;  3M0U A;  1WYX A;  5EC7 A;  2SEM A;  1GRI A;  1SRM A;  2RQU A;  1NG2 A;  3H0H A;  2RF0 A;  1K76 A;  2EQI A;  2RQW A;  4Z88 A;  5ECA A;  1BU1 A;  4OMN A;  2ROL A;  1GBR A;  1WI7 A;  2EPD A;  2DM1 A;  2M51 A;  4Z89 A;  1MV0 B;  3RNJ A;  1E6H A;  2CT3 A;  2JXB A;  2GQI A;  1CKB A;  2KYM A;  3I5S A;  2GGR A;  1OOT A;  2JS2 A;  1BBZ A;  2EYZ A;  1NM7 A;  1KFZ A;  2RN8 A;  1GFD A;  1GL5 A;  1AD5 A;  2O31 A;  2RPN A;  3GBQ A;  3U23 A;  4J9F A;  1NEB A;  2CUB A;  2DLP A;  2L3S A;  1JXM A;  2OI3 A;  3I35 A;  2K79 A;  3I9Q A;  1JQQ A;  2BZ8 A; 
#chains in the Genus database with same CATH topology
 1Y96 A;  2K6D A;  1VQO Q;  3OYK A;  1KC8 C;  1I5L A;  3I55 T;  2JT4 A;  1IO6 A;  3RBB B;  2RI2 A;  1QVF P;  4FT4 A;  2YUQ A;  4PJL A;  2RJE A;  4PJM A;  4AFQ C;  3JB9 G;  1K73 R;  1JJ2 P;  1ZUK A;  2K7A A;  1Y96 B;  4A4K A;  3X26 B;  1VQ7 T;  1PSE A;  2YUO A;  2JS0 A;  3HRS A;  4WCI A;  4OMQ A;  1VQM T;  2F69 A;  1RUW A;  1YJN A;  2H3J A;  2RHX A;  2WSE E;  1G83 A;  5A0G A;  1IRX A;  3JRZ A;  1M1G A;  2K3Y A;  3MEW A;  1ACM B;  2K3X A;  1AWJ A;  5CCA A;  1M90 U;  1VQ4 T;  3V8J A;  2A0F B;  2LRQ A;  1A0N B;  1WXT A;  1YCY A;  1HSQ A;  1K0S A;  1MMG A;  2OAW A;  5KCO A;  2E70 A;  3JCM d;  2LCC A;  1KD1 U;  2DVE A;  4ZGE B;  3CPW S;  2K2V A;  3EH1 A;  4OGE A;  2J05 A;  1ABO A;  2M0Y A;  4HVV A;  2LC4 A;  2ABL A;  2QQA A;  2PUO B;  3RKW A;  1OPL A;  2FYK A;  2JNG A;  3CCM A;  4M77 F;  2RNA A;  4JJN K;  3QJY A;  1M90 C;  1VIE A;  4IUV A;  2CP5 A;  2C0O A;  2FEI A;  1BCM A;  2L5Q A;  5GMK m;  3RDV A;  1YI2 A;  1KD1 C;  2D6F A;  1QKX A;  4XU1 A;  3RR6 A;  1PD1 A;  1UG1 A;  2MPX C;  3OSV A;  4KUL A;  1EFN A;  4A53 A;  3GP8 A;  2XDB A;  1X6B A;  2HDA A;  3JCM g;  1RAI B;  2DD5 A;  4C8Q F;  2DJZ A;  2RQR A;  2DYI A;  2CUD A;  2FPF A;  1YCS B;  3OW2 S;  4VUB A;  3CCE A;  4RTZ A;  1X2Q A;  2JVV A;  2ZPE B;  2VAS A;  2PVD B;  2F5K A;  2HAX A;  5IHN A;  1UGV A;  1RLP C;  4ZTF A;  4BI3 A;  4GBQ A;  2DXB A;  2DMO A;  4BUG A;  4IUT A;  3JB9 F;  2DPP B;  2QEX T;  1VOM A;  2K5I A;  4DOV A;  1S72 A;  4HCC A;  1NBE B;  3NTK A;  2OTJ T;  2RQT A;  1V1C A;  3CCV A;  2FPD A;  3CBO A;  5KYY A;  2M16 A;  1QWF A;  2JW4 A;  4JRQ A;  4HXJ A;  2RHY A;  3M4G A;  4D8D A;  1YJ9 T;  2DXU A;  4M7A A;  5HCK A;  3UDC A;  3CCL Q;  3G6E Q;  1XNI A;  5KYY B;  2FRW A;  2QGG A;  5D7U A;  2XK0 A;  4WF2 A;  4M7A B;  1TS9 A;  1SHF A;  4RG2 A;  1I8F A;  5GAN 4;  1QP3 A;  3CQT A;  4C5G A;  4ZN1 A;  3LGF A;  3CCM Q;  2V8I A;  3GLX A;  1QVG S;  1W2B P;  2F1L A;  4O6J A;  3BY7 A;  4AFU C;  3QYH B;  1YN8 A;  4RTX A;  1ZSG A;  4O5V A;  3PT9 A;  1YJW T;  1FMK A;  3L2U A;  2Y4Y A;  1UJ0 A;  2R58 A;  3GNF B;  4F14 A;  3CCQ A;  4Y28 E;  2DIL A;  2XID A;  1MV3 A;  3F70 A;  1YI2 Q;  2CSQ A;  4Z02 A;  2M0O A;  4E47 A;  2VXF A;  1M3A A;  4KH0 B;  4XTW A;  2D1X A;  5CR2 A;  3EGU A;  5FLX E;  1NLO C;  1SSH A;  3PTA A;  5GAM d;  1UTI A;  2JMC A;  5LJ3 e;  2HMA A;  2LMJ A;  2DL5 A;  3KXT A;  2M1H A;  4YTL A;  1R77 A;  1WIE A;  5D6Y A;  3UWN A;  1ZLM A;  1QQJ A;  2XMF A;  1QP2 A;  1ZSZ A;  1R8O B;  4C0D C;  1S72 Q;  3G71 T;  4C0F A;  4OB3 B;  4NL2 A;  1PKS A;  2EQM A;  1M90 R;  2M02 A;  3CXC P;  3HRU A;  2QTV A;  2XI9 A;  3PMT A;  2ROT A;  3GPL A;  1N6A A;  1ZSZ B;  1G8X A;  3CCV Q;  1M4Z A;  1VQN A;  2DAQ A;  4FYX B;  1EIF A;  4M75 D;  2J7I A;  1V29 B;  1K0X A;  5GAM g;  2ATC B;  2FPE A;  1QMC A;  2GTJ A;  3JCM f;  2QA4 A;  4X9C A;  4FSS A;  2MIO A;  2MMP A;  4LD6 A;  2LX9 A;  1K9A A;  1M30 A;  2E1H A;  1IHW A;  1KHC A;  2E41 A;  3E9F A;  2CRE A;  5GAN 8;  2E12 A;  4C5E A;  1H92 A;  4IKF A;  1VQO T;  1QVF A;  5D6X A;  3G1J A;  1GCP A;  4M77 D;  4X1V A;  3CCQ Q;  4RCB A;  4BE1 A;  3PNW C;  1ZBJ A;  5GAO p;  1ZUY A;  4N0A A;  1X27 A;  4WTO B;  1VQ9 A;  2CSI A;  2DFU A;  1TTH B;  1MGQ A;  5GAO q;  2G6F X;  5J3B A;  2YUP A;  3URG A;  4L6V 5;  3VRZ A;  2AKL A;  1BIB A;  1OEB A;  4FW2 A;  4AG2 C;  1VQK A;  5J26 A;  2SRC A;  5GMK l;  4JS4 A;  4M78 C;  2A28 A;  1M5Q 1;  2KRS A;  2MCN A;  2GNC A;  3EG3 A;  2DL7 A;  3EFO A;  2DTI A;  3NFC A;  3QDF A;  1VQL Q;  1K4U S;  3RMQ A;  4GLM A;  2VVK A;  1FX7 A;  3QJ6 A;  1K9M U;  4EIK A;  2KRO A;  1Y57 A;  2JTE A;  4E7S A;  3EFO B;  4OP0 A;  4QVC A;  5GMK h;  5IXB A;  3MEU A;  2BKD N;  5GAM j;  3EGX A;  2X4W A;  3SDZ A;  2EQK A;  3SEM A;  1YHQ A;  2VKN A;  1YJW A;  5DM7 R;  3WVE B;  1VQN Q;  1PKT A;  1WJS A;  4LN2 A;  1VYV A;  1YP5 A;  4JDS A;  3EGX B;  3NTI A;  3TU4 K;  1VA7 A;  4R0K A;  3LGL A;  1T3S A;  5FRN A;  4OB1 B;  1K9M C;  2QA4 Q;  5IN1 A;  3M0Q A;  2RJC A;  4EDU A;  5EC7 A;  3CCJ Q;  1WHK A;  1GRI A;  1M8V A;  1NG2 A;  1QCN A;  3MET A;  5KE3 A;  3CCS A;  3QDR B;  1GBR A;  1WI7 A;  2M51 A;  4AMC A;  1TUG B;  2JXB A;  3C12 A;  2GGR A;  2JS2 A;  1D0Z A;  1VQ9 Q;  3DKM A;  3JB9 J;  2RN8 A;  1GL5 A;  3OYE A;  1AD5 A;  4C92 C;  2X4Y A;  4XTX A;  1Y71 A;  4J9F A;  1F1B B;  3WXM B;  1YJN T;  1RL2 A;  4F7U G;  1VQK Q;  2CS7 A;  8ATC B;  1ZQ1 A;  3I9Q A;  3M53 A;  4CC7 A;  4IUP A;  2A08 A;  1NPP A;  4E7K A;  3SWN A;  2RHU A;  5GAM f;  4OVA A;  1I81 A;  1PCX A;  3C95 A;  3KFV A;  2PZ1 A;  3SWN B;  1WHL A;  3G6E T;  4EMH A;  5IH2 A;  1I1J A;  1AVZ C;  1W2B A;  1D1B A;  2DZC A;  3OMG A;  4M7A D;  1YHQ Q;  2NUP A;  3CCM T;  4BI8 B;  2ENM A;  4L59 A;  1FWZ A;  2J6F A;  3FB9 A;  2CT4 A;  1C6V X;  3HFO A;  2KEA A;  4XU2 A;  3EAE A;  2DRM A;  3FEO A;  3RIR A;  2NUP B;  3OYM A;  3NMZ C;  2Y4X A;  4M75 G;  3M59 A;  3CC7 A;  2ZGW A;  3A8G B;  3OBW A;  4PFZ A;  1YI2 T;  2RO0 A;  3SFM A;  4N4I A;  3OA6 A;  5FU6 B;  3M58 A;  3CCS Q;  2JMA A;  4M77 C;  4F16 A;  4PJO A;  4JZ4 A;  4EMK A;  2KK4 A;  2RH2 A;  3L2V A;  1D3B A;  2V1R A;  1ZA1 B;  1UUE A;  4PJO B;  3A8H B;  4M77 G;  3CCE T;  2VXE A;  1O9S A;  2L8D A;  1HJD A;  1ARK A;  1ZX6 A;  5LJ3 h;  2K4Y A;  3QWY A;  5CKE A;  4X34 A;  4EMK B;  1MMD A;  4JRI A;  4EMG A;  1D1A A;  5A0L A;  2NWM A;  5LJ5 g;  3M56 A;  4RCC A;  2CP0 A;  4XU0 A;  2AK5 A;  4J9H A;  2KI7 A;  3CXC A;  4C8Q C;  4KRT A;  3JCM J;  1S72 T;  1UGP B;  3CBM A;  4BDZ A;  2P4R A;  1KHI A;  1OQK A;  3OBY A;  3CCV T;  4KUI A;  2DEU A;  1K9M R;  2DL4 A;  3ZBD A;  3J81 E;  3V7S A;  3JCM X;  3LH0 A;  4HVW A;  2JUF A;  2VV5 A;  1G3W A;  2J6K A;  4QQD A;  1C0M A;  5KH6 A;  3QSU A;  2E4H A;  4RTT A;  3FRN A;  2KRM A;  1YIT Q;  2LQW A;  2DYB A;  4L5G A;  1D0Y A;  2VC8 A;  1ABQ A;  1G2B A;  3VS3 A;  2LJ3 A;  3EGD A;  3JV3 A;  4XTU A;  3TSZ A;  4ZGD B;  3CCQ T;  1I0C A;  4J6Y A;  4Q5W A;  4JJD A;  3ZL7 C;  2LT1 A;  3CC7 Q;  3HRT A;  4QW2 A;  4BE0 A;  3EGD B;  1QWE A;  1H64 1;  1U8R A;  1OZ3 A;  3OYC A;  1LPL A;  2VB6 A;  2KAF A;  1T0J A;  3C4S A;  2O2O A;  3FIF A;  4CI0 C;  5LJ5 j;  4TVR A;  4M75 F;  4M7D A;  6AT1 B;  2KGT A;  4DBF A;  4GLK A;  2GF7 A;  1OU9 A;  3E9G A;  2LCL A;  4M7D B;  1CSK A;  2FG0 A;  1AZE A;  3V8L A;  4DBH A;  1WXU A;  1QVF S;  3UAT A;  2E3H A;  3CCL A;  3QPH A;  5GMK e;  3G6E A;  2EKO A;  3RMS A;  5HK3 A;  2EKH A;  3MCA B;  2KYB A;  1J3T A;  2IG0 A;  5FU7 B;  4DOW A;  1Y0M A;  4J9B A;  2AHJ B;  3X20 B;  2Y90 A;  5LJ3 d;  1VQN T;  1OPK A;  4E7Z A;  3M5A A;  3CME A;  2JM9 A;  4XTV A;  4OMF B;  2QGF B;  3H0F A;  2DNU A;  5CIU A;  2DE0 X;  2QA4 T;  5FRM A;  3EHR A;  4N4H A;  3V7C A;  4FYV B;  4E7L A;  4RUG A;  3CCJ T;  1KQS P;  3P8D A;  3VJP A;  4IUR A;  1OU8 A;  1RLQ C;  4RTU A;  2NUZ A;  5A2Q E;  4M7A G;  1SKU B;  1UEC A;  2HBP A;  3VYH B;  1WHH A;  1YIJ A;  3E1S A;  5GAN 7;  1AOJ A;  3CPF A;  1TOV A;  4Z8A A;  1Z9Q A;  3FJP A;  2YDL A;  3T9N A;  4NL3 A;  2BZX A;  1X69 A;  5LJ5 f;  2CGH A;  1WHG A;  2FZK B;  1G5V A;  1PWT A;  1VQ9 T;  4KGX B;  3VU3 C;  2BTT A;  1X6G A;  2YRD A;  3H6Z A;  2DIQ A;  1H3H A;  2IPO B;  2DTO A;  4LE9 A;  3ASK A;  3P8H A;  2E5Q A;  1WJR A;  5GAN h;  1EZZ B;  4E7H A;  1KSW A;  4II1 A;  3TVT A;  2FB7 A;  3UA7 A;  1PC0 A;  3WVD B;  4RMO A;  3VS2 A;  3X25 B;  1VQK T;  2EYW A;  3QZ9 B;  1FXX A;  2IIM A;  2K3B A;  3SB2 A;  3V8K A;  2PNI A;  4N4G A;  4X9D A;  5IXF A;  2EGE A;  4NOY A;  4QQ6 A;  3VUZ A;  3SHW A;  4PJO E;  2HKQ B;  3Q1J A;  3PIO A;  1Q81 U;  2R5A A;  3OYL A;  2QDY B;  1M1F A;  1B34 A;  4IIO A;  3A8O B;  2MI6 A;  2BE7 D;  1WZO A;  2PQW A;  3JSC A;  2F2X A;  1FYN A;  1ZSZ C;  1B34 B;  1KJW A;  1NZ9 A;  2KBT A;  3QUI A;  4JRK A;  1Q95 G;  5CKF A;  1YHQ T;  3KUF A;  3GF5 A;  3CME Q;  3JB9 I;  2KT8 A;  1RAE B;  5AT1 B;  2H8H A;  2VGM A;  2YRC A;  2OJ2 A;  3CC4 A;  1W1F A;  5CVI A;  1Q81 C;  1G3S A;  7AT1 B;  4FYW B;  3LWI A;  4BY6 B;  1LJO A;  4HVU A;  1VQ5 Q;  3IQL A;  1D09 B;  3L42 A;  4JJC A;  2A36 A;  2EAY A;  2RMO A;  3JB9 H;  4MML A;  2L3P A;  3LWH A;  3CCS T;  3DB4 A;  1YIJ Q;  5L8R E;  4J9I A;  3FC3 A;  1IGU A;  4A63 B;  4QT7 A;  4J5Y A;  1W2B S;  1GCQ C;  1GFC A;  2JTF A;  4A4G A;  1VQL A;  5GJW B;  1AZG B;  4ZN3 A;  1WHM A;  3HKS A;  1NPR A;  4PJO D;  5KYW A;  2HZY A;  4M7A F;  2VYT A;  2RD1 A;  1TWB A;  4OML A;  4DEY A;  1M3C A;  3OYG A;  1ZA2 B;  3L2W A;  5KYW B;  2RQU A;  4LDV A;  5GAN 6;  2EQI A;  4Z88 A;  4LXC A;  5ECA A;  8AT1 B;  2HQX A;  4OMN A;  3OYD A;  1TH7 A;  3OYY A;  2DM1 A;  4Z89 A;  1MV0 B;  2VGN A;  2CT3 A;  1CKB A;  3I5S A;  5KCH A;  5C6S A;  4M7D E;  1MNE A;  1KFZ A;  1HXD A;  2EJG A;  3S3M A;  2FL7 A;  2QQR A;  2O31 A;  2RPN A;  1G3Y A;  3CCJ A;  2JJ9 A;  2ZPH B;  2CUB A;  2XDD A;  3I35 A;  3HHT B;  5DLQ E;  1JJ2 A;  2ZPF B;  2DEQ A;  2AZV A;  3VS0 A;  2LJ1 A;  3A8M B;  3CXC S;  5D6W A;  1N5Z A;  3CC4 Q;  4XQ3 A;  5FRO A;  3BE3 A;  2DKG A;  3VYG A;  2K2M A;  3CC7 T;  3JCM Q;  3TCJ A;  1M2O A;  1TSF A;  3ZEH A;  2P0Q A;  2CP7 A;  2MOX A;  2ED0 A;  1PD0 A;  2GFU A;  3EH2 A;  4JJB A;  1UEB A;  1QKW A;  3UA6 A;  3VS4 A;  2YWW A;  4LNP A;  1WNL A;  4J7F A;  1OX8 A;  2OTL Q;  1IRE B;  4JLI A;  1UDL A;  3HPW A;  1D0X A;  2BZY A;  4ATO A;  2QXF A;  2LQN A;  3CCR A;  1VYT A;  4KGZ B;  2EBP A;  4C0D B;  4M7D D;  2LZ6 B;  2M9U A;  2RA2 A;  1AWX A;  2EQU A;  4RTW A;  2EQJ A;  1B3Q A;  1SSF A;  2JZ2 A;  2DET A;  2EYX A;  2NYS A;  3G4S Q;  4FCY A;  2DX1 A;  2I2L A;  2XKO C;  5CKH A;  3QYG B;  3MO8 A;  1NEG A;  1NJI U;  1MUZ A;  3ME9 A;  3DLL A;  3CCU A;  4CC2 A;  3M9Q A;  2B8A A;  1Q81 R;  2L0A A;  4XU3 A;  5GJV B;  4PFO A;  4ZGJ B;  3SWN C;  3A98 A;  3BDU A;  5CO7 A;  3BW1 A;  1S1N A;  2KXC A;  3R6N A;  2LNV A;  3VKI A;  1KQS A;  3QXE B;  2QQS A;  4BI4 A;  4QQG A;  4JUV A;  2DBK A;  4R56 A;  2JM8 A;  1O75 A;  1N8R U;  4DA4 A;  4CC3 A;  1LCK A;  2OAU A;  5KYU A;  1NJI C;  1VQ8 A;  4M78 A;  4HT8 A;  2LVM A;  2VWF A;  4EPC A;  5KYU B;  3KBG A;  2DL8 A;  2MYS A;  2LX7 A;  3PE0 A;  3HL8 A;  3REA B;  5GAN e;  1SEM A;  2EIF A;  1UJY A;  4M78 B;  4D6W A;  5IAY A;  2ZZD A;  4HCK A;  5GAO n;  1UB4 A;  3DLM A;  2KDS A;  3C0C A;  1Y07 A;  4A4E A;  1OX9 A;  5IT9 E;  1N8R C;  1X43 A;  1TG0 A;  2VUB A;  4KGV B;  3EFR A;  2ECZ A;  2RK1 A;  4MDW A;  4F04 B;  3OYF A;  3CCR Q;  2QEX Q;  2L3Q A;  3MEV A;  1U1S A;  4E2F B;  1I07 A;  2O88 A;  2FRY A;  4PJJ A;  2COY A;  3CCL T;  2X51 A;  4RKU E;  3MHX A;  2HKN A;  5I22 A;  3OS0 A;  3OSS C;  4PJO G;  2KRN A;  2QG9 B;  2GQV A;  2F2V A;  4GY5 A;  1KIK A;  1YIT A;  1U1T A;  4M75 C;  2HSP A;  2RJF A;  3M0T A;  2DO3 A;  1FMW A;  2E3I A;  3CCU Q;  1OV3 A;  2E6N A;  1WA7 A;  2PUK B;  1OI1 A;  3ULR B;  2GFA A;  1BI2 A;  2XHC A;  3CEY A;  1AWO A;  5FWC A;  1Q7Y R;  1BIA A;  2AZS A;  3O5Z A;  3INZ A;  3UF4 A;  3CME T;  5I11 A;  1K8A U;  4ORZ A;  1QLY A;  2DJQ A;  4RTV A;  1IB8 A;  1EX4 A;  3VV0 A;  2FZC B;  1WXB A;  2KT1 A;  4PJN A;  3RUX A;  3JCM P;  3QG1 A;  3SD4 A;  4BB7 A;  4F7U A;  3OS2 A;  1P92 A;  1X01 A;  4C92 A;  4DBQ A;  2LT4 A;  2EGA A;  3H41 A;  4F7U B;  2C0I A;  1YIJ T;  2RM4 A;  1VQ8 Q;  2HD0 A;  4C92 B;  1BI3 A;  3JCM h;  1CKA A;  4KBM B;  3CMA A;  1SG5 A;  4JLG A;  2QDL A;  1K8A C;  2B86 A;  2LQK A;  1TUD A;  3TEE A;  1JEG A;  2RI5 A;  4J83 A;  3S3O A;  2YHT A;  2FVU A;  1OUL A;  3MP8 A;  3MP6 A;  4J8O A;  2COW A;  2X3W D;  5GAO r;  3L1A A;  4LD9 K;  5FWB A;  4BD3 A;  1PNJ A;  3L2R A;  2HCK A;  2RB6 A;  4AFZ C;  3MKD A;  2KVQ G;  2ZPI B;  2RJD A;  1AHJ B;  1Y7X A;  2DXC A;  2V1Q A;  4AT1 B;  4Y92 A;  1Z9Z A;  2QQ9 A;  1WDX A;  2F2W A;  2BIV A;  1H8K A;  3BDL A;  1Q86 C;  4MDX A;  4PNO A;  5J39 A;  4CC4 B;  3FDR A;  3X28 B;  4B9X A;  1JU5 C;  4ESR A;  1UHF A;  3TRE A;  1E7O A;  1NJI R;  1PM3 A;  2H3E B;  2ESW A;  4PJO F;  4M77 A;  2CDT A;  3HFN A;  2MAM A;  4PFP A;  1AT1 B;  3NGP A;  3CC4 T;  1WX6 A;  2O9S A;  1MMA A;  2EYY A;  4CRI A;  4E6R A;  3CD6 A;  4M77 B;  2O4X A;  2FZG B;  4LUD A;  4A4H A;  2L89 A;  3CPW P;  1GBQ A;  2EJF A;  4OB0 B;  2XDP A;  3HP9 A;  2DL3 A;  1HD3 A;  1N8R R;  1VQP A;  2WAC A;  5GAN 5;  2O4X B;  4DQ2 A;  3PFS A;  1DJ7 B;  5GMK j;  1YWO A;  3QBY A;  4A54 A;  4XTY A;  1VQ6 A;  1U5S A;  3VS6 A;  3CMA Q;  1NYF A;  4C8Q A;  2RHI A;  3H0I A;  3NHN A;  2OTL T;  2CZ0 B;  1VQL T;  3E2U A;  2YSQ A;  5L23 A;  1JJ2 S;  3QII A;  4KH1 B;  4OGC A;  3LH5 A;  3ZFJ A;  1BYM A;  2BUD A;  2DTH A;  3FJ5 A;  4FSX A;  1FMV A;  4C8Q B;  2CP3 A;  3M57 A;  4PK4 A;  3OYI A;  1WHJ A;  4OB2 B;  4MZP A;  3J7A F;  3V7R A;  4FW1 A;  4M78 E;  1UFF A;  2LTO A;  5I21 A;  4BAC A;  5LJ5 e;  1RI0 A;  3G4S T;  3S6W A;  4PLL A;  5AYF A;  2R5M A;  1ZBX A;  4K11 A;  3QKJ A;  2CYZ B;  3OW2 P;  2EGC A;  3H9N A;  3M0P A;  4M7A C;  5A0D A;  4BE2 A;  4XK8 E;  5CQY A;  4C0G A;  2K5L A;  2XU8 A;  1VQ5 A;  1BK2 A;  1WLP B;  3M0U A;  5GAM h;  3L2Z A;  1SF9 A;  1M1K U;  1SRM A;  4FU6 A;  2RF0 A;  4FT2 A;  1K76 A;  2RQW A;  1BU1 A;  4M7D F;  1K8A R;  2HL3 A;  3C94 A;  2EPD A;  1N27 A;  4HCZ A;  1WGS A;  1IZ6 A;  3RNJ A;  1E6H A;  1R0C B;  3CD6 Q;  2CZ6 B;  5CK9 A;  3UPU A;  4J6X A;  4BY6 C;  1X6O A;  1OOT A;  5LJ3 g;  1NM7 A;  1UGQ B;  5KYN A;  1YBY A;  2DK3 A;  2IVW A;  3OB9 A;  2QK0 A;  1GFD A;  3CC2 A;  2CP6 A;  2F5T X;  2P4T A;  2YXY A;  1VQP Q;  4M78 D;  4FM4 B;  1VIF A;  5I2S A;  1QVP A;  3U23 A;  5C0M A;  5KE2 A;  2DLP A;  1QVG P;  1M1K C;  4LDW A;  1VQ6 Q;  4F7U E;  1KQS S;  1YJN Q;  2K79 A;  4C92 E;  1E6G A;  1Q86 R;  3PMI A;  3CCR T;  2D0Q B;  1M3B A;  3RKX A;  1QCF A;  1RAD B;  2ZPB B;  3JCM V;  1OZ2 A;  1VYU A;  4JS5 A;  3I56 A;  3EG9 A;  4E7J A;  3L2Q A;  3PGG A;  1IXD A;  1VUB A;  1I5O B;  4HCB A;  1V76 A;  1XJW B;  3O8V A;  4P5N A;  2HQE A;  2EJ9 A;  2LCS A;  5GAO l;  1Q82 U;  3EG9 B;  3CCU T;  1KC8 R;  4OMP A;  2KE9 A;  3MP1 A;  3VS5 A;  3I55 A;  2EW3 A;  2GCX A;  9ATC B;  4BDY A;  3E19 A;  2PTK A;  3JCM b;  1NLP C;  2KMT A;  3OMC A;  3UT1 A;  4M75 E;  4AG1 C;  2YT6 A;  1VQ7 A;  2X4J A;  5LJ3 j;  1JBM A;  1TU0 B;  4C0Z A;  1WPY A;  1W6X A;  1T3L A;  4LDU A;  2P0P A;  3JCM e;  3QHS A;  1VQM A;  2E64 A;  2L3R A;  1UHC A;  3JCM c;  2A3L A;  2OTL A;  4B6M A;  1BI0 A;  1Q82 C;  5EG2 A;  2DIG A;  1VQ8 T;  1LVK A;  4C92 D;  1MND A;  3HTR A;  3RKY A;  4N0A C;  1YWP A;  1BCO A;  3MPU B;  2QAS A;  5I2M A;  5CAI A;  1KK7 A;  3M54 A;  1VQ4 A;  4M77 E;  4JRP A;  3CC2 Q;  3I5R A;  5DY9 A;  3OYH A;  3GNG A;  2AKK A;  3CCE Q;  3M0R A;  1NE8 A;  3M0S A;  3JAM E;  1ZUU A;  2K5F A;  2D8H A;  3G4S A;  3FLG A;  3OYB A;  1UE9 A;  4XTZ A;  4MMK A;  4OF1 A;  3OS1 A;  4DBR A;  2YRV A;  1JRI A;  3ER0 A;  1YNZ A;  1Q7Y U;  4XAX B;  2A7Y A;  5GAN d;  4LDY A;  2EWN A;  1G3T A;  2KXD A;  3MEA A;  3TQ7 P;  1X75 C;  5GAN 3;  3THK A;  4C8Q E;  5GAN 2;  3I56 Q;  4M4Z A;  1MMN A;  1KD1 R;  4J7I A;  4J9G A;  1YIT T;  2AT1 B;  1M2V A;  4AFS C;  3M4Y A;  3JCM W;  4J9D A;  1RAA B;  4OMM A;  1SHG A;  5LJ3 f;  2A37 A;  1QW1 A;  1WJQ A;  3HSB A;  1PSF A;  3H8Z A;  2RHZ A;  1PRL C;  1M2V B;  3I55 Q;  1Q7Y C;  4JPB W;  2KQW A;  1GCQ A;  2J6O A;  4E7I A;  1M8M A;  4KT0 E;  3CPW A;  2LNH B;  2W10 A;  1VQ7 Q;  3PVQ A;  1B7T A;  2D0N A;  4FYY B;  2MF2 A;  2KR3 A;  1M1K R;  2YLB A;  2LQ8 A;  1NYG A;  5GAN g;  2X3X D;  4J9E A;  1VQM Q;  2PVG B;  2L2P A;  2J06 A;  2XIC A;  4ME7 A;  3GIB A;  1B07 A;  3EHQ A;  2DD4 A;  4JZ3 A;  2YUN A;  2ZCF B;  1HYO A;  2ZAE A;  4PKC C;  2QEX A;  3CMA T;  5FW9 A;  2WSC E;  2OTJ A;  2FHD A;  1VQ4 Q;  2Z0W A;  4FL6 A;  2DZ9 A;  1WQ7 A;  1AWW A;  3EG2 A;  1SPK A;  1RAG B;  1M27 C;  3N5B B;  4C8Q D;  3A1P A;  1U06 A;  1YJ9 A;  4KUD K;  1SRL A;  1K1Z A;  3M55 A;  2G3R A;  1OYX A;  2QQB A;  1RI9 A;  5LJ5 h;  1BKB A;  4M78 G;  4PLI A;  2AIR B;  4C5I A;  3OYA A;  2KSS A;  2DRK A;  1XTD A;  3PVL A;  2NUT A;  3J80 E;  5KYX A;  3OY9 A;  3VS1 A;  2LP5 A;  3OW2 A;  1IHV A;  1XOV A;  2KNB B;  3PIP A;  4IIM A;  1TUC A;  4J6W A;  4NS5 A;  4MZT A;  3JB9 D;  2E10 A;  2NUT B;  2YLC A;  3LLR A;  5KYX B;  5IHK A;  5M9O A;  3X24 B;  2CH4 A;  5GAM e;  2V8J A;  5IHI A;  4LDX A;  1JXO A;  1K73 U;  2EVR A;  2CZ1 B;  1QCO A;  1I4K 1;  1Q82 R;  3EG0 A;  4ELY C;  2E6Z A;  2X35 A;  2JN0 A;  3NPF A;  5GAN j;  2HQH A;  1WFW A;  1LNX A;  3VUB A;  4M7A E;  3VS7 A;  4DEX A;  2DXT A;  3CD6 T;  5FU6 C;  3D7S B;  1M9S A;  2NLU A;  4QVZ A;  1BB9 A;  4ZNX A;  4RG8 A;  2QAZ A;  3REB B;  2FO0 A;  2LJ0 A;  2HSE B;  1VQP T;  4ELZ C;  4V2S A;  4HT9 A;  4UC4 A;  1K73 C;  3AHU A;  1QVG A;  1KQ2 A;  2E65 A;  5LL6 S;  3DB3 A;  1RAH B;  4PJO C;  1R0B G;  5GMK i;  1VQ6 T;  2KY9 A;  3QZ5 B;  4EMK C;  4J9C A;  2HNI A;  2COZ A;  3G71 A;  1N9S A;  4OMO A;  2V26 A;  2OTJ Q;  2E5K A;  3OYN A;  3QO3 A;  2MWO A;  4FIB A;  2HEQ A;  3OS5 A;  4C92 G;  1W4S A;  2CZ7 B;  5CKD A;  2PVO B;  4D8K A;  1HK9 A;  4HA8 A;  1YJ9 Q;  2I0N A;  1AEY A;  1IGQ A;  1PG5 B;  1N9R A;  2RI3 A;  3VRY A;  2QTX A;  1U3O A;  4RTY A;  2DF6 A;  2K9G A;  2DER A;  1PHT A;  2MWP A;  1JO8 A;  2CH4 W;  3QWX X;  2QYZ A;  5HKC A;  1MHN A;  2EYQ A;  1YJW Q;  2ED1 A;  2DVJ A;  2HBW A;  1KQ1 A;  1VQO A;  3A8L B;  4M78 F;  2PU9 B;  1KG1 A;  5GAN f;  3AT1 B;  1VQ5 T;  2LDM A;  5LJ5 d;  1ZHI A;  2D8J A;  4IUQ A;  2HL5 C;  2C06 A;  4ANJ A;  2MK5 A;  1W70 A;  1X2K A;  4Y91 A;  3TSW A;  2W0Z A;  5HK0 A;  4QKU A;  5CKB A;  3P8B B;  2GTO A;  2D9T A;  1D1C A;  1H3Z A;  2RK2 A;  1RAF B;  3EG1 A;  3LX7 A;  4A4F A;  2RQV A;  2O9V A;  3GOX A;  1RAB B;  3MJX A;  2BE9 B;  2JOY A;  2R57 A;  4LUE A;  1T0H A;  2ZPG B;  3RER A;  1BI1 A;  2WSF E;  4QVD A;  1Q86 U;  5GAO m;  4HKE A;  1UGS B;  2GBQ A;  4ZTJ A;  1PRM C;  2QI2 A;  2C0T A;  1GXI E;  2X9H A;  3G7Z A;  5CQX A;  3CC2 T;  2DA9 A;  2CP2 A;  2DBM A;  2O01 E;  2K57 A;  2XG8 D;  2P84 A;  4F17 A;  3LW5 E;  3OQ5 A;  5HY6 A;  2OX7 A;  4C5H A;  1WYX A;  1D3B B;  2SEM A;  1JB0 E;  4M7D C;  3H0H A;  2CKK A;  3NTH A;  4M75 A;  3G71 Q;  1YFN A;  2V8K A;  3BFM A;  3CBP A;  3LYI A;  2ROL A;  4R55 A;  1KC8 U;  3S3N A;  2GQI A;  2KYM A;  3A5Z B;  2P0K A;  4M75 B;  1TXQ A;  4M7D G;  1UGR B;  1BBZ A;  2EYZ A;  1RAC B;  4IUU A;  5FU7 C;  2XD0 A;  4PL6 A;  5DLO A;  2EFI A;  3I56 T;  3OYJ A;  4MZM A;  4B9W A;  2X4X A;  4C8Q G;  1XQH A;  4F7U F;  3GBQ A;  1WQW A;  4C92 F;  1C1A A;  3R6O A;  1NEB A;  1LOJ A;  2L3S A;  1JXM A;  2OI3 A;  2JTM A;  3EFS A;  1JQQ A;  2BZ8 A;  3RES A; 
#chains in the Genus database with same CATH homology
 2AZV A;  2K6D A;  1E6G A;  3VS0 A;  2LJ1 A;  4CC7 A;  2A08 A;  2JT4 A;  1IO6 A;  3RBB B;  1N5Z A;  1M3B A;  2YUQ A;  4AFQ C;  2K2M A;  1ZUK A;  2K7A A;  1QCF A;  3KFV A;  2PZ1 A;  1VYU A;  2YUO A;  2JS0 A;  2MOX A;  2ED0 A;  4WCI A;  5IH2 A;  1I1J A;  4OMQ A;  1AVZ C;  4JJB A;  1RUW A;  1QKW A;  3UA6 A;  2LCS A;  3VS4 A;  4LNP A;  2ENM A;  1G83 A;  2J6F A;  2CT4 A;  2KEA A;  1UDL A;  2BZY A;  4OMP A;  2KE9 A;  3VS5 A;  1AWJ A;  2LQN A;  1VYT A;  2EW3 A;  2DRM A;  2EBP A;  1A0N B;  1WXT A;  3NMZ C;  2PTK A;  1NLP C;  1HSQ A;  2LZ6 B;  1K0S A;  4AG1 C;  1AWX A;  2OAW A;  2YT6 A;  1W6X A;  2J05 A;  1T3L A;  4RTW A;  1ABO A;  1B3Q A;  2M0Y A;  2EYX A;  4HVV A;  2ABL A;  2JMA A;  2DX1 A;  1UHC A;  1OPL A;  4F16 A;  1NEG A;  1MUZ A;  2RNA A;  4JZ4 A;  4CC2 A;  2V1R A;  1UUE A;  2L0A A;  5GJV B;  1YWP A;  1HJD A;  2C0O A;  3I5R A;  1ZX6 A;  1ARK A;  2FEI A;  3QWY A;  3A98 A;  2AKK A;  1S1N A;  2KXC A;  3R6N A;  3M0R A;  1QKX A;  3M0S A;  2NWM A;  1UG1 A;  1ZUU A;  2AK5 A;  4J9H A;  2D8H A;  1UE9 A;  1EFN A;  2DBK A;  2JM8 A;  1X6B A;  2HDA A;  4KRT A;  4CC3 A;  1LCK A;  2P4R A;  1YNZ A;  2RQR A;  2CUD A;  2FPF A;  2KXD A;  1YCS B;  2VWF A;  2DL4 A;  3THK A;  2DL8 A;  2LX7 A;  3PE0 A;  4RTZ A;  3REA B;  1X2Q A;  1SEM A;  4HVW A;  4M4Z A;  1UJY A;  4J9G A;  5IHN A;  2J6K A;  4HCK A;  1UGV A;  1RLP C;  4RTT A;  3C0C A;  4AFS C;  4GBQ A;  2KRM A;  2DMO A;  4J9D A;  2LQW A;  4OMM A;  2DYB A;  1SHG A;  1X43 A;  1TG0 A;  2ECZ A;  1ABQ A;  1G2B A;  2A37 A;  3VS3 A;  1PRL C;  2LJ3 A;  2L3Q A;  3JV3 A;  4JPB W;  3TSZ A;  1GCQ A;  2RQT A;  1I07 A;  1V1C A;  2J6O A;  1M8M A;  2FPD A;  1I0C A;  1QWF A;  2JW4 A;  2O88 A;  4HXJ A;  2FRY A;  4JJD A;  3ZL7 C;  2LNH B;  4D8D A;  2W10 A;  5I22 A;  3PVQ A;  5HCK A;  2D0N A;  1QWE A;  2KR3 A;  2KRN A;  1NYG A;  2F2V A;  2FRW A;  1T0J A;  1KIK A;  2X3X D;  4J9E A;  2O2O A;  2HSP A;  2L2P A;  1SHF A;  2J06 A;  3M0T A;  3CQT A;  1B07 A;  3EHQ A;  4JZ3 A;  2YUN A;  1OV3 A;  1WA7 A;  4AFU C;  2KGT A;  3ULR B;  1YN8 A;  4RTX A;  1AWO A;  5FWC A;  1ZSG A;  5FW9 A;  2AZS A;  3O5Z A;  3UF4 A;  5I11 A;  1FMK A;  4ORZ A;  1QLY A;  1UJ0 A;  2DJQ A;  4RTV A;  1CSK A;  2FG0 A;  4F14 A;  1AZE A;  1WXU A;  1WXB A;  2DIL A;  3EG2 A;  1AWW A;  2KT1 A;  1MV3 A;  1SPK A;  1M27 C;  3UAT A;  2CSQ A;  1U06 A;  1SRL A;  1K1Z A;  1RI9 A;  2EKH A;  2KYB A;  1M3A A;  1J3T A;  2EGA A;  3H41 A;  1Y0M A;  2DRK A;  2D1X A;  2C0I A;  3EGU A;  3PVL A;  4J9B A;  3VS1 A;  2LP5 A;  1NLO C;  1CKA A;  1SSH A;  1XOV A;  2KNB B;  1OPK A;  4IIM A;  1TUC A;  2QDL A;  2JM9 A;  2B86 A;  1UTI A;  2JMC A;  1TUD A;  5IHK A;  1JEG A;  2CH4 A;  2LMJ A;  3H0F A;  2DL5 A;  2DNU A;  5IHI A;  1JXO A;  2DE0 X;  2X3W D;  2EVR A;  3EHR A;  5FWB A;  1PNJ A;  1WIE A;  3EG0 A;  1ZLM A;  2XMF A;  4RUG A;  2HCK A;  4AFZ C;  3NPF A;  1RLQ C;  1WFW A;  4RTU A;  2NUZ A;  1PKS A;  1UEC A;  2V1Q A;  4Y92 A;  1AOJ A;  1Z9Z A;  2ROT A;  1WDX A;  3VS7 A;  4DEX A;  4Z8A A;  1Z9Q A;  2F2W A;  2YDL A;  1H8K A;  2BZX A;  1X69 A;  1PWT A;  2J7I A;  1BB9 A;  4ZNX A;  2BTT A;  3REB B;  2FO0 A;  4CC4 B;  1X6G A;  2LJ0 A;  1H3H A;  1K0X A;  1JU5 C;  2FPE A;  2GTJ A;  4LE9 A;  4FSS A;  4ESR A;  2MIO A;  1UHF A;  1E7O A;  1KSW A;  3TVT A;  1K9A A;  1M30 A;  3UA7 A;  2ESW A;  3VS2 A;  2EYW A;  4J9C A;  2CRE A;  2IIM A;  2K3B A;  4OMO A;  2PNI A;  1H92 A;  2CDT A;  2E5K A;  5IXF A;  2EGE A;  2HEQ A;  1GCP A;  4X1V A;  3NGP A;  1WX6 A;  2O9S A;  2EYY A;  4E6R A;  1ZBJ A;  3SHW A;  1ZUY A;  4D8K A;  1X27 A;  2I0N A;  4LUD A;  1AEY A;  2CSI A;  1GBQ A;  4IIO A;  2G6F X;  2DL3 A;  2YUP A;  3VRY A;  1HD3 A;  1U3O A;  4RTY A;  2F2X A;  3VRZ A;  2DF6 A;  2K9G A;  1FYN A;  2KBT A;  1KJW A;  1YWO A;  2AKL A;  1OEB A;  1PHT A;  2CH4 W;  1JO8 A;  1U5S A;  4AG2 C;  3VS6 A;  3QWX X;  1NYF A;  2SRC A;  3H0I A;  3NHN A;  2A28 A;  2KT8 A;  2ED1 A;  2DVJ A;  2HBW A;  2KRS A;  2MCN A;  2GNC A;  2YSQ A;  5L23 A;  3EG3 A;  2DL7 A;  2H8H A;  3LH5 A;  2OJ2 A;  3FJ5 A;  1W1F A;  1K4U S;  4GLM A;  2VVK A;  2D8J A;  4EIK A;  2KRO A;  1UFF A;  1Y57 A;  1W70 A;  2JTE A;  4HVU A;  3IQL A;  1X2K A;  3TSW A;  2W0Z A;  4JJC A;  2GTO A;  5IXB A;  2A36 A;  2RMO A;  2L3P A;  3EG1 A;  2RQV A;  2O9V A;  4J9I A;  3SEM A;  2VKN A;  4K11 A;  4A63 B;  4QT7 A;  1GCQ C;  4LUE A;  1PKT A;  1T0H A;  4LN2 A;  1GFC A;  1VYV A;  1YP5 A;  2EGC A;  2GBQ A;  1PRM C;  1AZG B;  5GJW B;  1VA7 A;  3M0P A;  4R0K A;  2C0T A;  1T3S A;  2DA9 A;  2DBM A;  1BK2 A;  3M0Q A;  4OML A;  4DEY A;  1M3C A;  1WLP B;  4F17 A;  3M0U A;  1WYX A;  5EC7 A;  2SEM A;  1GRI A;  1SRM A;  2RQU A;  1NG2 A;  3H0H A;  2RF0 A;  1K76 A;  2EQI A;  2RQW A;  4Z88 A;  5ECA A;  1BU1 A;  4OMN A;  2ROL A;  1GBR A;  1WI7 A;  2EPD A;  2DM1 A;  2M51 A;  4Z89 A;  1MV0 B;  3RNJ A;  1E6H A;  2CT3 A;  2JXB A;  2GQI A;  1CKB A;  2KYM A;  3I5S A;  2GGR A;  1OOT A;  2JS2 A;  1BBZ A;  2EYZ A;  1NM7 A;  1KFZ A;  2RN8 A;  1GFD A;  1GL5 A;  1AD5 A;  2O31 A;  2RPN A;  3GBQ A;  3U23 A;  4J9F A;  1NEB A;  2CUB A;  2DLP A;  2L3S A;  1JXM A;  2OI3 A;  3I35 A;  2K79 A;  3I9Q A;  1JQQ A;  2BZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...