2J0AA

Structure of the catalytic domain of mouse manic fringe
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
269
structure length
243
Chain Sequence
ELQLGDIFIAVKTTWAFHRSRLDLLLDTWVSRIRQQTFIFTDSPDERLQERLGPHLVVTQCALSCKMAAEFDAFLVSGLRWFCHVDDDNYVNPKALLQLLKTFPQDRDVYVGKPSLFWFATGGAGFCINRQLALKMVPWASGSHFVDTSALIRLPDDCTVGYIIECKLGGRLQPSPLFHSHLETLQLLGAAQLPEQVTLSYGVFEGKLNVIKLPGPFSHEEDPSRFRSLHCLLYPDTPWCPLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-1,3-N-ACETYLGLUCOSAMINYLTRANSFERASE MANIC FRINGE
publication title Structural Insights Into the Notch-Modifying Glycosyltransferase Fringe
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 75
structure length 243
sequence length 269
ec nomenclature ec 2.4.1.222: O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase.
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02434 Fringe Fringe-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.50 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2j0aA00
2J0AA 2J0BA
chains in the Genus database with same CATH superfamily
3NGWA 2E8BA 1H5RB 1S4NA 3PKQA 4HO6A 2I5KA 3SX5A 5C3DA 1E5KA 2RIXA 3ZF8A 1NQIB 2XMHA 5C36A 5J49A 2YQCA 4DE7A 4ASJA 2VXLA 3Q80A 2QH5A 5HS2A 1O0RA 4Y7FA 2P73A 1JVGA 4B2XA 2WEEA 1JV3A 1LZ7A 5DDVA 3U0XA 5CQMX 1TVYA 1LZ0A 3U2WA 3USQA 1ZJ3A 1GQCA 1HJJA 1H3MA 2Z86A 5EIYA 4Y6NA 1KWSA 1VGZA 1HM9A 1G0RA 1WT1A 1VGTA 5FTVA 5FV9A 4Y64A 1ZCTA 2VSIA 2WVLA 2PGYA 1R7VA 2RJ4A 4B4MA 4FRPA 1ZHJA 2I5EA 2AECA 1QWJA 3SX8A 1V83A 4Y6UA 3SXDA 3U0YA 5C49A 4AYJA 1R82A 4JD0A 3CKOA 5CMIA 5JQQA 4FRQA 1G93A 1G8OA 1SS9A 4B4BA 1H5SC 5C1HA 1G1LA 1R81A 1ZJ1A 3SXAA 1OQMB 2OI7A 4J18A 5CQNX 1INIA 2O1GA 1LL3A 3I0GA 4XWIA 1H5RA 2OI5A 4Y7UA 3JUJA 5CQLX 3U2UA 2AE7A 4EE3A 3V0NA 4JISA 3I0LA 5IFYA 5C4BA 2V0KA 1ZI3A 4FRBA 5C1LA 2X5ZA 1ON6A 4HO8A 3F1YA 1H7HA 2JCKA 4ARWA 3N9WA 3K8EA 1ZCUA 2YC3A 4HG6A 3V0LA 4G3PA 1VZTA 3OH4A 3SXGA 4EEAA 3I0HA 3CKNA 3V91A 4O6NA 5C3AA 2AM5A 3OKRA 3POLA 5FUHA 2FYBA 5CQPA 3V8YA 1JYLA 1FG5N 4KC2A 2MZBA 4EE5A 1FO8A 2W0VA 4IRQA 3PKPA 4D11C 5C4DA 2VSHA 1VZXA 2OI6A 3D8VA 1H7FA 3U2XA 5IDSA 1G95A 1H5SD 4Y7TA 1JYKA 2GGOA 4E1KA 1TW1A 4FRMA 2VFZA 1ZI5A 3CKJA 4B4GA 5EJ1A 2VS3A 1FO9A 3JUKA 4NANA 1LL0A 2PA4A 1MP5A 4D0ZA 1H5SB 2BO4A 2Y4MA 1W57A 3I0CA 3I0IX 3Q4SA 3OC9A 1GA8A 3V8ZA 5C3BA 2ZU9A 1HM8A 4HOCA 1HJLA 1H5TA 1O7QA 2OEGA 4Y7VA 2WE9A 3EE5A 2YQJA 2W0WA 4CJBA 1TW5A 1NWGB 2ICXA 2DPWA 5D91A 2BO6A 2VS4A 2NXVA 1ZJ0A 2Q4JA 5C1GA 2Y4KA 1QGSA 3V0QA 1VH3A 5FU0A 1PZYB 4M4KA 4KPXA 2RJ1A 1I52A 1G9RA 1H4CA 3I0DA 4CJ8A 5CMJA 2WVKA 1LL2A 4KXOA 2PGVA 2Y6PA 1FWYA 1ZJOA 4HO3A 3D98A 2YQSA 4MIXA 1HM0A 4B5BA 2QGIA 2J0BA 2XWLA 3ZGGA 1XHBA 3ZGFA 1MC3A 2RJ7A 5FU8A 1H4DA 1FR9A 2AM3A 3IOHA 4EEGA 1LVWA 4EE4A 4EEMA 2Y7AA 1EZIA 4ZDQA 4HO5A 3U2VA 3V0OA 2A8UA 1G3LA 4LW3A 1R7YA 3SXEA 3OH3A 2X60A 1WT0A 4FRLA 4FROA 1ZI1A 5L6VA 1VH1A 3D5NA 1JVDA 3CKVA 2V0HA 4Y63A 1H7TA 1MP3A 4G3QA 4HO2A 3V0MA 3DJ4A 2O1FA 2OEFA 4B42A 5I1FA 1NHEB 3T7NA 1NKHB 1ZJPA 5CQOA 3RMWA 1H7QA 4KNXA 3PNNA 3V0PA 4DECA 4FQWA 5AJOA 1EYRA 1GQ9A 3SPTA 4C2SA 2RJ8A 2ICYA 1O7OA 2Y4JA 3IOIA 4P00A 4M2BA 2D0JA 2VD4A 4KPZA 2FFUA 2E3DA 2JCOA 3RMVA 2WVMA 5D92A 1ZIZA 2D7RA 5C38A 1VPAA 1G2VA 4EVWA 3I0FA 2I7BA 4AAWA 3I0EA 3ST8A 1K4VA 4G3SA 4FIYA 1IINA 3QVBA 1Z90A 3FOQA 5BXCA 3USRA 2YESA 1H7LA 1INJA 1WVCA 3O3PA 1YROB 4L41C 2J0AA 2AGDA 3JTJA 4G87A 5CMFX 5L6SA 2Z87A 1V82A 1H7GA 4K6RA 3SX3A 5DDTA 2WAWA 5C48A 4KRVA 3SXCA 2FFVA 4HO9A 1FRWA 3CU0A 1VGUA 3U2TA 3IOJA 2FYCB 2UX8A 5FYEA 2O1HA 4KC1A 4Y62A 1V84A 4M2AA 4HCQA 2V0JA 2GGQA 1MP4A 2WGZA 3HL3A 1LZIA 4Y9XA 1GX0A 1TZFA 3OH1A 2XWMA 2P6WA 1IIMA 1O23B 5CMGX 3BCVA 2XMEA 1YP4A 5AJPA 2P72A 1YP2A 3OH2A 1FR8A 3OAMA 4MYBA 5C8RA 4R7PA 4FRHA 5EJZA 4NAIA 1FGXA 4HO0A 1ZCYA 1VM8A 1W55A 3F1CA 3LW6A 4MNDA 1R7XA 4AC3A 1QGQA 3TZTA 2X5SA 1FOAA 1H5SA 3V90A 1ZI4A 3GUEA 4CVHA 1WT2A 3KIAA 4FCEA 3I0KA 2RJ0A 4B2WA 5C4CA 2FY7A 2V0LA 1GWVA 1YP3A 1FXOA 1S4PA 1G97A 1R7TA 1H4EA 1R7UA 2VS5A 1R80A 4ASYA 1HV9A 2VXMA 4B3UA 3SXBA 1NF5B 1G23A 1ON8A 3K8DA 4BQHA 4KT7A 4EEOA 4AYLA 5AJNA 1H7EA 2AESA 2RIYA 4KNRA 5FTSA 2BO8A 1OMXA 2QKXA 4GBPA 2YQHA 3T7OA 2APCA 2PX7A 1NMMB 4KQLA 2RIZA 2FYAA 2ZU7A 3TQDA 5C4FA 1FZWA 1QG8A 2RJ9A 1VGWA 4CJCA 4M28A 2YC5A 4O6MA 4P02A 3DK5A 1ZJ2A 4Y7GA 1S4OA 2FYDB 4FRAA 2D7IA 1H5TB 5IDTA 2RJ5A 1OMZA 3E25A 1LZJA 2RITA 1VICA 4NALA 3BRKX 1ZDGA 4D0TA 4ECMA 3R3IA 2JCLA 4D11A 2Y4LA 3Q7UA 2X65A 3ZLKA 2A8WA 1GWWA 1ZDFA 1W77A 4D48A 3DUVA 4BMAA 1WT3A 2V0IA 2RJ6A 1GX4A 1PZTA 4KC4A 3I0JA 3OGZA 2AH9A 4FIXA 4HO4A 3ZLLA 2AM4A 5C4EA 4UEGA 3T7MA 4Q7CA 4YS8A 2YCMA 1FGGA 3OH0A 3CGXA 2ZU8A 2JCJA 4FREA 4IRPA 1ZCVA 3CKQA 2XWNA 4FRDA 1JV1A 1FXJA 4NAKA 3FWWA 4LW6A 1XZ6A 4FCUA 2C0NA 3SX7A 5CMHA 4DDZA 2CU2A 1VZUA 2BO7A 5C47A 3RSBA 2VK9A 3R2WA 1WSZA 3E26A
chains in the Genus database with same CATH topology
3NGWA 2E8BA 1H5RB 1S4NA 3PKQA 4HO6A 2I5KA 3SX5A 5C3DA 1E5KA 2RIXA 3ZF8A 1NQIB 2XMHA 5C36A 5J49A 2YQCA 4DE7A 4ASJA 2VXLA 3Q80A 2QH5A 5HS2A 1O0RA 4Y7FA 2P73A 1JVGA 4B2XA 2WEEA 1JV3A 1LZ7A 5DDVA 3U0XA 5CQMX 1TVYA 1LZ0A 3U2WA 3USQA 1ZJ3A 1GQCA 1HJJA 1H3MA 2Z86A 5EIYA 4Y6NA 1KWSA 1VGZA 1HM9A 1G0RA 1WT1A 1VGTA 5FTVA 5FV9A 4Y64A 1ZCTA 2VSIA 2WVLA 2PGYA 1R7VA 2RJ4A 4B4MA 4FRPA 1ZHJA 2I5EA 2AECA 1QWJA 3SX8A 1V83A 4Y6UA 3SXDA 3U0YA 5C49A 4AYJA 1R82A 4JD0A 3CKOA 5CMIA 5JQQA 4FRQA 1G93A 1G8OA 1SS9A 4B4BA 1H5SC 5C1HA 1G1LA 1R81A 1ZJ1A 3SXAA 1OQMB 2OI7A 4J18A 5CQNX 1INIA 2O1GA 1LL3A 3I0GA 4XWIA 1H5RA 2OI5A 4Y7UA 3JUJA 5CQLX 3U2UA 2AE7A 4EE3A 3V0NA 4JISA 3I0LA 5IFYA 5C4BA 2V0KA 1ZI3A 4FRBA 5C1LA 2X5ZA 1ON6A 4HO8A 3F1YA 1H7HA 2JCKA 4ARWA 3N9WA 3K8EA 1ZCUA 2YC3A 4HG6A 3V0LA 4G3PA 1VZTA 3OH4A 3SXGA 4EEAA 3I0HA 3CKNA 3V91A 4O6NA 5C3AA 2AM5A 3OKRA 3POLA 5FUHA 2FYBA 5CQPA 3V8YA 1JYLA 1FG5N 4KC2A 2MZBA 4EE5A 1FO8A 2W0VA 4IRQA 3PKPA 4D11C 5C4DA 2VSHA 1VZXA 2OI6A 3D8VA 1H7FA 3U2XA 5IDSA 1G95A 1H5SD 4Y7TA 1JYKA 2GGOA 4E1KA 1TW1A 4FRMA 2VFZA 1ZI5A 3CKJA 4B4GA 5EJ1A 2VS3A 1FO9A 3JUKA 4NANA 1LL0A 2PA4A 1MP5A 4D0ZA 1H5SB 2BO4A 2Y4MA 1W57A 3I0CA 3I0IX 3Q4SA 3OC9A 1GA8A 3V8ZA 5C3BA 2ZU9A 1HM8A 4HOCA 1HJLA 1H5TA 1O7QA 2OEGA 4Y7VA 2WE9A 3EE5A 2YQJA 2W0WA 4CJBA 1TW5A 1NWGB 2ICXA 2DPWA 5D91A 2BO6A 2VS4A 2NXVA 1ZJ0A 2Q4JA 5C1GA 2Y4KA 1QGSA 3V0QA 1VH3A 5FU0A 1PZYB 4M4KA 4KPXA 2RJ1A 1I52A 1G9RA 1H4CA 3I0DA 4CJ8A 5CMJA 2WVKA 1LL2A 4KXOA 2PGVA 2Y6PA 1FWYA 1ZJOA 4HO3A 3D98A 2YQSA 4MIXA 1HM0A 4B5BA 2QGIA 2J0BA 2XWLA 3ZGGA 1XHBA 3ZGFA 1MC3A 2RJ7A 5FU8A 1H4DA 1FR9A 2AM3A 3IOHA 4EEGA 1LVWA 4EE4A 4EEMA 2Y7AA 1EZIA 4ZDQA 4HO5A 3U2VA 3V0OA 2A8UA 1G3LA 4LW3A 1R7YA 3SXEA 3OH3A 2X60A 1WT0A 4FRLA 4FROA 1ZI1A 5L6VA 1VH1A 3D5NA 1JVDA 3CKVA 2V0HA 4Y63A 1H7TA 1MP3A 4G3QA 4HO2A 3V0MA 3DJ4A 2O1FA 2OEFA 4B42A 5I1FA 1NHEB 3T7NA 1NKHB 1ZJPA 5CQOA 3RMWA 1H7QA 4KNXA 3PNNA 3V0PA 4DECA 4FQWA 5AJOA 1EYRA 1GQ9A 3SPTA 4C2SA 2RJ8A 2ICYA 1O7OA 2Y4JA 3IOIA 4P00A 4M2BA 2D0JA 2VD4A 4KPZA 2FFUA 2E3DA 2JCOA 3RMVA 2WVMA 5D92A 1ZIZA 2D7RA 5C38A 1VPAA 1G2VA 4EVWA 3I0FA 2I7BA 4AAWA 3I0EA 3ST8A 1K4VA 4G3SA 4FIYA 1IINA 3QVBA 1Z90A 3FOQA 5BXCA 3USRA 2YESA 1H7LA 1INJA 1WVCA 3O3PA 1YROB 4L41C 2J0AA 2AGDA 3JTJA 4G87A 5CMFX 5L6SA 2Z87A 1V82A 1H7GA 4K6RA 3SX3A 5DDTA 2WAWA 5C48A 4KRVA 3SXCA 2FFVA 4HO9A 1FRWA 3CU0A 1VGUA 3U2TA 3IOJA 2FYCB 2UX8A 5FYEA 2O1HA 4KC1A 4Y62A 1V84A 4M2AA 4HCQA 2V0JA 2GGQA 1MP4A 2WGZA 3HL3A 1LZIA 4Y9XA 1GX0A 1TZFA 3OH1A 2XWMA 2P6WA 1IIMA 1O23B 5CMGX 3BCVA 2XMEA 1YP4A 5AJPA 2P72A 1YP2A 3OH2A 1FR8A 3OAMA 4MYBA 5C8RA 4R7PA 4FRHA 5EJZA 4NAIA 1FGXA 4HO0A 1ZCYA 1VM8A 1W55A 3F1CA 3LW6A 4MNDA 1R7XA 4AC3A 1QGQA 3TZTA 2X5SA 1FOAA 1H5SA 3V90A 1ZI4A 3GUEA 4CVHA 1WT2A 3KIAA 4FCEA 3I0KA 2RJ0A 4B2WA 5C4CA 2FY7A 2V0LA 1GWVA 1YP3A 1FXOA 1S4PA 1G97A 1R7TA 1H4EA 1R7UA 2VS5A 1R80A 4ASYA 1HV9A 2VXMA 4B3UA 3SXBA 1NF5B 1G23A 1ON8A 3K8DA 4BQHA 4KT7A 4EEOA 4AYLA 5AJNA 1H7EA 2AESA 2RIYA 4KNRA 5FTSA 2BO8A 1OMXA 2QKXA 4GBPA 2YQHA 3T7OA 2APCA 2PX7A 1NMMB 4KQLA 2RIZA 2FYAA 2ZU7A 3TQDA 5C4FA 1FZWA 1QG8A 2RJ9A 1VGWA 4CJCA 4M28A 2YC5A 4O6MA 4P02A 3DK5A 1ZJ2A 4Y7GA 1S4OA 2FYDB 4FRAA 2D7IA 1H5TB 5IDTA 2RJ5A 1OMZA 3E25A 1LZJA 2RITA 1VICA 4NALA 3BRKX 1ZDGA 4D0TA 4ECMA 3R3IA 2JCLA 4D11A 2Y4LA 3Q7UA 2X65A 3ZLKA 2A8WA 1GWWA 1ZDFA 1W77A 4D48A 3DUVA 4BMAA 1WT3A 2V0IA 2RJ6A 1GX4A 1PZTA 4KC4A 3I0JA 3OGZA 2AH9A 4FIXA 4HO4A 3ZLLA 2AM4A 5C4EA 4UEGA 3T7MA 4Q7CA 4YS8A 2YCMA 1FGGA 3OH0A 3CGXA 2ZU8A 2JCJA 4FREA 4IRPA 1ZCVA 3CKQA 2XWNA 4FRDA 1JV1A 1FXJA 4NAKA 3FWWA 4LW6A 1XZ6A 4FCUA 2C0NA 3SX7A 5CMHA 4DDZA 2CU2A 1VZUA 2BO7A 5C47A 3RSBA 2VK9A 3R2WA 1WSZA 3E26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0A A;  2J0B A; 
#chains in the Genus database with same CATH topology
 3NGW A;  2E8B A;  1H5R B;  1S4N A;  3PKQ A;  4HO6 A;  2I5K A;  3SX5 A;  5C3D A;  1E5K A;  2RIX A;  3ZF8 A;  1NQI B;  2XMH A;  5C36 A;  5J49 A;  2YQC A;  4DE7 A;  4ASJ A;  2VXL A;  3Q80 A;  2QH5 A;  5HS2 A;  1O0R A;  4Y7F A;  2P73 A;  1JVG A;  4B2X A;  2WEE A;  1JV3 A;  1LZ7 A;  5DDV A;  3U0X A;  5CQM X;  1TVY A;  1LZ0 A;  3U2W A;  3USQ A;  1ZJ3 A;  1GQC A;  1HJJ A;  1H3M A;  2Z86 A;  5EIY A;  4Y6N A;  1KWS A;  1VGZ A;  1HM9 A;  1G0R A;  1WT1 A;  1VGT A;  5FTV A;  5FV9 A;  4Y64 A;  1ZCT A;  2VSI A;  2WVL A;  2PGY A;  1R7V A;  2RJ4 A;  4B4M A;  4FRP A;  1ZHJ A;  2I5E A;  2AEC A;  1QWJ A;  3SX8 A;  1V83 A;  4Y6U A;  3SXD A;  3U0Y A;  5C49 A;  4AYJ A;  1R82 A;  4JD0 A;  3CKO A;  5CMI A;  5JQQ A;  4FRQ A;  1G93 A;  1G8O A;  1SS9 A;  4B4B A;  1H5S C;  5C1H A;  1G1L A;  1R81 A;  1ZJ1 A;  3SXA A;  1OQM B;  2OI7 A;  4J18 A;  5CQN X;  1INI A;  2O1G A;  1LL3 A;  3I0G A;  4XWI A;  1H5R A;  2OI5 A;  4Y7U A;  3JUJ A;  5CQL X;  3U2U A;  2AE7 A;  4EE3 A;  3V0N A;  4JIS A;  3I0L A;  5IFY A;  5C4B A;  2V0K A;  1ZI3 A;  4FRB A;  5C1L A;  2X5Z A;  1ON6 A;  4HO8 A;  3F1Y A;  1H7H A;  2JCK A;  4ARW A;  3N9W A;  3K8E A;  1ZCU A;  2YC3 A;  4HG6 A;  3V0L A;  4G3P A;  1VZT A;  3OH4 A;  3SXG A;  4EEA A;  3I0H A;  3CKN A;  3V91 A;  4O6N A;  5C3A A;  2AM5 A;  3OKR A;  3POL A;  5FUH A;  2FYB A;  5CQP A;  3V8Y A;  1JYL A;  1FG5 N;  4KC2 A;  2MZB A;  4EE5 A;  1FO8 A;  2W0V A;  4IRQ A;  3PKP A;  4D11 C;  5C4D A;  2VSH A;  1VZX A;  2OI6 A;  3D8V A;  1H7F A;  3U2X A;  5IDS A;  1G95 A;  1H5S D;  4Y7T A;  1JYK A;  2GGO A;  4E1K A;  1TW1 A;  4FRM A;  2VFZ A;  1ZI5 A;  3CKJ A;  4B4G A;  5EJ1 A;  2VS3 A;  1FO9 A;  3JUK A;  4NAN A;  1LL0 A;  2PA4 A;  1MP5 A;  4D0Z A;  1H5S B;  2BO4 A;  2Y4M A;  1W57 A;  3I0C A;  3I0I X;  3Q4S A;  3OC9 A;  1GA8 A;  3V8Z A;  5C3B A;  2ZU9 A;  1HM8 A;  4HOC A;  1HJL A;  1H5T A;  1O7Q A;  2OEG A;  4Y7V A;  2WE9 A;  3EE5 A;  2YQJ A;  2W0W A;  4CJB A;  1TW5 A;  1NWG B;  2ICX A;  2DPW A;  5D91 A;  2BO6 A;  2VS4 A;  2NXV A;  1ZJ0 A;  2Q4J A;  5C1G A;  2Y4K A;  1QGS A;  3V0Q A;  1VH3 A;  5FU0 A;  1PZY B;  4M4K A;  4KPX A;  2RJ1 A;  1I52 A;  1G9R A;  1H4C A;  3I0D A;  4CJ8 A;  5CMJ A;  2WVK A;  1LL2 A;  4KXO A;  2PGV A;  2Y6P A;  1FWY A;  1ZJO A;  4HO3 A;  3D98 A;  2YQS A;  4MIX A;  1HM0 A;  4B5B A;  2QGI A;  2J0B A;  2XWL A;  3ZGG A;  1XHB A;  3ZGF A;  1MC3 A;  2RJ7 A;  5FU8 A;  1H4D A;  1FR9 A;  2AM3 A;  3IOH A;  4EEG A;  1LVW A;  4EE4 A;  4EEM A;  2Y7A A;  1EZI A;  4ZDQ A;  4HO5 A;  3U2V A;  3V0O A;  2A8U A;  1G3L A;  4LW3 A;  1R7Y A;  3SXE A;  3OH3 A;  2X60 A;  1WT0 A;  4FRL A;  4FRO A;  1ZI1 A;  5L6V A;  1VH1 A;  3D5N A;  1JVD A;  3CKV A;  2V0H A;  4Y63 A;  1H7T A;  1MP3 A;  4G3Q A;  4HO2 A;  3V0M A;  3DJ4 A;  2O1F A;  2OEF A;  4B42 A;  5I1F A;  1NHE B;  3T7N A;  1NKH B;  1ZJP A;  5CQO A;  3RMW A;  1H7Q A;  4KNX A;  3PNN A;  3V0P A;  4DEC A;  4FQW A;  5AJO A;  1EYR A;  1GQ9 A;  3SPT A;  4C2S A;  2RJ8 A;  2ICY A;  1O7O A;  2Y4J A;  3IOI A;  4P00 A;  4M2B A;  2D0J A;  2VD4 A;  4KPZ A;  2FFU A;  2E3D A;  2JCO A;  3RMV A;  2WVM A;  5D92 A;  1ZIZ A;  2D7R A;  5C38 A;  1VPA A;  1G2V A;  4EVW A;  3I0F A;  2I7B A;  4AAW A;  3I0E A;  3ST8 A;  1K4V A;  4G3S A;  4FIY A;  1IIN A;  3QVB A;  1Z90 A;  3FOQ A;  5BXC A;  3USR A;  2YES A;  1H7L A;  1INJ A;  1WVC A;  3O3P A;  1YRO B;  4L41 C;  2J0A A;  2AGD A;  3JTJ A;  4G87 A;  5CMF X;  5L6S A;  2Z87 A;  1V82 A;  1H7G A;  4K6R A;  3SX3 A;  5DDT A;  2WAW A;  5C48 A;  4KRV A;  3SXC A;  2FFV A;  4HO9 A;  1FRW A;  3CU0 A;  1VGU A;  3U2T A;  3IOJ A;  2FYC B;  2UX8 A;  5FYE A;  2O1H A;  4KC1 A;  4Y62 A;  1V84 A;  4M2A A;  4HCQ A;  2V0J A;  2GGQ A;  1MP4 A;  2WGZ A;  3HL3 A;  1LZI A;  4Y9X A;  1GX0 A;  1TZF A;  3OH1 A;  2XWM A;  2P6W A;  1IIM A;  1O23 B;  5CMG X;  3BCV A;  2XME A;  1YP4 A;  5AJP A;  2P72 A;  1YP2 A;  3OH2 A;  1FR8 A;  3OAM A;  4MYB A;  5C8R A;  4R7P A;  4FRH A;  5EJZ A;  4NAI A;  1FGX A;  4HO0 A;  1ZCY A;  1VM8 A;  1W55 A;  3F1C A;  3LW6 A;  4MND A;  1R7X A;  4AC3 A;  1QGQ A;  3TZT A;  2X5S A;  1FOA A;  1H5S A;  3V90 A;  1ZI4 A;  3GUE A;  4CVH A;  1WT2 A;  3KIA A;  4FCE A;  3I0K A;  2RJ0 A;  4B2W A;  5C4C A;  2FY7 A;  2V0L A;  1GWV A;  1YP3 A;  1FXO A;  1S4P A;  1G97 A;  1R7T A;  1H4E A;  1R7U A;  2VS5 A;  1R80 A;  4ASY A;  1HV9 A;  2VXM A;  4B3U A;  3SXB A;  1NF5 B;  1G23 A;  1ON8 A;  3K8D A;  4BQH A;  4KT7 A;  4EEO A;  4AYL A;  5AJN A;  1H7E A;  2AES A;  2RIY A;  4KNR A;  5FTS A;  2BO8 A;  1OMX A;  2QKX A;  4GBP A;  2YQH A;  3T7O A;  2APC A;  2PX7 A;  1NMM B;  4KQL A;  2RIZ A;  2FYA A;  2ZU7 A;  3TQD A;  5C4F A;  1FZW A;  1QG8 A;  2RJ9 A;  1VGW A;  4CJC A;  4M28 A;  2YC5 A;  4O6M A;  4P02 A;  3DK5 A;  1ZJ2 A;  4Y7G A;  1S4O A;  2FYD B;  4FRA A;  2D7I A;  1H5T B;  5IDT A;  2RJ5 A;  1OMZ A;  3E25 A;  1LZJ A;  2RIT A;  1VIC A;  4NAL A;  3BRK X;  1ZDG A;  4D0T A;  4ECM A;  3R3I A;  2JCL A;  4D11 A;  2Y4L A;  3Q7U A;  2X65 A;  3ZLK A;  2A8W A;  1GWW A;  1ZDF A;  1W77 A;  4D48 A;  3DUV A;  4BMA A;  1WT3 A;  2V0I A;  2RJ6 A;  1GX4 A;  1PZT A;  4KC4 A;  3I0J A;  3OGZ A;  2AH9 A;  4FIX A;  4HO4 A;  3ZLL A;  2AM4 A;  5C4E A;  4UEG A;  3T7M A;  4Q7C A;  4YS8 A;  2YCM A;  1FGG A;  3OH0 A;  3CGX A;  2ZU8 A;  2JCJ A;  4FRE A;  4IRP A;  1ZCV A;  3CKQ A;  2XWN A;  4FRD A;  1JV1 A;  1FXJ A;  4NAK A;  3FWW A;  4LW6 A;  1XZ6 A;  4FCU A;  2C0N A;  3SX7 A;  5CMH A;  4DDZ A;  2CU2 A;  1VZU A;  2BO7 A;  5C47 A;  3RSB A;  2VK9 A;  3R2W A;  1WSZ A;  3E26 A; 
#chains in the Genus database with same CATH homology
 3NGW A;  2E8B A;  1H5R B;  1S4N A;  3PKQ A;  4HO6 A;  2I5K A;  3SX5 A;  5C3D A;  1E5K A;  2RIX A;  3ZF8 A;  1NQI B;  2XMH A;  5C36 A;  5J49 A;  2YQC A;  4DE7 A;  4ASJ A;  2VXL A;  3Q80 A;  2QH5 A;  5HS2 A;  1O0R A;  4Y7F A;  2P73 A;  1JVG A;  4B2X A;  2WEE A;  1JV3 A;  1LZ7 A;  5DDV A;  3U0X A;  5CQM X;  1TVY A;  1LZ0 A;  3U2W A;  3USQ A;  1ZJ3 A;  1GQC A;  1HJJ A;  1H3M A;  2Z86 A;  5EIY A;  4Y6N A;  1KWS A;  1VGZ A;  1HM9 A;  1G0R A;  1WT1 A;  1VGT A;  5FTV A;  5FV9 A;  4Y64 A;  1ZCT A;  2VSI A;  2WVL A;  2PGY A;  1R7V A;  2RJ4 A;  4B4M A;  4FRP A;  1ZHJ A;  2I5E A;  2AEC A;  1QWJ A;  3SX8 A;  1V83 A;  4Y6U A;  3SXD A;  3U0Y A;  5C49 A;  4AYJ A;  1R82 A;  4JD0 A;  3CKO A;  5CMI A;  5JQQ A;  4FRQ A;  1G93 A;  1G8O A;  1SS9 A;  4B4B A;  1H5S C;  5C1H A;  1G1L A;  1R81 A;  1ZJ1 A;  3SXA A;  1OQM B;  2OI7 A;  4J18 A;  5CQN X;  1INI A;  2O1G A;  1LL3 A;  3I0G A;  4XWI A;  1H5R A;  2OI5 A;  4Y7U A;  3JUJ A;  5CQL X;  3U2U A;  2AE7 A;  4EE3 A;  3V0N A;  4JIS A;  3I0L A;  5IFY A;  5C4B A;  2V0K A;  1ZI3 A;  4FRB A;  5C1L A;  2X5Z A;  1ON6 A;  4HO8 A;  3F1Y A;  1H7H A;  2JCK A;  4ARW A;  3N9W A;  3K8E A;  1ZCU A;  2YC3 A;  4HG6 A;  3V0L A;  4G3P A;  1VZT A;  3OH4 A;  3SXG A;  4EEA A;  3I0H A;  3CKN A;  3V91 A;  4O6N A;  5C3A A;  2AM5 A;  3OKR A;  3POL A;  5FUH A;  2FYB A;  5CQP A;  3V8Y A;  1JYL A;  1FG5 N;  4KC2 A;  2MZB A;  4EE5 A;  1FO8 A;  2W0V A;  4IRQ A;  3PKP A;  4D11 C;  5C4D A;  2VSH A;  1VZX A;  2OI6 A;  3D8V A;  1H7F A;  3U2X A;  5IDS A;  1G95 A;  1H5S D;  4Y7T A;  1JYK A;  2GGO A;  4E1K A;  1TW1 A;  4FRM A;  2VFZ A;  1ZI5 A;  3CKJ A;  4B4G A;  5EJ1 A;  2VS3 A;  1FO9 A;  3JUK A;  4NAN A;  1LL0 A;  2PA4 A;  1MP5 A;  4D0Z A;  1H5S B;  2BO4 A;  2Y4M A;  1W57 A;  3I0C A;  3I0I X;  3Q4S A;  3OC9 A;  1GA8 A;  3V8Z A;  5C3B A;  2ZU9 A;  1HM8 A;  4HOC A;  1HJL A;  1H5T A;  1O7Q A;  2OEG A;  4Y7V A;  2WE9 A;  3EE5 A;  2YQJ A;  2W0W A;  4CJB A;  1TW5 A;  1NWG B;  2ICX A;  2DPW A;  5D91 A;  2BO6 A;  2VS4 A;  2NXV A;  1ZJ0 A;  2Q4J A;  5C1G A;  2Y4K A;  1QGS A;  3V0Q A;  1VH3 A;  5FU0 A;  1PZY B;  4M4K A;  4KPX A;  2RJ1 A;  1I52 A;  1G9R A;  1H4C A;  3I0D A;  4CJ8 A;  5CMJ A;  2WVK A;  1LL2 A;  4KXO A;  2PGV A;  2Y6P A;  1FWY A;  1ZJO A;  4HO3 A;  3D98 A;  2YQS A;  4MIX A;  1HM0 A;  4B5B A;  2QGI A;  2J0B A;  2XWL A;  3ZGG A;  1XHB A;  3ZGF A;  1MC3 A;  2RJ7 A;  5FU8 A;  1H4D A;  1FR9 A;  2AM3 A;  3IOH A;  4EEG A;  1LVW A;  4EE4 A;  4EEM A;  2Y7A A;  1EZI A;  4ZDQ A;  4HO5 A;  3U2V A;  3V0O A;  2A8U A;  1G3L A;  4LW3 A;  1R7Y A;  3SXE A;  3OH3 A;  2X60 A;  1WT0 A;  4FRL A;  4FRO A;  1ZI1 A;  5L6V A;  1VH1 A;  3D5N A;  1JVD A;  3CKV A;  2V0H A;  4Y63 A;  1H7T A;  1MP3 A;  4G3Q A;  4HO2 A;  3V0M A;  3DJ4 A;  2O1F A;  2OEF A;  4B42 A;  5I1F A;  1NHE B;  3T7N A;  1NKH B;  1ZJP A;  5CQO A;  3RMW A;  1H7Q A;  4KNX A;  3PNN A;  3V0P A;  4DEC A;  4FQW A;  5AJO A;  1EYR A;  1GQ9 A;  3SPT A;  4C2S A;  2RJ8 A;  2ICY A;  1O7O A;  2Y4J A;  3IOI A;  4P00 A;  4M2B A;  2D0J A;  2VD4 A;  4KPZ A;  2FFU A;  2E3D A;  2JCO A;  3RMV A;  2WVM A;  5D92 A;  1ZIZ A;  2D7R A;  5C38 A;  1VPA A;  1G2V A;  4EVW A;  3I0F A;  2I7B A;  4AAW A;  3I0E A;  3ST8 A;  1K4V A;  4G3S A;  4FIY A;  1IIN A;  3QVB A;  1Z90 A;  3FOQ A;  5BXC A;  3USR A;  2YES A;  1H7L A;  1INJ A;  1WVC A;  3O3P A;  1YRO B;  4L41 C;  2J0A A;  2AGD A;  3JTJ A;  4G87 A;  5CMF X;  5L6S A;  2Z87 A;  1V82 A;  1H7G A;  4K6R A;  3SX3 A;  5DDT A;  2WAW A;  5C48 A;  4KRV A;  3SXC A;  2FFV A;  4HO9 A;  1FRW A;  3CU0 A;  1VGU A;  3U2T A;  3IOJ A;  2FYC B;  2UX8 A;  5FYE A;  2O1H A;  4KC1 A;  4Y62 A;  1V84 A;  4M2A A;  4HCQ A;  2V0J A;  2GGQ A;  1MP4 A;  2WGZ A;  3HL3 A;  1LZI A;  4Y9X A;  1GX0 A;  1TZF A;  3OH1 A;  2XWM A;  2P6W A;  1IIM A;  1O23 B;  5CMG X;  3BCV A;  2XME A;  1YP4 A;  5AJP A;  2P72 A;  1YP2 A;  3OH2 A;  1FR8 A;  3OAM A;  4MYB A;  5C8R A;  4R7P A;  4FRH A;  5EJZ A;  4NAI A;  1FGX A;  4HO0 A;  1ZCY A;  1VM8 A;  1W55 A;  3F1C A;  3LW6 A;  4MND A;  1R7X A;  4AC3 A;  1QGQ A;  3TZT A;  2X5S A;  1FOA A;  1H5S A;  3V90 A;  1ZI4 A;  3GUE A;  4CVH A;  1WT2 A;  3KIA A;  4FCE A;  3I0K A;  2RJ0 A;  4B2W A;  5C4C A;  2FY7 A;  2V0L A;  1GWV A;  1YP3 A;  1FXO A;  1S4P A;  1G97 A;  1R7T A;  1H4E A;  1R7U A;  2VS5 A;  1R80 A;  4ASY A;  1HV9 A;  2VXM A;  4B3U A;  3SXB A;  1NF5 B;  1G23 A;  1ON8 A;  3K8D A;  4BQH A;  4KT7 A;  4EEO A;  4AYL A;  5AJN A;  1H7E A;  2AES A;  2RIY A;  4KNR A;  5FTS A;  2BO8 A;  1OMX A;  2QKX A;  4GBP A;  2YQH A;  3T7O A;  2APC A;  2PX7 A;  1NMM B;  4KQL A;  2RIZ A;  2FYA A;  2ZU7 A;  3TQD A;  5C4F A;  1FZW A;  1QG8 A;  2RJ9 A;  1VGW A;  4CJC A;  4M28 A;  2YC5 A;  4O6M A;  4P02 A;  3DK5 A;  1ZJ2 A;  4Y7G A;  1S4O A;  2FYD B;  4FRA A;  2D7I A;  1H5T B;  5IDT A;  2RJ5 A;  1OMZ A;  3E25 A;  1LZJ A;  2RIT A;  1VIC A;  4NAL A;  3BRK X;  1ZDG A;  4D0T A;  4ECM A;  3R3I A;  2JCL A;  4D11 A;  2Y4L A;  3Q7U A;  2X65 A;  3ZLK A;  2A8W A;  1GWW A;  1ZDF A;  1W77 A;  4D48 A;  3DUV A;  4BMA A;  1WT3 A;  2V0I A;  2RJ6 A;  1GX4 A;  1PZT A;  4KC4 A;  3I0J A;  3OGZ A;  2AH9 A;  4FIX A;  4HO4 A;  3ZLL A;  2AM4 A;  5C4E A;  4UEG A;  3T7M A;  4Q7C A;  4YS8 A;  2YCM A;  1FGG A;  3OH0 A;  3CGX A;  2ZU8 A;  2JCJ A;  4FRE A;  4IRP A;  1ZCV A;  3CKQ A;  2XWN A;  4FRD A;  1JV1 A;  1FXJ A;  4NAK A;  3FWW A;  4LW6 A;  1XZ6 A;  4FCU A;  2C0N A;  3SX7 A;  5CMH A;  4DDZ A;  2CU2 A;  1VZU A;  2BO7 A;  5C47 A;  3RSB A;  2VK9 A;  3R2W A;  1WSZ A;  3E26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...