2J0BA

Structure of the catalytic domain of mouse manic fringe in complex with udp and manganese
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
269
structure length
243
Chain Sequence
ELQLGDIFIAVKTTWAFHRSRLDLLLDTWVSRIRQQTFIFTDSPDERLQERLGPHLVVTQCALSCKMAAEFDAFLVSGLRWFCHVDDDNYVNPKALLQLLKTFPQDRDVYVGKPSLFWFATGGAGFCINRQLALKMVPWASGSHFVDTSALIRLPDDCTVGYIIECKLGGRLQPSPLFHSHLETLQLLGAAQLPEQVTLSYGVFEGKLNVIKLPGPFSHEEDPSRFRSLHCLLYPDTPWCPLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-1,3-N-ACETYLGLUCOSAMINYLTRANSFERASE MANIC FRINGE
publication title Structural Insights Into the Notch-Modifying Glycosyltransferase Fringe
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 76
structure length 243
sequence length 269
ec nomenclature ec 2.4.1.222: O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase.
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02434 Fringe Fringe-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.50 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2j0bA00
2J0AA 2J0BA
chains in the Genus database with same CATH superfamily
1S4NA 4NAKA 2RIXA 1YP4A 4YS8A 2YESA 1JV1A 4AYJA 5FU0A 3ZGFA 3OH1A 1G3LA 1JYKA 1WT0A 2AE7A 3SXEA 3T7MA 4KPXA 1H7TA 3Q7UA 5EJZA 5CQPA 4AC3A 4KC4A 2VS3A 2OI5A 2RJ9A 2Y4JA 2BO6A 2XWLA 5FU8A 4BQHA 4KNRA 1VGTA 4C2SA 2RJ1A 1ZI4A 1PZYB 5I1FA 1XHBA 2A8UA 1JVGA 1ON8A 3DUVA 4FRQA 2UX8A 2YC5A 1O0RA 1OQMB 2FFUA 3Q80A 1FR9A 1ZJ2A 3ZLKA 4FIXA 3I0FA 4UEGA 5C1HA 2I7BA 2Y4MA 3GUEA 5C4BA 4IRQA 2OEGA 1H5SA 1G95A 4L41C 1QWJA 5C38A 2OI6A 3TQDA 3V90A 4FRAA 3DK5A 1FXOA 1WSZA 4FRPA 1ZHJA 1FGGA 5FYEA 1GX0A 1HM9A 3RMWA 2Q4JA 2Y6PA 2OEFA 3T7OA 3F1YA 1KWSA 5AJOA 4HO8A 4AYLA 1ZJ1A 4Y62A 2WE9A 3SX8A 4D11C 5DDVA 4MIXA 4B5BA 4B2WA 2YQHA 5FTVA 3BCVA 3ZGGA 1VH3A 1FWYA 2E3DA 3OH4A 4HO3A 2VS4A 4MNDA 5CQMX 1G97A 3CKJA 4Y7VA 3V91A 4M4KA 3V0QA 1MP3A 2RJ8A 1W57A 4KXOA 4O6NA 2YC3A 3ZF8A 3ZLLA 4CJCA 1HJJA 5DDTA 4FRMA 4FRBA 2VSIA 2YQCA 1FGXA 4CVHA 4ZDQA 4B4GA 5CMFX 3OKRA 1H4EA 4CJ8A 3F1CA 2J0AA 4HO4A 3FWWA 5J49A 1FR8A 3BRKX 2JCOA 3CKNA 2PA4A 3U0XA 1NKHB 4EVWA 1EZIA 1LZIA 3PNNA 4GBPA 1H5SC 4IRPA 1HM0A 1GWVA 4HCQA 2VXMA 3U0YA 2W0WA 2O1FA 1ZCTA 1G1LA 3D5NA 4ASJA 4KT7A 1R7UA 5L6SA 5JQQA 1FXJA 3FOQA 1E5KA 2WAWA 3OH3A 1NWGB 2AESA 3I0JA 3V0MA 4FCUA 4NANA 4FREA 3SXAA 1GX4A 3TZTA 5CMGX 1S4PA 3EE5A 4FCEA 5CQLX 1FO9A 3JUJA 5D92A 3V0PA 5C3BA 5FTSA 4HG6A 5D91A 1LL0A 3T7NA 1VICA 2XWNA 1W77A 2V0JA 2PX7A 5CQOA 2QKXA 1NQIB 1VZUA 4HO0A 4P00A 2Y7AA 3HL3A 2PGYA 1W55A 5HS2A 5C4DA 4B4BA 1H5RA 2VK9A 2AH9A 4B4MA 3PKQA 2FY7A 5C1LA 4HO2A 1IIMA 4EE5A 1TZFA 4FROA 5AJNA 1H5SD 1LZ7A 1O23B 2VD4A 4EEAA 3SX5A 2Y4LA 4MYBA 2V0LA 1GQCA 3V0LA 2XMEA 3RSBA 1ZIZA 4Y7TA 4EEGA 4DE7A 2ZU8A 4Y6UA 2RJ6A 2I5KA 2ZU9A 1ZJPA 4HO6A 1LL3A 4M28A 1R7YA 1ZJ3A 4LW3A 1HM8A 1INIA 4Y9XA 2JCKA 3SXBA 2P72A 2AM5A 4LW6A 1NF5B 4Q7CA 5C4CA 1H7GA 1OMXA 1EYRA 3OGZA 2XWMA 4G3SA 3I0EA 1GWWA 4J18A 3E25A 3V0OA 4O6MA 2V0IA 5C1GA 4BMAA 3V0NA 5C49A 3JTJA 1I52A 1OMZA 3OH0A 2WGZA 3SX7A 3USRA 1HV9A 3OC9A 2FYAA 1FRWA 3CKQA 1G23A 2APCA 1H7HA 1FZWA 1TW5A 2DPWA 2WVMA 2ICXA 5C48A 1JV3A 1VGZA 1WT1A 1MP4A 5C36A 5CMJA 3SXDA 2AM3A 4KRVA 1ZI5A 2QGIA 2X5ZA 3V8ZA 2NXVA 2WVLA 5IDTA 3V8YA 3U2XA 4K6RA 2FFVA 2VXLA 2Y4KA 2JCLA 4JD0A 1ZJ0A 1V84A 4Y63A 1VH1A 2Z87A 2RJ4A 4JISA 3K8DA 5CMHA 4Y6NA 2CU2A 3R2WA 5IDSA 3U2UA 3E26A 1JYLA 2BO4A 2I5EA 4KC2A 2BO7A 2C0NA 4FQWA 4HOCA 1H7FA 1TW1A 2V0HA 4Y7UA 3ST8A 4B3UA 1H7QA 4G3PA 1PZTA 1Z90A 1VGWA 2VFZA 3D98A 4XWIA 2WVKA 1R82A 1LZ0A 4EEOA 1S4OA 1NHEB 2RIZA 3IOJA 3U2VA 3JUKA 1H5SB 4Y7FA 1ON6A 3SPTA 2PGVA 1O7OA 3PKPA 5C4FA 1H7LA 4EE4A 4D11A 4M2BA 3U2WA 4ASYA 4M2AA 1QGQA 2OI7A 1QG8A 1ZCYA 1H5TB 2O1HA 2P73A 5EJ1A 1R7XA 4FRLA 3DJ4A 2VS5A 1GQ9A 1ZDFA 2AECA 3Q4SA 1R7TA 1WT3A 1ZCUA 5CMIA 2RITA 1ZI1A 2VSHA 2BO8A 3N9WA 4NALA 1XZ6A 3R3IA 4E1KA 3CKVA 4KPZA 3SXGA 1VGUA 2P6WA 1V82A 3KIAA 2A8WA 3U2TA 1VZTA 2QH5A 5C8RA 2X65A 4FIYA 1H7EA 4G87A 4EE3A 1R80A 1LVWA 1R81A 2FYDB 4HO9A 1SS9A 2YCMA 2W0VA 5CQNX 4CJBA 1G93A 3USQA 4KNXA 1NMMB 3CGXA 5C3DA 3I0IX 3SX3A 3I0KA 1G0RA 2D7IA 1IINA 2YQSA 3I0LA 1H4DA 1YROB 1WVCA 2FYCB 2RIYA 5FUHA 2X5SA 1H4CA 5C47A 4G3QA 1H5TA 4FRDA 1WT2A 2D7RA 2YQJA 1YP2A 2XMHA 2J0BA 4HO5A 4Y64A 2D0JA 3SXCA 3POLA 3D8VA 4FRHA 2ZU7A 4AAWA 1ZDGA 1ZCVA 2RJ0A 3OH2A 5EIYA 1O7QA 2WEEA 3O3PA 5IFYA 3I0GA 5C4EA 4D48A 1VZXA 3I0DA 4ECMA 2AGDA 3CU0A 1R7VA 1G2VA 1INJA 1MC3A 1QGSA 5AJPA 4B2XA 1FO8A 1ZI3A 1TVYA 4KC1A 1GA8A 2JCJA 3I0CA 1ZJOA 4D0TA 1YP3A 2GGOA 1K4VA 5FV9A 2GGQA 4P02A 3QVBA 4R7PA 3I0HA 2FYBA 2X60A 3CKOA 2ICYA 4EEMA 3IOHA 3OAMA 5BXCA 1G8OA 1V83A 3LW6A 4D0ZA 4B42A 4DDZA 2RJ7A 1G9RA 2RJ5A 3RMVA 5L6VA 1H5RB 2AM4A 3NGWA 1FG5N 1VM8A 1JVDA 1VPAA 4Y7GA 2MZBA 4KQLA 2E8BA 4NAIA 5C3AA 3IOIA 4ARWA 3K8EA 2V0KA 4DECA 1LZJA 1H3MA 2O1GA 1LL2A 2Z86A 1FOAA 1MP5A 1HJLA
chains in the Genus database with same CATH topology
1S4NA 4NAKA 2RIXA 1YP4A 4YS8A 2YESA 1JV1A 4AYJA 5FU0A 3ZGFA 3OH1A 1G3LA 1JYKA 1WT0A 2AE7A 3SXEA 3T7MA 4KPXA 1H7TA 3Q7UA 5EJZA 5CQPA 4AC3A 4KC4A 2VS3A 2OI5A 2RJ9A 2Y4JA 2BO6A 2XWLA 5FU8A 4BQHA 4KNRA 1VGTA 4C2SA 2RJ1A 1ZI4A 1PZYB 5I1FA 1XHBA 2A8UA 1JVGA 1ON8A 3DUVA 4FRQA 2UX8A 2YC5A 1O0RA 1OQMB 2FFUA 3Q80A 1FR9A 1ZJ2A 3ZLKA 4FIXA 3I0FA 4UEGA 5C1HA 2I7BA 2Y4MA 3GUEA 5C4BA 4IRQA 2OEGA 1H5SA 1G95A 4L41C 1QWJA 5C38A 2OI6A 3TQDA 3V90A 4FRAA 3DK5A 1FXOA 1WSZA 4FRPA 1ZHJA 1FGGA 5FYEA 1GX0A 1HM9A 3RMWA 2Q4JA 2Y6PA 2OEFA 3T7OA 3F1YA 1KWSA 5AJOA 4HO8A 4AYLA 1ZJ1A 4Y62A 2WE9A 3SX8A 4D11C 5DDVA 4MIXA 4B5BA 4B2WA 2YQHA 5FTVA 3BCVA 3ZGGA 1VH3A 1FWYA 2E3DA 3OH4A 4HO3A 2VS4A 4MNDA 5CQMX 1G97A 3CKJA 4Y7VA 3V91A 4M4KA 3V0QA 1MP3A 2RJ8A 1W57A 4KXOA 4O6NA 2YC3A 3ZF8A 3ZLLA 4CJCA 1HJJA 5DDTA 4FRMA 4FRBA 2VSIA 2YQCA 1FGXA 4CVHA 4ZDQA 4B4GA 5CMFX 3OKRA 1H4EA 4CJ8A 3F1CA 2J0AA 4HO4A 3FWWA 5J49A 1FR8A 3BRKX 2JCOA 3CKNA 2PA4A 3U0XA 1NKHB 4EVWA 1EZIA 1LZIA 3PNNA 4GBPA 1H5SC 4IRPA 1HM0A 1GWVA 4HCQA 2VXMA 3U0YA 2W0WA 2O1FA 1ZCTA 1G1LA 3D5NA 4ASJA 4KT7A 1R7UA 5L6SA 5JQQA 1FXJA 3FOQA 1E5KA 2WAWA 3OH3A 1NWGB 2AESA 3I0JA 3V0MA 4FCUA 4NANA 4FREA 3SXAA 1GX4A 3TZTA 5CMGX 1S4PA 3EE5A 4FCEA 5CQLX 1FO9A 3JUJA 5D92A 3V0PA 5C3BA 5FTSA 4HG6A 5D91A 1LL0A 3T7NA 1VICA 2XWNA 1W77A 2V0JA 2PX7A 5CQOA 2QKXA 1NQIB 1VZUA 4HO0A 4P00A 2Y7AA 3HL3A 2PGYA 1W55A 5HS2A 5C4DA 4B4BA 1H5RA 2VK9A 2AH9A 4B4MA 3PKQA 2FY7A 5C1LA 4HO2A 1IIMA 4EE5A 1TZFA 4FROA 5AJNA 1H5SD 1LZ7A 1O23B 2VD4A 4EEAA 3SX5A 2Y4LA 4MYBA 2V0LA 1GQCA 3V0LA 2XMEA 3RSBA 1ZIZA 4Y7TA 4EEGA 4DE7A 2ZU8A 4Y6UA 2RJ6A 2I5KA 2ZU9A 1ZJPA 4HO6A 1LL3A 4M28A 1R7YA 1ZJ3A 4LW3A 1HM8A 1INIA 4Y9XA 2JCKA 3SXBA 2P72A 2AM5A 4LW6A 1NF5B 4Q7CA 5C4CA 1H7GA 1OMXA 1EYRA 3OGZA 2XWMA 4G3SA 3I0EA 1GWWA 4J18A 3E25A 3V0OA 4O6MA 2V0IA 5C1GA 4BMAA 3V0NA 5C49A 3JTJA 1I52A 1OMZA 3OH0A 2WGZA 3SX7A 3USRA 1HV9A 3OC9A 2FYAA 1FRWA 3CKQA 1G23A 2APCA 1H7HA 1FZWA 1TW5A 2DPWA 2WVMA 2ICXA 5C48A 1JV3A 1VGZA 1WT1A 1MP4A 5C36A 5CMJA 3SXDA 2AM3A 4KRVA 1ZI5A 2QGIA 2X5ZA 3V8ZA 2NXVA 2WVLA 5IDTA 3V8YA 3U2XA 4K6RA 2FFVA 2VXLA 2Y4KA 2JCLA 4JD0A 1ZJ0A 1V84A 4Y63A 1VH1A 2Z87A 2RJ4A 4JISA 3K8DA 5CMHA 4Y6NA 2CU2A 3R2WA 5IDSA 3U2UA 3E26A 1JYLA 2BO4A 2I5EA 4KC2A 2BO7A 2C0NA 4FQWA 4HOCA 1H7FA 1TW1A 2V0HA 4Y7UA 3ST8A 4B3UA 1H7QA 4G3PA 1PZTA 1Z90A 1VGWA 2VFZA 3D98A 4XWIA 2WVKA 1R82A 1LZ0A 4EEOA 1S4OA 1NHEB 2RIZA 3IOJA 3U2VA 3JUKA 1H5SB 4Y7FA 1ON6A 3SPTA 2PGVA 1O7OA 3PKPA 5C4FA 1H7LA 4EE4A 4D11A 4M2BA 3U2WA 4ASYA 4M2AA 1QGQA 2OI7A 1QG8A 1ZCYA 1H5TB 2O1HA 2P73A 5EJ1A 1R7XA 4FRLA 3DJ4A 2VS5A 1GQ9A 1ZDFA 2AECA 3Q4SA 1R7TA 1WT3A 1ZCUA 5CMIA 2RITA 1ZI1A 2VSHA 2BO8A 3N9WA 4NALA 1XZ6A 3R3IA 4E1KA 3CKVA 4KPZA 3SXGA 1VGUA 2P6WA 1V82A 3KIAA 2A8WA 3U2TA 1VZTA 2QH5A 5C8RA 2X65A 4FIYA 1H7EA 4G87A 4EE3A 1R80A 1LVWA 1R81A 2FYDB 4HO9A 1SS9A 2YCMA 2W0VA 5CQNX 4CJBA 1G93A 3USQA 4KNXA 1NMMB 3CGXA 5C3DA 3I0IX 3SX3A 3I0KA 1G0RA 2D7IA 1IINA 2YQSA 3I0LA 1H4DA 1YROB 1WVCA 2FYCB 2RIYA 5FUHA 2X5SA 1H4CA 5C47A 4G3QA 1H5TA 4FRDA 1WT2A 2D7RA 2YQJA 1YP2A 2XMHA 2J0BA 4HO5A 4Y64A 2D0JA 3SXCA 3POLA 3D8VA 4FRHA 2ZU7A 4AAWA 1ZDGA 1ZCVA 2RJ0A 3OH2A 5EIYA 1O7QA 2WEEA 3O3PA 5IFYA 3I0GA 5C4EA 4D48A 1VZXA 3I0DA 4ECMA 2AGDA 3CU0A 1R7VA 1G2VA 1INJA 1MC3A 1QGSA 5AJPA 4B2XA 1FO8A 1ZI3A 1TVYA 4KC1A 1GA8A 2JCJA 3I0CA 1ZJOA 4D0TA 1YP3A 2GGOA 1K4VA 5FV9A 2GGQA 4P02A 3QVBA 4R7PA 3I0HA 2FYBA 2X60A 3CKOA 2ICYA 4EEMA 3IOHA 3OAMA 5BXCA 1G8OA 1V83A 3LW6A 4D0ZA 4B42A 4DDZA 2RJ7A 1G9RA 2RJ5A 3RMVA 5L6VA 1H5RB 2AM4A 3NGWA 1FG5N 1VM8A 1JVDA 1VPAA 4Y7GA 2MZBA 4KQLA 2E8BA 4NAIA 5C3AA 3IOIA 4ARWA 3K8EA 2V0KA 4DECA 1LZJA 1H3MA 2O1GA 1LL2A 2Z86A 1FOAA 1MP5A 1HJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0A A;  2J0B A; 
#chains in the Genus database with same CATH topology
 1S4N A;  4NAK A;  2RIX A;  1YP4 A;  4YS8 A;  2YES A;  1JV1 A;  4AYJ A;  5FU0 A;  3ZGF A;  3OH1 A;  1G3L A;  1JYK A;  1WT0 A;  2AE7 A;  3SXE A;  3T7M A;  4KPX A;  1H7T A;  3Q7U A;  5EJZ A;  5CQP A;  4AC3 A;  4KC4 A;  2VS3 A;  2OI5 A;  2RJ9 A;  2Y4J A;  2BO6 A;  2XWL A;  5FU8 A;  4BQH A;  4KNR A;  1VGT A;  4C2S A;  2RJ1 A;  1ZI4 A;  1PZY B;  5I1F A;  1XHB A;  2A8U A;  1JVG A;  1ON8 A;  3DUV A;  4FRQ A;  2UX8 A;  2YC5 A;  1O0R A;  1OQM B;  2FFU A;  3Q80 A;  1FR9 A;  1ZJ2 A;  3ZLK A;  4FIX A;  3I0F A;  4UEG A;  5C1H A;  2I7B A;  2Y4M A;  3GUE A;  5C4B A;  4IRQ A;  2OEG A;  1H5S A;  1G95 A;  4L41 C;  1QWJ A;  5C38 A;  2OI6 A;  3TQD A;  3V90 A;  4FRA A;  3DK5 A;  1FXO A;  1WSZ A;  4FRP A;  1ZHJ A;  1FGG A;  5FYE A;  1GX0 A;  1HM9 A;  3RMW A;  2Q4J A;  2Y6P A;  2OEF A;  3T7O A;  3F1Y A;  1KWS A;  5AJO A;  4HO8 A;  4AYL A;  1ZJ1 A;  4Y62 A;  2WE9 A;  3SX8 A;  4D11 C;  5DDV A;  4MIX A;  4B5B A;  4B2W A;  2YQH A;  5FTV A;  3BCV A;  3ZGG A;  1VH3 A;  1FWY A;  2E3D A;  3OH4 A;  4HO3 A;  2VS4 A;  4MND A;  5CQM X;  1G97 A;  3CKJ A;  4Y7V A;  3V91 A;  4M4K A;  3V0Q A;  1MP3 A;  2RJ8 A;  1W57 A;  4KXO A;  4O6N A;  2YC3 A;  3ZF8 A;  3ZLL A;  4CJC A;  1HJJ A;  5DDT A;  4FRM A;  4FRB A;  2VSI A;  2YQC A;  1FGX A;  4CVH A;  4ZDQ A;  4B4G A;  5CMF X;  3OKR A;  1H4E A;  4CJ8 A;  3F1C A;  2J0A A;  4HO4 A;  3FWW A;  5J49 A;  1FR8 A;  3BRK X;  2JCO A;  3CKN A;  2PA4 A;  3U0X A;  1NKH B;  4EVW A;  1EZI A;  1LZI A;  3PNN A;  4GBP A;  1H5S C;  4IRP A;  1HM0 A;  1GWV A;  4HCQ A;  2VXM A;  3U0Y A;  2W0W A;  2O1F A;  1ZCT A;  1G1L A;  3D5N A;  4ASJ A;  4KT7 A;  1R7U A;  5L6S A;  5JQQ A;  1FXJ A;  3FOQ A;  1E5K A;  2WAW A;  3OH3 A;  1NWG B;  2AES A;  3I0J A;  3V0M A;  4FCU A;  4NAN A;  4FRE A;  3SXA A;  1GX4 A;  3TZT A;  5CMG X;  1S4P A;  3EE5 A;  4FCE A;  5CQL X;  1FO9 A;  3JUJ A;  5D92 A;  3V0P A;  5C3B A;  5FTS A;  4HG6 A;  5D91 A;  1LL0 A;  3T7N A;  1VIC A;  2XWN A;  1W77 A;  2V0J A;  2PX7 A;  5CQO A;  2QKX A;  1NQI B;  1VZU A;  4HO0 A;  4P00 A;  2Y7A A;  3HL3 A;  2PGY A;  1W55 A;  5HS2 A;  5C4D A;  4B4B A;  1H5R A;  2VK9 A;  2AH9 A;  4B4M A;  3PKQ A;  2FY7 A;  5C1L A;  4HO2 A;  1IIM A;  4EE5 A;  1TZF A;  4FRO A;  5AJN A;  1H5S D;  1LZ7 A;  1O23 B;  2VD4 A;  4EEA A;  3SX5 A;  2Y4L A;  4MYB A;  2V0L A;  1GQC A;  3V0L A;  2XME A;  3RSB A;  1ZIZ A;  4Y7T A;  4EEG A;  4DE7 A;  2ZU8 A;  4Y6U A;  2RJ6 A;  2I5K A;  2ZU9 A;  1ZJP A;  4HO6 A;  1LL3 A;  4M28 A;  1R7Y A;  1ZJ3 A;  4LW3 A;  1HM8 A;  1INI A;  4Y9X A;  2JCK A;  3SXB A;  2P72 A;  2AM5 A;  4LW6 A;  1NF5 B;  4Q7C A;  5C4C A;  1H7G A;  1OMX A;  1EYR A;  3OGZ A;  2XWM A;  4G3S A;  3I0E A;  1GWW A;  4J18 A;  3E25 A;  3V0O A;  4O6M A;  2V0I A;  5C1G A;  4BMA A;  3V0N A;  5C49 A;  3JTJ A;  1I52 A;  1OMZ A;  3OH0 A;  2WGZ A;  3SX7 A;  3USR A;  1HV9 A;  3OC9 A;  2FYA A;  1FRW A;  3CKQ A;  1G23 A;  2APC A;  1H7H A;  1FZW A;  1TW5 A;  2DPW A;  2WVM A;  2ICX A;  5C48 A;  1JV3 A;  1VGZ A;  1WT1 A;  1MP4 A;  5C36 A;  5CMJ A;  3SXD A;  2AM3 A;  4KRV A;  1ZI5 A;  2QGI A;  2X5Z A;  3V8Z A;  2NXV A;  2WVL A;  5IDT A;  3V8Y A;  3U2X A;  4K6R A;  2FFV A;  2VXL A;  2Y4K A;  2JCL A;  4JD0 A;  1ZJ0 A;  1V84 A;  4Y63 A;  1VH1 A;  2Z87 A;  2RJ4 A;  4JIS A;  3K8D A;  5CMH A;  4Y6N A;  2CU2 A;  3R2W A;  5IDS A;  3U2U A;  3E26 A;  1JYL A;  2BO4 A;  2I5E A;  4KC2 A;  2BO7 A;  2C0N A;  4FQW A;  4HOC A;  1H7F A;  1TW1 A;  2V0H A;  4Y7U A;  3ST8 A;  4B3U A;  1H7Q A;  4G3P A;  1PZT A;  1Z90 A;  1VGW A;  2VFZ A;  3D98 A;  4XWI A;  2WVK A;  1R82 A;  1LZ0 A;  4EEO A;  1S4O A;  1NHE B;  2RIZ A;  3IOJ A;  3U2V A;  3JUK A;  1H5S B;  4Y7F A;  1ON6 A;  3SPT A;  2PGV A;  1O7O A;  3PKP A;  5C4F A;  1H7L A;  4EE4 A;  4D11 A;  4M2B A;  3U2W A;  4ASY A;  4M2A A;  1QGQ A;  2OI7 A;  1QG8 A;  1ZCY A;  1H5T B;  2O1H A;  2P73 A;  5EJ1 A;  1R7X A;  4FRL A;  3DJ4 A;  2VS5 A;  1GQ9 A;  1ZDF A;  2AEC A;  3Q4S A;  1R7T A;  1WT3 A;  1ZCU A;  5CMI A;  2RIT A;  1ZI1 A;  2VSH A;  2BO8 A;  3N9W A;  4NAL A;  1XZ6 A;  3R3I A;  4E1K A;  3CKV A;  4KPZ A;  3SXG A;  1VGU A;  2P6W A;  1V82 A;  3KIA A;  2A8W A;  3U2T A;  1VZT A;  2QH5 A;  5C8R A;  2X65 A;  4FIY A;  1H7E A;  4G87 A;  4EE3 A;  1R80 A;  1LVW A;  1R81 A;  2FYD B;  4HO9 A;  1SS9 A;  2YCM A;  2W0V A;  5CQN X;  4CJB A;  1G93 A;  3USQ A;  4KNX A;  1NMM B;  3CGX A;  5C3D A;  3I0I X;  3SX3 A;  3I0K A;  1G0R A;  2D7I A;  1IIN A;  2YQS A;  3I0L A;  1H4D A;  1YRO B;  1WVC A;  2FYC B;  2RIY A;  5FUH A;  2X5S A;  1H4C A;  5C47 A;  4G3Q A;  1H5T A;  4FRD A;  1WT2 A;  2D7R A;  2YQJ A;  1YP2 A;  2XMH A;  2J0B A;  4HO5 A;  4Y64 A;  2D0J A;  3SXC A;  3POL A;  3D8V A;  4FRH A;  2ZU7 A;  4AAW A;  1ZDG A;  1ZCV A;  2RJ0 A;  3OH2 A;  5EIY A;  1O7Q A;  2WEE A;  3O3P A;  5IFY A;  3I0G A;  5C4E A;  4D48 A;  1VZX A;  3I0D A;  4ECM A;  2AGD A;  3CU0 A;  1R7V A;  1G2V A;  1INJ A;  1MC3 A;  1QGS A;  5AJP A;  4B2X A;  1FO8 A;  1ZI3 A;  1TVY A;  4KC1 A;  1GA8 A;  2JCJ A;  3I0C A;  1ZJO A;  4D0T A;  1YP3 A;  2GGO A;  1K4V A;  5FV9 A;  2GGQ A;  4P02 A;  3QVB A;  4R7P A;  3I0H A;  2FYB A;  2X60 A;  3CKO A;  2ICY A;  4EEM A;  3IOH A;  3OAM A;  5BXC A;  1G8O A;  1V83 A;  3LW6 A;  4D0Z A;  4B42 A;  4DDZ A;  2RJ7 A;  1G9R A;  2RJ5 A;  3RMV A;  5L6V A;  1H5R B;  2AM4 A;  3NGW A;  1FG5 N;  1VM8 A;  1JVD A;  1VPA A;  4Y7G A;  2MZB A;  4KQL A;  2E8B A;  4NAI A;  5C3A A;  3IOI A;  4ARW A;  3K8E A;  2V0K A;  4DEC A;  1LZJ A;  1H3M A;  2O1G A;  1LL2 A;  2Z86 A;  1FOA A;  1MP5 A;  1HJL A; 
#chains in the Genus database with same CATH homology
 1S4N A;  4NAK A;  2RIX A;  1YP4 A;  4YS8 A;  2YES A;  1JV1 A;  4AYJ A;  5FU0 A;  3ZGF A;  3OH1 A;  1G3L A;  1JYK A;  1WT0 A;  2AE7 A;  3SXE A;  3T7M A;  4KPX A;  1H7T A;  3Q7U A;  5EJZ A;  5CQP A;  4AC3 A;  4KC4 A;  2VS3 A;  2OI5 A;  2RJ9 A;  2Y4J A;  2BO6 A;  2XWL A;  5FU8 A;  4BQH A;  4KNR A;  1VGT A;  4C2S A;  2RJ1 A;  1ZI4 A;  1PZY B;  5I1F A;  1XHB A;  2A8U A;  1JVG A;  1ON8 A;  3DUV A;  4FRQ A;  2UX8 A;  2YC5 A;  1O0R A;  1OQM B;  2FFU A;  3Q80 A;  1FR9 A;  1ZJ2 A;  3ZLK A;  4FIX A;  3I0F A;  4UEG A;  5C1H A;  2I7B A;  2Y4M A;  3GUE A;  5C4B A;  4IRQ A;  2OEG A;  1H5S A;  1G95 A;  4L41 C;  1QWJ A;  5C38 A;  2OI6 A;  3TQD A;  3V90 A;  4FRA A;  3DK5 A;  1FXO A;  1WSZ A;  4FRP A;  1ZHJ A;  1FGG A;  5FYE A;  1GX0 A;  1HM9 A;  3RMW A;  2Q4J A;  2Y6P A;  2OEF A;  3T7O A;  3F1Y A;  1KWS A;  5AJO A;  4HO8 A;  4AYL A;  1ZJ1 A;  4Y62 A;  2WE9 A;  3SX8 A;  4D11 C;  5DDV A;  4MIX A;  4B5B A;  4B2W A;  2YQH A;  5FTV A;  3BCV A;  3ZGG A;  1VH3 A;  1FWY A;  2E3D A;  3OH4 A;  4HO3 A;  2VS4 A;  4MND A;  5CQM X;  1G97 A;  3CKJ A;  4Y7V A;  3V91 A;  4M4K A;  3V0Q A;  1MP3 A;  2RJ8 A;  1W57 A;  4KXO A;  4O6N A;  2YC3 A;  3ZF8 A;  3ZLL A;  4CJC A;  1HJJ A;  5DDT A;  4FRM A;  4FRB A;  2VSI A;  2YQC A;  1FGX A;  4CVH A;  4ZDQ A;  4B4G A;  5CMF X;  3OKR A;  1H4E A;  4CJ8 A;  3F1C A;  2J0A A;  4HO4 A;  3FWW A;  5J49 A;  1FR8 A;  3BRK X;  2JCO A;  3CKN A;  2PA4 A;  3U0X A;  1NKH B;  4EVW A;  1EZI A;  1LZI A;  3PNN A;  4GBP A;  1H5S C;  4IRP A;  1HM0 A;  1GWV A;  4HCQ A;  2VXM A;  3U0Y A;  2W0W A;  2O1F A;  1ZCT A;  1G1L A;  3D5N A;  4ASJ A;  4KT7 A;  1R7U A;  5L6S A;  5JQQ A;  1FXJ A;  3FOQ A;  1E5K A;  2WAW A;  3OH3 A;  1NWG B;  2AES A;  3I0J A;  3V0M A;  4FCU A;  4NAN A;  4FRE A;  3SXA A;  1GX4 A;  3TZT A;  5CMG X;  1S4P A;  3EE5 A;  4FCE A;  5CQL X;  1FO9 A;  3JUJ A;  5D92 A;  3V0P A;  5C3B A;  5FTS A;  4HG6 A;  5D91 A;  1LL0 A;  3T7N A;  1VIC A;  2XWN A;  1W77 A;  2V0J A;  2PX7 A;  5CQO A;  2QKX A;  1NQI B;  1VZU A;  4HO0 A;  4P00 A;  2Y7A A;  3HL3 A;  2PGY A;  1W55 A;  5HS2 A;  5C4D A;  4B4B A;  1H5R A;  2VK9 A;  2AH9 A;  4B4M A;  3PKQ A;  2FY7 A;  5C1L A;  4HO2 A;  1IIM A;  4EE5 A;  1TZF A;  4FRO A;  5AJN A;  1H5S D;  1LZ7 A;  1O23 B;  2VD4 A;  4EEA A;  3SX5 A;  2Y4L A;  4MYB A;  2V0L A;  1GQC A;  3V0L A;  2XME A;  3RSB A;  1ZIZ A;  4Y7T A;  4EEG A;  4DE7 A;  2ZU8 A;  4Y6U A;  2RJ6 A;  2I5K A;  2ZU9 A;  1ZJP A;  4HO6 A;  1LL3 A;  4M28 A;  1R7Y A;  1ZJ3 A;  4LW3 A;  1HM8 A;  1INI A;  4Y9X A;  2JCK A;  3SXB A;  2P72 A;  2AM5 A;  4LW6 A;  1NF5 B;  4Q7C A;  5C4C A;  1H7G A;  1OMX A;  1EYR A;  3OGZ A;  2XWM A;  4G3S A;  3I0E A;  1GWW A;  4J18 A;  3E25 A;  3V0O A;  4O6M A;  2V0I A;  5C1G A;  4BMA A;  3V0N A;  5C49 A;  3JTJ A;  1I52 A;  1OMZ A;  3OH0 A;  2WGZ A;  3SX7 A;  3USR A;  1HV9 A;  3OC9 A;  2FYA A;  1FRW A;  3CKQ A;  1G23 A;  2APC A;  1H7H A;  1FZW A;  1TW5 A;  2DPW A;  2WVM A;  2ICX A;  5C48 A;  1JV3 A;  1VGZ A;  1WT1 A;  1MP4 A;  5C36 A;  5CMJ A;  3SXD A;  2AM3 A;  4KRV A;  1ZI5 A;  2QGI A;  2X5Z A;  3V8Z A;  2NXV A;  2WVL A;  5IDT A;  3V8Y A;  3U2X A;  4K6R A;  2FFV A;  2VXL A;  2Y4K A;  2JCL A;  4JD0 A;  1ZJ0 A;  1V84 A;  4Y63 A;  1VH1 A;  2Z87 A;  2RJ4 A;  4JIS A;  3K8D A;  5CMH A;  4Y6N A;  2CU2 A;  3R2W A;  5IDS A;  3U2U A;  3E26 A;  1JYL A;  2BO4 A;  2I5E A;  4KC2 A;  2BO7 A;  2C0N A;  4FQW A;  4HOC A;  1H7F A;  1TW1 A;  2V0H A;  4Y7U A;  3ST8 A;  4B3U A;  1H7Q A;  4G3P A;  1PZT A;  1Z90 A;  1VGW A;  2VFZ A;  3D98 A;  4XWI A;  2WVK A;  1R82 A;  1LZ0 A;  4EEO A;  1S4O A;  1NHE B;  2RIZ A;  3IOJ A;  3U2V A;  3JUK A;  1H5S B;  4Y7F A;  1ON6 A;  3SPT A;  2PGV A;  1O7O A;  3PKP A;  5C4F A;  1H7L A;  4EE4 A;  4D11 A;  4M2B A;  3U2W A;  4ASY A;  4M2A A;  1QGQ A;  2OI7 A;  1QG8 A;  1ZCY A;  1H5T B;  2O1H A;  2P73 A;  5EJ1 A;  1R7X A;  4FRL A;  3DJ4 A;  2VS5 A;  1GQ9 A;  1ZDF A;  2AEC A;  3Q4S A;  1R7T A;  1WT3 A;  1ZCU A;  5CMI A;  2RIT A;  1ZI1 A;  2VSH A;  2BO8 A;  3N9W A;  4NAL A;  1XZ6 A;  3R3I A;  4E1K A;  3CKV A;  4KPZ A;  3SXG A;  1VGU A;  2P6W A;  1V82 A;  3KIA A;  2A8W A;  3U2T A;  1VZT A;  2QH5 A;  5C8R A;  2X65 A;  4FIY A;  1H7E A;  4G87 A;  4EE3 A;  1R80 A;  1LVW A;  1R81 A;  2FYD B;  4HO9 A;  1SS9 A;  2YCM A;  2W0V A;  5CQN X;  4CJB A;  1G93 A;  3USQ A;  4KNX A;  1NMM B;  3CGX A;  5C3D A;  3I0I X;  3SX3 A;  3I0K A;  1G0R A;  2D7I A;  1IIN A;  2YQS A;  3I0L A;  1H4D A;  1YRO B;  1WVC A;  2FYC B;  2RIY A;  5FUH A;  2X5S A;  1H4C A;  5C47 A;  4G3Q A;  1H5T A;  4FRD A;  1WT2 A;  2D7R A;  2YQJ A;  1YP2 A;  2XMH A;  2J0B A;  4HO5 A;  4Y64 A;  2D0J A;  3SXC A;  3POL A;  3D8V A;  4FRH A;  2ZU7 A;  4AAW A;  1ZDG A;  1ZCV A;  2RJ0 A;  3OH2 A;  5EIY A;  1O7Q A;  2WEE A;  3O3P A;  5IFY A;  3I0G A;  5C4E A;  4D48 A;  1VZX A;  3I0D A;  4ECM A;  2AGD A;  3CU0 A;  1R7V A;  1G2V A;  1INJ A;  1MC3 A;  1QGS A;  5AJP A;  4B2X A;  1FO8 A;  1ZI3 A;  1TVY A;  4KC1 A;  1GA8 A;  2JCJ A;  3I0C A;  1ZJO A;  4D0T A;  1YP3 A;  2GGO A;  1K4V A;  5FV9 A;  2GGQ A;  4P02 A;  3QVB A;  4R7P A;  3I0H A;  2FYB A;  2X60 A;  3CKO A;  2ICY A;  4EEM A;  3IOH A;  3OAM A;  5BXC A;  1G8O A;  1V83 A;  3LW6 A;  4D0Z A;  4B42 A;  4DDZ A;  2RJ7 A;  1G9R A;  2RJ5 A;  3RMV A;  5L6V A;  1H5R B;  2AM4 A;  3NGW A;  1FG5 N;  1VM8 A;  1JVD A;  1VPA A;  4Y7G A;  2MZB A;  4KQL A;  2E8B A;  4NAI A;  5C3A A;  3IOI A;  4ARW A;  3K8E A;  2V0K A;  4DEC A;  1LZJ A;  1H3M A;  2O1G A;  1LL2 A;  2Z86 A;  1FOA A;  1MP5 A;  1HJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...