2J0SD

The crystal structure of the exon junction complex at 2.2 a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
89
structure length
89
Chain Sequence
PQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-DEPENDENT RNA HELICASE DDX48
publication title The Crystal Structure of the Exon Junction Complex Reveals How It Mantains a Stable Grip on Mrna
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 18
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2006-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2j0sD00
4QU7A 3VF0B 5DDQC 2MQNA 4FXWA 2CPFA 1WEXA 2KVIA 2MJUA 1M5PC 5LJ3Y 3HI9A 5LSOA 1A9NB 2I2YA 1U2FA 2AD9A 1K9MT 1WHXA 2LKZA 4C4WA 2J0QD 1DHMA 1FT8A 1H6KX 3ULHA 3UCUP 2DHAA 1AUDA 2U2FA 2CPZA 3Q2TC 3G71S 1HL6A 2DHGA 2DH9A 4TU7A 2JRSA 1X0FA 1FO1A 2NLWA 2CPYA 2MXYA 1K73T 4C7QA 2BZ2A 1QVFR 2VODA 4Y0FA 1Q86T 4QPTA 5DDPC 1G2EA 4F25A 3BS9A 5FJ4A 3VAJA 2M52A 5EN1A 2NZ4A 2DGXA 3PIPQ 3BO2A 1U1PA 1WTBA 1D8ZA 2QFJA 1WEZA 1UAWA 1L3KA 1UP1A 4RU2A 1N54B 3UD3P 2KRBA 1SJ4P 2WBRA 2OTJS 1WI8A 3UCGA 5IFMA 2YH0A 4UQTA 2MZSA 1DRZA 4ERDA 3NS5A 3UCZP 5IM0A 2DGSA 3BO4A 2CJKA 2RS8A 1R8HA 4QQBA 3CCLS 1UFWA 2F9DA 2D9OA 2DNYA 2F9JA 2CQIA 3UE2A 2J0SD 3IRWP 1VQPS 4P6QA 2MSSA 2HGMA 1XN9A 3CCSS 4TU8A 2HGLA 1YITS 2O3DA 3PIOQ 4F02A 1X4GA 2MHNA 2VOOA 2ADCA 2M7SA 2Q79A 3NNCA 2GO9A 3SXLA 1X4AA 2XS5A 2J8AA 2KH9A 3S8SA 3EX7B 1X4CA 1SXLA 1WF2A 3VAKA 1YJNS 1O0PA 2YKAA 1WHWA 2QA4S 2XNQA 1OIAA 3G6ES 3J7ZT 2LXIA 1P27B 2CQ4A 3CF5Q 3OW2R 2K8GA 1FNXH 1HD1A 5MLCV 1SJFA 3ZZZA 3MD1A 2VOPA 5LXRA 2L41A 1KQSR 4PKDB 2MQMA 2M0GB 5DDOC 5DETA 2DNRA 5LSLA 1M90T 1WF1A 2FHOB 5LJ5Y 2KXFA 2N7CA 2UP1A 2RQCA 2CQCA 4PR6A 2DNKA 2XS7A 2CQBA 2G0CA 3R27A 3FEYB 2CQPA 2DNZA 3VAGA 2MZJA 2RVJA 1YTYA 2MY7A 3HHNB 1VQ4S 3UD4P 2B0GA 2KI2A 1S72S 2F3JA 3NNAA 1QVGR 1HA1A 2KYXA 4OZ1A 2XSFA 2I38A 4LIRA 1WELA 5GMKa 2LA4A 2JVOA 2XS2A 2M8DB 1U1NA 2LXUA 4IO9Q 3P49B 4LJMA 2AYEA 3ZZYA 3MDFA 3Q2SC 3VAMA 5IM0B 2M70A 1NJIT 2N3LA 2DB1A 1VQ7S 3US5A 2KXHA 3N9UC 2X1BA 3MI7X 2CPEA 3LPYA 2DH7A 4Y00A 3VAIA 4V19X 1WF0A 2DNLA 5DDRC 1U6FA 1Q82T 2G1DA 2MQPA 1N8RT 2X1FA 2CQ2A 2CPIA 2X1GA 4W92B 1WWHA 5GVQA 2KRRA 2G4BA 2A3JA 2RUGA 2XNRA 2MZTA 5CA5A 2DK2A 1WI6A 2LEAA 1HD0A 2CQGA 2KM8C 2MKHA 2E5GA 1SJQA 1WHYA 1X4DA 5HL7Q 2K3KA 3VAHA 2CPXA 2D3OR 2DHXA 1FJEB 2FPHX 1YHQS 2OJ3A 2QEXS 2EVZA 3G96A 2ZJPQ 1K8AT 1H2UX 2HYIB 3L3CA 2LA6A 1Q7YT 2M2BA 2M8HA 1D9AA 2MQQA 3TYTA 3R1LA 4TLQA 2CPDA 1H2TZ 2MB0B 2DIVA 3CD6S 2OTLS 2XB2D 1JJHA 4J5OA 2MMYA 3NS6A 2MKJA 1VQ8S 1KOOA 2MKCA 2DNPA 1U1LA 2KXNB 3CCUS 2M88A 3CCMS 4CQ1A 2MQLA 3DXBA 2JX2A 5H1SV 1U6BA 1WEYA 3MD3A 4C0OC 2M9KA 2E5IA 4WIIA 1FHTA 2YTCA 2DGVA 2M4MA 2MY8A 3NMRA 3G4SS 1PO6A 3CC4S 2KG0A 1FJCA 5GAGU 2MGZB 3G8TA 1X4HA 5DM6Q 1U1RA 1KD1T 2CQHA 1UW4A 2FY1A 2ZJQQ 2CQ1A 1SJ3P 1FXLA 5ITHA 2LMIA 4M5DB 3IWNC 3P6YC 2FC8A 3THTA 2X1AA 3U1MA 4CIOA 5JVGQ 1U1MA 3CMAS 1ZZFA 3BEGB 1JJ4A 2U1AA 3CPWR 5CXTA 3CCVS 2CPHA 4Z2XA 3MXHP 1WG1A 2DGQA 2ZJRQ 2CQDA 3UWTA 5GAHU 1DBDA 2EK1A 3CTRA 1VBZA 3MUMP 4WCEQ 2EK6A 2HGNA 2N3OA 2VONA 2KG1A 2JVRA 4IUFA 2KU7A 3SDEA 2MQOA 1IQTA 5D78A 2MGZA 2DNQA 2E44A 2MJNA 1X4BA 1X4EA 4WKRA 3B4MA 3FEXB 2AYBA 5JVHQ 4PRFA 3MUVP 3EGNA 1VC6A 5LXYA 3MOJB 2MKKA 1YI2S 2RRBA 2SXLA 1PGZA 2DISA 3TP2A 5GAEU 3CCJS 2ADBA 1VQ9S 2GHPA 2DGUA 3I56S 1M5OC 1M1KT 1VQ5S 3S6EA 4WFAQ 2LEBA 3VALA 1U1KA 2DITA 2CQ3A 3S7RA 2E5JA 1X5PA 3H2UB 2MSTA 2RQ4A 4LMZA 1URNA 2DHSA 3P5TL 2L08A 1VQLS 4FXVA 1ZH5A 3EGZA 1Q81T 4ZKAA 2CPJA 3CCQS 1M5KC 2MZQA 2HZCA 3G8SA 2PE8A 1H2VZ 3R1HA 1B7FA 3H2VE 1WG4A 2DNOA 2JWNA 1JMTA 3LQVA 2AYGA 4A8XA 1VBYA 2OSRA 3SMZA 1KOHA 4YB1P 5CYJA 2KT5A 3CMES 2RS2A 2DNNA 2LECA 3J7YU 2BOPA 5GADU 4EGLA 3B4DA 3CC7S 3MUTP 5HO4A 3CUNA 2DH8A 4W90B 5DM7Q 1R8PA 2AYMA 2ERRA 2CQ0A 2PEHA 2N82B 1M5VC 2YH1A 1VQ6S 1X5TA 4BS2A 2L9WA 1VQKS 2RT3A 2DGTA 2MZ1A 3JB9k 2MKSA 1P1TA 1VQNS 2DIUA 2MYFA 1OO0B 2J76E 2KN4A 3VAFA 2FC9A 2OSQA 3CC2S 2KHCA 1S79A 2LYVA 2RU3A 3CCES 2DNMA 3DLLQ 3TO8A 3SDEB 1YIJS 1BY9A 2E5HA 1JJ2R 3BO3A 4YOEA 4TU9A 2LCWA 1NO8A 4WF9Q 3V4MA 3CXCR 3CULA 3K0JA 2DGWA 1U1QA 4ED5A 2HVZA 2MKIA 1VC0A 1VQOS 3P3DA 2V94A 2DNGA 1X5OA 1YWXA 2RRAA 1SJRA 1ZZNA 3MURP 4CH1A 1X4FA 3RW6A 1W2BR 2MZRA 3THPA 1U1OA 1VBXA 2OIHA 2D9PA 4U67Q 1WG5A 2DNHA 4YUDA 1X5SA 4IOAQ 4F26A 1OWXA 1F9FA 1NU4A 2DO4A 2KM8B 1N52B 5BJRA 3I55S 1VC5A 1N88A 1CVJA 4WFNQ 1VQMS 2DGOA 2LQ5A 1RK8A 1A7GE 4QU6A 4WFBQ 2YWKA 3G9CA 1FJ7A 1DZ5A 1YJ9S 4OZ0A 2KFYA 1YJWS 1OPIA 2RNEA 4IOCQ 3RW7A 3D2WA 2MPUA 1WHVA 5D77A 4CH0S 3S01A 3CCRS 3NNHA 2DO0A 3U1LA 4UY8T 5IQQA 1RKJA 1KC8T 1QM9A
chains in the Genus database with same CATH superfamily
2QJ3A 4U8YA 4CYUA 1UA1A 1UJ6A 3AB4B 2WB1D 2KVIA 4N76A 2PMWA 3CJSA 1ZPWX 1RZMA 2AD9A 2HS4A 1IR0A 1H6KX 1U2RA 3G71S 2DHGA 2GAGC 2BKPA 5KG5A 1RAFB 4HACA 2MXYA 2BZ2A 3MFIA 3PIPQ 2ASLA 2BE2B 3QIPB 2QLJB 1D8ZA 4ID5B 5LT5A 1L3KA 4KHPJ 4C3KA 3OHAA 4KFBB 2HPUA 3Q83A 2V69A 4C8NA 1RHQB 5IM0A 1T9XA 1Q8IA 4URSA 1QDUB 2BJEA 3IG1B 1EKRA 1XJWB 5LMUF 1JLQB 4TU8A 3FBFA 2O3DA 3HX9A 5HMYA 2F63A 1BQNB 1RHUB 1LKZA 2VOOA 2ZKTA 2BE9B 1X4AA 1TP7A 3SYZA 1WF2A 3TUIC 3HHLD 1FKOB 2V8PA 4ECVA 3G6ES 2QL5B 4RR5A 1P27B 2C28A 4IDKB 2R7XA 3ADAC 1WF1A 5LJ5Y 1S57A 4MIWA 1FJGF 3HMJG 1JLFB 3KYLA 2ZOGA 2JJ4D 2CQPA 2DNZA 2Q3PA 3I6PA 1XIQA 3R8YA 3SBMA 1XR5A 4DV0J 3G6YA 4QIVA 2OD4A 1S72S 3NNAA 1P6TA 3BB5A 2HNYB 2AYEA 3UDVA 4QWCA 3Q2SC 3VAMA 3NGUA 1RAOA 1ELOA 1HI1A 1XC9A 2CWKA 1WDTA 2F65A 3KG1A 1TK5A 4NOHA 5K14B 4EBEA 2VFVA 5FDLA 4AFFA 2X1GA 3OVSA 3HDSA 3HFKA 3TJ9A 4V19J 1WHYA 5CCMA 3I9ZA 3HHEA 4MYUA 4KPYA 5HATA 2FPHX 1YHQS 5IT9Y 2RDIA 2J9DE 4MIAA 3CGIA 2Z2LA 3GR0A 2XYGB 3NMAA 3TYTA 4AL6A 2FZGB 2DIVA 4ZVEA 3O44A 2MKCA 2MTLA 1YZ7A 2GVZB 1HNXF 3DXBA 1EP4A 1WACA 4HDHA 3RB0A 1GQEA 3JTOA 1VJQA 4BDPA 1PSDA 5E3CA 5CABA 1LWFB 3M9NB 2OD6A 5ETLA 2HRUA 4LF7J 2XI2A 1DTQA 3MUMP 3HLUA 2ZWOA 1DQ9A 2KU7A 4OMFG 1S0VA 1RTDB 4ZHRA 3RBXA 1ZYQA 1RWKB 2SXLA 3TP2A 2OPPB 5KFDA 3POTA 4L76A 4BWJA 3T5JA 2PFFB 4R25A 3ZNUA 1X0PA 3BM7A 2J6TA 3FVYA 1VIOA 4BC7A 1JB0C 2DHSA 1TL3B 4EMDA 1FVQA 2ZBPA 2CPJA 1ULRA 2HZCA 3C14A 3R1HA 2W2MP 2KTQA 4NCBA 3JS9A 2FJVA 6AT1B 3T41A 2OAUA 3ILIA 4FF2A 1UWBA 3G82B 3CC7S 5E33A 4KHPF 5H9EJ 2RU9A 2CQ0A 4CLPA 3KLFA 3N4WA 1VQ6S 4U7UD 4BS2A 5CYMA 4K4UA 1G7CB 1KDNA 3W8PA 1O8BA 1VJWA 2DXDA 5KFZA 4O3OA 3C16A 5DZ6A 3CCES 3MM5B 3PJXA 4DU8A 4O0IA 2AJ0A 3ETMA 3M2UB 4OJGA 2IM3A 1VRQC 2HS3A 4M5LA 2QSFA 5EHHA 1AZSB 1LFWA 5DGAA 1S1XB 2GW8A 2RRAA 2OEKA 4ILLA 3AA8A 5D4LA 4KYZA 3EGWB 3ISND 2DRBA 3DLBA 1BWEA 2ACMA 2V8GA 4NLRA 4ALZA 4ED2A 2D9PA 2G0JA 2J9DA 1NUEA 1KTVA 1FKAF 1OWXA 3MHYA 2EEYA 1QTMA 2ZEJA 2ZKUA 4DSKA 3HD2A 5H9FJ 3A12A 3MFHA 1U6ZA 4WFBQ 1WTFA 1DZ5A 5EUHA 3OHBA 1YJWS 4IH5A 3MOZA 2F5GA 5HP1B 3U1LA 2L9NA 4DV0F 2AJ4A 4HH0A 5C25A 2IA6A 3C6TB 2OPQB 4JV0A 4IQXA 1WEXA 3K5LA 1A9NB 4LR9A 2ZC4A 1DHMA 3K5MA 4LQ3A 3BZQA 1HL6A 3VGTA 4C7QA 5H9FK 4EUVA 2A2CA 4RUCA 2BQUA 3FGVA 1TZ0A 5DDPC 1YJ7A 3FBCA 3OUYB 1ROFA 3UD5A 1S6QB 4F4ZA 4ZVQB 4KQZA 1U7LA 1SJ4P 2HWTA 3HHDA 2HHWA 4Q44A 3AH6A 1CS4B 3IS9A 1XWLA 4C8KA 1DRZA 2Y0SD 1OS5A 4YMEA 2QC3A 3G2XA 4KKOB 2EFQA 5KFFA 4KV8A 3UE2A 4KO0A 3E01B 4RL1A 2UZAA 4MKBA 2OELA 1YITS 1B0VA 3TJAA 4QIWD 3VVUA 1SC6A 3S8SA 2EXUA 4Y2KA 4CLKA 4KY3A 3HM9A 3UDLA 2YNHA 2LQBA 2MLYA 1VLYA 2HFVA 1LWXA 5LXRA 1X7VA 4DV3J 3IG1A 3VVTA 2WOMA 5HVGA 2YPZA 4USWA 5F8HA 2G0CA 3M32A 3KK2B 4ES1A 4EBDA 1NKCA 4ZCLA 4NLOA 2YX7A 1Z2ZA 2VU5A 1Y0HA 2CJAA 2PI4A 3MCNA 4IDKA 3K58A 1SJ1A 4LJMA 1UVLA 4OX7A 3J7YI 2DB1A 2VC1A 5M2PA 3WIVA 3DLKA 1JLFA 2POKA 4AYBD 4EZ6A 4DQPA 5B0BA 3KLHA 4OZJA 4ZITA 2E66A 4Q45A 2Z4PA 3UW1A 1FX4A 3IAM9 3GIMA 4UW2A 4C8OA 3RB3A 3TAPA 3DU5A 5HL7Q 4Y28C 5EX0A 5IT4A 4ECZA 5BYSA 2OJ3A 4X64J 1TMMA 2QFIA 3R1LA 2ZNZA 5FIIA 3BKFA 2OTLS 2HZAA 5K14A 2XY7A 4M5GA 1LOUA 1RWMB 2H65B 4C0OC 1DLOA 1NB2A 7FD1A 3OPKA 4O44A 5E3QA 1IXKA 2FJDB 2FYXA 1N0VC 4UUWA 2HFSA 4DXLA 3CMAS 3FK4A 3KLVA 2AX1A 3OL6A 5D6GA 1RWNB 1QUVA 3OFFA 2YNFB 3HK2A 1RT5B 3BSAA 1IKYB 3GZ7A 2N3OA 3FC9A 3OFEA 3IGVA 2J9CA 1CQMA 4AE5A 2E44A 4WP9A 2LU2A 1RWOB 3MUVP 3KDOA 1LWFA 3NEKA 4PXBA 4ENOA 4BLGA 2E1AA 3FEZA 1FE4A 5FLXY 4B3RJ 5J1EB 4ER8A 1U1KA 3AT1B 2E5JA 4IKAA 2BW2A 4RZRA 1V5VA 1CJUB 4UZCA 1RQ0A 3W60A 1IKVB 3QRQA 1FNMA 4Y6IA 1BQXA 2AMCB 3M2RB 4CRJA 3M2VB 2AYGA 3BR8A 1KOHA 2OPPA 3KUHA 2MLZA 2HLTA 1JLBA 1KFSA 4ZVTB 3MEKA 2ERRA 2RF2A 2HAIA 4G65A 3I32A 5I4MA 4O3QA 2CZ4A 2ZH5A 4PQUA 1VQNS 2K1RB 4UOGA 2ZZMA 4DFKA 1KKHA 4JI7J 5K8PA 4DX7A 3DLJA 1Z1ZA 3WIUA 2IMOA 3V81A 3G82A 2AZ1A 2DGWA 2HVHA 2HVZA 2IM0A 5E2QA 4J9PA 2AX0A 3J7Z5 1W2BR 1U1OA 2FIUA 5G0RB 2NUUG 1EJ7L 1J5EJ 3GIIA 4B3TJ 3GFXA 2RMLA 4ECYA 3SSRA 2GVDB 3I55S 4DV3F 1VC5A 3M2UA 2B4PA 4YN3B 4OZ0A 2KFYA 2RNEA 5CZVA 4QWBA 1FWKA 1S1XA 2XQCA 3PEHA 1N4LA 3PACA 2CIMA 2IIHA 5IQQA 2ZITA 4IYQA 1KRPA 2CPFA 2ZVSA 1JK9B 1QY7A 2ZH2A 2I2YA 2WCXA 1Y3JA 4N47A 1DQ8A 2LKZA 2FLLA 1T9UA 4W98A 1VI7A 3DFEA 1K47A 4LRBA 2DPJA 1CJTB 4UOCA 2KHDA 3D66A 3DOKB 1BGXT 1VRUB 1UAWA 4RU2A 3QMQA 5DRKA 2UXBJ 5IFMA 2I8EA 4LF5J 1OY8A 1AA1B 2YXLA 3CNQP 4ZJLA 4X64F 4K4SA 1MNEA 4CO2A 4ZOSA 1KS2A 2J0SD 3N5FA 2DYAA 4B02A 3RTVA 1CLFA 1S6QA 2QGFB 2QE5A 4LBPA 2Q79A 5L8RC 4ZCMA 2UUAJ 2UVRA 1CS4A 1W2IA 4ZCKA 1WHWA 2ATCB 3VQSA 1QSLA 2MKYA 3KLIB 2CG8A 1HD1A 3R5BA 3DDIA 1UVMA 3K17A 1F60B 1NZ8A 3TEHB 2UP1A 1YGYA 3UR3C 2CQBA 4O3PA 1S9FA 4OYBA 2QLWA 1VQ4S 3GTYX 2F3JA 3QATA 1NXIA 3B54A 4HTJA 1F5CA 3VR1A 2LDIA 1WKLA 4G3IA 3V2UC 3PDNA 3BGUA 2C2MB 2D7SA 4FS1A 1VQ7S 2IAJB 4CLLA 4B3RF 1Y10A 3QSIA 2WSEC 5ETTA 4RBUA 3H4DA 3A8EA 2CQ2A 2WVCA 2W01A 1ZM3A 5KFVA 4ZIWA 2W9AA 2EFGA 3TNVA 1Q0NA 5A6PA 4PWDB 2RKIB 1R6YA 2AGPA 2BJ8A 5A76A 2DJWA 3TAQA 3G96A 4DV1J 3T5LA 5KT3A 2MB0B 3CD6S 3BH7B 4F8RA 2DNPA 1U1LA 3AOBA 4JI7F 1IR2A 1WC0A 4K50A 2OPSB 3R5GA 2KG0A 1UW4A 2VZ9A 3R2DJ 3MEDB 4M5DB 4XIUA 1REVB 1AUSL 3CE8A 1T3NA 1NBEB 3CJ2A 1EQMA 2ZJRQ 4LSZB 2UU9J 3KHHA 2QRRA 3R6LB 1J5EF 1L3SA 1TU0B 4B3TF 3MMCA 4IUFA 4NMLA 4UY85 4YB7A 2JEJA 4K59A 4ZLLA 1FFWB 4ZP6A 4F0KA 4ANDA 1RWWB 4N7TA 1S97A 3GV5B 3Q86A 2UUCJ 4WKYA 3BN4A 1GXUA 3ONQA 5F41A 2K7JA 3QAUA 1U48A 2VV5A 2ZNYA 1IKYA 4DL6A 1VQLS 2GMLA 4A46A 1M5KC 2MZQA 3QNWB 3G8SA 5KFKA 1HLWA 5A8WA 2GAHC 2V4QA 1H73A 2RIJA 4EGLA 3TZWA 2QLFB 1VFJA 4C11B 4OHYA 4WWSA 1R8PA 2UXBF 3MR5A 2XZTB 4LF5F 3J7AN 1I6JA 3FQKA 2HWHA 3TUJC 1OO0B 3D0HE 4M5HA 3MAAB 2FVRA 1S79A 4P2SA 1ITPA 3CO0P 3QWPA 1SVDA 1FE0A 4FXDA 1O51A 1RGVA 2QYGA 2LLZA 2JOQA 2HFZA 1HNVA 2WZ1A 5FD1A 2IPOB 4ZCIA 4F04B 2BANB 5LM7E 4JI1J 4WZMA 2UUAF 4TKTA 1X4FA 3DRRB 3R5DA 3THPA 2CKWA 2K1RA 1X8DA 3HFZB 3I82A 4Q7AA 1F9FA 5MAOA 1JLGA 1CVJA 3R9LA 1RK8A 2R7OA 4DFMA 1SCJB 2YWKA 3CCWA 2R7VA 3H98A 4PUOA 5D0EA 1V5IB 4AQYJ 1JWWA 2XMMA 4OV1A 2BKNA 5G0RA 2P2CB 1MWQA 2Z2YB 2J5AA 1HBMB 1FT8A 2PIIA 3UCUP 1G4CA 2GJFA 1FO1A 1MMDA 4EO8A 4CWBA 1KHVA 3HVRA 2DKOB 2HQDA 2PI5A 2WAQD 2M52A 4X4TA 2ROEA 2RSQA 2NZ4A 3BO2A 1U1PA 2RILA 4K0KJ 1QAJA 1WEZA 3LWMA 3BBBA 1S0NA 1WI8A 4Z37A 5GAGI 4C3LA 1OMSA 1SC1B 1S1UB 3PR4A 3DLEA 4WXOA 3LGHA 3J80U 4KIAA 4DV1F 5T7LB 1CJTA 4OYIA 2V2VA 5KOXA 1XN9A 4E98A 2KJVA 1VRUA 4J91A 4F02A 4UOHA 3PW2A 1XNQJ 1HIYA 4GMKA 3H90A 2GCFA 4TY9A 3H5UA 4OYOA 4OHWA 4JV2A 2QA4S 3B82A 2CNKB 3UNGC 3SQGB 2E5LJ 3OLBA 2WVDA 4LRFA 3PJWA 4RNFA 2UU9F 3G87A 4WP3A 3D54A 3ITHA 2XS7A 3LANA 4P2FA 3V6DA 4PYAA 1MN7A 1J27A 4Z7YA 4HT5A 2IA0A 1CJKB 2KYXA 4K4VA 1AB8A 3KJVB 2E9ZA 4QCLA 2W9BB 2EWHA 4QOTA 2XS2A 1U1NA 1NMEB 4IO9Q 4CZCA 2UUCF 1QE1B 1SC4B 1NCLA 5C42B 4A8QA 1U8WA 1XK8A 4I2QB 2OMOA 4A8SA 4CT9A 2ASJA 1RHKB 1QSSA 2B5JB 1U6FA 1N8RT 3CD7A 3QRPA 4RWWA 2XMUA 5BR8J 1S7HA 1WWHA 3BPDA 4WIQA 1QAYA 3JTNA 3M8SA 1JLAB 1VQYA 2GIFA 5JJBA 1SJQA 5KT2A 1TK8A 1GK8A 2K3KA 1H74A 2D41A 3VAHA 2N4CA 1MG7A 4ILRA 3RU0A 4N56A 2IAJA 2XZWA 1Q7LB 4OYZA 2M2BA 3GMGA 4RBVA 1RTIB 2Z57B 1D9DA 5B09A 2AGOA 1Q79A 5LOQA 2ZD1A 1PAEX 2MQLA 3IWXA 2NSBA 2UV8A 4PWDA 2GQCA 3GSDA 3VGVA 2D69A 1KD1T 4NCAA 1Q5YA 4YHHJ 1FXRA 3SV3A 5KFXA 1MLAA 2CDRB 4RLEA 4JI1F 1NHKL 3OBIA 1F9HA 4OYWA 4LBHA 1VRTB 1R8AA 2D3UA 1NRKA 3CTRA 4WCEQ 4TLRA 2OPSA 2QLBB 3TA1A 3X1LB 4X62J 2Q6CA 2ZH8A 1T3OA 4CM0A 3MPDA 4M5DA 3PFOA 5DZ7A 1NSQA 3PHEA 2MKKA 3L7UA 3IRXB 2E7WA 4AQYF 5KFLA 1SI9A 4HEA9 4EU0A 1FDDA 2ZH7A 4FF3A 5AE2A 3OD2A 1H0HB 3CCJS 2UUWA 4LRDA 2R8GA 2DITA 2IVYA 2RQ4A 2DY1A 3GCWP 5ETOA 2R8KA 3PXGa 4X4OA 2Z0GA 2PE8A 1H2VZ 3HF5A 3D0GE 2BACA 1VBYA 3T9ZA 1FTCA 2HWIA 4R8UA 2H4YB 4WYLA 4K0KF 5D3GB 3ZTQA 5HO4A 2YQ1A 3CUNA 2N82B 1SIWB 1U4BA 3G8QA 2DGTA 3W2WA 1LWCA 4OX9J 2MKSA 1P1TA 5KFIA 3WHIA 4USMA 2OSQA 3M6VA 2W2PP 2JZ5A 5F8LA 3SDEB 2BX6A 2E5HA 4D3GA 3FRYA 1U1QA 1Q8LA 1C0UA 1VC0A 2FVSA 1JNRB 4OHZA 1XNQF 2B7CB 4CH1A 3NBPB 5J2NA 4DBQA 1RT2B 4H4KC 4ED7A 3F56A 1X5SA 2ACYA 3KTQA 3B78A 2E5LF 2QV6A 4OX6A 2JNJA 2BJ7A 3SIPB 3W9IA 2BRLA 5I3UA 1VQMS 3NWRA 2IFXA 5A6WA 3D2WA 2CNLB 1WHVA 4ZVFA 5D77A 2BANA 4NE9C 3LAKA 2BYCA 4NLDA 1M1GA 3DRRA 4NASA 4DS5A 3JSBA 4AD6A 2QYCA 4G6VB 3UVJA 4A8FA 3FQLA 2VBYA 3R5AA 2V4JB 2ZZTA 4EZ9A 3OVAA 2B6AB 1QVFR 4WU3A 1NB7A 2FJWA 1NPRA 1TV6B 3W9JA 4U7CA 5BR8F 3QGHA 1RAEB 2HQ3A 2OTJS 4G1QA 1R0AB 4PG8A 5K5MA 4ID8A 3T9NA 2B8QA 1JX4A 1FRMA 1ZA1B 1HQUB 2C2ZB 4DR5J 3KKFA 3EYZA 2F9DA 3DHWC 1TVRB 3OXFA 5D4PA 1F3FA 3TUZC 2B4UA 3NCQA 2YBVA 1X4GA 4QW9A 3BDPA 2AHOB 4H4KA 4NZ6A 2XG8A 3LOUA 3NCPA 2BXJA 4YHHF 3Q89A 2PMHA 3VAKA 1O0PA 1YBAA 2ALYB 1S1UA 2F4FA 2HQGA 5CH7B 5MLCV 4F4WA 1Y11A 2RHQB 2IHR1 4RNNA 1T9WA 5EDWA 2HMIB 4M63A 2HQCA 2DNKA 4RW8B 4CLUA 1U25A 2IVMA 4F3MA 4X62F 3HHNB 1CSJA 2FUG9 4RPFA 5ETNA 1J5OB 3DKDA 4OZ1A 4LF6J 3W1YC 3L95X 1SB6A 2XWYA 3GIKA 2JVOA 2VA3A 3SQGA 1T7PA 1Y9OA 3US5A 4DLGA 2AJ2A 4U96A 2OPRA 2G1DA 3RAXA 1S59A 1S10A 4HYKA 2H4WB 1XMBA 3KJVA 5KTQA 2W9BA 5HK4A 1QE1A 5C42A 1H38A 1RTJA 1MU2A 3LTOA 1Q5VA 2B5JA 3M8WA 3T19A 1UW9A 5BYQA 4OX9F 3CO9A 2H5EA 4I1TA 1X9SA 3H20A 3MMBA 2VKZG 2YTCA 2YKNB 1JLAA 4TYAA 4NA1A 5DM6Q 4DWIA 2XHCA 5K8OA 3A8JA 4CTAA 4YFUA 3JSRA 1SUQA 3GJRB 1U1MA 4C8LA 4RUHA 4NXNJ 4QR2A 3CPWR 1RTIA 2DGQA 4GO7X 2B43A 2EK1A 2ROGA 1PC4A 2KG1A 1RWVB 4OL8A 2DNQA 4L72B 3OT9A 3NAHA 4F4KA 2AYBA 4MTPA 3EPIA 4PRFA 4MYTA 3V6JA 3MOJB 2G2ZA 5J2MB 2RRBA 4CDIA 1FFSB 1EX8A 2EFOA 1RDRA 2XLKA 2H3EB 1NH8A 3LGMA 1VRTA 1C1CB 2CNOB 3QWUA 1ZAXA 1B0PA 1QJHA 4CO1A 3EGZA 2ZBIA 1RYSA 2EG2A 2GGPA 1WC6A 3EXCX 1UZHA 1I3OB 4P73A 5KG1A 1WG4A 4C0HA 4ZN1A 1WSVA 2GNKA 1ZETA 2IRXA 2B9YA 2AWZA 2DNNA 1I1GA 3DM2B 2RAQA 1T95A 1G6BA 2PEHA 3KK1A 1X5TA 2DIUA 2MYFA 2E9RX 1NDLA 4DR5F 3IM9A 5E3AA 3IFEA 2RU3A 3MEGB 2QZ8A 4BBYA 3WBZA 1R89A 3MPUB 1XNRJ 1BY9A 4NA2A 4DQIA 4WF9Q 3HP6A 4KB7A 4A4JA 4KJIA 2RUSA 3R5CA 2A1BA 3HHLB 1DURA 2P9CA 3D3BJ 3GIJA 2BM1A 2E7VA 3HFVA 2OFHX 4DCJB 3NLCA 3JQMA 3V4IB 3AD7C 1BQMB 3I9V9 2C2EA 2N7YA 3U7JA 2X7IA 1RT1B 4IOCQ 4CCHA 2HBYB 4ZVSB 2RJZA 2EFNA 3NBPA 5HN0A 3C15A 1T0TV 5DDQC 1NH7A 4LF6F 3SI8A 3Q2TC 5D4NA 4J90A 1WDDA 4X65J 2R8IA 4Y0FA 4B3OB 3BS9A 2PC6A 4RKUC 3AD9C 2KJWA 1Q53A 1HWIA 1K0VA 3GPAA 3RYLA 4CT8A 1N54B 1RE1B 2ZH6A 1IWAA 4WBFA 1PCAA 2HRYA 4QZVB 2V8VA 4C6AA 2YH0A 3CDEA 1JLEA 1ZAVA 2BA9A 3KWMA 1NPPA 1T11A 2XM3A 3BO4A 1ZBTA 3IM8A 2F1FA 4K5RA 1UFWA 3QJLA 2FLOA 2ZUAA 2F9JA 3PG9A 4WYWA 3RUBL 1KN6A 4P6QA 1NKEA 4H4OA 4I6YA 3MGJA 2BE7D 1H7XA 2LU1A 4NLQA 4RJVA 4W4MA 2J8AA 1HI0P 5IQ6A 2JHEA 1HQUA 4FDFA 5HI7A 4NXNF 2MQMA 1TVRA 1PJ5A 4HLBA 5LSLA 1M90T 5KFGA 3L9ZA 4FN5A 1H72C 5KFCA 3KLEA 1JXLA 2R7WA 2V67A 4MKVA 2XSJB 3OFHA 2XMKA 4H4MB 3CEDA 3GP9A 5B0GA 3JSMA 1S1TA 3C46A 3ZZYA 2BOAA 3MDFA 5GADI 3ZZTA 2ZHBA 5J2PB 2RDJA 4X4PA 1N5QA 4LR7A 4RW8A 2BBEA 3FCHA 2DNLA 2A2DA 1KLMB 5IOLA 4LR8A 2CPIA 4P9SA 2B3TB 4HT7A 4GKKJ 3PV8A 2KRRA 2QMWA 4OI3A 5CA5A 1J5OA 4AXIA 1S76D 2CADA 4HHUA 1RB0A 1ZA2B 3M9OB 1FF2A 2VG7A 3VTIA 1HQEB 4ICLB 1BC6A 4EYIB 5KFNA 2FDNA 3QAEA 2LXFA 2RH3A 4OZ5A 2QN6B 3P4UB 1UVIA 4DV7J 2W7OA 4JP8A 1PYTA 3GB0A 3TQ1A 5HROB 1PIEA 4WIIA 1XNRF 1U1RA 5D15A 4K2JA 2P9EA 2W2NP 2LMIA 1HWJA 1LNQA 3FBBA 4L6V3 4Z2XA 4P10A 8RUCA 4DL0C 1NLKL 3TZYA 4EYHB 3SV4A 3MPWA 2HGNA 2P8IA 1CJVB 3I0SB 1YBTA 3A3PB 4DQQA 2YKNA 5D78A 3H7HB 2R7UA 3W64A 4J9OA 4QYZK 1JLCB 2G9OA 4KSEB 3ZZRA 1LFPA 3IN5A 3KMSA 2GHPA 3FBEA 2BJ1A 4WFAQ 3VALA 3HHLC 1K1SA 2MSTA 2ZVIA 3P5TL 1U45A 3NGSA 2LP4A 4ETXA 7FDRA 4RW4A 1IKXB 4X65F 1OY6A 3TRGA 1HW8A 1RXOB 1N6QA 3SCIE 4PXEA 5FLXU 3J80Y 3AY0A 3H4BA 2LECA 3T1HJ 1F3VA 2DH8A 4W90B 2VKRA 5DM7Q 2G2OA 2HNZA 1F2GA 2NZCA 2YH1A 2FHKA 1C1CA 2B4VA 5M2UA 5LL6d 4P7VA 3PO4A 4R5PA 2KN4A 2W9CB 2FC9A 2C2KB 2UUBJ 3ENQA 3TI0A 4GRSA 4NI2B 2C3UA 5KOWA 1GTEA 1MMLA 1RT6A 3TO8A 5D4OA 4ZPAA 2V8DA 5JMNA 1RHMB 2JFKA 4MKAA 1S4EA 1S6UA 1BD6A 1IR1A 2HHUA 2FLPA 4C8YA 4ECRA 1YWXA 3MURP 1HBUA 2XO6A 2FZCB 1HNIB 2GJIA 2V2ZA 4JI0J 2YKOA 2KM8B 3MEGA 3HHKA 3OXLA 5AXMA 4WXWA 4M5KA 3EM1A 4DV6J 3DOLA 3S01A 3CCRS 4DUYJ 3NY0A 2DO0A 3HHLA 1K1QA 3OV7A 2AZ3A 4MJKA 1RT3A 3V4IA 1V3ZA 3HVWA 4C4WA 2J0QD 2XLJA 4ATNA 2U2FA 1IKWA 2JRSA 3AJ2A 2L3MA 3DDNA 2NLWA 2R2SA 1T03B 1GTHA 1SKRA 1K73T 5EN1A 2NPFA 4GKKF 3LP2A 2EBEA 2VG5B 4JI5J 1S7IA 2JL9A 3SQOP 5IV3A 1VBKA 4NL5A 4NYZA 3PR5B 3AXMA 1I94J 1GXLA 1FD2A 4B3OA 5GAHI 2J7KA 1RACB 1Y4ZB 4DV7F 4I56A 5I3PA 3WC2A 4FPIA 3AXKA 1RSCA 1WORA 5C5JA 2GV1A 3MMAB 3NNCA 1F5AA 2KH9A 3EX7B 2NYIA 2XNQA 2K06A 4OJ1A 3I5CA 2YNGA 3MD1A 4Q0BA 5IWAJ 3EZOA 2YNIB 5A2QU 2HIQA 3RBZA 2R2RA 3MTJA 4ITSA 4Z7CA 3RBDA 2DCLA 2RHSB 3H2LA 1GMUA 3D1HA 2YKMB 2JH3A 3IC1A 4U6PA 2BV3A 1EQ0A 2HBZB 4CNYA 4R0EA 2ASDA 1M0SA 4KE5A 1YRTA 3HJVA 4CI0B 2F40A 4QIFA 3ZC4A 4ZPWR 2GHVC 1NJIT 1GMWA 4IFYA 3W5ZA 4CO4A 4K4WA 1L3UA 5HMXA 1CULB 2MQ8A 2W1BA 4CO5A 5DDRC 1FTRA 1WC5A 5A8RA 2ASYA 1BWVA 1H7WA 4RWXA 3IR6B 3KUGA 3HJFA 2WVBA 2XNRA 2XSJA 2DK2A 3EPGA 2NQPA 5J1NA 3O8WA 2CPXA 2ZBQA 2E1PA 4LRAA 3T1HF 2VPZB 1W7WA 1RYRA 5IT0A 2C2RA 1UCNA 1KVJA 8ATCB 1DAXA 5KFPA 2XB2D 4LSLB 2UUBF 2M88A 3BSCA 2CDQA 4NCGB 2VG6B 1M5HA 4DPXA 2CQ1A 2GX8A 1RTZA 2XLIA 4ZN3A 3M6WA 2AKWB 1HQEA 2J8SA 1RU2A 4IRDA 3WX4A 2HNDB 1I5OB 3UDEA 4JI0F 4B9SA 3Q8PB 2W2OP 2XMTA 5C24B 5HROA 2HW3A 1U8SA 3C6UB 2JVRA 5A8KA 2IMWP 1NNDA 1S48A 4DX5A 3J7A1 5K8MA 3PYDA 4P2MA 3L4BC 1H3DA 4ANCA 4DV6F 4DUYF 3OR2A 1L5UA 5DLFA 4M5NA 4JI6J 4DG1B 2EC0A 1R43A 3TAMB 2QMUB 2KKHA 2KDOA 4X4QA 2DXEA 4M8LA 3H59A 4K5SA 1HHSA 1R0CB 1B4SA 2ZC3A 2AJ1A 3OTOJ 1RUSA 2E29A 1YBUA 4O0NA 1U47A 1VMBA 2AQ4A 4A8MP 2E7XA 3CMQA 2IBKA 5I42B 2DR8A 3CCTA 1U0HA 5ADZA 3Q24A 4J9SA 2PD1A 1C1BB 5HJXA 4F3OA 4J9KA 3M1VB 4JI5F 5SZTA 2RT3A 3I5BA 3MEEA 4DV5J 4FBTA 3W7BA 2B9EA 3ET6B 2LYVA 1I94F 3MMJA 5DO2A 3BH6B 1A6LA 3A3OB 1RA7A 3FFIA 3QYYA 1L3TA 3OFGA 2O67A 4CO3A 4LREA 1RWPB 1HBNA 3W2VA 4ECXA 2MZRA 3H0PA 3DMJB 2EC2A 3VGUA 2DXFA 5IWAF 3RRGA 1R27B 3PJ9A 3QLHB 1KBRA 1RT7B 1NK5A 3GYNA 3PTWA 5KG7A 1S9GB 2QL7B 1KEKA 3D28A 1QM9A 2VQEJ 4QU7A 4DFJA 4FXWA 5D8HB 1M1HA 1LW0A 1HNIA 4YS2A 2VFSA 1M5PC 2MJUA 5LJ3Y 5LSOA 1HARA 2GO8A 3DGPA 2JEFA 4USVA 1BHNA 3ZTRA 2LQ8A 4C0BA 3W65A 3IR7B 3RGIA 1JXVA 4QPTA 3HVTA 2DTJA 3VAJA 2JEGA 1V3SA 5HVFA 3AQOA 3D6HB 5L1IA 1UFKA 3GWCA 4G1PA 4UT4A 2BRKA 2MZSA 4QYRA 3LP1B 1HNWJ 4MFBB 2CJKA 3VGSA 3THVA 1R6VA 1AROP 4QQBA 1NJXA 1T03A 2W25A 3UQSA 3CIZA 1UVNA 5CYQB 3PRVA 2AP6A 1SV5B 4DEZA 2Y1JA 2M7SA 3EMTA 4J9MA 4ZLJA 3HZGA 5HMWA 1YJNS 1RLCL 5ETPA 1OIAA 1JKHB 2CQ4A 5GAEI 5J2QA 4PKDB 2M0GB 1TFYA 2ZDOA 1NSKL 1BXNA 4F0HA 2CJXB 5EWFA 4RW6A 2Z56B 2I6WA 3FEYB 1GNKA 3M8QA 3IP0A 3MMAA 2Y3YA 3UD4P 5L1LA 4LIRA 2EFVA 1ZM9A 1SL0A 1XR7A 2J6SA 3Q22A 4NRTA 4DOZA 2UVVA 1RI7A 1FDBA 1XBWA 2N3LA 1P9QC 4JI6F 2J7UA 5U47A 3RRKA 2BQRA 4IFVA 2CPEA 2VPWB 2Z8QA 1LW2A 2CZVC 4J37A 1ACMB 3DYAA 4XDCA 5CD4H 1C4AA 3OTOF 4W92B 3HT0A 2G4BA 1MN9A 2W4PA 5F8GA 1H98A 3M8PA 3ENVA 4LBIA 4UUXA 4OYAA 2HHVA 1NK6A 2Y8YA 3C66A 2XY5A 1CULA 3K5OA 3NS6A 3I0RB 1TL1A 1VQ8S 1U2CA 2V9KA 1GFWB 3N5BA 4YP3A 2WRMA 2JX2A 5H1SV 1KONA 4EFAC 3MD3A 1RAAB 4PCQA 1NJZA 3FSYA 2E5IA 3CB4A 3KK3A 3TEGA 2PN6A 4B9UA 1SJ3P 3BR9A 2RE1A 5DG7A 2XMJA 4Y2CA 3NS7B 1S12A 5HQMA 3MPVA 1UFLA 3H5YA 5KFSA 3Q23A 1I51B 5DS7A 3RAMA 1D1UA 3D3CJ 3HCXA 1RU1A 1S6PB 4GVBB 5EX3A 1FFGB 2FGOA 5DGBA 2VONA 2IM2A 4Q8FA 4USUA 4IG3B 4NCGA 1IQTA 3AAWB 3QGPA 3GQCA 1IBKJ 2I9SA 2FJEB 4XTTA 1AFIA 1OJ4A 3LUYA 2VQEF 3DRSA 2W8KA 1BUXA 2HNDA 4QBUA 1Y5LB 1TKXB 3UR0A 1SH0A 4LMZA 2VFTA 3B6BA 3C6UA 4RW9A 2L08A 4FXVA 2RQKA 1WOOA 1VHFA 1FDAA 4FPRA 2R3VA 4RW7A 1ZOTA 2KFNA 1IBCB 4PQAA 4WK1A 3J7YU 4LF2A 3Q8UA 3D1QA 5DQIA 4QWDA 3H8YA 3EJMA 4JOUA 4JBCA 1RHRB 1RBOB 4J9RA 3MM7B 2VF3A 1RABB 1HNWF 2YWFA 1Z4UA 1VLOA 1EETB 1KLNA 3H40A 1FEEA 5I42A 2J9EA 1A0OB 1SKWA 1RP5A 3MR6A 2BE2A 3FNNA 3QIPA 4ID5A 1C1BA 4U9RA 1HYSB 1FK9B 2IJFA 3M1VA 4KFBA 2JC1A 2GZOA 2QT7A 3EXYA 3PM9A 2O01C 3RR8A 2DO4A 2ZH4A 4TQRA 4GO5X 4QU6A 2YQ0A 4LF7F 2BMBA 5JUMA 1JLQA 5C2CA 1F9EB 1BQNA 1JXEA 6FDRA 2BR0A 4A8KA 2XMAA 2B8PA 1N5YB 4JV5J 3W5YA 1U02A 2VQFJ 3VF0B 5IC4B 3DMJA 1FKOA 2YX4A 4IR1A 4DF4A 5LMNJ 4DPWA 4QIEA 4TU7A 1AYEA 4NLXA 1S9GA 3VHQA 2HFNA 4F25A 3OL8A 5FJ4A 3CDAA 3BGLA 3KJNB 5E3RA 2PDAA 3NG8A 1O6XA 2NCKL 4NYOA 3D67A 2YX1A 2HNYA 3QFHA 1NK0A 3O2IA 2B56A 1LK5A 2GQQA 1GMVA 1JQGA 2DNYA 3I4HX 2MDAA 1TKZB 3PZPA 2HRTA 3PIOQ 2FB0A 4F50A 3W3SA 2C2DA 1N0UA 1GXTA 1HKAA 2GIQA 1SXLA 2ZHAA 4NWBA 1LQ9A 4HH1A 3R6GB 3GYGA 2FJBB 1NZAA 3BYRA 3LP1A 4NLYA 4MFBA 1Q8KA 3QIDA 1KQSR 2L41A 2AEMA 3HO1A 3QPIA 4J9LA 4I67A 2CJQA 2RQCA 4IO1A 1U49A 2GVZA 4I69A 3R27A 1SV5A 3WZ0A 1IBKF 1KHWA 3RB4A 3GG1A 1JKHA 2CRLA 4Y3CA 1NK8A 2KT2A 4LT6A 5IM0B 4PG6A 4DX6A 5ETMA 2X1BA 5AE3A 3LPYA 2DH7A 1N34J 3L7PA 4V19X 2XO7A 2OP5A 1VHIA 1Q82T 4ILMA 2X51A 2Y8WA 1YRUA 2VDIA 5GVQA 4KRWA 4PAAA 3KFWX 1RTDA 2A6OA 1T9VA 2D3OR 2DHXA 1JNZB 3PFEA 5ETRA 1VCTA 1N32J 3LA0A 3K2YA 5DLGA 2PEBA 4HR2A 2CPDA 3F44A 1SQFA 1VR6A 1TL3A 1NM2A 4J9UE 5IZHA 4HHJA 3LF0A 4KH1B 3MZIA 4C97A 1PAUB 3U1NA 3BPSP 1WEYA 1UPMB 2D3ZA 1PO6A 2W8LA 3CC4S 2ZH9A 3MF5A 2UXDJ 3OQ2A 3THTA 4K8RA 3OTBA 1T9YA 3CCZA 5EGYA 4USTA 3M6UA 1YJRA 2AT1B 4KTQA 1W26A 3BBFA 3R7NB 4ZVGA 4ZMMA 3SFUA 5FDLB 2V9WA 3MM5A 2HHSA 2UV8G 3FEXB 3VQTA 4F0MA 3KHLA 1UL3A 1L3VA 2WVEA 1YI2S 1AZSA 4KR0B 4JV5F 5L1JA 4WE1B 3PVXA 4GC6A 3QRRA 1UZDA 2ADBA 1VQ9S 1SC3B 2VQFF 2DGUA 1M5OC 3KLGB 1N48A 4I7FB 3S7RA 1S6PA 4GVBA 5B7WA 5HANA 5ETVA 4JUZA 5T14A 5LMNF 1HPZB 3M8YA 4CM2A 5F8IA 1RAGB 4YDXA 4CO0A 4I2PB 1TL7B 1EP4B 3LQVA 5LSRA 2B7BB 1BE4A 5HP1A 2BOPA 2HHPA 3C6TA 2OPQA 4LRCA 3PX0A 3A8IA 4YR0A 2VPXB 2OEJA 1RT4B 2W4DA 2V5HG 3VAFA 4Y34A 1DTQB 4YR3A 2CNNB 2KHCA 4ZPDA 2IY5B 4PYDA 2F8MA 3Q0AA 2OHDA 3QT7A 3BO3A 5ETSA 4IRKA 1D9FA 2BJ9A 4UOFA 3OUYA 3WQPA 4DPUA 4Q43A 3V4MA 4ZHRB 5A2QY 3KNGA 4A47A 3DDKA 5C7PA 3POTB 3N28A 1T02A 3OTDA 3RW6A 1PYOB 4B9NA 4U67Q 4IOAQ 2F8HA 4LFAJ 4KKOA 2BJ3A 4U8VA 2NXEA 4LSNB 5AXLA 3HKWA 3E01A 1RISA 2RDDA 3EVWA 2OKQA 3ZTSA 1HYSA 1ZM4A 4NPOA 3NGTA 3I96A 2F4VJ 1VIXA 2MQNA 3KLFB 4AXJA 5CYMB 3FKBA 3A1YG 1AXQA 4I0WA 3ULHA 1VQSA 2LQJA 2CG4A 1N34F 1F0XA 3V6HA 2HVEA 1QSYA 5T41A 3KK2A 4RU9A 4CLTA 4TXSA 5BYRA 4L75A 2OLWA 4Q2LA 3PYEA 4IRCA 5K8NA 3PRDA 1SL2A 2ILYA 2WW4A 1M5SA 3TA2A 1N32F 2L9DA 2ZDPA 4OI6A 1HWUA 3IRWP 3CCSS 2HGLA 2DRAA 3CVKA 3GG0A 4OLPA 4B3SJ 4JI4J 3QJJA 5F9LA 2IM1A 8AT1B 5C25B 3DRXA 4LVNP 3ETOA 2ATLA 5KT7A 2FHJA 2UXDF 1MROB 5AE1A 1NHUA 5KT4A 2HQIA 4KT0C 2JFDA 3E3XA 4LFBJ 1NKBA 2RVJA 1YTYA 4X4NA 1HR0J 3DN9A 1QVGR 2FTRA 3S1TA 5D0HA 3K8VA 3IS9B 3UN5A 3TQEA 5HQLA 5KFOA 1QTNB 1V3RA 4KV8B 2YNFA 4KGXB 1RT5A 2H54B 4KO0B 3MECB 3UI3A 2R9LA 1B3TA 4KGMA 2DHHA 2A3JA 2V2KA 5CD4A 2FJXA 1B0TA 4EEYA 4PPZA 2VC0A 2YNHB 3AJ1A 2VH7A 3PCOB 4NXMJ 3PX6A 2MHEA 5J1EA 1D9AA 1X9WA 3WDOA 3UO0A 2Y1RI 2WOMB 3SSSA 1KOOA 2XEXA 1CJUA 3CCMS 3M32B 1D09B 1IKVA 4L73A 2V6AA 4B08A 2W7PA 2M9KA 5AXNA 3EDQB 1KR4A 1FI4A 1FHTA 4V1Ak 3M2RA 2LVWA 5F3ZA 5GAGU 3M2VA 4AT1B 4AL7A 3J81U 4NLWA 5ITHA 4N5SA 3HXMA 1FXLA 3U27A 2FC8A 3CDWA 2V2QA 3LALA 4DL3A 1WOSA 1LWEB 5CXTA 1WG1A 1GX6A 4O3SA 4F4XA 4GKJJ 3DLKB 4LFAF 1EHWA 3KLHB 1P8GA 2H51B 3ZTPA 2VFUA 3FDSA 4JV1A 2R7TA 2DR7A 1CC7A 4P72A 2BDPA 1NDCA 2F4VF 3FRZA 4DDFA 1HQ2A 2FD2A 3BSNA 2H5JB 2ABYA 5M2RA 1X5PA 4LUBA 1KSPA 1URNA 1D8YA 4ZP9A 1Q95G 2GVDA 4KH0B 4NLTA 3BDEA 1DLOB 2BUNA 1B7FA 4PG4A 4Y2MA 1YK9A 3CJ5A 1JMTA 4O44B 3SFGA 4A8XA 4DCOB 4LF4J 4WE1A 1HI8A 2O1PA 3OJSA 2C42A 4OQJA 3B4DA 4ZIVA 3MUTP 2J0WA 1WC1A 1EKSA 4DSIA 2AYMA 3KLGA 9ATCB 4I7FA 1TUVA 1RHJB 1D3WA 2Q1LA 2J76E 1FKPB 2Z30B 1HPZA 1NAQA 4DQSA 2CJYB 4I2PA 1TL7A 1YIJS 3D6FB 4YOEA 3SCJE 3DLGB 2YY3A 3DOKA 5KFJA 2XBPA 2YKQA 4HI2A 1S4FA 5KFWA 4B3SF 1GX5A 3GU0A 2DNGA 2W2QP 1SH3A 4JI4F 4ECTA 3PW5A 3CW2C 3G6VA 1UVJA 1F1BB 3CDBA 3KJFB 3GJSB 1GMWD 1RT4A 3KHRA 2J6UA 3QJPA 1NU4A 2KT3A 1TELA 2KL8A 3G9CA 1PYSB 2AEFA 1YJ9S 4LFBF 2PA3A 4MT1A 1HR0F 4JYAJ 1JLBB 4KBIA 2ZWPA 1HNZJ 2RF2B 3HI9A 3DI6B 5B0EA 3NCRA 1U2FA 3KLIA 4PQUB 1K9MT 3C3LA 2PFDA 4FVCA 5K9FA 3M4XA 3QGIA 1TQLA 5KFAA 4LSNA 1P9YA 2IRUA 4B9VA 1X0FA 1TAQA 4DSEA 2VODA 2ZE2B 3A13A 4PEOA 3V81B 1U09A 3TARA 4Q2MA 2PO4A 1APSA 5B0DA 2QFJA 2OUGA 4CP5A 1MWZA 4ETZA 4UQTA 3PRBA 2GC8A 4DSLA 1EB0A 4NXMF 1YDLA 1T8EA 1UEKA 4DR6J 4ZP8A 1PJ7A 2FZKB 1R3NA 2HGMA 1DARA 4NLVA 3ILOA 4DUZJ 2V34A 4J9QA 2BM0A 2MHNA 2RKIA 3BQ0A 5H9EK 3H5SA 2OI2A 4EO6A 2V4RA 3F73A 2YWEA 3P8BB 5F3TA 1FNXH 2UUTA 3UNYA 4DZDA 1ZM2A 5DDOC 3MWBA 3CJRA 2R2UA 2C3OA 2KXFA 2N7CA 4GKJF 2OO4A 4TVAB 3ILJA 4F36A 2DR5A 3PYFA 3MEDA 4Y65A 1MROA 1REVA 2QLXA 2QA1A 3GFYA 5L46A 3QQCD 2R8HA 2IYGA 3DNCA 3C8YA 3MI7X 2GFFA 5F8JA 6FD1A 3VCDA 4YB6A 3DCAA 2FHMA 4IQMA 4WFYA 3TUPA 2KZMA 4Y2AA 2E5GA 3FCWA 4LF4F 4P2XA 2EW9A 3GIRA 2XZDB 2WSCC 2HIYA 5IXUA 3WC0A 5CQGA 4K4TA 1IJEB 1H2TZ 5B08A 3OR1B 3RBEA 2XHWA 1YJVA 3MECA 2KB2A 3CCUS 4DR4J 4FF1A 3DHXA 1KTQA 2HK3A 2BW7A 2OH2A 4B9LA 2MY8A 5IS2A 2MGZB 2HEKA 2R4FA 3N01A 3UN2A 4ED4A 4FNHA 3U1MA 4CIOA 4C11A 2DD8S 5L9XA 3HSGA 2NSCA 3M05A 2I1RA 2EPIA 1FD8A 1YZ6A 3ELHA 3MAAA 3ZNJ1 4IG0B 1T9TA 4DV2J 2OGUA 3NAIA 3ZO7A 2ZH1A 4CLYA 3EGNA 1PGZA 1Y00A 1S1VB 4JYAF 1LWEA 2HBRB 4I6AA 4ZPCA 3N6LA 5EWGA 1HNZF 1VQ5S 3S6EA 3UFCX 1NPKA 5IV4A 4USKA 2VJVA 1TUWA 3CCQS 2BJDA 4X4VA 2D3O1 1UTAA 3GONA 4ZDNA 1HWLA 3TJ8A 5DQHA 4ELVA 3AB2B 4I6WA 2PA8D 2ZOFA 2VB6A 3JQJA 3TW0A 4TQSA 3J81j 2OSRA 5CYJA 4LF1A 2A0FB 3M9MB 3NL0A 3FSXA 1QUPA 1M5VC 2RRNA 3PNIA 2HHXA 2EBGA 2BQ3A 3N6NA 1HBMA 3JTPA 4URQU 4QR0A 4FYDA 3MMCB 2WVFA 4DZ6A 5F0UA 3O6QA 3I87A 3B8HA 4DR6F 4OZ2A 1JJ2R 3JSYA 4RO0A 3UPFA 3OTEA 4OI1A 3CULA 2LFVA 3DU6A 4DUZF 3BV8A 1OSCA 3JAMY 1ZZNA 1IWGA 3LW5C 3F0NA 4ELUA 1EAYC 3EWGA 1CPZA 2NXCA 2OIHA 3DRPB 1FKPA 1WG5A 2DNHA 4CLFA 4OHVA 3LP0B 1PKUA 1FXDA 3IWLA 1N52B 4MMOA 4RBTA 1N88A 5T7LA 3FCVA 2DGOA 4C48A 4O4RA 1YX2A 2ZH3A 3DLGA 2Y9HA 5A8WB 2VDHA 2IBOA 3K59A 1WNEA 5DJBA 1MW7A 2AGQA 2CZ9A 4IH6A 1RWXB 1WHXA 1R0BG 3M30B 2EKYA 1AUDA 1SQGA 2DH9A 2B9WA 4FZVA 4ED8A 4QW8A 1HNVB 1FDNA 1AW0A 1HBOB 3BBCA 4F3QA 3HD1A 1CJKA 2VBXA 3IBWA 3DI6A 1UA0A 3MR3A 3BQ1A 2MEWA 4D3HA 4FP9A 2O5DA 3EE3A 1GEHA 4I2QA 4FKXA 1JLGB 4OFZA 1D0EA 3QFWA 2ZE2A 3GSIA 2CQIA 5HAOA 1WC4A 5GMEA 2EFPA 4DR4F 4PUOB 3PEJA 5JXSA 2GO9A 3CJ3A 3PKMA 4HI1A 5E7OB 1E6VB 5CAAA 1QAXA 1Y5NB 4QPXA 3PO5A 1CBKA 1F2HA 4PWUA 1RBAA 3ZZPA 7AT1B 2OEMA 4PABA 2CVIA 3IXQA 1SJFA 2HS0A 3D68A 1SBRA 3GE9A 4MH8A 1LEOA 2K2PA 1WD6A 5ETQA 4C8ZA 3KMQA 1EZZB 4F2SA 3L09A 4ZP7A 3VAGA 1WSRA 4FNIA 3TVZA 5IC6B 4DV2F 1ZAWA 2KI2A 3P96A 4DF8A 3EICA 1DY3A 1XTZA 3NXZA 3T5HA 3BGOP 2LA4A 4F4YA 4ED3A 2NXNA 2EKNA 1R7IA 1URRA 2OMLA 4IOBA 3DLEB 4M94A 3DGVA 2ZHOA 3H42A 2Q43A 4BCAA 4NYPA 2L48A 4F2RA 2X1FA 3KJQB 5GMDA 4ZK7M 3BJYA 2RUGA 3NRBA 3GFZA 4FKYA 1WI6A 4MAKA 3HPOA 2CQGA 2MKHA 5AXKA 2CA9A 2JSXA 3IRXA 1RADB 3ZTOA 1C4CA 5KFRA 1OY9A 2QEXS 1TUGB 2E9TA 1FEHA 2M8HA 3A8KA 3JXOA 2MQQA 2E1MC 3TX0A 1T05B 1DQAA 3ITHB 3ISZA 5F0WA 3TR5A 2QTWA 4ED0A 4K4YA 1R8BA 3V6DB 3E8OA 4KHRA 1X4HA 3ENWA 1KVIA 2AW0A 1QAIA 3H5XA 3P6YC 2QA2A 2X1AA 2F8EX 5D3GA 1PBUA 1WOPA 1FX2A 3RB6A 3RR7A 1JJ4A 2MLXA 4O23A 3CCVS 1SQEA 3Q8VA 2N4DA 2CQDA 3OR1A 3UWTA 4ZLPA 3Q8YA 3SDEA 2MGZA 4M5IA 5C2GA 5KT6A 3NKYA 3QT8A 2DISA 3AA9A 2G1HA 3UDCA 1RT2A 3I56S 1M1KT 4NX9A 4M5MA 1OQ6A 2ZD1B 5E0OA 2QA4G 4LF8J 1KQKA 4IG0A 3TX8A 3WX8A 3H2VE 4A8WA 4K4XA 4MIBA 1REGX 3SMZA 1BMQB 3EVOA 1S77D 1S1VA 3CSKA 3OLAA 3CJQA 5GADU 4H54A 5B0CA 3K57A 3MCMA 1MSWD 4JI2J 5L39A 2L9WA 1XMQJ 2ZUGA 1RAHB 2MZ1A 2XGPA 2W24A 3M8RA 2YWWA 1G3OA 3CC2S 1HFEL 2V4JA 2B6AA 2YQ3A 1S6OA 4L3NA 4K4ZA 3V6KA 2XMVA 2LCWA 1TV6A 3CXCR 2P6TA 4C2MA 3IBFB 3MR2A 3P3DA 1RTHB 5AJ3J 3LWLA 1SJRA 4XDDA 5F8NA 1R0AA 1LK7A 2YVSA 1Y5IB 3SSQA 4KGKA 1IJFB 3T3FA 4XO0A 1N33J 2CXEA 1FERA 4Q8EA 4OYXA 4FBUA 3R5JB 5L1KA 4OI0A 2HVDA 1NSPA 3MCSA 4CH0S 4R8UB 5CHCB 4JB8B 1RKJA 2F7VA 4LFCJ 3DRPA 2XY6A 4B3MJ 3MM6B 3LP0A 4OZ3A 3W2WB 1LWCB 4PZVA 3RZAA 2DHAA 3BGFA 2HMIA 2P5VA 4PXDA 1IM6A 2UXCJ 2RD5C 1G2EA 1C0UB 2JC0A 1ZTWA 5J2NB 9RUBA 4IH7A 5HMZA 1KFDA 1XEZA 4ERDA 2Y1LB 3M30A 4ZLNA 2HSEB 3D1OA 4DV4J 3PW7A 2FVQA 3FZ2A 3J81Y 2NXUA 2D9OA 4NZ0A 5I3UB 2C3PA 2MSSA 4CH7A 4L74A 1VS3A 1HBOA 2CAJA 3TVYA 3SCKE 3KG0A 5E5NA 1X4CA 2O66A 1SIZA 4QYZJ 1RAJA 3UVJB 2LXIA 4DHVA 2QG9B 4YDDB 1Y7PA 3UN3A 4WFXA 1NDKA 1U0SA 1NSAA 2M3DA 2I0XA 2CQCA 4PR6A 1NK9A 3I4PA 1YJUA 2WSFC 1RCXB 4HHHA 1ZTTA 2B0GA 1E6VA 1WJ9A 1SH2A 4G1QB 1WELA 1UKUA 5AT1B 2LXUA 3TWZA 3P49B 2R7QA 2G0IA 4B9TA 3EUNA 5KG4A 2GHWA 5HSPA 3HKZD 1N5VA 4Y00A 3QT5A 2XWXA 3H25A 2GMHA 4LF8F 4O3NA 5HLFB 4AUKA 2BKOA 1B70B 1CEZA 2DCUB 4YB5A 2LEAA 1HD0A 3A4TA 3BN7A 5J2MA 4DR3J 3P5BP 2EVZA 3OSNA 1K8AT 1Q7YT 2JLFA 3PX4A 4JI2F 1XMQF 2PMZD 2BABA 2E1CA 3FJ2A 4C3MA 4CQ1A 2XTJP 3NWGA 2FLNA 4O3RA 5SUHA 3G8TA 1SL1A 2FY1A 3EGVA 5DG9A 3DM2A 5JVGQ 5AJ3F 1F6TA 1T05A 2CPHA 4URGA 2YKPA 4KPCA 2E1RA 5GAHU 1TMJA 1DBDA 3D6TB 1UPPA 2OPRB 1VGYA 3NGDA 4NLPA 1PC5A 1N33F 3M6XA 3PW0A 1RAIB 4OZLA 2MJNA 1NJYA 4ZJQA 1YVFA 2CJ9A 1UWAA 4TN2A 5L9NA 4I4BA 3GJQB 3AJDA 2K7KA 3AQPA 2IDEA 1LXNA 1RTJB 1MU2B 4LFCF 4B3MF 3BKUA 3FMWA 2WBMA 3KHGA 2UVWA 5KG2A 3F41A 1K44A 3OL7A 2XMWA 1BQMA 3MMBB 4X66J 4C9DA 4ZVPB 2JWNA 2UXCF 1RT1A 2AIRB 3N0VA 2JLGA 4CTAB 1SUQB 2QO3A 4DI6A 3NP5A 2FHJD 4RNHA 2G2YA 5L38A 4DS4A 3MM9B 3JYTB 1N5TA 4UQGA 4DV4F 4F67A 2GQ2A 3GR1A 1PG5B 2Y1IA 1S99A 2H5IB 2A18A 2I5JB 4TU9A 1N56A 1NO8A 4WP8A 4DPYA 2MKIA 2HVIA 3DXSX 2G13A 1VBXA 1TKDA 3MM8B 4HVZA 3GV7B 4YUDA 3IBCB 1P1LA 4ZVHA 3W5XA 5BJRA 2CUYA 1IVZA 2GGPB 3CT9A 5KFTA 2QSWA 4K2XA 2NS1B 1FJ7A 3LAMA 2XGQA 3MTKA 3KOAA 1OPIA 1LXJA 1Z2LA 5HQ8A 2K3IA 3HSJA 4OZNA 1RTHA 3LH2S 3HSDA 3AD8C 4C98A 4UF4A 4WFZA 3KK1B 1VDHA 5KFEA 2KYZA 4TYBA 4DL5A 5D0GA 3W9HA 2IJRA 3ISNC 3M8ZA 3U02A 4USHA 2PSZA 3QO9B 1UP1A 3LPEA 3UD3P 4OYPA 2V8HA 4DPOA 5HVHA 1YG0A 2IC3B 3UCGA 3MM6A 3N79A 4WZQA 3ICLA 4HL9A 4H4MA 4DR3F 4ECWA 2DRDA 3NS5A 4ECQA 3UCZP 5KFBA 2RS8A 5J2PA 4P74A 2P9GA 3GV8B 1TR0A 4RUAA 2ZFHA 1KLMA 3VZHA 2KO1A 3D5MA 4P75A 4WJBA 2Q6BA 3ZZ0A 4DR2J 2XS5A 2NREA 3C15B 1OYDA 2IJNA 4QIGA 3PYGA 3W61A 3Q8SB 1PBAA 3J7ZT 4UTGA 5KT5A 2K8GA 3DRYA 4IR9A 4PXCA 2VOPA 4ICLA 2FJAB 1PJ6A 4BHQA 4OYMA 2DNRA 2WTFA 1FRXA 1RWUA 1S5ZA 4XPCA 3T5KA 1CG2A 4OJ3A 4S0MA 3TANA 1HA1A 1HHTP 5GMKa 5A0YB 1JLEB 1UETA 2XC9A 3ZZUA 2EI5A 2KXHA 2WK4A 3BYPA 3N9UC 2JLEA 3VAIA 4ZVUB 1WF0A 2DY9A 1HMVB 4H4OB 3K7RA 1CJVA 4OX8A 3I0SA 3TA0A 1RBLA 4X66F 2HHTA 2KM8C 3QBCA 4OJHA 2IYIA 1N5SA 1JLCA 4G1IA 3GLJA 3K8WA 3KG4A 2LDYA 3L3CA 3PW4A 1JIHA 5ETKA 3EZ5A 1X9MA 1JJHA 2MKJA 5F9NA 5HLFA 4ZVRB 1U6BA 4HTIA 1KWMA 2RB7A 3LO3A 1IKXA 3NMRA 3MCOA 3KLEB 3D0IE 2V50A 3PKYA 3CWJA 5BXIA 3IO1A 2ZJQQ 2C22A 4TNOA 3ZFVA 3IWNC 4CLWA 2JDJA 4L3KA 2HKEA 1RJJA 2YPYA 3JSMB 1S1TB 3R97A 2U1AA 2H48B 4X4RA 4I64A 4ES3A 3BSOA 1SKSA 3MXHP 3RJMB 4DCPB 2VHGA 4BWMA 3KXDA 4DL4A 2W9CA 4DSJA 4UZBA 4NI2A 2MQOA 2VUGA 3QGGA 1X4BA 1X4EA 3B4MA 5JVHQ 4FF4A 4R0JA 1VC6A 2XYHB 4DSFA 2KFZA 5GAEU 2VG7B 2P6SA 3CJKB 2AJFE 2W7AA 1PILA 4ZPBA 2X3GA 2CQ3A 1EIYB 3QSYB 3AFGA 3CJ0A 1Q81T 4ZKAA 1J2VA 4M5JA 2NPIA 1RA6A 3I5AA 2V68A 5KG0A 4EK2A 2XYPB 1N36J 4NA3A 3CJ4A 4DX8H 3Q8QB 3HULA 5E3PA 3Q8RB 3JB9k 1S1WB 4NRUA 4EI2A 1UJ4A 3O5TB 4KAIA 2Y0BB 2LQ9A 1C0TB 1TKTB 2CVEA 1LV5A 1UEUA 1OSDA 5IT9U 2GMJA 3P45B 1IN0A 4DN0A 2FQQB 2VBWA 4ED5A 2Q66A 1FRHA 2B9XA 1VQOS 1AT1B 4NLSA 2VG5A 4FYVB 4DR2F 5EWEA 2ROPA 3W62A 3MM9A 3SEOA 5G4DA 4DUTA 1HHQA 3JYTA 4F26A 1V9OA 1VK3A 4RW4B 2DPIA 2I5JA 3KUEA 4E0DA 4E2FB 1N6QB 2MPUA 3NNHA 1AFJA 1UJ5A 4UY8T 3K89A 2ZBCA 3OTCA 2HNZB 3MM8A 2IVFB 1QD1A 4R5PB 2IRYA 2YNIA 2HFOA 4FYWB 3KNAA 1RT6B 2A10A 2CPYA 3IGNA 4ZA1A 1SPBP 3QZ7A 2YKMA 2DGXA 2CJBA 1WTBA 4TY8B 4OHXA 3PY8A 2XCPA 4N41A 2KRBA 3QZ8A 4X84A 1HBUB 3O3LA 4J9NA 3ZZOA 3SCLE 3ZXWA 1CQNA 1R8HA 2AU0A 4LIWA 2DR9A 2UVUA 4NMXA 4DV5F 1R8CA 1XMOJ 2R7SA 1BLUA 3NGKA 2VA2A 1EARA 3DOLB 2M5YA 3QO9A 2ADCA 4CNZA 2D74B 4OIXA 2IC3A 2JEIA 1KQGB 3QT6A 4DR7J 2XCAA 1FVSA 1FWLA 3CD0A 2YKAA 4WK3A 2HG4A 4GC7A 1RT3B 1B7YB 3ZZZA 1UMJA 3EZUA 1FWPA 4LQ9A 1IKWB 1OYEA 5DETA 2VIHA 5KFHA 2FHOB 2COLA 4LSLA 1XR6A 2H9ZA 1VK8A 3D7SB 5KG3A 4DR1J 2CYYA 1E6YB 1NEEA 2MY7A 4X4UA 3LP2B 2VG6A 4JI3J 2XSFA 2I38A 4MK9A 3FUYA 3G86A 1GH8A 3OVBA 3T6JA 2M70A 4PWWA 1WKKA 3NOCA 1FNOA 2FY8A 4OI4A 5C24A 2W4CA 3N6MA 1WC3A 2R42A 4CLSA 4P71A 3CD5A 2MZTA 2LEPA 4EWTA 5A0YA 3GJTB 1X4DA 1Q16B 4PG5A 4U95A 1B99A 3VWSA 1S9EB 1FJEB 3NGRA 2YNGB 3HT3A 2WW8A 4DG1A 2ALZA 1N36F 1H2UX 2HYIB 4Q0BB 3TAMA 4AL5A 4LVOP 4TLQA 2HBQB 4QWAA 4J5OA 1HMVA 2MMYA 4NZ7A 1DTTB 3SZ2A 2KXNB 3OJUA 1K0TA 5I3QA 1RKIA 5CCLA 1C2PA 3CJ8A 2C3YA 2YWGA 2DGVA 3JQKA 3G4SS 3W63A 2CQHA 3BKTA 1FRIA 4J7CA 3DOMB 3CJTA 4DLEA 3FZBA 4IFYB 3DC2A 3T1YJ 2WONB 2HURA 2H1YA 3R7SB 1Q4RA 1VBZA 3ET6A 5A8RB 1NHVA 5KAKA 2RQMA 2X3DA 4X2BA 5RUBA 4DFPA 1G1XA 4WKRA 5LXYA 1OPZA 1VOMA 5E41A 1HW9A 1IBLJ 4YY3J 3VZIA 1O5JA 5HBMB 4A48A 4FS2A 3IA0A 3K5NA 2Z2MA 1Q78A 1Y3KA 3W66A 2IDLA 3L7OA 2J7WA 2GJ2A 4DMZA 3E51A 4JI8J 3RAQA 2DR6A 2EG1A 3D9BA 4RX6A 4O4GB 4DL2A 3QLHA 1RT7A 2NXJA 4DJBA 5DG8A 5F8MA 4B9MA 3HVAA 2KT5A 2RS2A 2VJUA 4DN9A 2R8JA 3TZZA 3TOQA 3CJKA 1TFWA 3CIMA 4KHMA 3BGRB 3GCXP 4RNMA 4PG7A 2DVIA 1NDPA 2DNMA 2D1CA 2WHOA 4FYYB 3DLLQ 5A8KB 1XQIA 2KZZA 3R2CJ 2QIFA 1B64A 1HWKA 4U7UK 2Z58B 1XMOF 1YLXA 2VPYB 3OR2B 2HAFA 1X5OA 1S0OA 3TVKA 4DR7F 1ZPVA 1S1WA 4CYUB 2R2TA 5KFYA 2ILZA 4PPDA 2VL1A 1C0TA 4P7TA 3C2PA 1TKTA 3EDRB 4X4SA 1TTHB 1NK4A 4WFNQ 3JAMU 1A7GE 2B4OA 4HACB 1NK7A 4LF9J 5THWA 5D0RA 5CYQA 4ECSA 2B51A 1U0HB 3A3NB 4DR1F 1TAUA 1U24A 3BQ2A 4JI3F 1KC8T 4ELTA 4M95A 4N8OA 3MEEB 1RLDA 2BEFA 2CPZA 3O1LA 2QMXA 3M7VA 1Q86T 2DEJA 5K20B 4CLZA 1ZS6A 2FVCA 3FFIB 3OXGA 3BREA 4QR1A 3GILA 4J9VA 5KFMA 2NR0A 4ZVOB 2C3MA 4WU2A 5KFUA 2CWXA 3R7BB 2WBRA 1NJWA 1HBNB 2GA7A 3W2VB 1JJCB 2AEJA 4KGVB 3MR7A 1R31A 2PT0A 1V6HA 4P52A 1IBMJ 4YQWA 1YJTA 4N77A 1CC8A 2DGSA 3LGNA 2CFXA 4MK7A 3CCLS 2HZVA 1ICEB 1DJ0A 3EVMA 1VQPS 2ZBRA 4NLGA 4A8YA 5DQGA 4TY8A 1YKWA 3AODA 3RRHA 2ZZNA 2C2NA 2DBBA 3AOCA 4YEAA 3SXLA 4I68A 3DLHA 1FA0A 2KVQE 1LW0B 3MAQA 4MK8A 5KG6A 2FGCA 3CF5Q 1FRLA 3OW2R 1DFDA 2HLUA 3DGPB 1TL5A 1UEVA 2VFRA 2FVPA 3FMBA 3T1YF 4Q5VA 2VASA 3I0RA 2ZM6J 2HHHJ 3I31A 1GT8A 3HVTB 2MZJA 2HHQA 2J0XA 1IM4A 2Z2ZA 1X31C 3K5PA 1TL4A 4XPEA 2HK2A 4WTOB 2WB4A 4ZS6A 2M8DB 1FRKA 1IBLF 4YY3F 1OQ3A 3IR5B 3C19A 1IQZA 3FSIA 1X60A 3HSZA 1T94A 4JI8F 3G6XA 2MQPA 1Q8BA 1E6YA 2BVZA 3T6BA 4IG3A 3TZXA 1QLNA 4A8OA 4ES2A 4ZPVR 2YWHA 4USIA 4RNOA 4BC9A 4DL7A 4DU7A 4DPTA 2ZJPQ 1WKJA 2LA6A 5J2QB 1TKXA 4YR2A 4MKYA 1IUJA 2C1EB 4K7QA 5LMUJ 4F7VA 1W25A 1Q1KA 4RW6B 4DQRA 1FRJA 4EBCA 1UVKA 3M8QB 4E8UA 4HDGA 3MAHA 2M4MA 3OL9A 1FJCA 4ZPTR 3W8GA 1KVKA 4Y2IA 4ED1A 1S9EA 4XAKA 1ZZFA 3BEGB 1RCOB 2QL9B 3GFHA 5CZXA 4ANEA 1U26A 4WTYA 1MMNA 4IFVB 3MM7A 1MWYA 3NOGA 1FJGJ 4KC5A 1DTTA 1LW2B 1S0MA 1FESA 4OLOA 2EK6A 3DYAB 1EETA 1YRXA 2XULA 1VYAA 3C14B 4NEYA 2VICA 2XI3A 5B0AA 4ECUA 1KQFB 1XERA 4N8NA 4LF9F 3DOMA 3M8PB 4USJC 1S49A 1UWBB 1FK9A 2ZOMA 4NEZA 3ENAA 4FYXB 2WONA 1GAOA 2QX0A 2LEBA 2A6MA 2APOA 3H2UB 3T1AA 3MPYA 1TL1B 1ZH5A 3KDNA 3C16B 1F5BA 2DT9A 4XK8C 2DNOA 3KK3B 2VD3A 5B0FA 4YB1P 4RUBA 2DEIA 3PHTA 2VBZA 3HZEA 1N5YA 3CMES 3D4JA 3R3TA 5HBMA 2AJQA 4C8MA 2HQFA 4ZJOA 3AHPA 4OI2A 3RG6A 1VQKS 3CDUA 2NYHA 4FVMA 1IBMF 3BF4A 1VISA 4ED6A 3ILLA 1TK0A 4O4GA 1HNXJ 4M1KA 3IMQJ 4KGZB 4B17A 2AV5A 2PGCA 1YSJA 3AOAA 4NLUA 1FCAA 3K0JA 2GIRA 2V0NA 3D6MB 2OFGX 2V94A 4QWEA 1WUUA 3X3UA 1KNZA 3BGRA 5J1PA 3DRSB 3VV2B 1SKUB 2HFUA 5KFQA 4GVLA 1YQHA 3E2EA 2R7RA 4HKQA 2NUHA 5HJYA 2GS8A 3OSPA 4RW9B 4WPAA 2C2OB 2LQ5A 2AF6A 1KP6A 1TKZA 3V5RA 2ZM6F 4OV6A 2HHHF 3IAS9 3RW7A 4RW7B 4F4AA 3GYXB 4QJVA 2V63A
chains in the Genus database with same CATH topology
3DRRA 3VF0B 1UA1A 4DS5A 3DMJA 3DRPA 3JSBA 2XY6A 2QYCA 1FKOA 1UJ6A 3AB4B 3MM6B 2WB1D 4G6VB 2KVIA 3LP0A 4N76A 3W2WB 4A8FA 1ZPWX 1LWCB 3FQLA 2YX4A 2AD9A 2VBYA 4IR1A 3R5AA 2HS4A 1IR0A 4DF4A 1H6KX 3RZAA 2DHAA 2V4JB 1U2RA 3BGFA 3G71S 2DHGA 5KG5A 2HMIA 4QIEA 4TU7A 4EZ9A 2P5VA 4PXDA 2B6AB 4NLXA 3OVAA 2MXYA 2BZ2A 1QVFR 4WU3A 1NB7A 1S9GA 2RD5C 2FJWA 2HFNA 1G2EA 4F25A 3OL8A 1TV6B 5FJ4A 3CDAA 3BGLA 4U7CA 3MFIA 3PIPQ 5BR8F 2ASLA 5E3RA 1C0UB 2BE2B 2JC0A 2PDAA 3QIPB 3QGHA 1D8ZA 1ZTWA 4ID5B 5LT5A 1L3KA 3NG8A 2HQ3A 2OTJS 4C3KA 4G1QA 3OHAA 4KFBB 5J2NB 4PG8A 1R0AB 4NYOA 5K5MA 4ID8A 3T9NA 2HPUA 1JX4A 4IH7A 5HMZA 1FRMA 1KFDA 1XEZA 4ERDA 2YX1A 1HQUB 2HNYA 4C8NA 3M30A 5IM0A 1NK0A 3KKFA 3D1OA 3O2IA 3PW7A 1Q8IA 2FVQA 2B56A 4URSA 1LK5A 2GQQA 3FZ2A 3EYZA 2F9DA 3J81Y 3DHWC 1TVRB 2BJEA 2NXUA 2D9OA 4NZ0A 5I3UB 3IG1B 2DNYA 3I4HX 3OXFA 2C3PA 1TKZB 2MDAA 2MSSA 4CH7A 5D4PA 1VS3A 5LMUF 1JLQB 4TU8A 3PZPA 2O3DA 3HX9A 5HMYA 3PIOQ 2FB0A 1HBOA 1BQNB 4F50A 3TUZC 2B4UA 3NCQA 1LKZA 1X4GA 4QW9A 3BDPA 3W3SA 2VOOA 2ZKTA 4H4KA 4NZ6A 3TVYA 2C2DA 2XG8A 1N0UA 3LOUA 1X4AA 1GXTA 3NCPA 1TP7A 3KG0A 5E5NA 3SCKE 2BXJA 1X4CA 4YHHF 2GIQA 1SXLA 1WF2A 3TUIC 2PMHA 4NWBA 2ZHAA 3VAKA 3SYZA 1O0PA 1YBAA 1SIZA 1LQ9A 1FKOB 2O66A 3HHLD 1RAJA 4HH1A 4QYZJ 1S1UA 2FJBB 1NZAA 3G6ES 4ECVA 3LP1A 4NLYA 2LXIA 1P27B 4DHVA 4MFBA 4YDDB 2C28A 4IDKB 5CH7B 5MLCV 4F4WA 3QIDA 1KQSR 2L41A 1Y7PA 2IHR1 4WFXA 4RNNA 2R7XA 3HO1A 3QPIA 5EDWA 2HMIB 1WF1A 2M3DA 4J9LA 4I67A 5LJ5Y 4MIWA 2CJQA 1FJGF 2I0XA 4M63A 3HMJG 2RQCA 2CQCA 4PR6A 1NK9A 4IO1A 2DNKA 1U49A 1JLFB 4RW8B 3KYLA 4I69A 2ZOGA 2JJ4D 3I4PA 3R27A 1SV5A 1YJUA 1U25A 2CQPA 2DNZA 2Q3PA 3I6PA 2IVMA 2WSFC 4F3MA 1XR5A 4X62F 1ZTTA 3HHNB 1CSJA 3G6YA 3WZ0A 4QIVA 2B0GA 2OD4A 1S72S 1E6VA 3NNAA 2FUG9 1IBKF 1P6TA 1J5OB 4OZ1A 1SH2A 4G1QB 1WELA 3L95X 1KHWA 3RB4A 3GG1A 3BB5A 1UKUA 1SB6A 2XWYA 1JKHA 3GIKA 2JVOA 2CRLA 2VA3A 3SQGA 1T7PA 4Y3CA 2LXUA 3P49B 2HNYB 1NK8A 2AYEA 2AYBA 4QWCA 2R7QA 2KT2A 3Q2SC 4LT6A 3VAMA 4B9TA 3EUNA 5IM0B 1Y9OA 4PG6A 3US5A 1ELOA 5KG4A 4DLGA 2GHWA 2X1BA 1HI1A 3HKZD 5AE3A 1XC9A 3LPYA 1N5VA 2DH7A 3KG1A 4Y00A 3L7PA 4V19X 2XO7A 1TK5A 2OP5A 4NOHA 5K14B 2XWXA 3H25A 1Q82T 2OPRA 2G1DA 4EBEA 2VFVA 5FDLA 2GMHA 4AFFA 4LF8F 4O3NA 3RAXA 5HLFB 1S10A 4AUKA 2X1GA 4HYKA 4ILMA 2X51A 1YRUA 5GVQA 3OVSA 3HDSA 1CEZA 3HFKA 4KRWA 2DCUB 1XMBA 4YB5A 3KJVA 5KTQA 2LEAA 1HD0A 3KFWX 2W9BA 4V19J 1WHYA 1RTDA 3BN7A 5J2MA 2D3OR 2DHXA 5CCMA 1JNZB 3I9ZA 3HHEA 1QE1A 3PFEA 4MYUA 4KPYA 2FPHX 1YHQS 5IT9Y 2RDIA 5C42A 1H38A 1RTJA 2J9DE 2EVZA 1MU2A 3OSNA 1K8AT 4MIAA 1Q7YT 2JLFA 2Z2LA 3CGIA 3PX4A 3K2YA 3GR0A 4JI2F 5DLGA 3NMAA 3TYTA 1XMQF 4AL6A 2PMZD 2B5JA 2CPDA 3F44A 3T19A 2DIVA 2BABA 5BYQA 4OX9F 2E1CA 4ZVEA 3CO9A 3FJ2A 3O44A 2H5EA 4I1TA 2MKCA 1TL3A 5IZHA 4HHJA 3LF0A 4C3MA 1HNXF 1X9SA 3H20A 3MZIA 4C97A 4CQ1A 3DXBA 3U1NA 3NWGA 1WEYA 2FLNA 3MMBA 2D3ZA 2VKZG 4O3RA 2YTCA 5SUHA 2YKNB 1PO6A 1JLAA 2W8LA 1EP4A 3CC4S 1WACA 4TYAA 3G8TA 4NA1A 5DM6Q 2ZH9A 4DWIA 3MF5A 4HDHA 3RB0A 1SL1A 2FY1A 1GQEA 5K8OA 3JTOA 4CTAA 4BDPA 1PSDA 3JSRA 5DG9A 1SUQA 4YFUA 3OQ2A 3THTA 5E3CA 3DM2A 5JVGQ 1U1MA 3OTBA 1LWFB 3M9NB 2OD6A 3CCZA 4C8LA 5AJ3F 4RUHA 4QR2A 5EGYA 3CPWR 1T05A 1RTIA 2HRUA 3M6UA 2CPHA 4URGA 1YJRA 2YKPA 4KTQA 2DGQA 2E1RA 5GAHU 4GO7X 1DBDA 2B43A 4ZVGA 2EK1A 2ROGA 2XI2A 1DTQA 4ZMMA 3MUMP 3HLUA 2OPRB 3SFUA 5FDLB 1VGYA 1PC4A 2KG1A 3NGDA 2V9WA 4NLPA 1PC5A 3MM5A 1N33F 1DQ9A 3M6XA 3PW0A 2KU7A 4OMFG 4OL8A 2DNQA 2HHSA 4OZLA 2UV8G 4L72B 2MJNA 3NAHA 4F4KA 1NJYA 3FEXB 4MTPA 3VQTA 1YVFA 2CJ9A 3KHLA 1UL3A 4MYTA 4TN2A 3EPIA 3V6JA 1S0VA 4PRFA 1L3VA 5L9NA 4ZHRA 1RTDB 4I4BA 1ZYQA 3MOJB 1YI2S 5J2MB 2RRBA 2K7KA 2SXLA 4KR0B 4JV5F 3TP2A 5L1JA 2OPPB 3AQPA 4WE1B 3PVXA 5KFDA 4GC6A 2EFOA 3POTA 1LXNA 4BWJA 1RDRA 1RTJB 2ADBA 3T5JA 2XLKA 1VQ9S 2VQFF 2DGUA 1MU2B 2PFFB 4LFCF 4R25A 1X0PA 1NH8A 3KLGB 3LGMA 1VRTA 1M5OC 3BM7A 4B3MF 3FMWA 2J6TA 3FVYA 2WBMA 1N48A 4I7FB 3S7RA 1C1CB 1S6PA 1VIOA 4BC7A 3QWUA 1ZAXA 1JB0C 5B7WA 1B0PA 3KHGA 2UVWA 1QJHA 2DHSA 1TL3B 5KG2A 3F41A 4JUZA 4CO1A 5T14A 3EGZA 1FVQA 3OL7A 5LMNF 2CPJA 2XMWA 2ZBIA 1RYSA 1ULRA 2EG2A 1HPZB 2HZCA 2GGPA 3EXCX 5F8IA 1BQMA 4YDXA 3MMBB 3R1HA 4CO0A 4I2PB 2KTQA 4C9DA 5KG1A 1WG4A 1EP4B 2JWNA 3LQVA 2UXCF 1RT1A 5LSRA 4NCBA 2FJVA 4C0HA 3N0VA 2B7BB 2OAUA 5HP1A 2JLGA 2GNKA 4CTAB 1ZETA 2IRXA 4FF2A 1UWBA 2B9YA 1SUQB 2AWZA 2DNNA 2QO3A 2BOPA 1I1GA 3NP5A 3DM2B 2HHPA 3CC7S 1T95A 2FHJD 4RNHA 1G6BA 5E33A 4KHPF 5H9EJ 2RU9A 2CQ0A 2PEHA 3C6TA 2OPQA 3KLFA 3KK1A 3N4WA 1VQ6S 1X5TA 4BS2A 5CYMA 5L38A 4K4UA 1G7CB 3PX0A 4DS4A 4YR0A 2VPXB 3MM9B 1RT4B 2DIUA 2MYFA 2W4DA 2V5HG 2E9RX 3VAFA 4DR5F 4Y34A 1N5TA 1O8BA 1DTQB 5E3AA 4UQGA 4YR3A 3JYTB 4DV4F 3IFEA 2KHCA 4F67A 1VJWA