2J0SD

The crystal structure of the exon junction complex at 2.2 a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
89
structure length
89
Chain Sequence
PQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Exon Junction Complex Reveals How It Mantains a Stable Grip on Mrna
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ATP-DEPENDENT RNA HELICASE DDX48
total genus 18
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2006-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2j0sD00
1VQLS 2V94A 1X5OA 2DGUA 1N88A 2MQLA 4W92B 2MY8A 2MMYA 2PEHA 4P6QA 4C0OC 1HA1A 1M5OC 2N3OA 4IUFA 2CPXA 1VQ5S 3IWNC 3VAJA 3US5A 2DIUA 4PRFA 2XSFA 3B4DA 1BY9A 2AYMA 2E5GA 1AUDA 3R27A 5FJ4A 2DNZA 3CCSS 4OZ1A 3R1LA 3THPA 3NNHA 2DO4A 2DO0A 2LA6A 2YH0A 5HL7Q 2HZCA 1P1TA 2OJ3A 1VQMS 5ITHA 2GO9A 2DGWA 2KM8B 2F9DA 1WI6A 2MZJA 3VAMA 4M5DB 1NJIT 2DH7A 2F3JA 2LEBA 2LECA 1WEZA 1F9FA 3S8SA 1VBYA 3CMES 5GAGU 3CCVS 1VQ8S 2J0SD 1JJHA 2M7SA 2XNRA 1B7FA 3OW2R 2XS5A 2MKCA 2MZ1A 2OIHA 2MKJA 4LMZA 2DGTA 2YH1A 2MZTA 1L3KA 1U2FA 3G8SA 1WEXA 2VODA 3TP2A 3NNCA 5DDPC 3CXCR 2KXNB 2CQHA 2CQ0A 1WG1A 2DH9A 3LPYA 1WF0A 2QFJA 1NO8A 3P6YC 3CCQS 1X4AA 2MY7A 1Q86T 2M0GB 2SXLA 1SXLA 1X5TA 3IRWP 1WEYA 1H2VZ 5LSLA 3THTA 2VONA 4PKDB 2RQCA 1SJRA 2RU3A 5JVHQ 1M5PC 1WELA 3CC4S 2XS7A 1QM9A 2LA4A 4LIRA 2M2BA 5H1SV 3PIPQ 1FO1A 4WIIA 2MQPA 5IM0B 2KN4A 2L08A 4TU7A 2M8HA 4LJMA 3D2WA 2UP1A 2AYGA 2MQNA 2MQOA 3UWTA 1X4FA 2DHXA 2LCWA 2KI2A 2FY1A 3HHNB 2O3DA 1YTYA 1VQPS 2DNLA 1SJFA 2JVOA 2MKHA 5MLCV 1P27B 2DNRA 1M1KT 1U1MA 1FHTA 2OSRA 2BOPA 2E5IA 5JVGQ 4RU2A 2VOPA 4ZKAA 5GADU 1VQNS 2MYFA 2WBRA 1X4CA 3V4MA 5GAHU 1X0FA 1YIJS 3NS6A 4PR6A 4F26A 1KQSR 2FPHX 3UCGA 1ZZFA 1S72S 3BO2A 3G9CA 3RW6A 1K8AT 5CXTA 1DBDA 5BJRA 2DIVA 2JX2A 1YJNS 4ERDA 1N54B 2DISA 2N3LA 1X4DA 1U1LA 2RS8A 4C7QA 2MZSA 2U1AA 2KU7A 2DNOA 3MURP 3VALA 3G6ES 3UE2A 3P49B 4QPTA 2MPUA 5DDQC 4WFBQ 1QVGR 5GMKa 2G0CA 3CTRA 4CIOA 3N9UC 5DDOC 2KVIA 1OIAA 2M8DB 2MHNA 2XNQA 1JJ2R 4QQBA 2HVZA 2RVJA 1WTBA 3CCMS 1OWXA 3MD1A 4WCEQ 3L3CA 4CH0S 2AYEA 1VQ9S 2MJUA 2DHGA 1VBXA 4FXVA 2RRBA 2GHPA 3CPWR 2KFYA 1DZ5A 3UD3P 1X4GA 4UQTA 2QA4S 4BS2A 2L9WA 1H6KX 4F02A 2HGMA 3DXBA 2KRRA 3CD6S 2DH8A 4WFAQ 2RNEA 5DM7Q 2N7CA 3MUTP 1W2BR 3BEGB 3K0JA 2JWNA 3I55S 1U6BA 1U1RA 2XS2A 2LMIA 3H2UB 1M90T 2DNPA 1KC8T 2X1FA 2OTJS 1X4BA 2AD9A 5LSOA 3PIOQ 2RS2A 2NZ4A 2LEAA 2MKKA 1K73T 4WKRA 2ERRA 3MXHP 1K9MT 3VAKA 3EGNA 3J7ZT 1FNXH 2M4MA 2DNKA 4OZ0A 4IO9Q 2KYXA 2ZJPQ 2CQIA 2LYVA 2OTLS 2MB0B 1PO6A 1UFWA 3MI7X 4V19X 3CULA 2JVRA 3EX7B 2JRSA 5DDRC 1X5PA 5LJ5Y 1VQOS 2LKZA 1FXLA 3CCRS 2KM8C 2X1BA 2LXIA 1X5SA 2HGLA 4WFNQ 2KH9A 3MD3A 3CUNA 2CPFA 1VC5A 4QU7A 1ZH5A 4CH1A 2DNGA 1HD1A 1DHMA 3I56S 2M52A 2MSTA 5DM6Q 1YITS 5CA5A 3VAFA 1DRZA 4TU9A 3Q2SC 1OO0B 2N82B 2FC9A 2CQCA 1U1PA 3MUMP 1D8ZA 2FHOB 1WWHA 2G1DA 2DGQA 1FJ7A 2RT3A 3U1LA 1WHYA 5IQQA 3ULHA 3NMRA 2KT5A 4CQ1A 1KOOA 4ED5A 2B0GA 1CVJA 4F25A 3G71S 3ZZZA 2CPYA 1O0PA 4A8XA 1VC0A 1HD0A 1YJ9S 2K3KA 4YB1P 1YHQS 2KXFA 2DGSA 3UCUP 2KHCA 1WF2A 2PE8A 2EVZA 2L41A 2QEXS 3CCES 2AYBA 4EGLA 2E5HA 3VAHA 1NU4A 5IM0A 1QVFR 2YTCA 2DNHA 3MDFA 3HI9A 4Y0FA 2NLWA 3CCUS 2CQPA 4TLQA 1M5KC 2M70A 2RUGA 3SMZA 2DNMA 2J0QD 2CQBA 3CC2S 2CPIA 2X1AA 4IOCQ 1SJQA 2G4BA 1U6FA 1KOHA 3H2VE 2YWKA 3P5TL 1N8RT 2MGZA 3BS9A 5D78A 3Q2TC 3JB9k 1KD1T 1U1NA 1RKJA 1VQ6S 2J8AA 1SJ3P 2MKSA 3UCZP 2ADBA 5LXYA 3FEYB 1WG5A 3SDEB 3BO4A 2HGNA 3U1MA 2MZQA 2DHAA 2LXUA 3CCJS 2CQ3A 4QU6A 2M88A 3VAGA 3VF0B 1Q7YT 1OPIA 2EK1A 3CC7S 2LQ5A 5DETA 2MGZB 2KRBA 1U1OA 2ZJQQ 1H2TZ 2OSQA 2Q79A 2CQ4A 4FXWA 3P3DA 5CYJA 1UP1A 2CQ2A 2CPJA 1ZZNA 3MOJB 1HL6A 1WHXA 2D3OR 2U2FA 3S7RA 2CQ1A 2ADCA 3RW7A 3G4SS 1S79A 1FT8A 2XB2D 1SJ4P 2ZJRQ 1JJ4A 3SDEA 2DGOA 4W90B 2EK6A 3B4MA 3TYTA 2D9PA 1YI2S 2CQGA 1VBZA 4Z2XA 1WG4A 2I38A 2CPDA 2A3JA 1R8PA 3CCLS 1A9NB 1YJWS 2K8GA 1G2EA 5LJ3Y 1N52B 1X4EA 2MZRA 3DLLQ 3S6EA 1IQTA 2E44A 2MQMA 3S01A 1VC6A 3R1HA 1U1KA 2KG0A 1Q82T 5LXRA 2DNNA 3G8TA 4C4WA 4Y00A 2CQDA 3TO8A 4WF9Q 2CPEA 5GVQA 3EGZA 3CF5Q 1VQ7S 2M9KA 5GAEU 2VOOA 5D77A 3MUVP 1WHVA 1UAWA 1WF1A 2RQ4A 2CPHA 2X1GA 4U67Q 2MXYA 1URNA 1VQ4S 4UY8T 2DITA 1PGZA 3FEXB 1FJEB 2CPZA 1XN9A 2MKIA 1Q81T 1M5VC 2MQQA 4IOAQ 3CMAS 2MJNA 2DNQA 1WI8A 2F9JA 3NNAA 1FJCA 2DGXA 4TU8A 1WHWA 2DHSA 2KXHA 3SXLA 5IFMA 1X4HA 4YUDA 2D9OA 1H2UX 2BZ2A 2I2YA 2DNYA 1YWXA 1R8HA 2DGVA 3ZZYA 2RRAA 3J7YU 2MSSA 3LQVA 2HYIB 1D9AA 5EN1A 2YKAA 2J76E 1JMTA 2DB1A 3UD4P 2KG1A 4J5OA 3G96A 3VAIA 3BO3A 1VQKS 2FC8A 2CJKA 1U1QA 3NS5A 1UW4A 2DK2A 1A7GE 2E5JA 1RK8A 5HO4A 4YOEA
chains in the Genus database with same CATH superfamily
1VQLS 1SC3B 3A3OB 1O5JA 5KOWA 2GV1A 4H4MB 4ES1A 5F9LA 1SL2A 1YG0A 1H3DA 1ZA2B 4KFBA 2ZH5A 1RWWB 1KTQA 3CJ8A 2EFNA 2MQLA 4NLDA 1S99A 3GIRA 3WZ0A 4CTAA 4W92B 2KJVA 1QY7A 1DQAA 4DPYA 2VQEJ 2A2DA 5LMNJ 4L3NA 5E41A 2W8KA 3E8OA 3U7JA 1HNZF 3M2RB 5HMXA 1J5EF 2KFZA 3DLEB 1HA1A 4NLPA 3GONA 3Q8PB 2UU9J 3KJQB 4CLKA 4OX7A 2HG4A 2JDJA 3POTA 3IWNC 1KQFB 1ZPWX 2QT7A 4LQ9A 3BYRA 4XDDA 3HJFA 2R3VA 3D1HA 4DV5F 1IWGA 4M95A 1UW9A 2AJQA 4CT9A 2A0FB 2XSFA 3QZ8A 4PXBA 2LQ9A 3MM6B 1EKRA 1IKXA 3R27A 5E5NA 4DFKA 4ES2A 3G6VA 4UUWA 4AL6A 3MCNA 3BQ1A 4DR5J 3GG0A 3CCSS 2V69A 3EZ5A 3THPA 2B9EA 4LFBJ 1CPZA 2ROPA 5HL7Q 4A8WA 1RLDA 4DU8A 1UWAA 5SUHA 2OKQA 4MMOA 3TWZA 1RT7B 3IBWA 3M6WA 4WP9A 3DLEA 3VAMA 4USWA 4OYZA 5AXKA 1KEKA 3NAIA 1XTZA 1RTIA 4FYVB 2DH7A 2ZH3A 2LECA 3HHLB 3CMES 3S8SA 1VBYA 4PQUB 3CCVS 1CJKB 1RUSA 4DLGA 1JJHA 2E5LF 1Y5LB 1BQNB 1NM2A 4DR3F 3FC9A 4Y2CA 3T3FA 3OW2R 1VQSA 1V3RA 2H9ZA 3SSQA 2OIHA 1RT6B 2Y1IA 4ZVPB 4ZLNA 2ASJA 4KHPJ 1F9EB 1NPRA 3SQGA 3W5ZA 4EI2A 3K5LA 3QT8A 2VJVA 3TP2A 3NNCA 1YRUA 3H5SA 5DDPC 1FWKA 2KXNB 3IBFB 1HWUA 3BSCA 1QUVA 3K5OA 4NLGA 2IM3A 3ZZUA 1RT7A 3AY0A 1GQEA 2HIQA 5LSRA 2H3EB 2XMTA 3LPYA 3M4XA 2OEKA 4JI5J 2QFJA 1OYEA 4NA2A 4O3PA 5K8NA 4RNNA 1X4AA 1EX8A 2PC6A 1C1BA 2ZEJA 2XLIA 4PG5A 3JYTA 3CCQS 2FZKB 1QLNA 2CRLA 3P8BB 4BC7A 4PQUA 1FXRA 3OVAA 1UJ4A 2GMLA 4ZPCA 3H5YA 3GV7B 3QFHA 3JAMU 1RADB 1S59A 2QRRA 1RT6A 3F73A 2E9RX 2RQCA 4OX8A 2Q6CA 5IWAF 2RU3A 2X7IA 3PX6A 3A8IA 2HHVA 4JYAF 3DM2B 5JVHQ 1WELA 5BYRA 3M30A 1QM9A 2LA4A 3OSNA 1KLNA 3CC4S 2YXLA 1ITPA 1XERA 1YDLA 4WIIA 3TNVA 3HP6A 1ZM3A 5I3UA 2G1HA 1DAXA 2L08A 4B02A 2V2ZA 3MTJA 3FGVA 4RNOA 4X4TA 1DQ9A 4WYLA 3D2WA 3GJTB 5H9FJ 1IBMF 2ZUGA 3JQMA 2UP1A 2XY5A 3GV5B 4HH1A 2MQNA 2VFTA 4DQIA 2AJ4A 2B3TB 3KK3A 4L3KA 2KI2A 2VBXA 2C2KB 1VJWA 2J0XA 2HNDB 4U7CA 4FPIA 4NCAA 1T02A 2K7KA 4IO1A 2AZ1A 2IBKA 4WFYA 3R6GB 4MK8A 2BM1A 2XMMA 1P27B 1M1KT 2ASDA 2L9NA 4PG6A 2XO6A 1FHTA 3EPGA 2CJQA 1UZDA 3GB0A 1K0VA 4DFMA 2J9DA 4DG1B 3KLGB 3M2VA 3M2UB 5DZ6A 4DR1F 1RT1B 3GZ7A 4RU2A 1K0TA 3DLHA 2AWZA 9RUBA 2CNNB 2MYFA 1VLYA 5B0DA 2ZH8A 4J9NA 4OJHA 4PG4A 2V68A 2WVBA 5GAHU 1X0FA 4RLEA 2ZHAA 4NLRA 1RHJB 4M8LA 1ZZFA 3G9CA 3BO2A 3RW6A 2OEMA 2OFHX 2RF2A 2W1BA 4WYWA 4K4SA 2DRBA 2GA7A 3N6LA 4HI2A 2Q6BA 3U1NA 3DU6A 3QRQA 4UOHA 1IKYB 1DBDA 4J9UE 4R0EA 2EFVA 3QRPA 1NAQA 3VHQA 2CYYA 2Z57B 4QOTA 5A0YA 2U1AA 2DNOA 4ELVA 4LSLA 4LR9A 2QLJB 3FFIB 4ECUA 3UE2A 4DFPA 3M2UA 2F8EX 1RT1A 2PIIA 4QPTA 3TX0A 4RU9A 2JEFA 3CTRA 3D5MA 1N0UA 1TTHB 1UTAA 1XQIA 4H4KA 3SYZA 2KVIA 3TI0A 5DRKA 3W62A 2J6UA 1OIAA 2XNQA 1R27B 3R5AA 4QQBA 2RVJA 1I94F 1FVSA 4Q0BA 2ZOMA 3GCXP 4J9OA 4CLZA 1WDTA 4LRAA 4N8OA 2HFZA 3FVYA 2UVVA 5AE1A 2IDLA 1WTBA 1N5TA 5KFGA 3CD5A 3MAHA 3MHYA 4NRTA 3KMQA 4URGA 2YQ0A 5IT9U 4NLXA 3R8YA 2WAQD 1VQ9S 3DMJB 3EPIA 2C3UA 3MMAA 3QWPA 1F0XA 1O8BA 9ATCB 3IG1B 4DCJB 3HHKA 2B4VA 4HVZA 1FX2A 1LXNA 1Z2ZA 2HQ3A 3GYGA 3OXGA 5C24A 1TKZB 2GS8A 3W5YA 3RBEA 1DZ5A 3BKTA 2VB6A 4N5SA 3UD3P 1HBNB 1X4GA 4B3MF 2L9WA 3O44A 4F02A 1RT4A 4QIWD 4B9UA 1RAAB 1AUSL 2J6SA 1IBLF 5DM7Q 2N7CA 1NEEA 2UV8G 4EYHB 1XNRJ 1OQ6A 3MMJA 2JWNA 3ET6B 3O1LA 1LQ9A 3OFEA 3I55S 4A8QA 3R2DJ 5KT7A 3NCQA 2Y8WA 3FZ2A 4RUCA 1HWJA 1R6YA 2RILA 3K89A 1YJVA 2XCPA 3DMJA 1NH8A 4L72B 2DNPA 4NLYA 4A48A 2HHUA 2HBRB 4F7VA 4OZJA 3OL6A 1FE0A 2P6SA 3ZZRA 4DX7A 4NEZA 3SZ2A 2RS2A 3DFEA 4I67A 2NZ4A 4LT6A 5C2CA 3KUHA 4ANDA 2LEBA 3M8ZA 1MWZA 3QGGA 1K9MT 4C9DA 2HVEA 2ZZMA 2B4UA 4LRFA 3POTB 1LOUA 4WE1A 4KKOB 1J5OB 2OTLS 5F8IA 4ZK7M 1V5VA 2O01C 2O67A 3SCIE 1PO6A 1W7WA 2ZC3A 3KUEA 1XJWB 2JC1A 1T03B 1WTFA 1F5CA 1UFWA 2JOQA 3MECA 2VC0A 2QG9B 3MI7X 2JSXA 2JVRA 3C6UB 4LBHA 5AXMA 4CLYA 5KFDA 2IM0A 2FHJA 1LXJA 3T1HJ 4CRJA 2E5LJ 2MLZA 1ZAWA 2KM8C 3O2IA 2YPZA 4Y3CA 4DV0F 3QFWA 2IJFA 4P7TA 4ZPBA 2XI3A 3RR7A 2JL9A 3MEKA 4KHRA 3J80Y 3UNGC 5C42A 1UA1A 2RMLA 4DF4A 4CO0A 3IR5B 2E7WA 4GO7X 3KK1B 2AJFE 1S1XA 4IFYA 1U8WA 3SIPB 3Q89A 1IJFB 4WE1B 3TRGA 2FHKA 4P7VA 4RNHA 5KT5A 2C2DA 4X4UA 2RSQA 5L1JA 1Y0HA 3VTIA 3C15A 2MSTA 3M6VA 4LBIA 1RWOB 1RHRB 1FVQA 2J9DE 3KG0A 4LSNA 5KFYA 3PDNA 5KFBA 3V6DB 1HNXJ 3VAFA 1VDHA 1GMWA 4X64J 1DRZA 4TU9A 2XM3A 2NSCA 4QW8A 3SQGB 3EMTA 4DV6J 3AH6A 1R7IA 4WK3A 5GAEI 4DSEA 1FKPA 3LANA 3PZPA 5IT4A 4QR2A 2XI2A 1HBMB 2CVEA 2EC2A 4X62J 4JOUA 2IYGA 1J5EJ 1VRUA 3R5JB 4HI1A 2WSEC 3X1LB 3NY0A 1SC6A 1S6QB 1O51A 3HSDA 4UZBA 3JYTB 1IWAA 1CVJA 4ECYA 4KO0A 3GLJA 2CPYA 4ES3A 4CCHA 4A8XA 4FNHA 4N7TA 3DI6A 4LSNB 3V6DA 1YHQS 1QE1B 3NRBA 3UCUP 1U45A 1L3TA 3R5BA 2DPJA 2UU9F 2J5AA 4FP9A 2GAHC 1C1CA 3CDBA 1WJ9A 1HBUA 1RHMB 4F3MA 1HNWJ 1NK4A 3NOCA 3TJAA 4IG0A 3W1YC 3AXKA 5LMNF 1NU4A 4I7FA 1Y11A 5I3UB 2FQQB 5ETKA 4F50A 1X9SA 1QVFR 3FMBA 1TV6A 3M1VA 3TVKA 3W2VB 3TZXA 2P2CB 1JXEA 5FD1A 2YTCA 3N01A 4C0HA 2VDHA 5DG7A 2QLFB 5F0UA 2NXCA 2UXBJ 3AAWB 3MM7A 4CO1A 2Q1LA 2BBEA 1NLKL 4HL9A 2ZH1A 3BR8A 3E3XA 5K20B 1BLUA 2M70A 3SMZA 2DNMA 3VZIA 5F3ZA 4N56A 2DR7A 2WSFC 2CQBA 3ZZ0A 4DPXA 4DV7J 1DFDA 3D0IE 3J7YI 2ZZNA 2CPIA 4IOCQ 4KGVB 1CJVA 1SJQA 4X4SA 5J2QB 3PTWA 3AA9A 3FSIA 4JI4F 4LFAJ 1C1CB 3T1AA 4WTYA 3UW1A 3KJVA 3P5TL 4DCPB 2VPYB 3I87A 3SFGA 1N8RT 3NS7B 4QW9A 4ETXA 4Q8EA 1AROP 2EG2A 1S6PA 4I7FB 4BWMA 4LF4J 2JEIA 2IRUA 1HWLA 1C0UB 2AEJA 2QN6B 2QE5A 4YY3J 1EKSA 5CZXA 5HROB 2HHXA 2B4OA 3AA8A 1YZ7A 2WONA 3DOKB 3EJMA 5U47A 2R2SA 5CH7B 1SJ3P 1Q8KA 3M8YA 2YWGA 4C8LA 2DXEA 2JC0A 1HNVB 3LP2B 4JB8B 2DHHA 3UDVA 3IGVA 2VG6A 5LXYA 3P5BP 1WG5A 4GO5X 1TKDA 2HGNA 2V4RA 3FRZA 3I5AA 4K7QA 3W63A 2R7WA 3MMBB 4DS4A 3CGIA 3MR3A 2CQ3A 3D3CJ 4J9QA 1IBKJ 4F4KA 1S6UA 1GXTA 3QJPA 8AT1B 4RX6A 2BDPA 1VQYA 4NMLA 1WKLA 2AJ2A 1OPIA 2EK1A 5HSPA 1Q7YT 3GMGA 2LQ5A 4JP8A 4BDPA 1GFWB 1WC5A 4FDFA 3GE9A 4K4VA 4MKVA 2KRBA 4Q7AA 2PMHA 4KH0B 2ZJQQ 1IQZA 5D0EA 4WPAA 3MOJB 2CQ2A 3PHEA 2CPJA 3GYNA 2XZDB 1T9TA 1HBOB 1LW0B 4RJVA 3TJ8A 2HURA 4U7UK 3DOKA 1OSDA 5L9NA 2B9WA 3VGUA 2ZWPA 2CA9A 4RBVA 1CEZA 4WXOA 3DNCA 4QR0A 3G4SS 1ZAXA 2VF3A 2WCXA 2BV3A 1SJ4P 2V63A 4NLOA 3DLJA 3H20A 4PWUA 1NB2A 1U47A 1R3NA 4LF1A 1IM6A 1YX2A 2EK6A 2H4WB 3M6XA 4RUBA 5EGYA 1U48A 1NMEB 2NUHA 1PBUA 1WC1A 1VCTA 2BJ7A 1RZMA 4DR3J 1WG4A 2I38A 4PPZA 2A3JA 3PW0A 1KWMA 1SH2A 3IG1A 4NWBA 4USVA 4O3OA 4ZLPA 2AQ4A 3BBBA 5E3AA 1FA0A 4N47A 5LJ3Y 3D68A 2JLFA 4KE5A 2MZRA 1CULB 1E6YB 2FJDB 1FNMA 5KG7A 1TFYA 1TU0B 1RT4B 4ID5A 3CMQA 1KLMA 4TY8B 4IRKA 1LW2B 1JB0C 2MQMA 1OQ3A 2GQQA 1VC6A 1CJTB 1HQEB 2Q3PA 4UOCA 5LXRA 2DNNA 1H98A 3PR5B 5HQMA 1FJGF 5EX0A 4P75A 4Y00A 4K0KJ 1T94A 2L48A 2LU2A 2JFDA 1AZSB 4LMZA 4WWSA 3D9BA 3EDRB 2AP6A 3B82A 1L5UA 2RDDA 3GR1A 4OV1A 3DGVA 3ISNC 4Z7CA 1U49A 1PYOB 2KL8A 1S10A 2R42A 4XAKA 4DBQA 1UPMB 4DSFA 3NCPA 3BKFA 2CNOB 2IYIA 3W66A 1Q16B 1ZM4A 4F0KA 5EWFA 4LSZB 2RQ4A 1T05B 1R8AA 2HVDA 4DPTA 1S1TA 1HMVA 2KYZA 3IWXA 5FLXU 3NGDA 2BE2A 2ERRA 2DITA 3MPDA 4JI0J 2RQKA 1Q4RA 2YQ1A 1U0SA 2VKRA 2Z2YB 1PJ7A 1E6YA 1LWCB 1KHWA 2HRYA 2MKIA 2HHSA 2BXJA 1ELOA 2ZD1B 3MEDB 4I2PA 5ETMA 5GMEA 1FRJA 1GMWD 4OJ3A 5A6WA 3GILA 3Q0AA 4IOAQ 2PFFB 3GFXA 2DNQA 2F9JA 1B0VA 2F40A 3AOBA 1FJCA 3M32A 4OI2A 4O44A 1YGYA 5D6GA 2F4VJ 4B3OB 2B5JB 4TXSA 4ED3A 2PSZA 2YKPA 3A3NB 2X3GA 3NAHA 4KGMA 1GAOA 2ZOFA 2CNKB 2ZVSA 3M8QB 3MECB 1FRXA 3QRRA 1H2UX 4IG3B 3PYGA 5AE2A 4HEA9 4U95A 4YB6A 2NXNA 1C4CA 2ZZTA 4J9MA 5EUHA 4ETZA 1T7PA 1UPPA 5D4LA 2ROGA 1KNZA 1XIQA 1D9AA 5T41A 2LDIA 5EN1A 5KFVA 2YKAA 3H90A 4F04B 5KFHA 4LF4F 3FUYA 1VR6A 3UVJB 2C2NA 4J5OA 2IY5B 3EZOA 1IUJA 3MEEA 2R7SA 1VQKS 2FC8A 2FIUA 4S0MA 2F4VF 4CO5A 1VK8A 1S1XB 1SVDA 3CJ2A 2HHPA 3T6BA 2QV6A 3OUYB 4F2RA 2QA1A 1A7GE 3MZIA 4NLWA 5CYMA 4EU0A 5I3PA 5KT2A 2W9AA 4DR2J 2UXCF 1REGX 3NGUA 3OLBA 5HO4A 1PILA 1U2RA 1JLBA 3A12A 1NDPA 1AXQA 5BXIA 2A1BA 3R7NB 4I6AA 1NH7A 5HI7A 4JV1A 1SJ1A 3T41A 3NWGA 1N88A 1FKPB 2M3DA 2OD6A 3MCSA 2CWKA 1JJCB 2RRNA 2XMJA 3D6MB 2PEHA 1YSJA 4O3SA 1FKOB 4E0DA 2HRTA 3CJKB 4HKQA 4P6QA 3KFWX 1KHVA 3JTOA 3KDNA 4KIAA 4C0OC 4CP5A 2EWHA 4DX5A 1AYEA 2ZDOA 2AGOA 5K8PA 1NKCA 1M5OC 2Y1RI 2N3OA 4DL4A 2ZUAA 3GU0A 5AE3A 1VQ5S 3PFOA 4OJ1A 3OTOJ 4FF4A 2HNZA 2EFGA 3GSIA 4L6V3 1HLWA 2YNHB 1IR2A 2FYXA 1S4FA 1BY9A 2C3MA 3O3LA 3WDOA 2HQDA 3HZGA 2LQJA 3BPSP 2R4FA 1FRKA 2VDIA 1FDDA 2B9YA 3OTEA 4I2QB 3AD7C 2XSJB 3TJ9A 4ALZA 3NNHA 2DO0A 2YH0A 4V1Ak 4AUKA 2HZCA 2IDEA 2ALZA 2D3ZA 1N5SA 2QO3A 4MYUA 1VQMS 2ILYA 2V8VA 4EUVA 2GO9A 3P4UB 4DV2F 1SKSA 4FBTA 2DTJA 3JSYA 1UVLA 2DGWA 1IR1A 3EVOA 2F9DA 4J90A 4N8NA 3QAUA 5KFTA 5KTQA 3KHGA 2NREA 1P8GA 1T0TV 2N4CA 2QA2A 3HT0A 3QO9A 2F3JA 2QLXA 1Z1ZA 2YKOA 5CYQA 5ETSA 5J1EA 5LOQA 1F9FA 4DCOB 3M05A 3ONQA 3C66A 3R97A 3NWRA 3IXQA 4MT1A 3GIJA 1XMOJ 1CS4A 3B8HA 4LREA 3Q22A 1Y4ZB 4GVLA 4DQRA 2NR0A 3IS9A 3V6HA 2XS5A 4U8VA 1NJYA 4N76A 1ZAVA 2H4YB 1L3KA 1U2FA 5DQHA 1PSDA 1RWVB 2FD2A 2G0JA 2WW8A 3MPVA 4WIQA 3H4DA 3Q23A 4RW8A 3CXCR 2W7OA 3IM9A 2DRAA 1S6PB 2RHQB 2N4DA 3H0PA 5I3QA 1QSSA 2CQ0A 1WG1A 4CLLA 2KHDA 4B9NA 3Q8UA 3HSZA 2YNGB 4WZMA 5A8WB 4LFAF 4ILLA 1S1UB 1L3SA 2C2OB 1TL1A 3MM5B 5DG9A 3IBCB 4NYPA 2MY7A 2IBOA 1Q86T 1RT2B 1MROA 1T95A 4ZLJA 4JV2A 3OVBA 2VG6B 2ASLA 1CC8A 3MR6A 2VBYA 3KG1A 2F65A 1NHVA 3QPIA 3H5XA 2YKNB 4ZVOB 3FQLA 2RDIA 2VONA 3THTA 4ANEA 3RR8A 1E6VA 4NXNJ 2UUCJ 4WBFA 1RTHB 2V4QA 4PKDB 2IMOA 4RUHA 2GC8A 5KG4A 3V6JA 3N5BA 1TMMA 4HHJA 4C0BA 1M5PC 2XS7A 5CCMA 5K14B 2M2BA 5H1SV 3PIPQ 2XO7A 3V4IA 1RAHB 1TVRB 2J7KA 3L4BC 3L9ZA 4DV1F 4Y6IA 1AT1B 3BSNA 4LR8A 2IRXA 4TU7A 1N36J 2UVUA 1SQFA 3K5PA 3QMQA 2HWIA 3MFIA 3W2WB 3HVRA 1FEHA 3DDIA 4MJKA 2GGPA 3OL9A 1SIWB 1EAYC 2MQOA 1URNA 1X4FA 1RT2A 3NMRA 2FY1A 3HHNB 4JUZA 2A2CA 3EWGA 4M63A 6FDRA 1HPZA 5M2UA 1OS5A 2DNLA 1AFIA 2JVOA 2MKHA 2HKEA 4NRUA 1VHFA 4OZ5A 2FVQA 1N56A 1K47A 5A2QU 2ZNZA 1T11A 1M5SA 1D09B 3RYLA 2OSRA 4MK9A 1K44A 4OI0A 2E5IA 2J6TA 1NSQA 2E66A 3CNQP 1FCAA 4EO8A 5K14A 2VOPA 4E2FB 2X51A 3M8PA 4ED6A 1N36F 3HVAA 1JWWA 2ZH7A 1ICEB 1BQXA 1X4CA 1CULA 3IC1A 1U02A 3V4MA 2V67A 4PR6A 4NMXA 1R0AA 1SBRA 1KQSR 2PMZD 2C28A 2W7AA 4B3RJ 2GGPB 3UCGA 2DKOB 1LW2A 2V2VA 3PO5A 4RW9B 2VPXB 4HACA 1K8AT 1J27A 2BJ1A 4I6YA 4I4BA 2KO1A 1REVA 1SV5A 1ZM2A 4ZVTB 2JX2A 3DHWC 1YJNS 4FXDA 2N3LA 2DISA 4HHUA 4Z7YA 2RS8A 3FRYA 2VG5B 2LQBA 1U1LA 5KFWA 2E9ZA 3AODA 2MZSA 4Y2KA 2EPIA 3A4TA 4K5SA 4MTPA 3FSXA 3HZEA 3PVXA 2HZVA 4NX9A 1R8BA 1TP7A 1T05A 3P49B 2VQEF 4ECSA 2WW4A 3G82B 3KMSA 1M5HA 1QAXA 2BE2B 1VHIA 1PKUA 2MPUA 3D0HE 5DDQC 1QVGR 4A8MP 2IPOB 2IC3B 1FTRA 4CIOA 3W64A 5GADI 1N48A 2H5EA 1PAEX 4M5GA 4ZVUB 4DOZA 1BWVA 2XQCA 1YBUA 1ZS6A 3RRGA 4Y34A 1G1XA 3NCRA 3T1YF 1HIYA 1U7LA 2HS3A 3H98A 5F9NA 4RW4A 1FERA 2HAFA 1VJQA 2HVZA 2P8IA 2QIFA 5L1IA 1VIOA 5KG3A 4C48A 1Y10A 2KKHA 2ZKTA 3C8YA 2FLOA 1ZYQA 4PABA 3BSOA 2H48B 4DL6A 3MD1A 1KVIA 3QGIA 3N4WA 3EE3A 1RT5B 2AYEA 4C8MA 3PRVA 5AXNA 3KLVA 3TEGA 3NMAA 2JJ4D 2MJUA 3FK4A 2DHGA 3UI3A 4DV0J 4FYWB 3PR4A 3BDPA 2NCKL 4B3TF 2GHPA 1OY6A 4DQPA 4LF6F 3PYDA 3CPWR 3DRRA 1FI4A 2KZMA 2I5JB 1RB0A 3DRPA 4OHZA 5DLFA 2AT1B 3ILJA 4BS2A 1H6KX 4XTTA 2F4FA 4A4JA 2KRRA 3BGFA 1JQGA 4QIEA 3OHBA 4ZVHA 3V6KA 2QMUB 4KT0C 3AXMA 2R7RA 5FLXY 2CG4A 3HLUA 2XWYA 1SPBP 2RNEA 4KH1B 4OLPA 4UUXA 1KN6A 1HKAA 1W2BR 2R9LA 4NYOA 3E2EA 1M1GA 1XR6A 5F8LA 3DU5A 4PAAA 5KFRA 1N5QA 2F1FA 2B56A 2IA0A 4MFBB 1PYSB 4DN0A 5L1LA 1U6BA 3QWUA 2RE1A 2LMIA 3BGLA 1EQ0A 4DLEA 1JLGA 1JLBB 2ASYA 2RHSB 5FDLB 4NA1A 4OZ3A 4CNYA 2W9CB 1F1BB 1KC8T 4CLWA 4HT7A 1KFSA 4GKKJ 3RAMA 3OTBA 1KR4A 1X4BA 3K17A 3PIOQ 3BQ0A 3DLKA 4HH0A 1RYRA 1PC4A 3BBCA 3CCWA 3DDKA 1DTQB 1RDRA 4JI5F 4IH5A 4LF9F 2WVDA 4P52A 3QSIA 2ZH4A 1N6QA 1VRQC 1XNQF 4OZ0A 4ZOSA 4X65J 4IO9Q 2ZJPQ 2V8PA 3MMCB 2WHOA 1X9MA 2LYVA 3MOZA 4JI7J 1EB0A 3LPEA 2WOMB 2XCAA 2EXUA 3PX0A 1N33J 2CJYB 4IH7A 5GAGI 5AXLA 1WOOA 4KSEB 4YB7A 1GK8A 2YX7A 5KFKA 3DOMB 3UN5A 5FDLA 3T1YJ 3PW2A 5DDRC 2QGFB 3AHPA 3EM1A 3FEZA 5A2QY 4I2QA 1VQOS 2J7UA 1SKRA 1FXLA 2GO8A 4RNMA 3T5HA 1ZTTA 4P2SA 5ETNA 4GKJF 3ENAA 3Q83A 2LXIA 4R5PA 1T3NA 1U2CA 1K1QA 2VG7B 1IBLJ 4ZPDA 1RAJA 3DLKB 3AJ2A 3UFCX 3IWLA 3R2CJ 1S77D 3CDEA 3KHHA 4DV6F 3IP0A 5B0GA 1UVNA 3R5GA 2AHOB 2CPFA 3MR7A 4QU7A 1UMJA 3CDWA 2V9KA 4M5DA 1JLQB 7AT1B 4CH1A 4K4WA 1P6TA 3HSGA 5ETLA 2K1RA 3IRXB 3HHLD 3LOUA 3TVZA 5J1EB 4JI3J 4AL5A 2HVIA 4NZ0A 2ZKUA 2R8HA 1NRKA 1SUQA 5B08A 1U09A 3HD2A 3MM8A 1NJXA 4K50A 3DOLB 1CS4B 5DM6Q 1YITS 3U27A 4GVBA 3FQKA 3IS9B 2BW7A 2WRMA 3Q2SC 4KV8B 2OEJA 3TZYA 1TK8A 1OO0B 3ZZOA 2QMWA 3I5BA 4OX9F 1KBRA 1DQ8A 2FC9A 5J2PB 1B3TA 4A8FA 3RGIA 4NL5A 3Q8SB 2GHVC 1MW7A 3FZBA 3E51A 1FD2A 2DGQA 1LWFB 4O23A 3KLFA 5J2MA 2AMCB 2RT3A 2AU0A 4KTQA 1FJ7A 4ZITA 2P9CA 2Y1LB 2HS4A 3HVTB 2PEBA 5CZVA 4CQ1A 3PJ9A 2G2YA 3PYEA 5HK4A 1IVZA 3Q8RB 2B0GA 4PPDA 1WKJA 4R0JA 1TKTA 3G71S 3KLEB 1Q79A 3JSRA 2G2ZA 2YNFB 4OHWA 3RBZA 1O0PA 1Q8BA 1TL7A 2RB7A 4JBCA 5HP1B 1FDBA 1VC0A 3THVA 1YJ9S 2K3KA 4YB1P 2KXFA 2YKNA 1HI1A 2JHEA 3D66A 3N79A 1RTHA 3J81U 4RW7A 4ECRA 2QEXS 2HHTA 1PAUB 5KT6A 2QL9B 5J2PA 2IAJB 4A8SA 3EYZA 4EGLA 2Y8YA 2XMUA 2YX4A 3I9V9 2WVFA 3A8KA 3VAHA 1CQMA 5IM0A 3L95X 3SSSA 4I1TA 3HCXA 4JI2J 4JV5J 3JTPA 2V2KA 4CWBA 4JI8F 2UZAA 4DSKA 3MDFA 4O4RA 5F8MA 4OYWA 4QWEA 3OJUA 4DL7A 2I8EA 4KHMA 1IKVB 2IVMA 1F3FA 2XY6A 4CZCA 4EBCA 2DVIA 3MPUB 1CQNA 2AJ0A 4ICLA 4TLQA 2RUGA 4YN3B 2PA8D 3OHAA 2J0QD 2VPZB 3PJWA 4KAIA 4ZPTR 4DU7A 2W4CA 3DLGA 3QNWB 5D3GB 1F2HA 1YKWA 2XLKA 1F5AA 2VQFJ 1UVIA 2HNYA 2ZM6J 3K7RA 3ZNUA 4WU3A 3HK2A 1DTTB 3RB3A 2IAJA 2XHWA 1VLOA 3BS9A 5D78A 3Q2TC 2LEPA 1DJ0A 3JB9k 1GXUA 1TR0A 1UL3A 3NOGA 4NASA 1FX4A 4LBPA 3ZFVA 1MWQA 2NYIA 4W98A 1RKJA 2J8AA 3NLCA 3WQPA 4IDKB 2MKSA 3MPYA 3DRYA 1YRTA 4RW9A 1SB6A 1IM4A 3CCZA 1NK7A 3GV8B 3KYLA 3R6LB 3BO4A 1WOPA 1REVB 2AIRB 1LFPA 4RKUC 4ZVQB 1EQMA 3U1MA 1FD8A 4ELUA 1SV5B 2DHAA 1D9DA 3VAGA 1HNIB 2VG5A 4DPWA 1U0HA 3BM7A 3LH2S 4QYZK 3JSBA 2VBWA 3DN9A 3HFZB 4KY3A 4YS2A 4A46A 2ZOGA 4CO4A 1VK3A 1U1OA 4DPUA 3TW0A 4BWJA 1CG2A 2Z2MA 5HANA 2AZ3A 3P3DA 1ZZNA 1RHUB 4LVNP 1Q78A 1HL6A 3JSMA 4G6VB 2YWHA 4DL3A 1X60A 4ZN1A 2L3MA 3VVUA 3HHEA 3EVWA 2RD5C 3OLAA 2ADCA 5HVFA 2ALYB 1S79A 1VYAA 1RLCL 2VL1A 2C2ZB 3RZAA 3KHLA 2OPSA 4AT1B 1HNWF 2AV5A 4W90B 2WB4A 3B4MA 4RW6A 5D0HA 4JI1F 2D9PA 2BABA 3PM9A 1KQKA 4DHVA 1QSLA 1RKIA 1HNIA 4B3MJ 2EI5A 3MEGA 1VBZA 5KFCA 1U0HB 2ZITA 2BA9A 4DUYF 1HQUB 3HKWA 3RB6A 3W3SA 2CPDA 1R8PA 1UKUA 4PXEA 3CCLS 1I94J 4LFBF 4Y2IA 4LFCJ 1A9NB 1Q5VA 2D74B 2HFVA 5L46A 3DRRB 1JIHA 2K8GA 3PFEA 3QZ7A 3MPWA 4QR1A 3Q8VA 3UDEA 3N28A 2GVDB 2D3O1 1AW0A 2P6TA 3A13A 3RBXA 4PYAA 3TQ1A 4R8UA 5M2PA 2UUBF 2E44A 3DLBA 4DFJA 4DXLA 2B4PA 3KWMA 2KG0A 1Q82T 4XDCA 4C98A 4N77A 5IS2A 4JI1J 2QC3A 5KFJA 2R8GA 2OPSB 1X8DA 2RKIB 3I82A 4ENOA 1S1VB 4MKYA 1H7WA 2W2PP 4PZVA 1IKYA 2ACYA 1WKKA 1OY8A 2DCLA 4IQMA 1S9GB 2IHR1 4C8YA 4K4ZA 3EGZA 1WUUA 2VC1A 3SSRA 4DDFA 2B8PA 2HBQB 2RAQA 4PCQA 4L76A 2WTFA 2M9KA 5GAEU 2R2UA 1KTVA 5A0YB 2VOOA 3DHXA 3OT9A 4M5MA 1GH8A 1SCJB 2FVPA 5I42B 2HHHJ 5HMZA 1KONA 2CPHA 2XGPA 4U67Q 1KQGB 1WC0A 3G6XA 4P71A 1VQ4S 1Y3KA 2FVSA 1R0CB 4X4VA 4FF3A 2C42A 2AX1A 3VQSA 1YRXA 1Q7LB 4ZJOA 3VV2B 2JH3A 1C4AA 3I0SA 4QWCA 3J81Y 4J9RA 5AT1B 5FIIA 2XMVA 3EZUA 1WOSA 3CB4A 1BD6A 2IM1A 2N7YA 3I32A 1C0TA 2GJFA 2XMKA 3NG8A 1B64A 3WHIA 1RAIB 1WHWA 1S5ZA 3SXLA 3EUNA 2NXJA 4NPOA 4OJGA 1X4HA 1GX5A 2D9OA 1R8CA 2BZ2A 2OHDA 2DNYA 2XTJP 2GJIA 1NZAA 3JTNA 3Q8YA 5E0OA 2CKWA 5HAOA 2RRAA 3RRKA 1ZETA 2DR5A 3NKYA 3PO4A 3J7YU 5HLFA 4UY85 1FXDA 4KFBB 1FWPA 1GMUA 3H8YA 1Y00A 4CTAB 2VG7A 1NZ8A 6AT1B 3BJYA 1HBNA 4OI6A 5KFIA 3W65A 2J76E 2DB1A 5KFUA 4CLPA 3AD9C 1QAJA 4BHQA 4JYAJ 3TANA 2J9EA 1GXLA 2VJUA 2CJKA 1JLQA 5IWAJ 1N5YA 4Y2AA 2K1RB 2NPIA 3N0VA 1U1QA 4QZVB 5A8KA 1F9HA 1QD1A 1EARA 1MG7A 2QTWA 2IRYA 5DJBA 5J2NA 1RTDB 2C3OA 3HKZD 3GQCA 1FJGJ 2ZHOA 3DOLA 2LDYA 3BV8A 3TQEA 2HQCA 1FNOA 1URRA 1F60B 2D69A 2LLZA 2V94A 2Z2ZA 1JLEA 3HJVA 4OYMA 5RUBA 2I0XA 2OMLA 2FJXA 2APOA 1UJ5A 2QYGA 2DGUA 1EJ7L 2ZFHA 2MY8A 3GIKA 2MMYA 2YPYA 1RTJA 4C8NA 3W5XA 2QZ8A 1LWFA 1Z4UA 2VKZG 5J2MB 4C3KA 3KLFB 3PY8A 3KNAA 1GX6A 1SH3A 1FRMA 2LP4A 2V4JA 2Q66A 4KKOA 4AFFA 5KG5A 1QSYA 5HP1A 3JXOA 5J2NB 1TL7B 3GCWP 3PXGa 3VAJA 1OMSA 3MGJA 2V34A 2DIUA 4EWTA 3ADAC 1DARA 2AW0A 2E5GA 1XEZA 3QAEA 4FKXA 4O0IA 4Q2MA 1AUDA 2J7WA 1SKUB 3GJSB 1I3OB 4ZIVA 3PW4A 5FJ4A 3FCWA 2B7CB 3R1LA 1HHQA 2D7SA 4DV3F 2NSBA 1Q8IA 2LA6A 3F44A 4FS1A 1TK5A 1S7HA 1EP4A 2OJ3A 4XPCA 4IRCA 1LEOA 2Z30B 3B78A 3GFZA 1YJ7A 4OV6A 1ULRA 1WI6A 2ILZA 5CHCB 4YP3A 4TNOA 3WX8A 1MSWD 5KG1A 2V4JB 3BH7B 1RAOA 1C1BB 3IO1A 1XWLA 4IFYB 1JNRB 1QUPA 2GNKA 3CWJA 1HQ2A 2DXFA 1WEZA 4K59A 5CQGA 1CC7A 5F8NA 1SI9A 5GAGU 1D9FA 1BUXA 1LK5A 3EICA 1VQ8S 3OTOF 4V19J 4ZHRB 2M7SA 4Q2LA 2J0SD 2XNRA 4OX6A 1Y3JA 4DWIA 2CADA 3HD1A 2HFSA 3QBCA 1RA7A 1IKXB 3DLGB 2VV5A 2ZWOA 4IQXA 1KVJA 2DGTA 5K8OA 1QJHA 3ITHA 5L39A 1WEXA 4V19X 2VODA 4J9KA 3M30B 4DX6A 3FCVA 2CDQA 4WJBA 1LV5A 2OFGX 2CDRB 1EP4B 4P9SA 3TUZC 2CQHA 2XHCA 3EXCX 2W4DA 1I1GA 5JXSA 2YVSA 1WF0A 3Q8QB 1XMQF 1RWUA 3L09A 5BR8J 1RAGB 4JI4J 4IDKA 4F2SA 4NCGA 4HT5A 1Q5YA 3D6HB 3K57A 3P6YC 1T3OA 3BB5A 3KTQA 5A6PA 2B51A 2BOAA 1AFJA 1TUWA 3KG4A 4I6WA 2EFQA 4OI4A 1CJKA 1SQGA 3OVSA 1X5TA 3CJ3A 2BMBA 3IRWP 3UQSA 1HI8A 3PJXA 1WEYA 2PT0A 1QE1A 3SCJE 3C46A 4HR2A 2R7XA 3CEDA 4AE5A 1YJTA 2CJXB 3W7BA 2Z56B 3DKDA 4DX8H 2ACMA 3GSDA 2HZAA 4ZVFA 1HBUB 2WZ1A 1I51B 3FJ2A 4B08A 4URQU 5D4PA 4B9VA 2R7UA 4RWXA 4BLGA 2MQPA 3LW5C 5B0AA 1Q95G 3M1VB 2F8HA 4TQSA 1FK9B 3H4BA 1NNDA 2M8HA 1HYSB 2FVCA 2H51B 5KFZA 1U8SA 3ZZZA 3PKMA 1KP6A 5E33A 3W61A 3RJMB 2BM0A 3C19A 2AYGA 5EDWA 3TA1A 3UWTA 2PN6A 2LCWA 2OI2A 2RF2B 4RBUA 4X65F 2G13A 4FYDA 2O3DA 3T5JA 1VQPS 4YR0A 1HW9A 3H25A 3TUPA 3SQOP 2QSFA 1SJFA 4BC9A 1TUGB 2W2MP 3EGVA 1Q8LA 2FJWA 4C6AA 5MLCV 3D54A 3MEGB 5KFNA 5J2QA 1U1MA 2HMIB 2OO4A 4P73A 5ETQA 4G3IA 4W4MA 4LSLB 2AKWB 2BKNA 5D15A 4UF4A 2F7VA 3OD2A 2BUNA 4U9RA 3BGRB 3W9HA 1N34F 4ZKAA 5GADU 4JI0F 3SV4A 1QAYA 1Q1KA 4F4AA 5F8JA 2MKYA 4WP8A 4CT8A 3K8WA 3NS6A 5HROA 1YIJS 4LF5F 1TZ0A 4J9SA 3F56A 3HDSA 4IH6A 4G1IA 4LUBA 2FPHX 2W2NP 2ZM6F 1S72S 4QYZJ 1HNVA 3LP2A 2QMXA 4UW2A 3QIDA 3I6PA 2NS1B 4CLUA 5CXTA 1S4EA 4AD6A 1BXNA 2HNDA 4HTIA 1N32F 4DR6F 1UEKA 1VMBA 1B0PA 3AQOA 3LGNA 2AEMA 3BREA 3SEOA 2F8MA 4OI3A 4WK1A 4C11A 2COLA 3MR5A 1RA6A 1R89A 3NEKA 1FKAF 1N54B 2JFKA 1X4DA 4P2MA 2V2QA 5KG0A 2Z2LA 4ED8A 1NPPA 2E1RA 1I6JA 2DR8A 3LAKA 2HMIA 2RUSA 3EDQB 3PW5A 4DR6J 1W2IA 4PYDA 3MURP 4NE9C 3G6ES 5I42A 4B3TJ 1YK9A 2FHMA 2XMWA 4OYPA 4WFXA 2IVYA 5ETTA 3TA2A 5LMUJ 1TKZA 2D41A 4C3LA 1GEHA 5LMUF 3OXFA 3N9UC 4OLOA 2GQ2A 1LW0A 3TZWA 4NA3A 3TARA 4YHHF 1ZM9A 2ZVIA 2MHNA 4HLBA 3D7SB 3F0NA 2FHJD 2E1MC 3FBCA 3ZC4A 4DUTA 1HWKA 1C0TB 3KHRA 2WB1D 1IKWA 2WSCC 4O3NA 3ILLA 3TR5A 3NXZA 4OMFG 3OR2A 4XPEA 4YHHJ 4LR7A 1W25A 4C11B 5T14A 5AJ3F 1NPKA 4WCEQ 5SZTA 3WIUA 3CJ5A 3A8JA 3N6NA 4C97A 4CH0S 3L3CA 2JLEA 2GAGC 2BVZA 1S0VA 1VBXA 2B8QA 2QL7B 1VBKA 4FXVA 3WIVA 3FFIA 2W7PA 5HLFB 2VHGA 4FS2A 2KFNA 1UEUA 2A6OA 3LTOA 4O0NA 2KFYA 2DRDA 3TZZA 3D28A 2R8KA 3R5DA 3H42A 4UQTA 2HGMA 1UA0A 3VQTA 1ROFA 3CD6S 1FF2A 5IQ6A 3CDAA 1WSRA 3GYXB 2XGQA 2MHEA 5I4MA 2AGQA 3MUTP 1J5OA 2CFXA 3BEGB 4MIWA 3OSPA 5KFLA 2XG8A 1IBKF 2HVHA 3A8EA 2Q43A 2DY9A 3JS9A 1AZSA 1XNRF 3ZNJ1 3ENWA 1T03A 2A10A 1U1RA 2FLPA 2E9TA 1RABB 4OYOA 4JI3F 4M94A 5CD4A 1M90T 1JLEB 3AOCA 1B4SA 2OTJS 1JK9B 2C2EA 1S49A 1GT8A 1NK9A 1S1TB 2HIYA 3CD0A 3KUGA 4DMZA 3D0GE 5BYSA 4RZRA 5LSOA 3N6MA 2AD9A 2LEAA 1RTZA 3UPFA 5D4OA 3M8RA 1RTJB 1YJUA 4DPOA 1Q53A 1XMBA 4J7CA 1LWCA 5KOXA 3UR0A 2VIHA 2HK3A 4CLTA 4NXMF 3M2RA 3MEDA 5KFEA 3J7ZT 2M4MA 2O5DA 5L38A 2ZH2A 2FLLA 3HULA 2BJ3A 2K7JA 1YLXA 1B7YB 3D6TB 4ZPVR 2UVRA 3VZHA 4J37A 4A8YA 5H9EK 2NPFA 1GTEA 3ET6A 4M5IA 4ED7A 3D4JA 1Z2LA 2UXDF 3CE8A 2EC0A 2GZOA 3CIZA 4KC5A 1F2GA 3ISZA 4PQAA 1X5PA 3TAPA 2VICA 3PHTA 2YWWA 4MAKA 4DS5A 3CCRS 1R43A 3OR1B 1X5SA 4NXMJ 3GIMA 3ZZTA 3LAMA 2Y0SD 4MK7A 4WU2A 4A8OA 3BN4A 4WFNQ 3TAMB 3MD3A 4AQYJ 3NGKA 5D8HB 4QWBA 1VC5A 2CIMA 2JZ5A 1RJJA 1ZH5A 1S6QA 3Q24A 3AFGA 1NB7A 5HBMA 3HHLA 1DHMA 1TL3A 2OLWA 4FZVA 4KO0B 3I56S 3SV3A 4B9SA 2C2MB 2QX0A 3FBBA 1X0PA 3M8WA 3I4PA 3P96A 1TELA 2W25A 3MCOA 3QT5A 4TVAB 4ZVRB 5ADZA 3HT3A 2I1RA 3ZTRA 1IBCB 4D3GA 2Z58B 1LK7A 1RWPB 2FY8A 3ITHB 4ID8A 2HEKA 1ZPVA 2GIRA 2N82B 3OR1A 3CJRA 2MTLA 3ZXWA 1U1PA 1U4BA 3AOAA 4IG0B 3V2UC 4X62F 2K06A 1H74A 2XYHB 1HWIA 1U26A 1WWHA 3AB2B 3V5RA 4CYUA 3TAMA 1FKOA 4YDDB 5JUMA 1I5OB 5C42B 3Q86A 4E98A 3M8SA 3TAQA 4TYAA 5H9FK 2IJNA 3ULHA 1N5VA 2KT5A 4NCGB 2DEIA 3H40A 4MYTA 3KK1A 4ED5A 5DO2A 2OELA 3HHDA 4ZS6A 1MLAA 2MEWA 4Q8FA 5CD4H 4EMDA 1FEEA 3C15B 1RT3A 5HQ8A 1AB8A 1HD0A 2HNZB 3IAS9 3R9LA 4YR2A 3RG6A 1VRTA 2DGSA 4USJC 4OI1A 3M6UA 2FJAB 2B43A 4WXWA 3RAQA 1RU2A 3T5KA 1DURA 1UFLA 2PE8A 1ZBTA 1QTNB 2L41A 1RGVA 4DR4J 4XK8C 5C7PA 3CCES 3DM2A 2YBVA 3BQ2A 3CJ4A 1YQHA 2E5HA 1T9UA 4H4OB 5DGAA 4JI7F 3ETMA 8ATCB 1YBTA 5MAOA 3O6QA 5IOLA 5G4DA 3WBZA 2WONB 2HS0A 2VUGA 4IYQA 5F8HA 3GFHA 1TKXB 4NLQA 1VS3A 3QO9B 2R7QA 2NLWA 5CAAA 1UCNA 2CQPA 4QIFA 2NXUA 4Y0FA 3KK3B 3CCUS 4FF1A 1M5KC 2AX0A 1UZHA 3KLIB 4U6PA 2J9CA 5THWA 3MMBA 4GMKA 2BR0A 2YY3A 5B0EA 4EBDA 1OPZA 4YFUA 2BACA 1OY9A 3ELHA 1N0VC 1JXLA 2E1CA 2X1AA 4KGZB 4OYAA 5J1NA 2WK4A 2XZTB 1T8EA 1S0MA 1BWEA 3BYPA 1F5BA 1U6FA 1KOHA 4HHHA 2YWKA 4O4GA 3W8GA 1KVKA 3HF5A 2C2RA 3BGRA 4FVCA 3QGPA 4J9LA 1GNKA 2EFPA 4YB5A 1U1NA 4D3HA 3CSKA 1NHKL 1TV6B 4P74A 3W2VA 3PV8A 4DSLA 1VQ6S 3GIIA 5DG8A 1S1UA 4KB7A 3UCZP 2EKNA 2EW9A 2KDOA 2OUGA 3I0RB 3MM7B 3O8WA 3RB0A 3W8PA 1RACB 1RCXB 1MN9A 4CO3A 4TQRA 4M5NA 4ZVEA 2VFSA 2OPRA 4QYRA 1APSA 1FRLA 2DR6A 1L3UA 4ED4A 4QU6A 4ZN3A 4BBYA 1CJVB 2EFOA 4KRWA 1VGYA 1K73T 3CC7S 1FFSB 5IXUA 2XULA 3OV7A 1RQ0A 1S76D 1H2TZ 2OSQA 2Q79A 4FYXB 1UP1A 1VISA 2PMWA 2UUBJ 2CJAA 2BJ9A 4NLUA 2E7XA 2KZZA 2BEFA 3ZTPA 2NYHA 2D3OR 3S7RA 2FLNA 2HHHF 3RW7A 2PI5A 3KNGA 3ZTSA 4LF8F 2ZBIA 5DS7A 1FT8A 4USKA 2YKQA 2XB2D 4Q0BB 3GPAA 1HQEA 1JJ4A 5HQLA 2VFVA 2V8HA 3CIMA 4CO2A 5IV3A 2H54B 1V6HA 1U25A 3D67A 1MMLA 4A8KA 4KGKA 1YI2S 2XYGB 4ZP6A 2POKA 1QDUB 4F0MA 1G6BA 2R7OA 3CO0P 2QLBB 3B54A 4Z2XA 4YMEA 4KR0B 1WSVA 3MMAB 1RISA 2FTRA 4ZCKA 3QGHA 2UXBF 1MMDA 1S57A 3FBEA 1EHWA 4DR5F 1CJUA 4TY9A 3CDUA 2QSWA 3M8PB 3VVTA 5C24B 4AL7A 2I6WA 1N52B 1S0NA 3LF0A 1K1SA 3DLLQ 5KFMA 1HBOA 2W9BA 2RDJA 3S6EA 2B9XA 1TMJA 2FZCB 2VASA 2ZD1A 2NZCA 2GJ2A 4I2PB 2EKYA 4ED1A 3G2XA 3S01A 2FUG9 3R1HA 3RUBL 4HACB 4XIUA 1U1KA 4CNZA 1TK0A 3AQPA 3OXLA 3UDLA 1B0TA 3W9JA 3G8TA 2P9GA 4DR1J 2UUTA 3SBMA 4X4RA 2GMJA 1NSKL 3DCAA 1UVKA 3LUYA 1G7CB 4M5KA 5GVQA 3T19A 3LWLA 3M8QA 5KFQA 1RWXB 4IG3A 1H0HB 5D77A 4LF9J 3BH6B 3I9ZA 1WHVA 1UAWA 1WF1A 3QQCD 4LFCF 4ZP8A 2MXYA 3LALA 4H54A 4NLVA 5KG6A 1CJUB 2FVRA 4E8UA 4UY8T 2ZBQA 1C2PA 2W24A 4LF7F 2OPPB 3FEXB 2LU1A 2CPZA 3LP0B 3OPKA 4ZVGA 3GG1A 4LRBA 4QIGA 1Q81T 4ID5B 3MEEB 1KLMB 1LFWA 2ZNYA 3CCTA 4TY8A 3ZZPA 3UR3C 2MJNA 3IR6B 2MQQA 1XR7A 4ECXA 1WI8A 3NNAA 2DGXA 3CT9A 4TU8A 2YQ3A 5CYMB 1ZOTA 3HFVA 4M5JA 1RCOB 2HHWA 2XEXA 2LQ8A 3QT7A 5IFMA 2QYCA 3QIPA 2UUCF 4PWWA 4YUDA 3C6UA 3TUJC 1F6TA 1R0BG 2BQUA 4JI6F 1MWYA 1YWXA 4J9VA 1R8HA 2DGVA 3T9ZA 3CO9A 4H4KC 4LRDA 4Q44A 2MSSA 4L73A 3PACA 1HMVB 1FWLA 3LQVA 1UEVA 4RR5A 4USIA 4X66J 3DRPB 1D8YA 2OPPA 4NEYA 4XO0A 5B09A 2XMAA 3ILIA 4G1PA 1JXVA 1JMTA 1M0SA 4NZ6A 5B0CA 2KG1A 3V81B 4JI8J 3G96A 4QWAA 3EXYA 2ZC4A 1NJWA 4DR7J 3GP9A 4FNIA 4X66F 1NXIA 1WC3A 3NS5A 1S9FA 5HBMB 1WC4A 5IT9Y 1TL3B 1FFGB 2FGOA 3M32B 4O44B 4A47A 2VU5A 4B3OA 1TQLA 4MFBA 4OYBA 3T6JA 1FTCA 4ANCA 3OL7A 5B0FA 2XC9A 4DV4F 2AJ1A 2JLGA 4JI6J 2DT9A 4K2JA 4YOEA 1MN7A 1PJ5A 1KFDA 1VFJA 2HQFA 2VFRA 1FFWB 3ETOA 4TN2A 5HATA 5B0BA 1JKHA 2W9CA 1T9XA 2J8SA 3DGPA 4K4YA 4LF6J 2XSJA 1Q0NA 1X5OA 3C6TB 5IT0A 4EZ6A 3AJDA 1Y5IB 3LGMA 3D6FB 3K58A 2FB0A 1DLOA 1MNEA 3HSJA 4QJVA 4CYUB 4ZMMA 1HBMA 3WX4A 4UOFA 1VRUB 3HFKA 5F3TA 4ELTA 3A1YG 3KJNB 1X9WA 1AA1B 1O6XA 2CPXA 4OYIA 3OUYA 4F3OA 4IUFA 4OYXA 7FD1A 2BE9B 3NGSA 4RBTA 4OX9J 4QPXA 1RT3B 1WC6A 3TUIC 3DI6B 3US5A 2OH2A 4PRFA 5E3QA 1VRTB 1OJ4A 2O66A 3B4DA 1KRPA 2AYMA 4EK2A 4JV5F 2Z4PA 4Z37A 1NKEA 3DOMA 2GVZA 4B3RF 2ZBPA 1NUEA 1JKHB 1P9YA 2DNZA 1JLAB 5G0RA 3AD8C 2EEYA 4OZ1A 4ECTA 1T9YA 2DO4A 4H4OA 3AT1B 1P1TA 2HAIA 1JLCA 1WDDA 1DLOB 2ZH6A 3M9OB 5ITHA 2V8GA 2DXDA 2HPUA 2WVCA 2KT3A 3UN3A 5E3CA 2KM8B 3VGVA 4IFVA 3L7OA 1CBKA 4NI2B 2MZJA 3RTVA 1HNZJ 2CVIA 2I9SA 4ZPWR 4M5DB 4I68A 1TKXA 3TOQA 1NJIT 1MROB 3IRXA 3LA0A 2G2OA 1SKWA 3CW2C 2HRUA 3CJ0A 2DY1A 2X3DA 5JMNA 2Z0GA 3KLIA 4QWDA 4Y2MA 4LVOP 2AF6A 3UNYA 2G0IA 2R8IA 1B7FA 3K5NA 2MKCA 2MZ1A 3GJQB 2V0NA 2MKJA 2GVZB 4K8RA 4KV8A 1S97A 1S48A 4B9TA 3KJVB 2YH1A 2MZTA 4O4GB 3W9IA 4X4PA 2F5GA 1H73A 2WBMA 4WP3A 3G8SA 2UXCJ 4WFZA 1NSPA 4ED2A 4WKYA 3V4IB 1N4LA 3I4HX 2E1PA 3F41A 2R7TA 3BZQA 1TVRA 5DQIA 4F4ZA 1PCAA 2DR9A 5EX3A 4USTA 3J7A1 1C0UA 1FE4A 4I69A 4GC7A 2DH9A 4PXCA 5LT5A 1RHQB 4NI2A 3W2WA 1NK5A 3OJSA 1TL5A 2CJBA 1NO8A 2HQIA 2J0WA 4G1QA 4L74A 3L7PA 4DSIA 2E7VA 2XBPA 5ETPA 3I0RA 1SIZA 2M0GB 2SXLA 3JAMY 1TKTB 4QCLA 3KLEA 3BKUA 1SXLA 2H5JB 2DD8S 2FDNA 1V5IB 4F4WA 1S6OA 2QFIA 2OPRB 1N33F 2MQ8A 1H2VZ 1KSPA 3MF5A 4FYYB 3VGTA 1TL4A 3VR1A 2BE7D 4M1KA 5LSLA 4F4YA 3J81j 4C8OA 3UDCA 3UO0A 4P2XA 4KBIA 1SJRA 1PG5B 2H65B 2YNIA 4NLTA 3PG9A 3HM9A 3MWBA 1QTMA 4ZP9A 4UTGA 2NQPA 4LIRA 5K5MA 4RW8B 1FO1A 2F63A 1EIYB 4CH7A 1S12A 5IM0B 1RP5A 2KN4A 4DJBA 4DV4J 3TA0A 1IBMJ 3R7BB 4LJMA 3E01B 5J1PA 4CLSA 5A8WA 3FNNA 4ER8A 2HK2A 4K2XA 1IJEB 1UVMA 2HLTA 3H2LA 5F41A 2DHXA 1P9QC 1WORA 1UJ6A 3IGNA 2GQCA 4OIXA 1UVJA 4DR7F 1D0EA 1XR5A 2LXFA 4ICLB 1YTYA 1U24A 3T5LA 1BHNA 4FN5A 3D3BJ 3PRDA 3I5CA 3PCOB 1RI7A 5ETVA 4RNFA 4C8KA 2DNRA 3BN7A 3OBIA 4OZ2A 1A0OB 3OTDA 4P2FA 4TYBA 5KFSA 4UOGA 1HHTP 4ILMA 2CZ9A 3D1OA 2YNIB 4TKTA 4ATNA 2E29A 1D1UA 2BOPA 1DTTA 5JVGQ 1IR0A 2DBBA 2WVEA 2OPQA 2Y0BB 3M7VA 3G82A 5F0WA 5IC6B 1VQNS 1NKBA 2WBRA 2MLYA 3BPDA 4B3SF 3I31A 1G3OA 1F3VA 3ICLA 2W9BB 2H5IB 4LF7J 1XMOF 3C3LA 1RBAA 4F26A 4DSJA 3E01A 2V50A 1NDLA 3H7HB 4U96A 4ZVSB 1NK0A 3FCHA 3PRBA 4GC6A 3C14A 2BYCA 4AXIA 5L8RC 2FZGB 1H72C 4P72A 4ZPAA 1CJTA 5HMWA 4USHA 1VI7A 4MIAA 3I96A 4AYBD 4F36A 1DY3A 1RXOB 2BRKA 3NBPA 4OHYA 1CLFA 4PG7A 4DV7F 2DPIA 5BJRA 4L75A 2BRLA 2DIVA 3H59A 4URSA 4LQ3A 1Y7PA 4MKBA 2ZE2A 4FBUA 4ERDA 2HBZB 5K9FA 2HSEB 2UV8A 4C7QA 2KU7A 1JLFA 1HARA 3IN5A 3VALA 2BJ8A 2XZWA 4DQSA 2OPQB 2RH3A 2VD3A 4WFBQ 2AGPA 5GMKa 2JNJA 1HW8A 2G0CA 1ACMB 3T9NA 2VA3A 1RAEB 3J7AN 3JSMB 3LP0A 1SQEA 5DDOC 1R0AB 4X4QA 1T9WA 2M8DB 4F0HA 5DQGA 1JJ2R 3GFYA 4DL2A 3PKYA 4OL8A 1BC6A 4NZ7A 1FDNA 3QLHB 1W26A 2DCUB 2UXDJ 1RSCA 2AEFA 3NBPB 1S1WB 2B5JA 4RW6B 1OWXA 4AQYF 2BX6A 2ROEA 4K5RA 3O5TB 1P1LA 3QIPB 2GX8A 2ZE2B 4IKAA 1N32J 3VGSA 4OQJA 5KFOA 2BW2A 3OQ2A 4NLSA 2Y1JA 4LF8J 4ZA1A 3HO1A 1B99A 1TUVA 5M2RA 3QJJA 4ZLLA 2RRBA 8RUCA 4X2BA 3IMQJ 1J2VA 4ZIWA 1HHSA 4DI6A 4F4XA 2KVQE 3S1TA 2A18A 2IC3A 2C22A 2QA4S 3MAAB 4NCBA 3V81A 2R2RA 3UVJA 3DXBA 3IR7B 4R8UB 2OAUA 2ATCB 5IC4B 5E3RA 3JQKA 4YY3F 1VIXA 2DH8A 1ZA1B 4RW4B 4WFAQ 2W2OP 3MMCA 3J7Z5 2XY7A 4DUZJ 1YBAA 2ZHBA 1NHUA 2OD4A 2QJ3A 3BBFA 3GR0A 1HI0P 1JX4A 3K0JA 5KFXA 1S1VA 1HNXF 4GKJJ 4F3QA 1KS2A 4DV5J 2MLXA 2OGUA 2QLWA 3TEHB 4PWDA 3OL8A 2XS2A 1RT5A 3PNIA 3WC0A 3JQJA 3IAM9 4DEZA 3H2UB 4HDGA 4ZJQA 1RBOB 5BYQA 4UT4A 3DGPB 1X7VA 2PA3A 3RAXA 2X1FA 1QAIA 3LO3A 1H7XA 3C6TA 5KG2A 4F8RA 1RAFB 2CZVC 3BDEA 3RBDA 3R5CA 2GIFA 2MKKA 3K5MA 4WKRA 3I0SB 2YX1A 4ILRA 3MAAA 3KKFA 1XNQJ 2JEJA 1BQMA 2O1PA 4LRCA 3CJKA 4F67A 1XMQJ 3MXHP 3MAQA 3NP5A 4YEAA 2BKPA 3EGNA 3QYYA 3VAKA 1FNXH 4NXNF 2DNKA 4AXJA 2KYXA 2IVFB 2CQIA 1WNEA 3QJLA 1PJ6A 3OFGA 1NDCA 2MB0B 3MM8B 2R8JA 4ECQA 2YNHA 1FRHA 3ILOA 4DV1J 3K2YA 3CULA 2HQGA 4GVBB 5HVHA 5KT3A 3EX7B 2JRSA 5LJ5Y 3PEJA 4J91A 2LKZA 3NGRA 3SCKE 1JLAA 5G0RB 4EFAC 2HWTA 1UETA 2YKMA 4FF2A 2CWXA 4DL0C 1L3VA 3QSYB 2X1BA 3C2PA 1A6LA 1JLCB 2HGLA 5JJBA 1ZTWA 4MIBA 4OHVA 4YQWA 2FJVA 2VFUA 1OSCA 3MM9A 2KH9A 3HXMA 1DTQA 3RB4A 1BMQB 3CVKA 3SFUA 2B6AB 5AJ3J 4DF8A 3BGOP 4IFVB 3IFEA 1V3SA 2H1YA 3ENVA 4ZDNA 5L9XA 3CUNA 3HVTA 4DR4F 2E1AA 1XBWA 4Q5VA 4KJIA 3KOAA 4B17A 2DNGA 2YWEA 5GMDA 5C5JA 5A8RA 1HD1A 5CYQB 1EETA 1LWXA 3C16A 2M52A 2HWHA 2WOMA 1MMNA 4I56A 1RTDA 4IRDA 4M5HA 2BQ3A 3OFFA 5T7LA 4K4TA 2EBGA 1BGXT 5H9EJ 3AJ1A 4X64F 5IV4A 3DDNA 1EZZB 2ZBRA 5CA5A 4ECVA 4MH8A 2R7VA 3OFHA 2IJRA 4U8YA 2V8DA 4H4MA 2FJEB 3SI8A 4FVMA 4X4NA 4PUOB 2CQCA 2KB2A 1N34J 4HTJA 5B7WA 3CJTA 3MUMP 1D8ZA 2HFUA 3D1QA 4Q43A 2FHOB 4G65A 2G1DA 3AB4B 1SL1A 4MKAA 4WTOB 2P5VA 1V3ZA 3L7UA 2YNGA 3U1LA 4RWWA 4Y65A 2VPWB 4K4XA 3PW7A 1WHYA 2PD1A 4ZCLA 1TL1B 3MM5A 1KOOA 4G1QB 5IQQA 2A6MA 2C1EB 5LL6d 2IA6A 1LWEA 2CJ9A 2EBEA 3FSYA 5A8RB 3B6BA 1EETB 3OTCA 3FMWA 4F25A 4PEOA 2UVWA 4FPRA 3C16B 3W60A 4C8ZA 5EWGA 2OMOA 4ED0A 1SUQB 2HLUA 2V9WA 4KPYA 2CAJA 4UZCA 3LWMA 3HHLC 4ECZA 1SH0A 1HR0J 2KHCA 2NXEA 4N41A 3MM6A 1E6VB 2GIQA 1WF2A 3NGTA 3TX8A 5D3GA 1M1HA 3BR9A 3ZO7A 2EVZA 1WACA 3HPOA 4USMA 2D3UA 5E3PA 2Y9HA 1LKZA 3VCDA 2P9EA 2AYBA 6FD1A 3GJRB 4X4OA 4EO6A 5IZHA 2VBZA 1SC1B 7FDRA 3RU0A 1R6VA 3LGHA 4ZCIA 4RL1A 3ZTQA 3FKBA 4IR9A 3KLHA 4LF5J 2DNHA 2Z8QA 5C2GA 4RO0A 1PIEA 3HI9A 1LWEB 1RTIB 4YR3A 3N5FA 2YNFA 2ZDPA 4O3QA 4KPCA 3IA0A 4I64A 4OZLA 1HPZB 1NSAA 2FGCA 4ZHRA 1NK6A 3CJSA 1UWBA 5F8GA 1BQNA 3UN2A 2BQRA 1S7IA 3CC2S 4DR2F 1YJRA 2HHQA 4Y28C 2CG8A 4C3MA 5BR8F 4RW7B 4PUOA 3H2VE 5KFAA 2G4BA 4TLRA 3KDOA 3MTKA 4CI0B 2MGZA 3KK2A 1LNQA 2ABYA 2QL5B 3DC2A 3KXDA 3EVMA 1VOMA 3A3PB 5ETRA 2Y3YA 2PI4A 4U7UD 4ZP7A 1FRIA 4KYZA 2KT2A 1KD1T 2DYAA 1Y9OA 2K2PA 1YVFA 5D0RA 4P10A 4QBUA 4EEYA 1RU1A 5D4NA 4IOBA 3M9NB 3KLHB 3ENQA 4DL5A 5D0GA 3C14B 4LF2A 2B7BB 3WC2A 1IKVA 3K8VA 1KDNA 2ADBA 3J80U 3FDSA 2ZBCA 3FEYB 2PDAA 3SDEB 2XWXA 5C25A 1GTHA 3BSAA 3IM8A 1UWBB 2MZQA 2LXUA 1S9EB 2PGCA 1KKHA 4RPFA 4ITSA 3CCJS 1TAUA 2M88A 2CNLB 3G86A 3VF0B 2JEGA 3M9MB 1H38A 2DJWA 2NUUG 1U6ZA 2R2TA 1HQUA 3MCMA 2UUAF 1JLFB 2HNYB 4M5LA 2M5YA 5DETA 3HX9A 2MGZB 1MU2A 3KK2B 4GKKF 2HFNA 4K0KF 3UD5A 3G8QA 2CZ4A 4I0WA 2RJZA 5DLGA 3K59A 2GFFA 2CQ4A 1B70B 4FXWA 5CYJA 5EWEA 2GVDA 1Y5NB 3R3TA 2YWFA 4HYKA 5E7OB 1SL0A 2BANA 3PYFA 1FK9A 5E2QA 1HR0F 1HYSA 2HW3A 3DRSA 5A76A 1WHXA 5EHHA 2W8LA 2U2FA 1XK8A 2CQ1A 2XLJA 2VZ9A 3R7SB 1NCLA 1HFEL 2V6AA 4NYZA 3QLHA 5DGBA 4O3RA 2FJBB 2ZH9A 1PC5A 2ZJRQ 3SDEA 1RBLA 5C25B 2IFXA 4HDHA 3PEHA 1S1WA 2GW8A 2LVWA 5KFPA 2DGOA 3G87A 3RRHA 2UUWA 3TYTA 1S9EA 1S9GA 2PO4A 4DUYJ 3HVWA 2KTQA 2CQGA 3H5UA 2PFDA 2GMHA 3QATA 3SCLE 4CM0A 4EBEA 2V5HG 1R31A 4PXDA 1NK8A 5KT4A 2W2QP 1PYTA 1JNZB 4DV3J 1MU2B 3CJQA 1RYSA 4DG1A 3KLGA 3M2VB 2K3IA 1RE1B 4JV0A 2GHWA 4DZDA 1FESA 2I5JA 4RUAA 1YJWS 2IMWP 1G2EA 3VWSA 1X4EA 2QA4G 4EZ9A 4K4UA 3GWCA 2BANB 2C3YA 4BCAA 3FBFA 2IM2A 3DRSB 1WD6A 3NL0A 4QIVA 1N6QB 2L9DA 1IQTA 4DV2J 1NJZA 4Q45A 3LP1A 3MFHA 1IN0A 2BJEA 2BJDA 3HMJG 4KQZA 4J9PA 5HJYA 4B9MA 3ZTOA 1NBEB 4C4WA 2ATLA 2XYPB 1RWNB 2CXEA 4ZJLA 2CQDA 3TO8A 4NOHA 4WF9Q 2CPEA 4PWDB 1TFWA 3X3UA 3CF5Q 1BE4A 2EG1A 1VQ7S 2C3PA 1JLGB 2VA2A 1CSJA 3MUVP 3BF4A 3TVYA 1XC9A 2IIHA 3ISND 4C2MA 2VH7A 2X1GA 1TAQA 2CUYA 1UFKA 3T1HF 3G6YA 4B3SJ 2W01A 4GRSA 2D1CA 4PG8A 5HN0A 1T9VA 2G9OA 1PGZA 3U02A 2RU9A 1V9OA 1FJEB 4LIWA 5DZ7A 4DN9A 5KAKA 1BQMB 1XN9A 3CCMS 3KJFB 4OZNA 1M5VC 2UUAJ 3LP1B 3CMAS 5KFFA 5ETOA 5L1KA 1N5YB 4CM2A 1OYDA 4DZ6A 3P45B 5A8KB 5CCLA 1G4CA 3DYAA 2RKIA 1IKWB 2OP5A 2LFVA 1SC4B 1RWMB 2DHSA 5K8MA 4EYIB 3OR2B 2HFOA 2KXHA 4OFZA 1RWKB 3BGUA 4USUA 2I2YA 4FKYA 1D3WA 4ECWA 5CABA 1S0OA 5LM7E 3ZZYA 5HVGA 2BKOA 1X31C 2DEJA 2YKMB 5HJXA 2MDAA 1IXKA 1PBAA 2RIJA 1RHKB 4R5PB 2HYIB 1NDKA 5HMYA 4B9LA 3MM9B 4WZQA 3DRXA 4X84A 4YDXA 3PX4A 2B6AA 4OHXA 3UD4P 2KJWA 4CDIA 3GTYX 3MR2A 3QT6A 5GAHI 3BO3A 3VAIA 4JI2F 4KGXB 2VQFF 4DUZF 2W4PA 1UW4A 2DK2A 4IR1A 4DQQA 3DYAB 2HBYB 1FDAA 3DXSX 2RQMA 3EGWB 4ZCMA 1YZ6A 3CD7A 1GMVA 2E5JA 4CLFA 5T7LB 1RK8A 4UQGA 2GCFA 4KHPF 4R25A
chains in the Genus database with same CATH topology
1VQLS 1O5JA 5KOWA 2GV1A 4H4MB 4ES1A 5F9LA 1SL2A 1YG0A 1H3DA 2ZH5A 4KFBA 4PUOA 1KTQA 2EFNA 2MQLA 4NLDA 1S99A 3WZ0A 4CTAA 4W92B 2KJVA 1QY7A 1DQAA 2A2DA 4L3NA 5E41A 2W8KA 3E8OA 3U7JA 1HNZF 3M2RB 5HMXA 1J5EF 2KFZA 3DLEB 1HA1A 4NLPA 3Q8PB 4OX7A 2HG4A 2JDJA 3POTA 3IWNC 1KQFB 1ZPWX 2QT7A 4LQ9A 4XDDA 3HJFA 4DV5F 3D1HA 4M95A 2AJQA 4CT9A 2XSFA 3QZ8A 4PXBA 2LQ9A 3MM6B 5E5NA 1IKXA 3R27A 4DFKA 4ES2A 3G6VA 4UUWA 4AL6A 3BQ1A 3GG0A 3CCSS 3EZ5A 3THPA 1CPZA 2ROPA 5HL7Q 4A8WA 5SUHA 2OKQA 4MMOA 1RT7B 3IBWA 3M6WA 3DLEA 3VAMA 5AXKA 1KEKA 3NAIA 1XTZA 1RTIA 2DH7A 2ZH3A 2LECA 3HHLB 3CMES 3S8SA 1VBYA 4PQUB 3CCVS 4DLGA 1JJHA 2E5LF 1Y5LB 1BQNB 4DR3F 3T3FA 4Y2CA 3OW2R 1VQSA 1V3RA 2H9ZA 3SSQA 2OIHA 1RT6B 2Y1IA 2ASJA 3SQGA 3K5LA 3TP2A 3NNCA 1YRUA 3H5SA 5DDPC 2KXNB 1HWUA 3BSCA 1QUVA 3K5OA 4NLGA 2IM3A 3ZZUA 3AY0A 1RT7A 1GQEA 2HIQA 5LSRA 2XMTA 3LPYA 3M4XA 2QFJA 4NA2A 4O3PA 5K8NA 4RNNA 1X4AA 2PC6A 3CCQS 1C1BA 2XLIA 3JYTA 4PG5A 1QLNA 2CRLA 4BC7A 4PQUA 1FXRA 3OVAA 1UJ4A 2GMLA 4ZPCA 3H5YA 3GV7B 2E9RX 2QRRA 1RT6A 3F73A 2RQCA 4OX8A 2Q6CA 5IWAF 2RU3A 3PX6A 2HHVA 4JYAF 3DM2B 5JVHQ 1WELA 5BYRA 3M30A 1QM9A 2LA4A 3OSNA 1KLNA 3CC4S 1XERA 4WIIA 3TNVA 1ZM3A 5I3UA 1DAXA 2L08A 4B02A 3MTJA 3FGVA 4RNOA 4X4TA 1DQ9A 4WYLA 3D2WA 1IBMF 5H9FJ 2ZUGA 2UP1A 2XY5A 3GV5B 4HH1A 2MQNA 2VFTA 4DQIA 2AJ4A 2B3TB 3KK3A 2KI2A 2VBXA 1VJWA 2J0XA 2HNDB 4U7CA 4NCAA 1T02A 2K7KA 4IO1A 2IBKA 4WFYA 4MK8A 2BM1A 2XMMA 1P27B 1M1KT 2ASDA 2L9NA 4PG6A 1FHTA 3EPGA 2CJQA 3GB0A 1K0VA 4DFMA 2J9DA 4DG1B 3KLGB 3M2VA 3M2UB 4RU2A 4DR1F 1RT1B 3GZ7A 1K0TA 3DLHA 2AWZA 2MYFA 4J9NA 1VLYA 5B0DA 2ZH8A 4OJHA 4PG4A 5GAHU 1X0FA 4RLEA 2ZHAA 4NLRA 4M8LA 1ZZFA 3G9CA 3BO2A 3RW6A 2OFHX 2RF2A 4WYWA 4K4SA 2DRBA 2GA7A 3N6LA 4HI2A 2Q6BA 3U1NA 3DU6A 1IKYB 1DBDA 4R0EA 2EFVA 1NAQA 2CYYA 4QOTA 5A0YA 2U1AA 2DNOA 4ELVA 4LSLA 3FFIB 4ECUA 3UE2A 4DFPA 3M2UA 2F8EX 1RT1A 2PIIA 4QPTA 4RU9A 2JEFA 3CTRA 3D5MA 1N0UA 3SYZA 4H4KA 2KVIA 3TI0A 5DRKA 2J6UA 1OIAA 2XNQA 1R27B 3R5AA 4QQBA 2RVJA 1I94F 1FVSA 4Q0BA 2ZOMA 4J9OA 4N8OA 2HFZA 3FVYA 2UVVA 5AE1A 1WTBA 1N5TA 5KFGA 3CD5A 3MAHA 3MHYA 4NRTA 3KMQA 4URGA 4NLXA 2WAQD 1VQ9S 3DMJB 3EPIA 2C3UA 3MMAA 3QWPA 1F0XA 1O8BA 3IG1B 3HHKA 2B4VA 4HVZA 1LXNA 1Z2ZA 2HQ3A 3OXGA 5C24A 1TKZB 3RBEA 1DZ5A 2VB6A 4N5SA 3UD3P 1HBNB 1X4GA 4B3MF 2L9WA 3O44A 4F02A 1RT4A 4QIWD 4B9UA 2J6SA 1IBLF 5DM7Q 2N7CA 1NEEA 2UV8G 4EYHB 1OQ6A 3MMJA 2JWNA 3O1LA 3I55S 1LQ9A 3OFEA 4A8QA 5KT7A 3NCQA 3FZ2A 4RUCA 1HWJA 1R6YA 2RILA 1YJVA 2XCPA 3DMJA 1NH8A 4L72B 2DNPA 4NLYA 4A48A 2HHUA 4OZJA 3OL6A 1FE0A 2P6SA 3ZZRA 3SZ2A 2RS2A 3DFEA 4I67A 2NZ4A 4LT6A 1MWZA 3QGGA 1K9MT 4C9DA 2ZZMA 2B4UA 3POTB 1LOUA 4WE1A 4KKOB 1J5OB 2OTLS 5F8IA 4ZK7M 2O01C 2O67A 3SCIE 1PO6A 2ZC3A 2JC1A 1T03B 1WTFA 1F5CA 1UFWA 2JOQA 3MECA 2VC0A 3MI7X 4V19X 2JSXA 2JVRA 3C6UB 5AXMA 5KFDA 2IM0A 2FHJA 1LXJA 1ZAWA 2KM8C 3O2IA 4Y3CA 4DV0F 4P7TA 2IJFA 4ZPBA 2XI3A 2JL9A 3MEKA 4KHRA 3J80Y 3UNGC 5C42A 1UA1A 2RMLA 4DF4A 4CO0A 3IR5B 2E7WA 4GO7X 3KK1B 2AJFE 1S1XA 4IFYA 1IJFB 4WE1B 3TRGA 2FHKA 4P7VA 4RNHA 5KT5A 2C2DA 4X4UA 2RSQA 5L1JA 1Y0HA 3VTIA 2MSTA 3M6VA 4LSNA 3V6DB 1FVQA 2J9DE 3KG0A 5KFYA 1QSYA 3PDNA 5KFBA 3VAFA 1DRZA 4TU9A 2NSCA 4QW8A 3SQGB 3AH6A 1R7IA 4WK3A 5GAEI 4DSEA 1FKPA 3LANA 3PZPA 5IT4A 4QR2A 2XI2A 1HBMB 2CVEA 4JOUA 2IYGA 1VRUA 4HI1A 2WSEC 3X1LB 1SC6A 1S6QB 1O51A 3JYTB 1CVJA 4ECYA 4KO0A 4ES3A 2CPYA 4CCHA 4A8XA 4FNHA 3DI6A 4LSNB 3V6DA 1YHQS 1QE1B 3NRBA 3UCUP 1U45A 1L3TA 3R5BA 2DPJA 2UU9F 2J5AA 4FP9A 1C1CA 3CDBA 1HBUA 4F3MA 1NK4A 4IG0A 5LMNF 1NU4A 4I7FA 4F50A 5I3UB 1X9SA 1QVFR 3FMBA 1TV6A 3M1VA 3TVKA 3W2VB 1JXEA 5FD1A 2YTCA 3N01A 4C0HA 5DG7A 5F0UA 3AAWB 3MM7A 4CO1A 2Q1LA 2BBEA 4HL9A 2ZH1A 4ECQA 3BR8A 3E3XA 1BLUA 2M70A 3SMZA 2DNMA 3VZIA 5F3ZA 4N56A 2DR7A 2WSFC 2CQBA 3ZZ0A 1DFDA 3D0IE 3J7YI 2ZZNA 2CPIA 4IOCQ 5J2QB 1SJQA 4X4SA 3AA9A 3FSIA 4JI4F 1C1CB 3T1AA 4WTYA 3UW1A 3KJVA 3P5TL 2VPYB 3I87A 3SFGA 1N8RT 4QW9A 4ETXA 4Q8EA 1AROP 2EG2A 1S6PA 4I7FB 4BWMA 2JEIA 2IRUA 1HWLA 1C0UB 2QE5A 5HROB 5CZXA 2HHXA 2B4OA 3AA8A 2WONA 3DOKB 5U47A 2R2SA 1SJ3P 5CH7B 2YWGA 4C8LA 2JC0A 1HNVB 3LP2B 3IGVA 2VG6A 5LXYA 1WG5A 4GO5X 1TKDA 2HGNA 2V4RA 3FRZA 3I5AA 2R7WA 3MMBB 4DS4A 3CGIA 3MR3A 2CQ3A 4J9QA 4F4KA 1S6UA 1GXTA 3QJPA 4RX6A 2BDPA 1VQYA 4NMLA 1Q7YT 1OPIA 2EK1A 3GMGA 2LQ5A 4BDPA 3GE9A 4K4VA 2KRBA 4Q7AA 2PMHA 2ZJQQ 1IQZA 3MOJB 2CQ2A 3PHEA 2CPJA 3GYNA 1HBOB 1LW0B 4U7UK 3DOKA 1OSDA 5L9NA 2B9WA 4RBVA 1CEZA 4WXOA 3DNCA 4QR0A 3G4SS 1ZAXA 2WCXA 2BV3A 1SJ4P 4NLOA 3DLJA 3H20A 4PWUA 1U47A 1R3NA 1U48A 3M6XA 2EK6A 5EGYA 2NUHA 1WG4A 2I38A 4PPZA 2A3JA 3PW0A 1SH2A 3IG1A 4NWBA 4O3OA 4ZLPA 2AQ4A 5E3AA 1FA0A 4N47A 5LJ3Y 2JLFA 4KE5A 2MZRA 1E6YB 2FJDB 1FNMA 5KG7A 1TFYA 1RT4B 4ID5A 1KLMA