2J0TA

Crystal structure of the catalytic domain of mmp-1 in complex with the inhibitory domain of timp-1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
161
structure length
161
Chain Sequence
b'GNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERSTITIAL COLLAGENASE
publication title Crystal Structure of the Catalytic Domain of Matrix Metalloproteinase-1 in Complex with the Inhibitory Domain of Tissue Inhibitor of Metalloproteinase-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 43
structure length 161
sequence length 161
chains with identical sequence B, C
ec nomenclature ec 3.4.24.7: Interstitial collagenase.
pdb deposition date 2006-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2j0tA00
2OVXA 1EB6A 1QICA 1SMPA 2Y6CA 4GUYA 1JAOA 3KMEA 2CLTA 3ZUKA 4GR8A 2EROA 1HY7A 3F17A 4H3XA 1YCMA 3LMCA 1MMRA 1JAQA 1IADA 4H82A 2JSDA 1HFCA 3AYUA 4AXQA 2MZIA 2DW0A 1CGEA 4DV8A 1O0QA 1IACA 1YP1A 2QPJA 3DNGA 2OZRA 1G05A 3F15A 3LK8A 3AIGA 3ELMA 1CAQA 1JIZA 4JIJA 4H49A 4XM6A 2OW1A 3EDZA 2MZEA 5I2ZA 2OXUA 830CA 3N2VA 3LQ0A 4WK7A 2CKIA 2Y6DA 1IAGA 1SRPA 3WV1A 4A3WA 2O3EA 3DSLA 3LJGA 4AYKA 1SLNA 1XFUA 1ROSA 5BPAA 1KUHA 3F19A 4HX3A 4XM7A 3TS4A 4JQGA 1I76A 2DDYA 3SHIA 1GKCA 5I0LA 3OHLA 1KUGA 1XFYA 1JH1A 4FXYP 2MLSA 1K7QA 1D8FA 3LILA 1CGFA 1Y0VA 3EWJA 1EUBA 1Q3AA 2HU6A 2SRTA 3EDGA 4A7BA 1UMTA 5I4OA 3NX7A 2POJA 5I3MA 4JPAA 4IUWA 5CZMA 2O36A 1B3DA 4H84A 2OW2A 4L19A 3DPFA 2V4BA 4WKIA 4WKEA 1R1IA 3HYGA 3OHOA 2E3XA 2ERPA 4XM8A 1S4BP 1ZVXA 2L0RA 1G9KA 966CA 1HTDA 1FBLA 1L6JA 3DPEA 2ERQA 1ND1A 3B8ZA 1D5JA 1CGLA 2WOAA 1GE5A 3HBVP 3LUNA 1JANA 1XUCA 1C8TA 4WF6A 456CA 1BUVM 5D1SA 2A8HA 3ZXHA 3DL1A 4L6TA 2JNPA 2MZHA 1XFZA 2JIHA 2YIGA 3O64A 1CXVA 2X7MA 4FVLA 3B92A 3I7IA 3LJTA 1USNA 1ZP5A 3TSKA 1K7GA 1BIWA 1PWQA 2DW2A 2AIGP 2WO8A 3CKIA 4PKUA 2W15A 4GWNA 3F18A 4FXQA 1A85A 1BM6A 5I12A 3HY9A 1IABA 1C7KA 2X3AA 1B8YA 1HOVA 4CTHA 3EHXA 4PKQA 1DTHA 4DD8A 1BUDA 1XFWA 2OW9A 3U1RA 1GE6A 2OY2A 1JIWP 3WV3A 1SLMA 2JT6A 2PJTA 3KEKA 1JK3A 5B5OA 1A86A 2FV9A 2J83A 4AIGA 4Q1LA 3KHIA 1GO7P 1G12A 4I03A 2DDFA 2OXWA 3LJZA 5D1UA 3ZVSA 2USNA 1IAEA 2XS3A 1KUFA 5B5PA 4H76A 1BKCE 3RTTA 1CIZA 2W13A 4PKVA 1KUIA 3V96B 2AYKA 4FU4A 1UMSA 4XBHA 1WNIA 1BQQM 1XURA 1Y8JA 3USNA 3LIRA 1XFXA 2JT5A 4GR0A 2OI0A 3AYKA 3F1AA 3E8RA 5D3CA 4HMAA 4PKTA 1J7NA 1R55A 1CK7A 1HV5A 2RJPA 2TCLA 3L0VA 1KAPP 1IAAA 1BKCA 4ILWD 4IN9A 1BSWA 2W0DA 4EFSA 1D8MA 3MA2A 3LIKA 1K7IA 3HDBA 3P1VA 1OM6A 3B2ZA 1ZXCA 2J0TA 1EAKA 4IJOA 1OMJA 2FV5A 2X3BA 3KEJA 3LGPA 1CQRA 1OS2A 1XFVA 1ASTA 3VTGA 2XS4A 1QUAA 4I35A 4JA1A 4GF1A 4PKRA 1UEAA 1AF0A 1OM7A 1FLSA 1H71P 2W12A 3LQBA 5D7WA 2MLRA 5CXAA 1BKCI 1JKYA 3WV2A 3F16A 1I1IP 1BQOA 4WZVA 1UTZA 1FM1A 2OW0A 4PKWA 3KWVC 1G49A 2KRJA 1OO9A 5BOTA 1D7XA 1QJJA 1Y93A 5JMYA 3VI1A 3GBOA 1PWUA 1XUDA 3HB2P 1ATLA 4QKZA 1ZTQA 1OS9A 1PWPA 3UVCA 1JAPA 4PKSA 3K7NA 5LABA 1AKLA 1MMBA 4ZR5A 1GO8P 4G0DA 3P24A 5D1TA 3BA0A 4JP4A 4GR3A 4ON1A 4GWMA 3Q2GA 1HFSA 5L7FA 2DW1A 3KRYA 1MMQA 1YOUA 2W14A 3HDAP 1MNCA 2OY4A 4DF9A 4R3VA 3RTSA 3TT4A 1R54A 3O2XA 4L63A 1AYKA 2X3CA 1GXDA 1O0TA 1Z3JA 3LUMA 4DPEA 1KBCA 4J4MA 2E2DA 3KECA 4H30A 4XCTA 2D1NA 2N8RA 5I43A 1PWVA 1RMZA 4H2EA 3EDHA 3I7GA 1YQYA 1ZXVA 2YB9A 1RM8A 4H1QA 2RJQA 1DMTA 3Q2HA 1JJ9A 1QIBA 4G9LA 3L0TA 5D2BA 3LKAA 1R1JA 3DWBA 1SATA 3TVCA 3EDIA 5H8XA 3LE9A 3K7LA 1KUKA 1GKDA 1UTTA 3KMCA 1PWWA 2OXZA 4AUOA 5BOYA 3G42A 2D1OA 2K2GA 3HBUP 1ZS0A 4GQLA 1QJIA 1GE7A 1I73A 3G5CA 5CUHA 2K9CA 3HY7A 2OVZA 3EHYA 1R1HA 1MMPA 5L79A 1BZSA 1OM8A 1G4KA 1SU3A 2Z2DA 2I47A 1C3IA 3N2UA 2WO9A 3LEAA 1QIAA
chains in the Genus database with same CATH superfamily
2OVXA 1EB6A 1QICA 1SMPA 2Y6CA 4GUYA 1JAOA 3KMEA 2CLTA 3ZUKA 4GR8A 2EROA 1HY7A 3F17A 4H3XA 1YCMA 3LMCA 1MMRA 1JAQA 1IADA 4H82A 2JSDA 1HFCA 3AYUA 4AXQA 2MZIA 2DW0A 1CGEA 4DV8A 1O0QA 1IACA 1YP1A 2QPJA 3DNGA 2OZRA 1G05A 3F15A 3LK8A 3AIGA 3ELMA 1CAQA 1JIZA 4JIJA 4H49A 4XM6A 3EDZA 2OW1A 2MZEA 5I2ZA 2OXUA 830CA 3N2VA 3LQ0A 4WK7A 2CKIA 2Y6DA 1IAGA 1SRPA 3WV1A 4A3WA 2O3EA 3DSLA 3LJGA 4AYKA 1SLNA 1XFUA 1ROSA 5BPAA 1KUHA 3F19A 4HX3A 4XM7A 3TS4A 4JQGA 1I76A 2DDYA 3SHIA 1GKCA 5I0LA 3OHLA 1KUGA 1XFYA 1JH1A 4FXYP 2MLSA 1K7QA 1D8FA 3EWJA 1CGFA 1Y0VA 3LILA 1EUBA 1Q3AA 2HU6A 2SRTA 3EDGA 4A7BA 1UMTA 5I4OA 3NX7A 2POJA 5I3MA 4JPAA 4IUWA 5CZMA 1XM5A 2O36A 1B3DA 4H84A 2OW2A 4L19A 1OZ9A 3DPFA 2V4BA 4WKIA 4WKEA 1R1IA 3HYGA 3OHOA 4L7AA 2YUFA 2E3XA 2ERPA 4XM8A 1S4BP 3DTIA 1ZVXA 2L0RA 1G9KA 966CA 1HTDA 1FBLA 1L6JA 3DPEA 2ERQA 1ND1A 3B8ZA 1D5JA 1CGLA 2WOAA 1GE5A 3HBVP 3LUNA 1JANA 1XUCA 1C8TA 4WF6A 456CA 1BUVM 5D1SA 2A8HA 3ZXHA 3DL1A 4L6TA 2JNPA 2MZHA 1XFZA 2JIHA 2YIGA 3O64A 1CXVA 2X7MA 4FVLA 3B92A 3I7IA 3LJTA 1USNA 1ZP5A 3TSKA 1K7GA 1BIWA 1PWQA 1XAXA 2DW2A 2AIGP 2WO8A 3CKIA 4PKUA 2W15A 4GWNA 3F18A 4FXQA 1A85A 1BM6A 5I12A 3HY9A 1IABA 1C7KA 2X3AA 1B8YA 1HOVA 4CTHA 3EHXA 4PKQA 1DTHA 4DD8A 1BUDA 1XFWA 2OW9A 3U1RA 1GE6A 2OY2A 1JIWP 3WV3A 1SLMA 2JT6A 2PJTA 3KEKA 1JK3A 5B5OA 1A86A 2FV9A 2J83A 4AIGA 4Q1LA 3KHIA 1GO7P 1G12A 4I03A 2DDFA 2OXWA 3LJZA 5D1UA 3ZVSA 2USNA 1IAEA 2XS3A 1KUFA 1TVIA 5B5PA 4H76A 1BKCE 3RTTA 1CIZA 2W13A 4PKVA 1KUIA 3V96B 2AYKA 4FU4A 1UMSA 4XBHA 1WNIA 1BQQM 1XURA 1Y8JA 3USNA 3LIRA 1XFXA 2JT5A 4GR0A 2OI0A 3AYKA 3F1AA 3E8RA 5D3CA 4HMAA 4PKTA 1J7NA 1R55A 1CK7A 1HV5A 2RJPA 2TCLA 3L0VA 1KAPP 1IAAA 1BKCA 4ILWD 4IN9A 1BSWA 2W0DA 4EFSA 1D8MA 3MA2A 3LIKA 1K7IA 3HDBA 3P1VA 1OM6A 3B2ZA 1ZXCA 2J0TA 1EAKA 4IJOA 1OMJA 2FV5A 2X3BA 3KEJA 3LGPA 1CQRA 1OS2A 1XFVA 1ASTA 3VTGA 2XS4A 1QUAA 4I35A 4JA1A 4GF1A 4PKRA 1UEAA 1AF0A 1OM7A 1FLSA 1H71P 2W12A 3LQBA 5D7WA 2MLRA 5CXAA 1BKCI 1JKYA 3WV2A 3F16A 1I1IP 3DTEA 1BQOA 4WZVA 1UTZA 1FM1A 2OW0A 4PKWA 3KWVC 1G49A 2KRJA 1OO9A 5BOTA 1D7XA 1QJJA 1Y93A 5JMYA 3VI1A 3GBOA 1PWUA 1XUDA 3HB2P 1ATLA 4QKZA 1ZTQA 1OS9A 1PWPA 3UVCA 1JAPA 3DTKA 4PKSA 3K7NA 5LABA 1AKLA 1MMBA 4ZR5A 1GO8P 4G0DA 3P24A 5D1TA 3BA0A 4JP4A 4GR3A 4ON1A 4GWMA 3Q2GA 1HFSA 5L7FA 2DW1A 3KRYA 1MMQA 1YOUA 2W14A 3HDAP 1MNCA 2OY4A 4DF9A 4R3VA 3RTSA 3TT4A 1R54A 3O2XA 4L63A 1AYKA 2X3CA 1GXDA 1O0TA 1Z3JA 3LUMA 4DPEA 1KBCA 4J4MA 2E2DA 3KECA 4H30A 4XCTA 2D1NA 2N8RA 5I43A 1PWVA 1RMZA 4H2EA 3EDHA 3I7GA 1YQYA 1ZXVA 2YB9A 1RM8A 4H1QA 2RJQA 1DMTA 3Q2HA 1JJ9A 1QIBA 4G9LA 3L0TA 5D2BA 3LKAA 1R1JA 3DWBA 1SATA 3TVCA 3EDIA 5H8XA 3LE9A 3K7LA 1KUKA 1GKDA 1UTTA 3KMCA 1PWWA 2OXZA 4AUOA 5BOYA 3G42A 2D1OA 2K2GA 3HBUP 1ZS0A 4GQLA 1QJIA 1GE7A 1I73A 3G5CA 5CUHA 2K9CA 3HY7A 2OVZA 3EHYA 1R1HA 1MMPA 5L79A 1BZSA 1OM8A 1G4KA 1SU3A 2Z2DA 2I47A 1C3IA 3N2UA 2WO9A 3LEAA 1QIAA
chains in the Genus database with same CATH topology
2OVXA 1EB6A 1QICA 1SMPA 2Y6CA 4GUYA 1JAOA 3KMEA 2CLTA 3ZUKA 4GR8A 2EROA 1HY7A 3F17A 4H3XA 1YCMA 3LMCA 1MMRA 1JAQA 1IADA 4H82A 2JSDA 1HFCA 3AYUA 4AXQA 2MZIA 2DW0A 1CGEA 4DV8A 1O0QA 1IACA 1YP1A 2QPJA 3DNGA 2OZRA 1G05A 3F15A 3LK8A 3AIGA 3ELMA 1CAQA 1JIZA 4JIJA 4H49A 4XM6A 2OW1A 3EDZA 2MZEA 5I2ZA 2OXUA 830CA 3N2VA 3LQ0A 4WK7A 2CKIA 2Y6DA 1IAGA 1SRPA 3WV1A 4A3WA 2O3EA 3DSLA 3LJGA 4AYKA 1SLNA 1XFUA 1ROSA 5BPAA 1KUHA 3F19A 4HX3A 4XM7A 3TS4A 4JQGA 1I76A 2DDYA 3SHIA 1GKCA 5I0LA 3OHLA 1KUGA 1XFYA 1JH1A 4FXYP 2MLSA 1K7QA 1D8FA 3LILA 1CGFA 1Y0VA 3EWJA 1EUBA 1Q3AA 2HU6A 2SRTA 3EDGA 4A7BA 1UMTA 5I4OA 3NX7A 2POJA 5I3MA 4JPAA 4IUWA 5CZMA 2O36A 1B3DA 4H84A 2OW2A 4L19A 3DPFA 2V4BA 4WKIA 4WKEA 1R1IA 3HYGA 3OHOA 4L7AA 2YUFA 2E3XA 2ERPA 4XM8A 1S4BP 3DTIA 1ZVXA 2L0RA 1G9KA 966CA 1HTDA 1FBLA 1L6JA 3DPEA 2ERQA 1ND1A 3B8ZA 1D5JA 1CGLA 2WOAA 1GE5A 3HBVP 3LUNA 1JANA 1XUCA 1C8TA 4WF6A 456CA 1BUVM 5D1SA 2A8HA 3ZXHA 3DL1A 4L6TA 2JNPA 2MZHA 1XFZA 2JIHA 2YIGA 3O64A 1CXVA 2X7MA 4FVLA 3B92A 3I7IA 3LJTA 1USNA 1ZP5A 3TSKA 1K7GA 1BIWA 1PWQA 2DW2A 2AIGP 2WO8A 3CKIA 4PKUA 2W15A 4GWNA 3F18A 4FXQA 1A85A 1BM6A 5I12A 3HY9A 1IABA 1C7KA 2X3AA 1B8YA 1HOVA 4CTHA 3EHXA 4PKQA 1DTHA 4DD8A 1BUDA 1XFWA 2OW9A 3U1RA 1GE6A 2OY2A 1JIWP 3WV3A 1SLMA 2JT6A 2PJTA 3KEKA 1JK3A 5B5OA 1A86A 2FV9A 2J83A 4AIGA 4Q1LA 3KHIA 1GO7P 1G12A 4I03A 2DDFA 2OXWA 3LJZA 5D1UA 3ZVSA 2USNA 1IAEA 2XS3A 1KUFA 5B5PA 4H76A 1BKCE 3RTTA 1CIZA 2W13A 4PKVA 1KUIA 3V96B 2AYKA 4FU4A 1UMSA 4XBHA 1WNIA 1BQQM 1XURA 1Y8JA 3USNA 3LIRA 1XFXA 2JT5A 4GR0A 2OI0A 3AYKA 3F1AA 3E8RA 5D3CA 4HMAA 4PKTA 1J7NA 1R55A 1CK7A 1HV5A 2RJPA 2TCLA 3L0VA 1KAPP 1IAAA 1BKCA 4ILWD 4IN9A 1BSWA 2W0DA 4EFSA 1D8MA 3MA2A 3LIKA 1K7IA 3HDBA 3P1VA 1OM6A 3B2ZA 1ZXCA 2J0TA 1EAKA 4IJOA 1OMJA 2FV5A 2X3BA 3KEJA 3LGPA 1CQRA 1OS2A 1XFVA 1ASTA 3VTGA 2XS4A 1QUAA 4I35A 4JA1A 4GF1A 4PKRA 1UEAA 1AF0A 1OM7A 1FLSA 1H71P 2W12A 3LQBA 5D7WA 2MLRA 5CXAA 1BKCI 1JKYA 3WV2A 3F16A 1I1IP 3DTEA 1BQOA 4WZVA 1UTZA 1FM1A 2OW0A 4PKWA 3KWVC 1G49A 2KRJA 1OO9A 5BOTA 1D7XA 1QJJA 1Y93A 5JMYA 3VI1A 3GBOA 1PWUA 1XUDA 3HB2P 1ATLA 4QKZA 1ZTQA 1OS9A 1PWPA 3UVCA 1JAPA 3DTKA 4PKSA 3K7NA 5LABA 1AKLA 1MMBA 4ZR5A 1GO8P 4G0DA 3P24A 5D1TA 3BA0A 4JP4A 4GR3A 4ON1A 4GWMA 3Q2GA 1HFSA 5L7FA 2DW1A 3KRYA 1MMQA 1YOUA 2W14A 3HDAP 1MNCA 2OY4A 4DF9A 4R3VA 3RTSA 3TT4A 1R54A 3O2XA 4L63A 1AYKA 2X3CA 1GXDA 1O0TA 1Z3JA 3LUMA 4DPEA 1KBCA 4J4MA 2E2DA 3KECA 4H30A 4XCTA 2D1NA 2N8RA 5I43A 1PWVA 1RMZA 4H2EA 3EDHA 3I7GA 1YQYA 1ZXVA 2YB9A 1RM8A 4H1QA 2RJQA 1DMTA 3Q2HA 1JJ9A 1QIBA 4G9LA 3L0TA 5D2BA 3LKAA 1R1JA 3DWBA 1SATA 3TVCA 3EDIA 5H8XA 3LE9A 3K7LA 1KUKA 1GKDA 1UTTA 3KMCA 1PWWA 2OXZA 4AUOA 5BOYA 3G42A 2D1OA 2K2GA 3HBUP 1ZS0A 4GQLA 1QJIA 1GE7A 1I73A 3G5CA 5CUHA 2K9CA 3HY7A 2OVZA 3EHYA 1R1HA 1MMPA 5L79A 1BZSA 1OM8A 1G4KA 1SU3A 2Z2DA 2I47A 1C3IA 3N2UA 2WO9A 3LEAA 1QIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OVX A;  1EB6 A;  1QIC A;  1SMP A;  2Y6C A;  4GUY A;  1JAO A;  3KME A;  2CLT A;  3ZUK A;  4GR8 A;  2ERO A;  1HY7 A;  3F17 A;  4H3X A;  1YCM A;  3LMC A;  1MMR A;  1JAQ A;  1IAD A;  4H82 A;  2JSD A;  1HFC A;  3AYU A;  4AXQ A;  2MZI A;  2DW0 A;  1CGE A;  4DV8 A;  1O0Q A;  1IAC A;  1YP1 A;  2QPJ A;  3DNG A;  2OZR A;  1G05 A;  3F15 A;  3LK8 A;  3AIG A;  3ELM A;  1CAQ A;  1JIZ A;  4JIJ A;  4H49 A;  4XM6 A;  2OW1 A;  3EDZ A;  2MZE A;  5I2Z A;  2OXU A;  830C A;  3N2V A;  3LQ0 A;  4WK7 A;  2CKI A;  2Y6D A;  1IAG A;  1SRP A;  3WV1 A;  4A3W A;  2O3E A;  3DSL A;  3LJG A;  4AYK A;  1SLN A;  1XFU A;  1ROS A;  5BPA A;  1KUH A;  3F19 A;  4HX3 A;  4XM7 A;  3TS4 A;  4JQG A;  1I76 A;  2DDY A;  3SHI A;  1GKC A;  5I0L A;  3OHL A;  1KUG A;  1XFY A;  1JH1 A;  4FXY P;  2MLS A;  1K7Q A;  1D8F A;  3LIL A;  1CGF A;  1Y0V A;  3EWJ A;  1EUB A;  1Q3A A;  2HU6 A;  2SRT A;  3EDG A;  4A7B A;  1UMT A;  5I4O A;  3NX7 A;  2POJ A;  5I3M A;  4JPA A;  4IUW A;  5CZM A;  2O36 A;  1B3D A;  4H84 A;  2OW2 A;  4L19 A;  3DPF A;  2V4B A;  4WKI A;  4WKE A;  1R1I A;  3HYG A;  3OHO A;  2E3X A;  2ERP A;  4XM8 A;  1S4B P;  1ZVX A;  2L0R A;  1G9K A;  966C A;  1HTD A;  1FBL A;  1L6J A;  3DPE A;  2ERQ A;  1ND1 A;  3B8Z A;  1D5J A;  1CGL A;  2WOA A;  1GE5 A;  3HBV P;  3LUN A;  1JAN A;  1XUC A;  1C8T A;  4WF6 A;  456C A;  1BUV M;  5D1S A;  2A8H A;  3ZXH A;  3DL1 A;  4L6T A;  2JNP A;  2MZH A;  1XFZ A;  2JIH A;  2YIG A;  3O64 A;  1CXV A;  2X7M A;  4FVL A;  3B92 A;  3I7I A;  3LJT A;  1USN A;  1ZP5 A;  3TSK A;  1K7G A;  1BIW A;  1PWQ A;  2DW2 A;  2AIG P;  2WO8 A;  3CKI A;  4PKU A;  2W15 A;  4GWN A;  3F18 A;  4FXQ A;  1A85 A;  1BM6 A;  5I12 A;  3HY9 A;  1IAB A;  1C7K A;  2X3A A;  1B8Y A;  1HOV A;  4CTH A;  3EHX A;  4PKQ A;  1DTH A;  4DD8 A;  1BUD A;  1XFW A;  2OW9 A;  3U1R A;  1GE6 A;  2OY2 A;  1JIW P;  3WV3 A;  1SLM A;  2JT6 A;  2PJT A;  3KEK A;  1JK3 A;  5B5O A;  1A86 A;  2FV9 A;  2J83 A;  4AIG A;  4Q1L A;  3KHI A;  1GO7 P;  1G12 A;  4I03 A;  2DDF A;  2OXW A;  3LJZ A;  5D1U A;  3ZVS A;  2USN A;  1IAE A;  2XS3 A;  1KUF A;  5B5P A;  4H76 A;  1BKC E;  3RTT A;  1CIZ A;  2W13 A;  4PKV A;  1KUI A;  3V96 B;  2AYK A;  4FU4 A;  1UMS A;  4XBH A;  1WNI A;  1BQQ M;  1XUR A;  1Y8J A;  3USN A;  3LIR A;  1XFX A;  2JT5 A;  4GR0 A;  2OI0 A;  3AYK A;  3F1A A;  3E8R A;  5D3C A;  4HMA A;  4PKT A;  1J7N A;  1R55 A;  1CK7 A;  1HV5 A;  2RJP A;  2TCL A;  3L0V A;  1KAP P;  1IAA A;  1BKC A;  4ILW D;  4IN9 A;  1BSW A;  2W0D A;  4EFS A;  1D8M A;  3MA2 A;  3LIK A;  1K7I A;  3HDB A;  3P1V A;  1OM6 A;  3B2Z A;  1ZXC A;  2J0T A;  1EAK A;  4IJO A;  1OMJ A;  2FV5 A;  2X3B A;  3KEJ A;  3LGP A;  1CQR A;  1OS2 A;  1XFV A;  1AST A;  3VTG A;  2XS4 A;  1QUA A;  4I35 A;  4JA1 A;  4GF1 A;  4PKR A;  1UEA A;  1AF0 A;  1OM7 A;  1FLS A;  1H71 P;  2W12 A;  3LQB A;  5D7W A;  2MLR A;  5CXA A;  1BKC I;  1JKY A;  3WV2 A;  3F16 A;  1I1I P;  1BQO A;  4WZV A;  1UTZ A;  1FM1 A;  2OW0 A;  4PKW A;  3KWV C;  1G49 A;  2KRJ A;  1OO9 A;  5BOT A;  1D7X A;  1QJJ A;  1Y93 A;  5JMY A;  3VI1 A;  3GBO A;  1PWU A;  1XUD A;  3HB2 P;  1ATL A;  4QKZ A;  1ZTQ A;  1OS9 A;  1PWP A;  3UVC A;  1JAP A;  4PKS A;  3K7N A;  5LAB A;  1AKL A;  1MMB A;  4ZR5 A;  1GO8 P;  4G0D A;  3P24 A;  5D1T A;  3BA0 A;  4JP4 A;  4GR3 A;  4ON1 A;  4GWM A;  3Q2G A;  1HFS A;  5L7F A;  2DW1 A;  3KRY A;  1MMQ A;  1YOU A;  2W14 A;  3HDA P;  1MNC A;  2OY4 A;  4DF9 A;  4R3V A;  3RTS A;  3TT4 A;  1R54 A;  3O2X A;  4L63 A;  1AYK A;  2X3C A;  1GXD A;  1O0T A;  1Z3J A;  3LUM A;  4DPE A;  1KBC A;  4J4M A;  2E2D A;  3KEC A;  4H30 A;  4XCT A;  2D1N A;  2N8R A;  5I43 A;  1PWV A;  1RMZ A;  4H2E A;  3EDH A;  3I7G A;  1YQY A;  1ZXV A;  2YB9 A;  1RM8 A;  4H1Q A;  2RJQ A;  1DMT A;  3Q2H A;  1JJ9 A;  1QIB A;  4G9L A;  3L0T A;  5D2B A;  3LKA A;  1R1J A;  3DWB A;  1SAT A;  3TVC A;  3EDI A;  5H8X A;  3LE9 A;  3K7L A;  1KUK A;  1GKD A;  1UTT A;  3KMC A;  1PWW A;  2OXZ A;  4AUO A;  5BOY A;  3G42 A;  2D1O A;  2K2G A;  3HBU P;  1ZS0 A;  4GQL A;  1QJI A;  1GE7 A;  1I73 A;  3G5C A;  5CUH A;  2K9C A;  3HY7 A;  2OVZ A;  3EHY A;  1R1H A;  1MMP A;  5L79 A;  1BZS A;  1OM8 A;  1G4K A;  1SU3 A;  2Z2D A;  2I47 A;  1C3I A;  3N2U A;  2WO9 A;  3LEA A;  1QIA A; 
#chains in the Genus database with same CATH topology
 2OVX A;  1EB6 A;  1QIC A;  1SMP A;  2Y6C A;  4GUY A;  1JAO A;  3KME A;  2CLT A;  3ZUK A;  4GR8 A;  2ERO A;  1HY7 A;  3F17 A;  4H3X A;  1YCM A;  3LMC A;  1MMR A;  1JAQ A;  1IAD A;  4H82 A;  2JSD A;  1HFC A;  3AYU A;  4AXQ A;  2MZI A;  2DW0 A;  1CGE A;  4DV8 A;  1O0Q A;  1IAC A;  1YP1 A;  2QPJ A;  3DNG A;  2OZR A;  1G05 A;  3F15 A;  3LK8 A;  3AIG A;  3ELM A;  1CAQ A;  1JIZ A;  4JIJ A;  4H49 A;  4XM6 A;  3EDZ A;  2OW1 A;  2MZE A;  5I2Z A;  2OXU A;  830C A;  3N2V A;  3LQ0 A;  4WK7 A;  2CKI A;  2Y6D A;  1IAG A;  1SRP A;  3WV1 A;  4A3W A;  2O3E A;  3DSL A;  3LJG A;  4AYK A;  1SLN A;  1XFU A;  1ROS A;  5BPA A;  1KUH A;  3F19 A;  4HX3 A;  4XM7 A;  3TS4 A;  4JQG A;  1I76 A;  2DDY A;  3SHI A;  1GKC A;  5I0L A;  3OHL A;  1KUG A;  1XFY A;  1JH1 A;  4FXY P;  2MLS A;  1K7Q A;  1D8F A;  3EWJ A;  1CGF A;  1Y0V A;  3LIL A;  1EUB A;  1Q3A A;  2HU6 A;  2SRT A;  3EDG A;  4A7B A;  1UMT A;  5I4O A;  3NX7 A;  2POJ A;  5I3M A;  4JPA A;  4IUW A;  5CZM A;  1XM5 A;  2O36 A;  1B3D A;  4H84 A;  2OW2 A;  4L19 A;  1OZ9 A;  3DPF A;  2V4B A;  4WKI A;  4WKE A;  1R1I A;  3HYG A;  3OHO A;  4L7A A;  2YUF A;  2E3X A;  2ERP A;  4XM8 A;  1S4B P;  3DTI A;  1ZVX A;  2L0R A;  1G9K A;  966C A;  1HTD A;  1FBL A;  1L6J A;  3DPE A;  2ERQ A;  1ND1 A;  3B8Z A;  1D5J A;  1CGL A;  2WOA A;  1GE5 A;  3HBV P;  3LUN A;  1JAN A;  1XUC A;  1C8T A;  4WF6 A;  456C A;  1BUV M;  5D1S A;  2A8H A;  3ZXH A;  3DL1 A;  4L6T A;  2JNP A;  2MZH A;  1XFZ A;  2JIH A;  2YIG A;  3O64 A;  1CXV A;  2X7M A;  4FVL A;  3B92 A;  3I7I A;  3LJT A;  1USN A;  1ZP5 A;  3TSK A;  1K7G A;  1BIW A;  1PWQ A;  1XAX A;  2DW2 A;  2AIG P;  2WO8 A;  3CKI A;  4PKU A;  2W15 A;  4GWN A;  3F18 A;  4FXQ A;  1A85 A;  1BM6 A;  5I12 A;  3HY9 A;  1IAB A;  1C7K A;  2X3A A;  1B8Y A;  1HOV A;  4CTH A;  3EHX A;  4PKQ A;  1DTH A;  4DD8 A;  1BUD A;  1XFW A;  2OW9 A;  3U1R A;  1GE6 A;  2OY2 A;  1JIW P;  3WV3 A;  1SLM A;  2JT6 A;  2PJT A;  3KEK A;  1JK3 A;  5B5O A;  1A86 A;  2FV9 A;  2J83 A;  4AIG A;  4Q1L A;  3KHI A;  1GO7 P;  1G12 A;  4I03 A;  2DDF A;  2OXW A;  3LJZ A;  5D1U A;  3ZVS A;  2USN A;  1IAE A;  2XS3 A;  1KUF A;  1TVI A;  5B5P A;  4H76 A;  1BKC E;  3RTT A;  1CIZ A;  2W13 A;  4PKV A;  1KUI A;  3V96 B;  2AYK A;  4FU4 A;  1UMS A;  4XBH A;  1WNI A;  1BQQ M;  1XUR A;  1Y8J A;  3USN A;  3LIR A;  1XFX A;  2JT5 A;  4GR0 A;  2OI0 A;  3AYK A;  3F1A A;  3E8R A;  5D3C A;  4HMA A;  4PKT A;  1J7N A;  1R55 A;  1CK7 A;  1HV5 A;  2RJP A;  2TCL A;  3L0V A;  1KAP P;  1IAA A;  1BKC A;  4ILW D;  4IN9 A;  1BSW A;  2W0D A;  4EFS A;  1D8M A;  3MA2 A;  3LIK A;  1K7I A;  3HDB A;  3P1V A;  1OM6 A;  3B2Z A;  1ZXC A;  2J0T A;  1EAK A;  4IJO A;  1OMJ A;  2FV5 A;  2X3B A;  3KEJ A;  3LGP A;  1CQR A;  1OS2 A;  1XFV A;  1AST A;  3VTG A;  2XS4 A;  1QUA A;  4I35 A;  4JA1 A;  4GF1 A;  4PKR A;  1UEA A;  1AF0 A;  1OM7 A;  1FLS A;  1H71 P;  2W12 A;  3LQB A;  5D7W A;  2MLR A;  5CXA A;  1BKC I;  1JKY A;  3WV2 A;  3F16 A;  1I1I P;  3DTE A;  1BQO A;  4WZV A;  1UTZ A;  1FM1 A;  2OW0 A;  4PKW A;  3KWV C;  1G49 A;  2KRJ A;  1OO9 A;  5BOT A;  1D7X A;  1QJJ A;  1Y93 A;  5JMY A;  3VI1 A;  3GBO A;  1PWU A;  1XUD A;  3HB2 P;  1ATL A;  4QKZ A;  1ZTQ A;  1OS9 A;  1PWP A;  3UVC A;  1JAP A;  3DTK A;  4PKS A;  3K7N A;  5LAB A;  1AKL A;  1MMB A;  4ZR5 A;  1GO8 P;  4G0D A;  3P24 A;  5D1T A;  3BA0 A;  4JP4 A;  4GR3 A;  4ON1 A;  4GWM A;  3Q2G A;  1HFS A;  5L7F A;  2DW1 A;  3KRY A;  1MMQ A;  1YOU A;  2W14 A;  3HDA P;  1MNC A;  2OY4 A;  4DF9 A;  4R3V A;  3RTS A;  3TT4 A;  1R54 A;  3O2X A;  4L63 A;  1AYK A;  2X3C A;  1GXD A;  1O0T A;  1Z3J A;  3LUM A;  4DPE A;  1KBC A;  4J4M A;  2E2D A;  3KEC A;  4H30 A;  4XCT A;  2D1N A;  2N8R A;  5I43 A;  1PWV A;  1RMZ A;  4H2E A;  3EDH A;  3I7G A;  1YQY A;  1ZXV A;  2YB9 A;  1RM8 A;  4H1Q A;  2RJQ A;  1DMT A;  3Q2H A;  1JJ9 A;  1QIB A;  4G9L A;  3L0T A;  5D2B A;  3LKA A;  1R1J A;  3DWB A;  1SAT A;  3TVC A;  3EDI A;  5H8X A;  3LE9 A;  3K7L A;  1KUK A;  1GKD A;  1UTT A;  3KMC A;  1PWW A;  2OXZ A;  4AUO A;  5BOY A;  3G42 A;  2D1O A;  2K2G A;  3HBU P;  1ZS0 A;  4GQL A;  1QJI A;  1GE7 A;  1I73 A;  3G5C A;  5CUH A;  2K9C A;  3HY7 A;  2OVZ A;  3EHY A;  1R1H A;  1MMP A;  5L79 A;  1BZS A;  1OM8 A;  1G4K A;  1SU3 A;  2Z2D A;  2I47 A;  1C3I A;  3N2U A;  2WO9 A;  3LEA A;  1QIA A; 
#chains in the Genus database with same CATH homology
 2OVX A;  1EB6 A;  1QIC A;  1SMP A;  2Y6C A;  4GUY A;  1JAO A;  3KME A;  2CLT A;  3ZUK A;  4GR8 A;  2ERO A;  1HY7 A;  3F17 A;  4H3X A;  1YCM A;  3LMC A;  1MMR A;  1JAQ A;  1IAD A;  4H82 A;  2JSD A;  1HFC A;  3AYU A;  4AXQ A;  2MZI A;  2DW0 A;  1CGE A;  4DV8 A;  1O0Q A;  1IAC A;  1YP1 A;  2QPJ A;  3DNG A;  2OZR A;  1G05 A;  3F15 A;  3LK8 A;  3AIG A;  3ELM A;  1CAQ A;  1JIZ A;  4JIJ A;  4H49 A;  4XM6 A;  2OW1 A;  3EDZ A;  2MZE A;  5I2Z A;  2OXU A;  830C A;  3N2V A;  3LQ0 A;  4WK7 A;  2CKI A;  2Y6D A;  1IAG A;  1SRP A;  3WV1 A;  4A3W A;  2O3E A;  3DSL A;  3LJG A;  4AYK A;  1SLN A;  1XFU A;  1ROS A;  5BPA A;  1KUH A;  3F19 A;  4HX3 A;  4XM7 A;  3TS4 A;  4JQG A;  1I76 A;  2DDY A;  3SHI A;  1GKC A;  5I0L A;  3OHL A;  1KUG A;  1XFY A;  1JH1 A;  4FXY P;  2MLS A;  1K7Q A;  1D8F A;  3LIL A;  1CGF A;  1Y0V A;  3EWJ A;  1EUB A;  1Q3A A;  2HU6 A;  2SRT A;  3EDG A;  4A7B A;  1UMT A;  5I4O A;  3NX7 A;  2POJ A;  5I3M A;  4JPA A;  4IUW A;  5CZM A;  2O36 A;  1B3D A;  4H84 A;  2OW2 A;  4L19 A;  3DPF A;  2V4B A;  4WKI A;  4WKE A;  1R1I A;  3HYG A;  3OHO A;  4L7A A;  2YUF A;  2E3X A;  2ERP A;  4XM8 A;  1S4B P;  3DTI A;  1ZVX A;  2L0R A;  1G9K A;  966C A;  1HTD A;  1FBL A;  1L6J A;  3DPE A;  2ERQ A;  1ND1 A;  3B8Z A;  1D5J A;  1CGL A;  2WOA A;  1GE5 A;  3HBV P;  3LUN A;  1JAN A;  1XUC A;  1C8T A;  4WF6 A;  456C A;  1BUV M;  5D1S A;  2A8H A;  3ZXH A;  3DL1 A;  4L6T A;  2JNP A;  2MZH A;  1XFZ A;  2JIH A;  2YIG A;  3O64 A;  1CXV A;  2X7M A;  4FVL A;  3B92 A;  3I7I A;  3LJT A;  1USN A;  1ZP5 A;  3TSK A;  1K7G A;  1BIW A;  1PWQ A;  2DW2 A;  2AIG P;  2WO8 A;  3CKI A;  4PKU A;  2W15 A;  4GWN A;  3F18 A;  4FXQ A;  1A85 A;  1BM6 A;  5I12 A;  3HY9 A;  1IAB A;  1C7K A;  2X3A A;  1B8Y A;  1HOV A;  4CTH A;  3EHX A;  4PKQ A;  1DTH A;  4DD8 A;  1BUD A;  1XFW A;  2OW9 A;  3U1R A;  1GE6 A;  2OY2 A;  1JIW P;  3WV3 A;  1SLM A;  2JT6 A;  2PJT A;  3KEK A;  1JK3 A;  5B5O A;  1A86 A;  2FV9 A;  2J83 A;  4AIG A;  4Q1L A;  3KHI A;  1GO7 P;  1G12 A;  4I03 A;  2DDF A;  2OXW A;  3LJZ A;  5D1U A;  3ZVS A;  2USN A;  1IAE A;  2XS3 A;  1KUF A;  5B5P A;  4H76 A;  1BKC E;  3RTT A;  1CIZ A;  2W13 A;  4PKV A;  1KUI A;  3V96 B;  2AYK A;  4FU4 A;  1UMS A;  4XBH A;  1WNI A;  1BQQ M;  1XUR A;  1Y8J A;  3USN A;  3LIR A;  1XFX A;  2JT5 A;  4GR0 A;  2OI0 A;  3AYK A;  3F1A A;  3E8R A;  5D3C A;  4HMA A;  4PKT A;  1J7N A;  1R55 A;  1CK7 A;  1HV5 A;  2RJP A;  2TCL A;  3L0V A;  1KAP P;  1IAA A;  1BKC A;  4ILW D;  4IN9 A;  1BSW A;  2W0D A;  4EFS A;  1D8M A;  3MA2 A;  3LIK A;  1K7I A;  3HDB A;  3P1V A;  1OM6 A;  3B2Z A;  1ZXC A;  2J0T A;  1EAK A;  4IJO A;  1OMJ A;  2FV5 A;  2X3B A;  3KEJ A;  3LGP A;  1CQR A;  1OS2 A;  1XFV A;  1AST A;  3VTG A;  2XS4 A;  1QUA A;  4I35 A;  4JA1 A;  4GF1 A;  4PKR A;  1UEA A;  1AF0 A;  1OM7 A;  1FLS A;  1H71 P;  2W12 A;  3LQB A;  5D7W A;  2MLR A;  5CXA A;  1BKC I;  1JKY A;  3WV2 A;  3F16 A;  1I1I P;  3DTE A;  1BQO A;  4WZV A;  1UTZ A;  1FM1 A;  2OW0 A;  4PKW A;  3KWV C;  1G49 A;  2KRJ A;  1OO9 A;  5BOT A;  1D7X A;  1QJJ A;  1Y93 A;  5JMY A;  3VI1 A;  3GBO A;  1PWU A;  1XUD A;  3HB2 P;  1ATL A;  4QKZ A;  1ZTQ A;  1OS9 A;  1PWP A;  3UVC A;  1JAP A;  3DTK A;  4PKS A;  3K7N A;  5LAB A;  1AKL A;  1MMB A;  4ZR5 A;  1GO8 P;  4G0D A;  3P24 A;  5D1T A;  3BA0 A;  4JP4 A;  4GR3 A;  4ON1 A;  4GWM A;  3Q2G A;  1HFS A;  5L7F A;  2DW1 A;  3KRY A;  1MMQ A;  1YOU A;  2W14 A;  3HDA P;  1MNC A;  2OY4 A;  4DF9 A;  4R3V A;  3RTS A;  3TT4 A;  1R54 A;  3O2X A;  4L63 A;  1AYK A;  2X3C A;  1GXD A;  1O0T A;  1Z3J A;  3LUM A;  4DPE A;  1KBC A;  4J4M A;  2E2D A;  3KEC A;  4H30 A;  4XCT A;  2D1N A;  2N8R A;  5I43 A;  1PWV A;  1RMZ A;  4H2E A;  3EDH A;  3I7G A;  1YQY A;  1ZXV A;  2YB9 A;  1RM8 A;  4H1Q A;  2RJQ A;  1DMT A;  3Q2H A;  1JJ9 A;  1QIB A;  4G9L A;  3L0T A;  5D2B A;  3LKA A;  1R1J A;  3DWB A;  1SAT A;  3TVC A;  3EDI A;  5H8X A;  3LE9 A;  3K7L A;  1KUK A;  1GKD A;  1UTT A;  3KMC A;  1PWW A;  2OXZ A;  4AUO A;  5BOY A;  3G42 A;  2D1O A;  2K2G A;  3HBU P;  1ZS0 A;  4GQL A;  1QJI A;  1GE7 A;  1I73 A;  3G5C A;  5CUH A;  2K9C A;  3HY7 A;  2OVZ A;  3EHY A;  1R1H A;  1MMP A;  5L79 A;  1BZS A;  1OM8 A;  1G4K A;  1SU3 A;  2Z2D A;  2I47 A;  1C3I A;  3N2U A;  2WO9 A;  3LEA A;  1QIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...