The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
43
|
sequence length |
182
|
structure length |
182
|
Chain Sequence |
RTLWTTPDTSPNCTIAQDKDSKLTLVLTKCGSQILANVSLIVVAGKYHIINNKTNPKIKSFTIKLLFNKNGVLLDNSNLGKAYWNFRSGNSNVSTAYEKAIGFMPNLVAYPKPSNSKKYARDIVYGTIYLGGKPDQPAVIKTTFNQETGCEYSITFNFSWSKTYENVEFETTSFTFSYIAQE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural and Mutational Analysis of Human Ad37 and Canine Adenovirus 2 Fiber Heads in Complex with the D1 Domain of Coxsackie and Adenovirus Receptor.
pubmed doi rcsb |
| molecule keywords |
FIBER PROTEIN
|
| molecule tags |
Viral protein/receptor
|
| source organism |
Human adenovirus d37
|
| total genus |
43
|
| structure length |
182
|
| sequence length |
182
|
| ec nomenclature | |
| pdb deposition date | 2006-08-08 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00541 | Adeno_knob | Adenoviral fibre protein (knob domain) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Adenovirus Type 5 Fiber Protein (Receptor Binding Domain) | Adenovirus pIV-related, attachment domain |
#chains in the Genus database with same CATH superfamily 3EXW A; 1P6A A; 2BZV A; 2J1K C; 2WBW A; 4K6T A; 2WGT A; 1NOB A; 2J12 A; 4ZDG A; 4LIY A; 4XQA A; 3L89 A; 3BQ4 A; 3QND A; 1KAC A; 2O39 A; 2WGU A; 2WST A; 3N0I A; 3O8E A; 3CNC A; 4XL8 A; 3L88 A; 1UXB A; 4WYJ A; 2W9L C; 2WBV A; 4XQB A; 4K6V A; 3EXV A; 4K6W A; 4K6U A; 1KNB A; 4ATZ A; 2QLK A; 1UXE A; 1QHV A; 1H7Z A; 3F0Y A; 1UXA A; 1P69 A; 2BZU A; 2J2J A; 1QIU A; #chains in the Genus database with same CATH topology 3EXW A; 1P6A A; 2BZV A; 2J1K C; 2BT7 A; 2WBW A; 2WGT A; 1NOB A; 2J12 A; 4GU4 A; 4ZDG A; 4LIY A; 4XC5 A; 4XQA A; 4K6T A; 3ZPE A; 3L89 A; 3BQ4 A; 3ZPF A; 4D63 A; 3QND A; 4ODB A; 4CW8 A; 2IUN A; 1KAC A; 2VRS A; 2VTW A; 4D62 A; 2O39 A; 2WGU A; 2WST A; 3N0I A; 2OJ6 A; 3O8E A; 3S6X A; 3CNC A; 4XL8 A; 3L88 A; 1UXB A; 5MHS A; 4WYJ A; 2BT8 A; 2W9L C; 2WBV A; 2BSF A; 2JJL A; 4XQB A; 4K6V A; 3EXV A; 4K6W A; 1KKE A; 2IUM A; 1KNB A; 4K6U A; 4ATZ A; 2QLK A; 2OJ5 A; 4GU3 A; 1UXE A; 1QHV A; 1H7Z A; 3F0Y A; 1UXA A; 1P69 A; 2BZU A; 3EOY A; 2J2J A; 1QIU A; #chains in the Genus database with same CATH homology 3EXW A; 1P6A A; 2BZV A; 2J1K C; 2WBW A; 4K6T A; 2WGT A; 1NOB A; 2J12 A; 4ZDG A; 4LIY A; 4XQA A; 3L89 A; 3BQ4 A; 3QND A; 1KAC A; 2O39 A; 2WGU A; 2WST A; 3N0I A; 3O8E A; 3CNC A; 4XL8 A; 3L88 A; 1UXB A; 4WYJ A; 2W9L C; 2WBV A; 4XQB A; 4K6V A; 3EXV A; 4K6W A; 4K6U A; 1KNB A; 4ATZ A; 2QLK A; 1UXE A; 1QHV A; 1H7Z A; 3F0Y A; 1UXA A; 1P69 A; 2BZU A; 2J2J A; 1QIU A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...