2J1KA

Cav-2 fibre head in complex with car d1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
SLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mutational Analysis of Human Ad37 and Canine Adenovirus 2 Fiber Heads in Complex with the D1 Domain of Coxsackie and Adenovirus Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Virus/receptor
molecule keywords COXSACKIEVIRUS AND ADENOVIRUS RECEPTOR
total genus 25
structure length 117
sequence length 117
chains with identical sequence B, G, J, K, O, P, T, V, X, Y, Z
ec nomenclature
pdb deposition date 2006-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2j1kA00
3HNTH 4HFUH 1NSNH 4ORGB 5I0ZA 4KRLB 1V7ML 4W6YB 4FABH 1D5XA 4U3HA 1ADQL 4YFEA 1JZ4A 4LPWA 4JO3H 1T1YB 3SKOA 4GBXD 1MLBB 1U8IA 4H0IA 4L8SC 2CKBL 1KCLA 2GJZB 2A9NH 2R0LL 2IPUG 1F4YH 2EDBA 3B4NA 5E9DA 4EN3C 4X6FB 4OQTH 1MCWW 4ZO7A 1CCZA 1HZHH 1UCTA 2COQA 4K3GA 4P2RA 3ARVA 3KJ6L 1ZOXA 4XP4H 4EVNB 3VWKD 4UDUB 2DQCH 4OGAD 5JOPE 1JHTA 4JG0L 4APQD 5DHVH 3PDDA 2IG2H 3MLXL 4JPKL 5IBUB 4G6MH 2FZ3A 5I16B 4XPGL 4XVJL 2V9TA 3ILQD 2IAND 1BFTA 4OFYD 1J7VR 3KPOA 1MJ7L 3MRHA 3QDGA 4Z95H 3GDBA 5T3ZH 5C0BB 5KN5B 1DN0A 2AVGA 4J3XA 2FEEI 2RGSA 3EJZC 3S97C 3HNSL 3OG6B 4NQEA 5CILH 1CFSA 5DHXB 1F3DH 3EYQC 2Q8BL 4UBDC 1W0WA 3AB0B 1XGUA 4HKBB 4P57A 4UUJA 4X9FA 3MLSL 5DYOB 1NDGB 3HA0A 1IGFH 1N6UA 1TNMA 3LDBB 1NGZB 5B3JF 5C07A 2PO6D 2WBJB 4HUWB 1Z9SA 4JFHD 5C7XH 1Q0YH 4BUGA 4U2YA 3ZKMC 1UEMA 4N8CH 4I3SL 4DTGH 1A22B 4JFXB 2YN5A 1GGTA 4Q58C 43CAB 5B3JE 3NCBB 5F44A 3BI9X 1T1ZB 3FFDB 5EC1B 5CD3A 1HOCA 1IEAB 1P7QB 2YD5A 5F96L 3O6KH 3U2SA 3RUGA 2DQDL 4CVWA 2GTZB 1ZK9A 1ZV5A 4N0CC 4QEGA 1MHHB 2PW1A 2Y07L 3SDXE 5CJ5A 5DMKB 2YZ1A 4PJ8A 5KTEL 4UQ3A 5DQDL 2JK5B 5IVOA 3VXMB 5FUZH 3EKCA 4EBQH 4TUKH 5GJTL 1RSFA 3U83A 2IPTH 4WHTB 1MWAH 3UPAA 3VE0B 3WBDA 4GW4A 4Z7VE 1QBLH 3MGOA 3IXAA 3UYOD 1MCOH 3HPLA 3PDOB 1VADB 4NM8L 3R1GH 1FYHB 3O3UN 4Z7UB 5D70L 1KCVH 3FN0H 4I0PB 1KT2B 3PNWB 4N0YH 4L4VB 4Z18A 5F72S 3MBXH 2DBLL 1RPQA 3H3KA 2DWEB 2DM4A 4CMHC 1KULA 4FHBD 4UMGA 1S7RB 5HGAA 1WZMA 4MQ7B 3QDGB 1NAMH 4QCIA 5B4MD 5A16A 4XH2B 3FQRB 3C8HA 3H2WA 5GGQH 1U6AL 3VFUA 2F54D 4HG4K 1RJZB 4G3YH 2XG4A 2EECA 2NY7H 4HK3J 1MSPA 3U9UB 2XPGB 1I3VA 4Q9QL 4LSPL 3W0WD 3HC0B 1LO2H 3LQAL 2YD1A 3MV9A 5D7IE 5I19H 3FO9A 4D0CA 4X7CC 5FB8A 3LMJH 3N85L 1MJ8H 1UB6B 1IC5H 1B2WL 1K2DB 1MFBL 1FFNB 1JJUA 3RU8H 3FB8A 4HS8L 4NN6C 5E2TL 4GS7C 4KPHL 3VXRD 2RCSH 3MJ8B 3V5DA 3C5ZA 3U30C 4GQPH 1R3JA 3OB0H 5E1HB 4M7LL 3DETD 3OHXB 4TSAL 5A43C 3V6ZA 4IIQA 1KYOJ 3HFMH 3MNVA 5BOPA 4NNYB 1G0XA 4R4FL 3QUYC 2V5RA 1MJ7H 4OZIA 4MAYC 2VQ1A 3FQUA 1CLZL 3MFFB 4KI5C 3BE1H 4KKBD 1Q9LB 1JRHH 1XFPA 4TQEH 2O61A 1VFBB 3TZVB 1A1OB 4D94A 4MWFB 3D18A 3S36H 3HZKA 3H8NA 2DYPD 4IDLA 2DQFA 5IMOA 3RVXC 5BZWB 2OM5A 5IFJB 3ARSA 1LDSA 5IFAH 3V5HB 1NMCC 1GHFL 3M17A 5EBLA 3T8XB 3CFBB 2HT4D 2D31B 1OT2A 2QQQA 5IB5B 4DTGL 3TIDB 3MACL 1QSEB 2BXZA 3GMQB 4LSRL 5BV7H 5TH2A 4M1DH 3O6FA 1OTUC 1Y0LB 4QOKB 3V52L 1F90L 1SY6A 2J8OA 3MZGB 1EAJA 3ES6B 3RX8A 3K7UA 1F6AA 2YPLA 1MF2L 3LEVH 4JAMA 1AE6H 3GK8H 4IRSA 3O6LL 3U79A 3OB8A 3SE3A 4YHLH 4D9QD 4F33B 5IGXL 5AZEL 3GJEB 4JJ5A 1Y0LA 4QOKA 3SGJA 3KPTA 5CD3B 3OKOB 1R3IL 3B6SB 4N1EA 2P5WD 4FTVD 2YD2A 5FUZL 2PTTA 1NBYA 3NTCL 5HYQA 2YA2A 4PRNB 3WL9A 4H5SB 1FLRL 3PF2A 3T0AA 4PP1C 3ULSA 3N0PB 5B39G 4M3JA 1BQHG 4O2CA 2MQCA 5I71C 1MVUB 4FXGB 5EG6C 2IALB 4U7SA 3QUYD 5D1QC 4QF1A 4PRNA 2PTTB 2WWKO 4PGJA 2EIEA 4HIHA 4IDJL 3EW3B 2YD3A 4R90H 4YAQA 4ZPVA 2VLRB 4PTUB 3WE6B 5DJ0B 1AH1A 1ZT1A 2Z31A 2PYEE 4YE4L 5L88H 5I1GL 1GPOL 1RZGA 1F13A 2G2RA 5GS0H 5D7KD 2NY7L 3C8KA 4P3CL 2CIIB 5HI4C 1MRCH 2R2HB 3GO1H 4YNYB 1OY3B 1J86A 3SKUD 3NACH 3EFDH 1SMOA 3BQUD 1RZIB 4XP1H 1MJ8L 4PLKD 3TYFA 4H25B 1U3JA 3CGTA 4CN4A 3M17B 4I0CC 5DJ8A 2EZ0C 5B3NA 5HY9A 1NH6A 2JCCF 4TPRL 4L3AA 5CINL 5E4EB 4FFWC 2VOTA 3CFKB 1YEDB 1HQRA 4F58H 4PJCE 1UM5L 3U4EB 4DN4L 4XBEH 4HV8B 1LWRA 4X4YA 2B4CH 3H9SB 2Y06L 5GGVH 5DRWA 2E7LA 3V7AG 4JVWA 3B5TA 2ITCA 1HSAB 5D6DC 5CJBA 3AY4C 1XIWB 2YRPA 1QLRA 2AK1H 4HZLA 4HUKB 4PRBA 4W6WB 5KSAB 3DMMB 4LSDA 1FVEB 5MI0B 2ESVE 1F00I 4K23L 1TDQA 4K9EC 3HG1B 4PJ5A 3NCYS 5IB1A 5BS0E 3O4LA 3PWPA 1ZA3A 4LF3A 1RIHL 4Q74A 1F02I 4QRRA 4EKXA 1Q72L 2KZWA 3QNYA 4WY7H 4PJAF 2VMFA 1JHLL 3UAJD 1VKXA 2NZ9D 3GMLB 5IVZA 5F7FA 3OKKB 5KG9B 5JW5B 1QRKA 2KBGA 2HN7B 4FZEL 4J6RH 3ZTNL 3PWUB 1KUMA 1NCWL 2VLRA 5FYKU 3QDMA 5E5MB 4F3FB 2OMBA 4HGMA 4MJID 2P47B 3V52H 3O3EB 1CG9A 1LK3H 2C3VB 3RWCA 3H7BB 3WS6C 2FB4H 4IOFD 4OM1L 1ZLUH 3BJLA 3QIWC 4U1NA 5EU7E 4EUPA 3HNTL 1VPOH 1KIPA 2Z93B 3MO1A 3I85A 3D25B 5DQ9A 1B6UA 1SYVB 2X89A 3F7PC 1I1YA 5JQHC 2YUXA 1H5BA 1LE5B 5DJAA 1JPTH 2C26A 1LO3L 4Z7QE 1P7HL 2G9HA 5T1LB 1NEUA 1P6AB 3WHXA 4IHOA 1JGDA 1AKJA 3S8WA 4PRAB 5AG9A 4JGUA 4GAGH 4P99A 1T0MB 4YUEH 1EEYA 3SGDH 4KVCL 5JMOC 3R8BB 2P42B 3VJ6B 3VXOB 1F6AB 5C0BD 3NIFE 1MJUL 3QH3A 5K9OB 3ZYZA 1J1OL 4LGRB 4IDJH 4JQIH 4X7TB 3MOBL 4HIXL 4JFFB 2NTFA 5CFHA 3ZKXB 2W9EL 2XWJB 5ESQB 1DCLA 4ENEC 3RA7H 1NANH 3JTSB 4H1LH 3OAZH 1K4DA 1N3NB 5K9JL 1X9QA 2GAZB 5CSBA 1OSPL 2FECL 2R1YB 5HYSB 1QO3A 2GSGA 3NH7L 3BWUC 2GCYA 4QY8A 3VXTA 4LCCB 1H3XA 3FFDA 3MGTB 1FNFA 5E9DB 4UILH 2O93L 4LP5A 4JN2B 3VFVA 5HTSA 1KPRA 4KUCF 1YEJL 4XPHH 1A1OA 4MA8L 4XP1L 5GGRA 3LRGA 1NLBL 4RWYL 1ND0B 3LKRA 1P7QD 3M1BB 3IS1X 4M3KB 1A21A 4Q6IA 1PG7L 3VGHA 1OAXH 3RDTC 5B39A 2CKNA 4YHPA 1JNNH 4YHOH 3LKSB 2KL6A 1H3GA 2F5BH 1L4IA 3HMWL 4XAKE 3F5WB 3DBXA 4XBEL 3OJDA 4NQEB 4D3CL 5F96H 4JHWH 2NX5D 4PLNC 4DKDC 4NQDA 2NR6D 1MREL 4Y5YC 1T83C 1PW3A 1XIWA 1JZ8A 1IAOB 1N0LA 4R8WL 4U1SA 1CU4H 5FKAB 3VW3L 3LPFA 1RJYB 3MR9A 5J9PB 4UT7L 1FO0A 4XTRD 5FYJU 5GJTH 4RGOL 3JTTA 5I8EA 3REWB 3OKEA 1JHTB 3BZ4A 3QWOA 5M94B 1YEHH 2BDNL 1DSFH 4PRHA 3KPQA 4XVSH 1LO0H 2X09A 5C0CE 2OSLA 4MYWB 2C3HA 3QDGD 3BZFA 3FN0L 5FYKL 2CGRH 3IFOB 4M8QB 1EGJH 2BNQB 1H8OA 2XACC 1MQKH 1F11B 2R2HA 2V5YA 3UJIL 3P11L 4UT6H 3LZFL 2F54B 4UIMA 3ARFD 2QR0B 3VH8A 3L7FA 2F53D 5HHQA 1PKQA 2F53E 3OKMB 1I7TA 1NFIB 5CJQH 1NLDH 4NT6A 2BY2A 3DGGA 3GBLA 3V6FB 1W72H 1NGXB 3P4OB 3IDJA 3TESA 2VDQH 5CJXA 2QSVA 3Q3GB 4Y5YA 3K46A 2AI0H 1EBAA 5T3XE 2GK0A 3VXRB 4NRYB 4XHQA 1A1NB 3MMEB 5I19L 2WIIB 1H5BB 2QADD 3JV4A 1I8MB 3DROA 1GZQB 2DQFB 1TZIA 1XT5A 2R4SL 2AXGA 2X4OB 4YUEL 4S1SL 1V05A 4MB5A 4NYLB 1JK8A 4I77H 5KJRH 2F54E 1IT9H 4ZPTB 3RTQD 5C8JB 2GY7B 4FQLL 1AIFA 2DKMA 4YHIB 5BV7B 1QFUH 4JQVA 2VXUL 5LAXA 2F15A 2XKSA 3S35H 1KLUA 3STZA 2FH6A 3D48R 3VWJD 4MMXC 4L8BA 4KMTH 4LIQE 1K6QL 3MROA 4FFZH 2ZNXA 3TA3B 4MA3A 4JM2D 4NZRH 3GFUA 4TQEL 2ARJA 5DZNA 4KZEH 5F8QC 4X0KA 1X44A 3BMVA 2ZPKL 2J1KA 3SE8H 1UXSA 2XWTA 1RUML 1A7NH 5ALCH 1FV1B 5MHSD 4HMDA 1C5BH 1I4FB 3T4YB 2SEBB 3BMWA 3QUMH 1FVEA 4AJ0A 8CGTA 1FPTL 1FJ1B 1XCQB 4LRNH 4NHUB 4PRDA 2X4NA 4HIEB 4M62H 3ARFA 2I25N 5GZOD 2X70B 4XXDA 2V7NA 1KIPB 3U9PL 3V4VL 4HUNB 2NTFB 2HTKD 3ULUE 4MWFA 5FOBB 4TUOA 3EBAA 2I9TB 4LCYB 1S9VB 4AH2A 4PRDB 2NXYC 1EAPA 3W81A 4CDHA 3T4AA 4HGWA 2HJKB 3VDBA 4M6NH 5BOZG 5IGXH 4PRPD 1WTGT 1F42A 1U3ZA 4NQXB 4JPWL 3CZJA 5EPMA 1JTOA 2HFEA 5GSVA 4QRSA 4ISVB 1MCNA 4JFDD 3WHE1 3T2QA 2VDKH 3QIWA 1PX4A 1MCFA 3MLUL 4U0QB 2ARJQ 2EIZA 4XPBL 4HWBL 4ZXBC 2JCCB 5GXBB 4JN1H 4QRRB 2ICWJ 2HTLD 4YBHA 1JZ3A 1U93A 3MUGA 1U8MA 3RJDA 4L9LC 3CX5J 4NKQB 1MRDH 2H41A 1WWWX 1WZ1L 4OLUL 3ZDXE 2XZCH 4LVHB 4MXVF 1CI5A 4H8WL 3NOIA 1TQBB 4HUUA 5EPMB 4JLRA 3E1F1 4ODSH 1V8HA 4WU5B 1MQKL 1A4KB 4MB4A 1YDPB 2R2CA 4LLYA 1FNAA 2H1PH 4KY1L 3RWDA 1R5VB 2Y36L 5GRYA 5MENA 1G9EA 5CP7B 1BQHB 4QXGL 2P5WA 3LCYA 4KQ3L 3O6MH 2PNDA 3LEXA 4HV8A 1GGUA 3RNQA 2Z91A 3D2UA 1IKFL 5BZDA 3LQZB 4YE4H 3L3KB 4LSQL 2A6KB 2HKHH 1G9MC 5AEAA 3HMXL 3WL9B 5JORA 3UJJL 2L0DA 4TYUA 3TVMC 2AI0L 5FM5O 3EFDL 2OP4H 1KLFA 3RPIB 5IB2A 1YNTA 3BPCB 1FV1A 3GJFB 2QSCL 3BKYH 4X4ME 2L4OA 2VL5B 2LTQB 5BS0D 1MHPL 2DLHA 1UB5B 4YZFE 4XXCC 1PYWA 1N7ML 3C8DA 1IAKB 4OTXH 5D2LB 5IW6B 5JORB 1HXMB 5KAQG 2A6DB 4KHTL 4MD4B 3MBEB 1QQDB 4XMPL 1XF2A 1FIGH 1XCTA 2VITA 3FCTB 4KJYB 1T6VN 2AK1L 2H32A 5BRZB 4PJHA 2P4AB 1RVFL 2WANA 2YUZA 5ECJE 1ETZA 4JFYB 4NN5C 2DDQL 2ICWA 2AEPL 5FUCE 4GSDL 2GFBB 4P5MA 1HK6A 1GZQA 5EORH 4K55A 1DQQA 4D0BA 1L6ZA 3MREA 1BD2E 1PBYA 1KPVA 2VDML 2E9JA 1WLHA 2EDFA 1C5BL 1QYGL 5E2WL 4LPTA 1J9CT 1OTTD 1NGPH 4H1LG 1XAUA 3CUPA 3W0WA 4DK3A 2YS4A 5FDWB 1KG0A 3H9HA 5D7KE 1ZLSH 4P4RB 1A47A 4PJBB 1AFVH 5JO5B 4M62L 2X4SB 3KPPB 5CIPH 3O3AA 1JGEB 4U3XA 1DE4A 2W65A 1W0WB 3MQIA 5GGRY 3KPMB 1CD8A 1VFOA 4P2OB 4QHMB 4EDWL 1QA9A 4PRHE 3AAZB 2EYSB 3QDME 1P53A 4QRQA 4EN3B 2VR9A 3TPUB 3QAZC 3NZ8B 1W0YT 4NQSB 1F11A 1P84K 4FTVA 4RNRB 5E24E 4N90D 4NCC2 4OGYL 1NFDF 2QHLA 4P5TD 3EO1A 2DBJA 3OKNA 3QHFL 3BDBA 3R0MA 2WBKA 2D7MA 2DI7A 1DQMH 3FQXB 2HJLA 2R1YA 1F4YL 5D1XD 4KGLA 1FJ1A 3HR5A 1AQKL 4OLXH 4JN1L 5GGTH 2M8XA 1PSKL 2NW3A 4AEHL 4DKEH 4KK6D 4GAGL 1J12A 1B4RA 2D03L 3RX7A 5DHYA 1ZVYA 1BP3B 1U41A 5CSZA 3H3PL 3RAJH 1R3KB 2ICWI 4JHZA 5FYKD 4FNLL 2A6DA 4F7PB 3VWKB 1BAFL 3FQNA 4I48A 5BCAA 3TNNB 4G8GE 2DMCA 1JPSH 4P46B 3DO3A 3LHPH 2WLZA 3MYZA 4LLQB 3CDGA 1PEWA 2VAJA 3O6ML 1QSFA 5IMKA 3RA7L 4OZ4B 4LASH 2BSED 2Y9RT 3ET9F 3MLSH 3HRPA 1YPZA 4XMKL 3VA6A 4WO4A 1N6VA 3AU1A 4JPIB 5JDJA 3QG6A 4K7PX 4YBLC 5C7XL 2UYLA 1JYXA 5ACZB 3G6DH 4I3SH 4G6FD 3DROB 2Z9TA 3OPZL 1YJDH 1BLNB 1T5XB 2PO6B 5C2BH 1N7MH 1K3ZA 3MRFA 3SDCD 1YMMA 3Q5TA 1R5VA 4XTRC 5E8NA 4NQCB 3O6KL 4RFOL 5A2JH 3FT3B 4WI3A 2AGJL 2VZSA 4KH2A 3EGSA 4EI5A 1S5HA 3EAKA 4ZTOL 1LMKA 1KBGL 4LP4A 4ODTH 5HHQB 2PO6A 1A64A 3C60C 4QTHA 4HUWA 1F5WA 4NFBA 4R8WH 5LCVH 3VXSE 5HYEA 4JY5H 2ADGB 2CRZA 4YFLI 1A6TA 1HHKA 3DUUA 2VL5A 5TH2B 3RIAF 3JWDH 5DTFB 1G7PA 5T3ZD 4N8PA 3PHSA 3ULUL 2BNQD 3FO9B 1ZT7A 4PJGF 5JHDB 5MEQB 2IBGA 2AQ2A 4IRZL 1DBML 4YDJB 1AGCB 4V2CB 2FLRT 2F53B 5IFJA 2VR5A 3FONB 5EU5B 1IBGH 3CDGB 3GB7B 3RVUD 3DI2B 3DTXA 4HCRL 1I9JL 1QSFD 1I9IH 5LG1A 5DMIH 5JHLL 3AM8C 4XXDB 1MRFH 4K7PL 4BSWB 2FWOA 5FXCH 4NFDA 3BKJL 5J7CC 3PGDB 4EDWH 3KHOA 5CGYD 2UWEE 4LKCA 5CJQL 2X2YA 3BT2L 2J88L 1FVDB 4NNYA 4UOW1 2JJSA 3VDAA 2P7TB 5ESAA 2HG5B 1QEWB 1A9EA 1WT5A 3QJHB 3MRGB 3X14A 4OSUH 5SWQB 2YA1A 3O9WA 4GAYA 4P2QE 4ODVH 2JTDA 3WCYA 5FV1L 1I1CA 2EDYA 1A6UH 3JV0A 2BY3A 3SKJH 3GMRB 3ALXA 1FIEA 2HT3C 1H15B 2IQ9L 4FQQB 5BRZE 5E2UH 4KVNH 5EOTB 4Q7DA 1AHWB 1GYAA 4KK5D 1JWUB 1JI1A 1NCUA 5DUBA 3L95A 3G9VA 3VI3F 4YAQB 4F7EB 4P59H 1P9MC 3TH2T 3HFML 4ZQKA 4RBPH 3MV9B 1NFKA 3MRJA 2DJUA 3AAZA 1PZ5B 3HKFA 1FFPA 4HS3B 4YXLL 3ULUF 2IAMC 4RISL 5I75C 1ZGLB 4PJEE 1NC4D 1T0NB 2Y5TA 3FO1B 5DA4A 1U92A 4Q9BA 3F12A 1EO5A 1RK0B 3B9AA 4FFZL 5GIRB 2BOCB 1UZ8A 2NLJA 2GJ6B 1N0XH 1N5YH 2X4NB 3GSUA 1A1NA 4NPYB 4ODXA 4Y19E 4NJAL 2F8XC 3IDYB 2Z35B 3T3MF 43C9A 5J1AB 4UOW0 3ARDC 3SE8L 3VRLF 3RWIA 4NUJB 4LLDA 5IFAL 3LKPA 4Q6IC 1G7PB 2PYFA 3WFZA 1ZS8B 4F9LC 5CIPB 2B1HL 3GSXB 4L3EB 2R9HD 4QXWA 1IAIM 3OKDA 1I85C 1PVHA 2WINA 3QNZA 1BM3H 1C1EL 3K3QA 3GNMH 5M7QA 3FQTB 1A6AA 3QPQC 5L8KB 4X80L 4OD3H 5GZOC 4I2XA 1JYNA 2NX5A 5FCSH 3MRDA 3BD5A 3VFGH 4YHMH 2HWZL 4HFUL 1NCBH 4KQ4L 2IANE 4RWHA 2RB8A 3ILQC 2FIRT 5HD8C 2IPKA 1P84J 5I1HH 3U2SB 2EXWC 4GG8B 5D9SB 3QI9D 1H8NA 5FCUH 1FG2B 3MV7B 4P23C 1JPFB 2A9NL 2R0LH 5KANI 4OQ1A 5HGHB 1X4XA 4X8XA 4JJHA 3U0TB 3A0OA 4LQFL 3ULUH 3N1QC 5DEFB 5EOQH 1GC1H 4OZHF 4NO3B 2P8MA 1AD9A 2OK0H 3S7GA 2Z8RA 4G6ML 4PJ7B 1EIBA 2NY4C 1D5IH 1CXIA 4AZ8A 1FYTB 4IIQB 1OF2B 4CBPA 5C0GB 4Z95L 3IJSB 4MVBC 3BKJH 2CJUL 3OG4B 4X6CF 1EFXD 1BZ9A 2OL3A 4NUGL 5DJXA 1VEOA 1L0YA 5I1DB 4HZLB 3HPJA 1IKFH 1TQBC 4YIQB 3WEXB 3B9KD 4XCFH 1M7IA 2D9CA 2X41A 4G8IA 3VD7A 5BS0B 3HMXH 1DP0A 5DK3A 4LGPB 1A1MA 3K8KA 1CICB 3CFDB 1T89C 2AXFA 3VRJB 2XZAH 1T2QH 4JDZB 1QACA 5K9QI 5T3XD 3IXTA 5E94B 4YDVA 2XQBH 3MBED 5CINH 4Y5XB 1QVOA 1UKQA 4N8VG 4OCYH 4R96B 4LNRA 4U1GB 1YY9C 2AK4A 3BQUB 1N26A 3IDMB 4HKZB 4WU7A 5BJTA 4H26B 3WDJA 2HT2C 4NHCH 3C6SB 1A7QL 2XQYG 3BPOC 4LCWA 1CF8L 2A6JA 1MPAH 2XA8H 3HLAA 4PV9B 4X9BA 3IVKB 2P24A 1RUQL 1S7WB 2NCMA 5KTEH 1IGIH 2W65B 3V7MA 3WFCH 2VL4A 1RMFH 2ORBH 3HZYB 4Y4KA 3LIZH 1ZGLA 3HR6A 2F53A 1I8IA 4X6BB 3BP4A 2CK0L 3ARGA 3U6RA 4Z78B 4KTDL 3DMMD 2WK2A 5I1AB 4WI2A 4GKSB 3UCRA 4CVZA 5B8CA 4NZTH 5C3TA 1DBJH 1BMGA 2R0ZH 2YRZA 4U1IA 4HC1H 4WWID 1P5VA 3MRCA 4WUKH 4LCCA 4FZEH 4J6RL 2XG5A 3BDYL 1NCCL 5FA3B 1NFDB 5BQ7B 2ZJSL 3X11A 1U8NB 3RUGB 4AG4L 4KK9D 2NZ9C 2YEZB 1S9WB 1HH6B 1QPPA 4LLUA 4X5WA 2BVEA 4GMSH 4DVRH 3BEWB 2WIMA 3FT3A 2E3VA 1F6LL 5F3HA 4DOHB 3QXDB 5H2BA 5K33A 1VPOL 4P5TB 4J3WA 3KYNA 4G9FD 3CMGA 3GRWH 3LH2L 3EYSH 1YNLH 2E8ZA 4HLZG 1EK3A 1FL6B 5ITFA 1ZLUK 1VADA 2DMKA 4LCUB 3QT2A 5KZCD 3O2DA 3PQYA 3KWWB 3BUYB 4NRYA 4IEFB 4HUMB 3GMPA 3EYQD 1JNLH 1YPZB 4OLXL 2OL3H 4LQFH 2C7UB 1RURH 3F7VA 1INQB 3QIBB 2YMXL 3U7WH 4LK4A 3K80A 2OK0L 5IF0B 4HJJL 1K8IA 5DZOA 4PBWD 2VWEE 4XP6H 2D0FA 3IF1B 1BPVA 1JZ7A 2H26B 1N2RB 1P4BL 2A6JB 2GTZA 3IVKA 3O3DA 3B9EA 4IOIB 3BVNB 1GGIH 1CLZH 1SVZA 2O5ZH 1JF1B 1QSFE 1AJ7H 2EC9U 4BQ9A 2FGZA 1I8KB 3OTTA 1TVBB 5JNYA 2NY5H 4XWGH 5HI3D 4CGTA 4GRLB 1JZ5A 4P2CG 2C9AA 3C5ZB 2G75A 4RFNB 1GHFH 5KVEH 3OV6A 1OAUL 2Z8SA 3PWLA 1CGYA 3AREC 3QEGL 2ITDB 3ZL4L 5FO7A 2EE6A 2P5EA 3IU4L 4GOSA 4HKBA 2O26U 3ZKNC 3BIKA 1E4XI 3GJFH 1TETH 3MLVL 1ZLWK 1K3IA 3NBNA 2F5BL 4ODWB 1F90H 1GOHA 3TPUA 1XZ0B 2Z8WC 4R4ND 1MCDA 2B20A 4MGXA 4J3SA 3ZE2E 1NKOA 4BQ6A 1R6VA 2NY0C 5EU6B 1QLEL 3UTSA 3I3DA 3DRTB 1KSRA 5GHWL 3PWJA 2VDRH 2YOCA 1RMFL 2ORBL 4Y2DD 3WFBL 2HFFA 1NAMB 2XKNA 4OD2A 5C0IA 1WAAE 4Z76A 4UDUA 1WAAA 5C0CA 1DN2A 3L5HA 1MH5A 1CZ8H 1FLRH 5C9KA 2IEPA 1OGTA 4KUZL 1HILB 2P7TA 4RMTA 2B2XH 4X6DB 3D0VB 4Y5XA 4ELKB 1E27B 2I60H 1FFQA 3AM8A 2I9LA 4JZNB 1FC1A 2ENSA 4ONFL 5DVOA 2R23A 3F7RA 1IILE 2IBBA 5D9SA 1HDMA 5LWYH 4HX1B 4U1MA 4LLWB 3WIFA 5BS0A 4ZMAT 4R9HA 5HYJE 3OF6A 5JHLH 4R90L 4KRPB 1NMBH 5DEGB 4WNQA 2OXHA 3GMQA 4YHIA 1C7TA 2GTWA 1WFUA 5D7JA 5I1GH 5K9KA 4KI5F 2O5XH 3TBWA 4ERSH 5D2LA 4KKLD 4P3CH 5M95B 3HC4H 5HDLA 4LHQB 4RGNC 3BPNB 2AXHA 4NRZA 2APFA 2FHCA 5JOEA 5CS7A 1AO7E 4U05A 3EO0B 4MNGB 3QQ4A 5GRVK 4PJXB 2PTUA 4XNZB 4L3EE 1S7TB 1TVHA 4PGZA 5FHAL 5HHPB 3K2UH 3DMMC 1FL5B 3IDIA 1C8PA 1RJLB 3RWFB 1OVZA 3O11A 1IARB 2ATKA 3QEQD 5CZVH 3BEWA 3JV5A 3PWJB 4ODUA 4O5LL 3FO2A 1F8TH 1KCUL 2JJWA 3V6OC 3V4UL 1WEJH 3FB6A 3O45A 5H94B 4WW1A 4HJ0D 4UIKH 3MJ8A 3V5DB 3GBNH 2R2EA 1G7JA 3IF1A 1OAKL 2EIBA 5DK0A 1FC2D 5J12C 3T0ED 1A7PL 4P2YA 3H42H 3QXWA 3VWJB 2DF3A 2FD6L 1JFQH 4K3EH 4OF5A 4L3ED 3TA3D 3D3VE 2M26A 4LLWA 3SJVE 4KKCC 1IAII 2PETA 4R7NA 4W4NA 1FG9C 1WJ3A 4JKMA 5KVEL 1RI8A 2PYEB 1CTNA 1VACB 4YK4C 4D0DA 3MYJA 3MV01 2GIYA 4AEEA 1WC7B 3AMLA 3O8XA 3GSRB 1Y6NR 1NDMA 1X5IA 1W8NA 4OM0L 1TLKA 5IBUG 1K4CA 3EIFA 4TN9A 3KYOB 3TCLB 1LK3L 3T4AB 4NKMB 3V8CA 2A74B 3QXTA 2XZZA 1NMCB 3IFLH 1QLEH 4UAOB 1NDMB 4K8RD 4HULB 5DJDA 5DD3L 5I15L 4YC2C 2YEZA 3MV7D 2EDWA 1QFWI 2AJUL 4N0FA 3VH8G 2VWEC 1G7QB 2LVCA 1V3KA 1LO5A 3TT1H 3QULA 4DZ8A 3FHQA 1GIGL 5GRUH 3DVNB 3P3YA 1EV2E 2P5EB 1JHKH 25C8L 5IMMB 2HH0L 1CDYA 3ARBB 1EFXA 3ZTJG 2X05A 5E8EB 1QFPA 4JFDB 3DUHA 1BZ9B 1A3LH 4G8GB 1G7QA 5EOQL 2A9MH 5LWYL 5GS1B 2VLKA 2VXQL 3MTRA 3RRQA 5GSVB 4XGZA 1J1OH 1M05B 3S96B 4L9LA 4HIXH 1C16B 3MRLA 1T22B 4XC1L 3UC0L 4RSVA 1SY6L 4WHYH 5CEYA 5D5MF 2Q7NA 4PJAB 3QRGH 4I0PC 2FX8L 1RIUL 5C6TL 3HC4L 3UJJH 4NKDB 3RBGA 3E3QC 3LN4B 2RFXA 4YPGA 3QUMA 4AIXA 3KAAA 1S9YA 4XHJD 1J87A 1QFWM 4WJ5A 3RY4A 1MFDH 1WCBA 5HYQB 4MMZC 1VEMA 3B2VH 1CT8A 5FF6A 2ZG1A 3O41A 4Y4FC 4V2BA 3RNKB 1JNNL 1XF2B 1HYRC 4LHUD 4P9HH 1T1XB 1Y6KR 2OTWB 3MJ6A 3RZCC 5F7EH 1S7SB 2FBJL 1K8DB 2LAGB 3PQYE 2BNUA 5EZOL 4TUJA 1EGJA 1EZVX 4N9GA 4ZUVB 4JRYB 1WAAF 1MEXL 3LN5A 3CVIH 2NZIA 4ZAKC 4PY7A 1OGAA 1ZVSA 1ZE3C 4UINL 3THMH 3MV8B 4DZBB 5IFHL 4PJHE 5C2UB 5D7SL 3NFSL 5EC1A 1T1ZA 3CX5K 3ZLQC 1XGQB 5ITBH 4U6XA 2V2XA 3BPLB 1CLYH 2HN7A 4YEFA 2G60L 1PGRB 5DQJB 4LVHC 2NXYB 1SBSL 5CZXC 4JDTL 4JDZA 1S7TA 5GS1A 5BO1H 2B0SH 4GMTH 2BDNH 4NGHL 4XVSL 2AK4E 3OKNB 4NZTL 2OR9H 5ESVB 1GGYA 1CIDA 2FEDC 2WW8A 3T0VA 3LPWA 1G6RH 1FN4A 1R5IA 3VD4A 1UZ6F 2DI8A 3ZE0E 2ZJSH 4F8QA 3QB7C 3P11H 2VIRA 3LZFH 4IMKC 4NN7C 4AIOA 1X7QB 4DUXA 1OTSC 4OZGB 1RZKL 2OI9C 3QUKA 2QSTA 1AGEA 4WFEE 2CLRB 3BGFB 5JDSA 5DDHA 3H9SA 5I76B 1YN6B 5KW9L 4AMKL 2DD8L 3WIFB 4WI5A 1U93B 2VB5A 4FABL 3TNNA 2R56H 4IMLB 3RFZC 4KXZH 3TBVB 3UDWA 1WITA 1JUFA 2DLTA 2IJ0C 4YHYC 5IWLC 3SO5A 3VWKC 1B0RB 5JPNB 1E27A 4LNRB 1X5KA 1TVBA 5FM4A 2QHRL 4WV1C 3O8XB 3CD4A 1PSKH 4XBPB 4WIQA 2QKIA 4PUBH 4PJEA 3MRNA 3VXQA 4M7ZC 4FXKB 4XX1E 3VXSD 3WNMA 1XF5B 4O9HH 4U49A 3LN5B 3PGDA 4ZFOB 4MCYA 4FQJH 4JG0H 4OCXH 4ZYKA 1FFOB 1TZHB 2J6EH 3L3JB 4XVJH 1U8LB 4GG6E 3JWOC 5CBAB 3IGAA 2EDOA 3FFCE 1UFUA 3ZHLA 1TCRB 5T3ZL 1DVFA 2HVJA 2O5ZL 5F7YC 4LDOB 1ZA6A 4GRLD 4F57L 1BOGB 2VQUA 3RKDD 4X4XA 3H9ZA 3QDGE 3OWEA 4GAFB 3RY5A 4Q2ZA 4G6JL 2BVQA 4FQQA 3OAZK 3B9KA 5D1ZC 4Q9RL 5ALCL 1RIVL 3HHRB 4WENB 5GJSH 3N1PC 3DVIA 1MI5A 4LLMA 3VI4E 5HHXH 3B2VL 3MRGA 3CSYA 3X14B 1ZVHA 3VI3E 5KAQF 5L8LB 3HI1B 3VGFA 2DRUA 2XI9A 2BSTB 2B39A 2KDGA 1T0NA 2QSQA 3AFLA 2BNRB 4RFOH 3GSQB 4O4YH 4X7SL 4Y2DB 5I1IH 4M9PA 4H0HB 3AROA 3A6CH 3F7YB 1QRNB 3SDCB 3MUJA 3LQAC 4BSWA 3K8LA 4YFDB 3QUZB 2Y07H 2RQ8A 1KOAA 1YPZE 4M7KL 6FABL 4JPWH 5KOVC 5BV7C 4NO0B 1AHWA 1LEGB 4OCRH 2NY2C 4BJLA 3U0PA 1JF5A 4KUCD 2DOCA 5GSRB 5B38A 4EBQL 3HMXA 2NQCA 4NZUL 2CUHA 4U31A 1NC2B 3L5IA 5J56B 3NAAH 2BK8A 1TJIH 1U8KB 1IEBB 5SV3A 3SJVD 3ETBF 1EERB 1KELH 3WFEL 3VWJC 3QEHB 3MUY1 2PR4H 4GRWH 3QQ3A 3G6AB 4ODSL 4QRUB 4HWZB 3S37L 3EOBA 2JJTA 4YDIL 2DQUH 1DQTA 2OYPA 2H8PB 1CDJA 1U8LA 1VDGA 2H2SC 1MELA 5T1KD 3ELAT 1QVOB 1OP5K 3B8YA 5E94A 2A73A 4ZNCD 4XNXH 3FONA 5EU5A 4AMKH 2O5XL 4B7LA 3G5XB 4HS3A 2ICEA 5FGSA 3UP1A 2MCG1 5MEQA 1LO2L 4KDVA 3TO2A 5DFWH 4LAQL 1T04A 4Z0XA 2YPVL 3DECA 2WWMD 4LARL 1HE7A 3MA9L 3P9MA 3B43A 2VDLL 4QGYA 3SKNA 4M7LH 4FQJL 4KHTH 3WD5H 4Z6AT 4O2FB 3GJFK 4LVOB 4XP5H 2X4SA 1MCQA 5I1LA 3U82B 4KRMB 2PO6C 4PLJC 5T1MA 5GS1C 1HXYA 1RVFH 4RGNE 2NY1C 1JNJA 4U1HA 2FGWH 3U7YL 3AGVA 4A6YL 4BQCA 1KEGL 5GS2H 1GL4B 3C2AL 1U3HB 5IM7A 1FZJA 4X4YB 1F3DJ 1ES0A 1BJMA 5FFLA 2X70A 3UDWC 4I13B 2B5IC 3KG5A 3I6KA 4JZJB 4DGIH 5GJSL 4C57C 1P4LA 1U2HA 2OBGA 4PFEA 5BW7A 2B1HH 4HXBH 1P5UA 2I27N 5F9OH 5GGVY 5DK2A 3SE9H 1ZLSL 3SO3B 5IR1A 5ICZA 3BHBB 4JR9H 4ZUUB 4RQQA 1HHIB 4OGAC 1KJ3L 3MRDB 3CDYA 4LSRH 1CFBA 3L7EB 3NZHH 4PJDF 1EH9A 3W2DH 3G5VA 2J4WH 4XVUC 3IB4A 4YBQC 1CFVH 2X5PA 4ZUVA 4GH7B 3IAPA 1MHHA 3LB6C 1DL7L 4X7SH 5CUSH 5T3XL 1T7VA 1AE6L 4P9ML 4L4JA 4PYHA 5JQ6H 3GSXA 4L3EA 5DURD 5EUOF 3L7EA 3GUTA 1BGXH 3PABA 4Y4HD 4S1DD 1UQSA 2VTFA 2P5ED 4OFYA 5KS9A 3MA7A 3ARBD 2FHFA 3NABH 4LLMB 2CQVA 2PXYD 2BFVL 5GGTL 3WFHB 2ARWA 1UWXH 2A2QT 3F6IA 2BP3A 1TZIB 2BHYA 5DD0L 5D71L 1ZT4A 1HKLL 5DWUH 4GG8A 4GKSA 1REIA 4I9WE 5CHNB 3HRZA 2AS5M 1ERNA 4MQXD 1B0WA 5CP7A 1AO7B 4AM0B 4Y1AB 3DO7B 2PCPB 3UJTH 4U1KB 2VLME 4YHNB 5FYLD 1YJDC 5LGJB 1FL3B 3NIGF 4E41D 1FGVL 3GMMB 3MRHB 5F6IB 4WWKC 2ICCA 3MNVB 2E6PA 3MRIA 3KPPA 3I2CH 3PWLB 3OHXA 1S7WA 1AGDB 3HE6B 4ZYKB 5GGSY 4TSBH 4PB9H 5LGHL 3P40A 3RVUC 5D7LE 1EFXB 2CPCA 1WWCA 5F7NC 4Z77A 4QRSB 1R3KA 2ED9A 4ZOCA 3X17A 1HHHA 2XZAL 5MHSE 2YPLE 3G6DL 2YPVH 4NJ9L 5C0NC 3CVHA 4X98A 4PPTA 4M02A 1QO3B 4YBQD 2P5WE 1MNUH 3RWEB 5LJYH 4FQCL 5FGBC 3BVNA 2FJFA 3EDEA 2A6KA 4ZXBA 4Y4FD 4ZO8A 1JGLL 5BZWA 2VABB 2VDLH 4NHCL 5DJDB 2VLLB 3MR9B 2EDEA 4FQ2H 3RHWK 4Z8FL 2FO4B 1A7QH 3S5LB 5TJWK 3H6JA 4X8JB 3QXVA 3GB7A 3RWHA 3BIAX 4YIQA 2CLVB 1DQLL 4Z9KB 5MENB 5L2KE 1RUKL 1HH9B 4Q0XH 2NXYD 3THML 5HPOA 3PNWA 3T3ME 4FQPA 3PIQA 5ICXA 4O2EB 2OZ4H 5JXAH 1D7FA 2EH8L 4XPAL 4Z7OF 3WHE0 1OSZA 3GHBL 1BJ8A 5DRZB 2G60H 3O2WH 4PJBA 5I30L 1FL6A 4ZFZB 1I1FA 3IU3B 5IB2B 3MRBA 3CZFB 4XPFL 1E6JL 2OZ4A 4MXWH 4GAYB 4IMKA 2FCBA 2UWEB 2LU3A 4P5TC 5I8CB 4OZIF 5FKPB 5JUEH 1NCCH 5DRNA 2Y23A 5IMLA 4HXBL 5D1ZB 3IDXL 3FO0L 3ZTNH 2Z93A 4AG4H 5I17B 4H0GA 1V7NL 2Y4SA 5EBWA 3HB3D 4N0CD 5DJYB 4KMQA 3W11C 4GMSL 4DVRL 1Q0XL 1EEQA 3UMTA 1BD2A 1CFVL 1XF3B 1BQHA 5FGBA 2XN9A 4P23A 5BVJB 5EIIB 5IK3A 2FB4L 2Y1VA 3QCVH 2IALA 4M48L 5HHNB 1CICC 5EBWB 5JHDE 3CFEB 3Q6FA 3B2UC 4IS6B 1KJ2B 4QRPD 4TVPL 4UT9H 2H8PA 2VERN 4OLWH 1QLFA 1BOYA 4LHUG 1MI5E 1TQCB 4GBXA 4OSUL 4G9FB 1WV7T 4C58B 4B7IA 4CADB 4OAWA 4LBEA 2K1MA 5FV2A 1U8QB 3FQWB 5E8PA 5F9DC 2IAMB 2E9IA 4WCYH 4RMSA 3T0EA 2BHZA 4ISVA 4UBDD 3BD3A 2BVQB 2EEDA 4E5XB 2ZUVA 4LLQA 5C08B 4LVNC 2IH1A 4P59L 3I02B 3PHOB 4N68A 4LBEB 5ERWB 5J89A 4JY6B 3SCMD 2X10A 3C6SA 2Q76B 5E6ID 1KCRH 2OR7A 5DJ2B 3QIBD 2BOBA 4Q6YA 5CEYB 4EI5B 1G7LB 1SJXA 3HE7C 1U8JA 4U1GC 4U1LA 3V0WL 5LXGL 5DHYB 2HRPH 2FJHA 5GS3A 1YEDA 2Q86A 4QYOA 1N0XL 1N5YL 2Q8BH 3GSVB 3P30L 3NVQA 2Q3AA 1OSPH 4GKNB 3TF7C 1OARH 1L7IH 1RD6A 3NH7H 4FQHB 4JFEA 5FA4B 5CMAB 4XBPA 3C5SB 1UCBL 4UILL 4C55A 4AENA 3A6BL 4WW2B 2A77L 4WI8A 3HC3H 2E7CA 4JANB 1I1AB 1TJHH 2UWEA 1BIIB 4MA8H 5I8CA 3VFPB 3I84A 3JZ7A 3QUXC 2VZTA 2D4DA 3DOSA 1EHNA 2WBJA 2AABL 3H0TB 5JPMA 4O51A 4MLSA 4G7YL 3O4LB 3PWPB 4LF3B 1PG7H 4HK0B 2DTML 4QRTB 4FMKA 1JGEA 3O3AB 4ETQB 4FQ2L 3GMMA 5HGBA 4R97C 1AHWC 1A6WH 1G7IB 3EYFB 4MLIA 1DQLH 4I48B 3ARDB 3VFPA 2UZIH 5DT1L 4HFWA 1WISA 4QF1B 1A7OL 2ITCB 3SJVB 4TUKL 2YPKB 4Y5VA 3D3VB 3CCHB 4K9EH 1CXKA 1CZ8L 2K7PA 5I2IB 1A6ZB 1E4KA 5LGKA 1F45A 5ADPH 5EOCH 3SOBH 1QBAA 2DKUA 4JREB 2X4QA 3KGRA 4ZTPH 3R1GL 1GC1L 3CFJB 4I2XE 1SQ2N 3ZT6A 5KS9B 2HKFL 5JUEL 2IC2A 2PR4L 2VE6B 2OQJB 1D9KB 1ZANH 3DGGB 4POZC 2B5IB 4OB5L 4GAJH 4EIZC 4ONOA 4JZOA 4PRPE 5JXED 5IEKA 1Q0XH 4XCNA 1AP2B 5T5FH 2IGFH 4M43H 1WZKA 2UUDK 4TNVF 4XC3L 1X6LA 4ERSL 2XT1B 3FO2B 2PN5A 2CK2A 4MJIE 3EGSB 3OR7B 3G04A 4M8VA 4PD4J 3HNVH 5DVKA 5C0FA 3C60A 5JOFA 4Q9QH 4B41A 1IEBA 4M7LT 3O41B 3TM6A 1W72L 5GGSA 3DX9A 4EIGB 1MCIA 1FQ9C 2BVYA 3TN0C 5EA0H 4PRID 1U8HA 3VCLB 3RDTB 3L9RA 3X13B 3JSSA 5H8DA 1OD7A 3RZCD 3LQZA 4YJZL 1M1SA 4HS8H 5E2TH 1DVFC 5B4MC 5I6XB 2DYPA 1ZHKB 5J12B 3NPSB 4S1SH 5HVHC 3EJYD 1OPGH 5JIKA 4TVSa 2AJ3B 3WD5L 1EZVY 5DD6B 3KPSA 5D2LE 3UTSE 3VXMD 2VUYA 1JV5B 3QFJE 1QFUL 3MRQA 1HH6A 5L2KA 4FG6C 5DUBB 1CFTB 1UH3A 1WBXA 3F5WA 4YFLF 1CK0H 3TO4C 5L6YL 1NFIA 1I7TB 3O2VL 4WFHD 4KMTL 4NWTL 5KG9A 4JY6A 1K6QH 1A7PH 5FO9B 5JZ7C 3GM8A 1BWMA 3OKDB 1YEGH 2R0KH 3ZZ1A 3KJ4B 4V1DD 5F6IC 1YEFH 1J0ZA 5IB1B 4CVUA 3C5JA 2CXKA 4J2XA 3D0VA 1QSEA 3RY6A 1RUMH 2BRQA 3A6BH 4L4VD 4O2EA 4P46C 4QY8B 2DQTL 1EEZA 1ZLVH 1MI5D 4GKNA 5ADOL 2HJKA 4WW2F 1I75A 3ZKQD 1QLRB 5FEBA 3D25A 3WNNA 2PYED 2X1PA 3IJHA 4PP2B 4U1LB 4BSJA 2DLGA 3V4VH 5IM7B 3IYLW 4P3DA 3O6LH 1NGWA 2HFGL 2WBJC 1DL7H 3WUWA 4CU6A 5CEZH 2XIDA 5I15H 1GSMA 3K74B 1KPUB 2F8VA 5F6HI 1V7MH 4QGTA 3LH2H 4PJEB 1QSVA 4QRRE 4I0KA 4FFVC 3T3PE 1KLGB 4LOUD 5HGBB 2VSCA 3CXHK 4JO3L 4Y0GA 3ISWA 3KPMA 5EDXA 3MCLL 2PYEA 3MRRA 1O0VA 3LV3B 1JHKL 25C8H 4OZFA 5ADPL 2HH0H 1AO7D 5E5UB 4O58L 1WIPA 4KK8D 2NY5C 1CYGA 1QLFB 3MRIB 3VG0L 4FTVE 4NNPH 2HKFH 2ZCHH 1KLUB 5DWUL 1I3GH 5INCA 1AGBB 4LSUH 4OB5H 5EO1A 3QAZB 2CO6B 4BK4A 3HE6D 4G8GD 2DM7A 3TZVD 3UJTL 3ROLA 4XC1H 4UTBL 2Z8VC 1CBVL 4UV4L 1P7QA 2IGFL 3KXFE 1NC4A 3PV6A 4PJHB 3BP7B 4LLAA 3S5LA 3UTTA 1I9RH 2BVOB 4U2ZA 5GS0L 1H8SA 4JKWA 5D7IF 3KNBB 5HHOE 5TE4H 2JIXA 4LSQH 4TSBL 1FHGA 1FL5A 4KJQD 1YMHB 1S7UA 5EZIH 3U4AA 4F2MB 1M6OB 1WQVT 1E4WL 4L4VA 4HWNA 4OGXH 3ROOA 1NGXA 1WIUA 1L9MA 3NA4A 1NBVL 4QOKD 4OZ4A 2QSCH 5FYJL 3VFOB 5DJ6A 4JFZL 3TWCH 2P44B 4KROD 3GSOB 4W4OC 1U95B 3MLVH 2ZOKB 4G5ZH 3OKLB 1S7VB 4W4OA 3Q5YA 4TRPL 1YMHA 4F2MA 5KSAA 5KN5A 1RY7B 2B4CL 4GW5A 3BWAA 3PGCB 5EZJA 1T03H 2R39A 4N0UB 4P4KC 1IZKA 3VXMA 5K9QG 1FVCA 5FIEA 2FIKB 2LTQC 5IFHH 3PL6C 2OSLB 5JLZB 1UM4H 4K23H 3DXAE 3VGDA 3DSNA 5D1XA 3PGFL 1X5YA 5DVNA 2GQHA 5EU3B 4IRJC 4NZJA 1U8NA 1AY1L 4HBCH 1S9XA 3DURA 1X5HA 2YHGA 3BP6A 3UBXA 4JDTH 5FYJE 2IPTL 2R0KL 3QDJD 2KPNA 4MVBD 3WSQL 3P0YL 4P2OC 1JHLH 4NO5B 4JE4B 4XPFH 4ONFH 3EO9L 1N5AB 3PXHA 5DS8B 4GRMB 3UTZB 5HHMB 1NBYB 2NY6D 4LSSH 5C3LD 1HN1A 4IRSC 1LDPL 3T1WA 1LK2B 3OXSA 1KYOK 1HSBB 1IC7L 5KVGH 2DBLH 1SEQL 3E6HB 3S96A 3TP4A 1CL7I 4RMQA 1A5FH 1QNZL 1YEEH 3JUYA 4MXQC 2XQYK 5IEHA 4QRPB 3JWDC 3VH8B 5GGQL 5IW1A 1RFDL 1P2CA 5FGRA 2ADIB 5C0AB 5TGBB 1RZ7L 2Z92A 1YY8B 1JWSA 3WIIH 1BQSA 5GISH 1CDGA 1GH7A 4RAVA 4OCLC 3RVVC 4CL7A 4UT9L 4D0BB 1B0GB 4XI5D 1OCWH 3N85H 2ICEB 1XEDA 3L5WA 3RZWA 1B2WH 1AR1C 1XF1A 1E4XH 3KHQA 1IRAY 5SX5H 1CD1B 2W0FB 4PRIE 4I18C 3MRKA 5D72L 3QWQB 4KPHH 4BKLB 2VH5L 1FO0B 4O58H 3TYFB 3V0AC 1CGXA 1ACYL 2E6JA 3H9SD 4BSVB 3L3GA 5A16B 1MCSA 4PJ5D 4D8PB 4YZFF 1J10A 3OKOA 3IKKA 1U3HA 2ED7A 4XNYH 1IAOA 4KI1A 3H3PH 3RAJL 2NY1D 4LSUL 2Q20A 4J3TA 1EFQA 4ELMF 4JKKA 4L8SB 3D5OF 4TUJB 2VDOH 1K8DA 3PWVA 5MEOB 1OP9A 1UJ3A 2APVA 3D85A 4G6KH 3S36L 5IR1B 3GMOB 4LASL 4NP4L 1EVUA 4Q9RH 4RMUA 1RZJC 1Z5LA 1ZT7B 5JHDA 5I9QC 3QO0B 4IOSD 1J11A 1JCKA 5TDOB 3WJLC 4BELD 5HHXL 1RUAL 1S3KH 1VSCA 3DIFA 4HJGB 4XCYB 5TQ2L 2A77H 5D7JC 3RIAK 4NKDA 5BV7L 4YH6A 2D7NA 2PW1B 3OPZH 5HD8D 4HG4J 5C2BL 4GRLA 2CUMA 3ROLB 4G7YH 4U1HB 1HCFX 3RWCB 3MFFA 2ICES 4O4YL 3HUJF 3RVWC 1LNUB 2IANA 1MHEB 1MREH 1A6WL 2B8OT 4YX2H 5J06A 1JF1A 4KI5E 1T5WA 4AEIH 4Y5XC 4MNHA 3VXOA 4ZG1A 2OXGA 4WV1B 4F8TA 1R0AL 2BNUB 3G5ZA 4OZFB 4NQEE 1IL1B 4Y16A 4UT7H 1MFNA 2BNRE 3DUSA 2XTJC 1QKZH 1NBZB 2DLIA 3NAAL 4JCMA 2OCFD 4EXKA 2ERJC 4ZODA 4L8DA 3BN3B 1CVRA 2DQHH 2X4PA 1QP1A 2NXZC 1FDLL 3EO9H 1JGVH 3OGOE 1WCBB 4MAYA 3QIUB 1YC8A 2I9TA 2JIXB 1LDPH 1DANU 4Y19A 3PHQA 3MV9E 2UZXB 1HI6B 1A5FL 1QNZH 4M7ZB 2R29H 3KDMB 1MRFL 3BGMA 5EIQA 1DUZA 3I9GH 4OUUA 1QR4A 5C92A 2HJFA 3TBTB 1M71B 3BRDA 1DQJA 2R23B 2X40A 3KYOA 4XC3H 3TCLA 1ZLVK 3C6LC 5E9DD 4X6FA 3EHBD 4GG6B 3WIIL 3QXUA 1MRCL 4RCAA 3LKQA 5TPWH 3PWUA 3RZCB 4F9PA 4UAOC 2NY3C 1MH5B 2QL1A 1RU9L 2VLKB 1FSKB 3VRIA 1OP5H 5EFIB 3H0TA 5CEXB 4Y2OA 4JM2A 3ZSSA 4KDTC 1N59B 3O9WB 2R4SH 4N8VA 2AV1B 5D72H 3NCMA 1OSZB 5IB3B 4P3WA 1I9EA 4DUVA 4CN1A 1IT9L 4JFQB 2VN4A 4PJEF 1BOGA 2D9QB 4XNYL 4NQDE 5IBTH 3BPNC 4KI5D 1EJOH 5I71B 1ZWIA 4NYLA 4L4TD 1W72B 4M6AA 3QIWD 1OGAE 4KTEH 3B5HA 2FGWL 2OMNA 4V1DB 4PP2A 3NFSH 4BH8A 1FFOA 4CAGA 3KR3L 2WLYA 4EUPH 1KXQE 2HTKC 1G7LA 1F4HA 1LK2A 3O11B 3OXSB 3NPSC 3ZE1E 2VAAA 4ZOAA 4R2GC 4JFXA 1SHMA 3NCCB 4LCWD 3UTZA 9CGTA 1YEGL 4C54A 5DJ8B 3VJ6A 1ZEAL 1OQXA 3SQBA 1A7NL 3PG2A 3U0TA 4Q97A 2W0LA 1Q94B 3WXVL 1YEFL 5C9JA 2OI9B 3AY4A 5D5MA 5IKCA 4L8DB 2D0HA 2X9WA 3GKWL 2NY4D 4LPVA 3ZKXC 3HPLB 3PDOA 4Q2ZB 1G6RL 1A6TB 1HHKB 5F89A 5F9OL 3AREA 4LRNL 4PRAA 1NCWH 5F9WC 2VXVH 3T1FB 3EFFA 1KXVC 4L3CB 2P1YA 4U6YA 5F7LB 4CADA 3FMGH 1N2RA 5L0QC 3VXSA 3E3QE 2F54A 4UIMB 3SDAB 3V9FA 1LEGA 3U0PB 3W9EB 5MP6H 1FNEB 1YPZF 2YR3A 2NX5E 5T1KA 1VFMA 5DMGD 5FAAA 4IRJA 3BZFB 4MDJB 5HGDB 5IVXA 1S8DA 3BZEA 2WWKT 1BVZA 2HLFC 4YHNA 3SHSA 2H3NA 4XB7A 2EKSB 4PJIA 4G8EA 1RJCA 1H5BC 1KB5A 3SPVA 2QADB 4DFHA 4YO0A 2DS4A 4HT1L 5LBSH 1LE9A 1IQWH 2JELL 3JWOH 1R5IB 1MVUA 1ZS8A 5FUCC 5KSAC 1ADQA 1A14H 4XCYA 2ATKB 4HJGA 2A38A 3RUGE 3SJVA 3RWIB 1KGCD 3EOAB 4Y4KC 2WIIA 1AC0A 3G6JF 4PBXA 2DQHL 2W9DL 1TCMA 3Q3GA 4Y5YB 3QYCA 4R7DB 2FEEL 1OL0A 5HGHA 4PGCB 3VG0H 1H3WM 1I1FB 3IU3A 4NNPL 2ZCHL 4OCXL 5HXMA 1IAIL 4HQQL 4YGVB 1MJUH 2WQ8A 4BH8B 4JQXA 5C0DA 5AG8A 1UJ3B 1WVZA 5HGGS 1U91A 1CFSB 1QPXA 1VERA 2NY0D 4EQ2A 3IJYB 1J05B 4CKVX 4F7CA 2E6QA 1U36A 1BIIA 4NUGH 4MA7H 2VLRE 4GFTB 1IGTB 1V3MA 3UEZA 5I75B 3QCUH 4WDIB 2LE9A 1OAQL 4JFHE 3RWEA 3BKYL 1W2KT 1X6NA 1I8LC 5HVWA 3JTTB 5DO2D 5KSBF 3IFPA 2YC1B 1OWRM 3RZCA 2BJMH 4LCIL 2XQBL 3WLBB 3D3VA 1XGQA 1JGLH 1R5WA 4RBPK 5JA8B 1Z9OA 3O4OB 1B0RA 1KCKA 3CPLA 4G5ZL 3HAEG 4DWHA 4QHUA 5EO9A 3O81A 1F58L 3UBXI 4OUUB 1DUZB 4PJ9B 5I0DA 4PRPB 1B88A 4XMPH 4HWZA 3C9NA 5F9JA 1T03L 4XAWL 1T22A 3PHOA 4OLZL 3BZDA 4Q0XL 3WNPA 5IESL 2NYYD 2BZDA 5FUOH 2YC1A 1U42A 3UZVB 3MGOB 3ZYOA 1CU4L 1KCSL 1R3JB 1JGUL 3MNZB 1EUTA 1H3PL 4GW4B 1CICA 2V7HB 3CIQA 1UKSA 5JR1L 3VFSA 3G6JB 4RX4A 2B7DT 3BUTA 4BQBA 4A6YB 1TJIL 3G9AB 4JO1L 3WXVH 3ULVE 1Q9OB 5D96B 1J1XH 4WI6A 4ODBD 4HDIB 1GAFL 1BVKB 2BERA 3UROR 2M2DA 3WN5B 4AL8L 3SBWA 1KJMA 5KSBE 3PL6A 1IL1A 3NPZB 1J18A 4KJWD 2CGRL 3IJYA 2NPLX 1IGJB 2CKBB 1T7ZA 4P23B 3C5ZC 4WWKB 1ITBB 1G9NH 4BH7B 4Z7WB 5DQJA 1WICA 1IGCH 1XR9A 3HS0B 4CW1A 5D1ZD 1UZ6E 4CRPA 4IJ3B 2Q6WA 3HI1A 1X5JA 3JBG7 4IBLT 1QTYT 4QHNA 2Q76A 4BZ1L 5F7WC 4IRSB 2F9BT 2A83A 2VC2H 4WEBL 3VXPA 2ZUQC 4OGYH 5GISL 2Y25A 3MXVL 3VGAC 4KZDL 3VXUB 4JGMA 1HHGB 1BF8A 4NQVA 4PJ5B 1LE9B 3TC9A 5I1AA 1AQKH 3T3PF 2C1OB 4NDMB 4OZGF 2E9WA 3IFNL 2NY1B 2GITA 5H35A 5FYJD 1BBDL 3BUYA 1RURL 3DV6B 4KDTA 1D5BA 3DXAD 4HIJB 4UTAL 1FNEA 1FAKT 2Q3ZA 3KJ4C 4KFZC 1B4JH 4HJJH 5C08D 1PAMA 2LU7A 5IBLD 1VFBA 3TZVA 1JPSL 1P4BH 4PLOB 2HRPL 4R4BB 1IM3A 1XF5A 1CXEA 2OJEB 5C08E 3SCMB 1DQDH 5MERB 3AREB 3VXQB 3EJJX 4HKZA 5T5NF 1NEZG 3P30H 1A8JH 3P2TA 4KZEL 1CS6A 3NIGE 4K94H 4KTYA 4C83B 1R3LA 3FN3A 2IFFL 4NP4H 1G7HA 1ORSA 1SJHA 2KZ1B 4Z7NF 4P49A 2ZG3A 2KUTA 3MJGX 3ZT5A 1A6ZA 4K8RL 4PJFF 2AJVL 4OKVA 5CGYC 3LRSB 1R24B 3KPSE 4TNWK 2DQIL 2BVUA 2I07A 4D9RE 5DD5H 5I73B 5INDA 2CLRA 4P2OD 1TETL 1MWAA 3W2DL 3D39D 1EXUA 3U9PH 3TEUA 4WO4D 3RJQB 4NQDB 1J05A 2X89D 3RVTC 2IADA 5F1NA 4R2GB 1HWHB 4HKXA 1Z6JT 4F7EA 3O4LD 3PWPD 5INDB 2HFTA 1T4KA 4YX2L 4OKVB 3P9WB 3TO4D 2OTUA 4OBSA 4CUCA 4AQ1B 5JW4R 1I1RA 3NFPA 1IAMA 4EEEA 3ULSB 2A1WH 2EE9A 1BZQK 4G9DB 4NO3A 4JY5L 4K9EL 4H5SA 2Y6SC 4F7PA 2XZQL 5I74C 3SDDA 3ARDD 1MOEA 1UH2A 1TTUA 1T20B 5EOCL 3UZEA 2JIXD 2QQKL 2G5RA 4FZ8H 4HCRA 1MRDL 3UBXB 5D71H 3HR5B 1FDLH 1HKLH 1J0YA 3VU2A 4AL8H 2JCCE 1KB5L 4IOIA 2I26N 4NKOB 2IQAB 1UH4A 4P46D 1PZUB 5GSRA 1M7IB 2FR4A 4K7PH 1KIUA 2Y36H 5IVXB 3BZEB 5T5FL 1UACH 1PKQE 1J1PL 2CR3A 4WVRA 1T6WA 4DKFH 5KOMC 2JK5A 4KQ3H 4HUXA 1EBPA 1CGUA 3QUZA 3TFKC 4C4KT 2R1XA 1MJJA 5GPRA 3OKLA 4PGDB 5IEHB 3FT2A 3GSOA 2W59A 4PY8I 5AAMA 1I1AC 35C8L 1ZT4B 2I07B 5IOPB 1FE8L 3MCG1 3HI5H 1TPXC 4ODVL 2NY3D 1EX0A 2JJSC 4DAGH 5DHVA 3LVEA 2HLAA 4NJ9H 1MHPH 3SEPA 4YLQT 3MZTA 1DFBL 5SX4H 5TDNA 1QR1A 4NO2B 1HXYB 4LVEA 5BXFB 3RDTD 3S88H 4L4TB 5ID1B 1A9BB 2EDDA 1NDGA 1KEML 5I1LB 1NCAH 2V5TA 3TBSB 1GVIA 1O7SA 5CJOH 3BP7A 4U0RB 5CZVL 4OCMC 5IOPA 3ARWA 2YD8A 1DBBL 5IBTL 4BFIB 3QWRA 4XPGH 3QISA 4WHCA 1CFNB 5DD1H 3TPKA 4NQTA 5CGMA 3P9MB 4P2RE 4KTEL 3TBYA 5D7IA 1KJMB 1FNSH 3PDGA 4OI8A 4NM4H 3K1KC 3W9DB 1YC7A 3TV3L 2GJJA 3UX9B 2HVKA 4NZDA 2AEIT 1YZZA 1UG9A 4D0CB 5JW5A 4XVUD 3GMRA 3GIVB 3O2WL 4ENED 1FBIL 3OL2A 5IW6A 4OUOA 2ZOKA 4WTWA 2WINB 4GXVL 4FXKA 3RI5K 3J7HA 2L7JA 2YBRB 3TT3L 2VZ1A 4CMHB 1QSFB 5IMKB 1FFRA 1P7KB 4PG2C 5J6GA 3HG1A 5ESAB 4OIAA 5CAYB 5DD5L 5AYUL 1FZJB 4CVXA 1M7DA 4W70A 1M71A 3TNMA 4QHNB 4P2RD 3VFTB 3QO1A 4R4BA 4NWUH 1JIBA 3MFGB 1ZHNB 1FGNL 2DM3A 3FQUB 4C56E 1D5XB 3VFGL 5MP6L 4QXUL 3J8F7 1F4WH 3MRLB 3VFMB 4Z7VA 4UV7H 5F7DB 4LMQE 4YDKL 2WP3T 1P7KA 2VABA 1QOKA 5CSGA 5DQDH 3QIBA 5B39B 4HJ0C 3MCLH 1T1WA 3ARRA 5ENWA 1IQWL 1H0DA 5J11C 4BZ2H 4JLRB 3TT1L 1MWAL 3BX7C 2YN3A 3K8MA 4HWBA 4B53A 3C5SA 2VDPL 3QULB 2D03H 3IKCA 4GKZB 4F7CB 4KKAC 3TN0B 4EN3A 4QTHB 2ZNWA 1O5DT 2NW2A 5SWZE 4XWOD 1EHLH 5HJ3B 4ZAKD 3MRRB 5MEPA 1KCRL 5F1KC 4DGVL 3W5MA 4UTBH 3W5NA 1CBVH 2J12B 3ZYJA 3QQNA 1UACL 5A2FA 1CDBA 2A74A 2CLZA 4G6AC 1J1PH 1C7SA 3UC0H 4ZO9A 2AEWA 1AO7A 4AM0A 4Z7NE 1BIHA 5EH1A 2X1OA 3KYKH 4XBGB 4S1QH 1J8HB 1R5WB 3T2OA 1F3JA 3GHEL 4LSPH 1E4WH 1T1XA 3I75B 3DSFL 2BMKA 5TF0A 1ED3A 1AKJB 1EMTH 3ZSTA 3OXRA 3SKMA 4JFZH 3QQ9C 2W0PA 3FT4A 1MFBH 3LKNA 5AAWA 4PJ9D 4GBXB 3TJEH 1RZKC 3MNWA 1H3VA 4KJYA 2G5BB 4LHJB 5A1AA 4PJGB 3V6FA 5EZLB 4IRJB 4MDJA 5D2LF 4TRPH 1TJGL 4E0RB 3QPXH 2GK2A 2EDRA 1LP9A 1KV3A 4KROB 1YYML 5IK3B 4POZD 1CDHA 1IGIL 4U6HA 4PJAA 4XAWH 1VCAA 3QI9B 2ADFL 3CVIL 5IT2H 2OLDA 4PJBF 2IANB 1A7OH 2I9LB 1EO8L 3EYVB 5EU6E 3CC5B 5I17A 3ROOB 3CSBA 4EDXB 3N50A 5JPNA 2R4RH 2X4TB 4D9RD 2R69L 3OAYH 3IXTB 1JUFB 3QNXA 4CMMB 1ITCA 2OJZH 1FNGA 5D8JL 2MQ0A 3NFPB 5HHVH 5EBMA 1ES0B 1MY7A 5I76A 1SJVA 3QDJB 4XMLH 2V9QA 4CVZB 1VGKA 2QQLL 5B8CB 2WBJD 3ZMRA 4GAJL 2EO9A 4F7MA 1I9JH 1N8ZA 4OIIH 1T7YA 3QZWA 4XRCA 5DMIL 5B22A 3DMMA 1YEEL 1XF4A 1MAML 1CD9B 4S1RH 1VFUA 2VDNL 4PTTA 2FJGB 1MCBA 1XGYL 1RFDH 1LEIA 2YA0A 2VLMD 1F4WL 1WSST 3GRWL 1I7RA 4WUUE 2J88H 1OAZH 1AD0A 2HT3D 3PWVB 5AYQA 5C0BE 3VFMA 1HSBA 3SO3C 1I7ZB 1RHFA 1FNHA 3G08B 3VFWA 3FN9A 4OIBA 4GLRI 5E6IC 4BUHA 2MJWA 4GRMA 3MJ9H 2WUBH 4FS0A 5CCKL 5EN2A 4NNXA 1A6UL 2LVEA 4FQXA 2MFNA 2OL3L 4YDVB 5ID0A 3C6LD 5E2UL 3ZYIA 2FRGP 4OV6F 2CIIA 4TNVK 4N9GB 2BY1A 4MSWB 4O9HL 5JXEC 4WEMB 3LKOB 4C59B 3ARED 2Y5TB 4ONHB 4QCIB 5DDHB 1FVCB 3FRUA 4I0PD 3BEVA 1S7RA 5HGAB 2W91A 4OZGA 4G80B 4U1KA 4NWTH 3SDXF 3BO8A 1NANI 1JWMA 5ERWA 4PB0L 4QKXB 4F57H 1Q9KB 2C1OA 1OTSD 2VRAA 3ARTA 3PQYB 1UA6H 4JPVL 4Z7UA 3L3DA 3QUMB 3BJ91 3OX8B 3VA2C 4QRTA 3W11D 1OD9A 5EC2B 1H15A 4PJ7A 1PJ9A 5FYLH 3MJ7B 5DSCB 1F3JB 2IAMA 5T1LA 2OX5A 3B9DA 3ZDYF 5F71A 1EO7A 4JO2H 4PR5B 4H88H 4K8RH 1U58A 3QUZC 2GT9A 1CFTA 1WBXB 3GNML 4GQ9H 4MNGA 4R2GD 3UXFA 3B6SA 1RK0A 3ZO0A 4X80H 1XGTB 4V1DA 1S9WA 4LLUB 5DMKA 1UWEL 1KACB 3GJEA 4CDGC 5IG7A 2OJEA 3L5XL 4Y5VC 3GI8L 1B3JA 4OF3A 5IV2A 4MHHI 5FYLE 3A6CL 1ZHKA 4HWEH 4LEOA 4G8GA 1HOCB 1LP9B 3VD3A 2VZVA 4PJFB 2J8UF 1WT5C 5I73C 4F3FA 1T3FA 4M7KH 4QT5B 1VGEL 3EOTH 1JNHB 3UTQB 5TFSH 3IT8D 4WGVB 3SGJC 2JB5H 4OCRL 1UJ3C 1XGPB 4BFGA 2D31A 3MLRL 3MUGB 5DUML 4KK5C 3LB6D 5GRJH 4MCZB 1QSZA 3ULVH 2B2XL 4HKJA 1CE6A 2QQKH 4UI2A 1AR2A 4WY7L 4E5XA 5A2KH 3QCTL 1PY9A 3QHZL 2P5EE 3WHXB 1HILA 4UQ2A 4YXKL 5IIEB 1J8HA 2QQLH 2BVPB 2MKLC 1D5IL 4M61A 3T2PA 3STBA 4F9LA 2HJFB 3BKML 2MCPL 3DHJA 1AI1L 5FM5M 3EDJA 3QIUD 2HFFB 1DEEA 1WWAX 5HHOB 3PP4L 5J8OA 4LFHG 2ATPB 1MCWM 2OQJA 4DKFL 5IJKA 4PS4H 4U33A 3TFKD 3K4ZA 1J88A 4OF0A 3MUHL 1CD1A 1OAZL 3LSOA 4RFNC 3O4OC 4TNWF 1IQDA 4LLYB 5DA0B 1HEZA 1DBKH 4S1DC 5BQ7A 5I8EB 3REWA 5J0BA 5IHUH 3MRJB 2N4IA 35C8H 5CJXC 1I4FA 3T4YA 3KPLA 2CD0A 1TTGA 2J8UA 2FYYA 1KGCE 4P4KB 4LSTL 4DAGL 5IMLB 4FTVB 4OFKA 5ANMB 2ITDA 5DZLA 4PJFE 3NZ8A 4UB0L 3TBYB 1X5XA 4X99B 4DUWA 4X7EC 1VHPA 2VLJE 4JHAL 1UGNA 5EU6D 3N1GC 3T0WA 3O45B 3GSNH 1G9MH 3GBML 1KEMH 3QEUB 4LRIA 2XICA 4ZFFB 3FB5B 2XTJE 2PW2A 4ZPVB 1WEJL 4MHHG 4Y4HC 5DD1L 2D3VA 3QRFM 3C9NB 5F9JB 3M1BA 1UM4L 4HGWB 5J4MA 3QO1B 3FJTA 1INEL 4B50A 1QFOA 3WFDH 2A0LD 1J0IA 2IWGA 2CK0H 2PXYC 1LEKA 4HBCL 3U36A 3LPGA 1KEGH 3QQ4B 3MREB 3F58L 3SDCC 3U0WH 4K3EL 3OQ3B 4KTDH 4M6MH 3O3BB 5LKNA 4H1LB 2BRRH 3I3EA 4AT6A 3WSQH 2ZP0T 2R9HC 3O2DL 5B21A 1FBIH 2IBZX 1JP5A 4QXTA 4DK6A 3MMEA 4HKJB 3FFCA 1TVDA 5CWSA 3ZDZF 4X4MA 4XI5C 4LSSL 3TT3H 3BISA 4EDXA 5FM8A 1T7XA 4B0MM 4NSKA 4MQTB 4KRPD 2ZUQB 3GUTB 2N7BA 1HHGA 1OAXL 3L3OB 1RUPH 3MV8A 2O5YH 4OFDA 4R0LA 3CJJA 1ZMYA 1GGCL 2AEQH 4AIZB 4RFEA 2ARJB 1FGNH 4XCNB 5GS0C 3L5XH 2XWBB 4XP5L 2XXMB 3TA3A 4RAUB 2VXSH 3LQMA 2IMMA 4UV7L 5IG7B 2QJDA 3X3FH 3SDAD 4ZS7L 3MSPA 5JQ6L 3A6OA 2BNQA 1XH3B 4MAUH 2AJUH 3HE7A 5DR5L 2JKXA 5F7MC 2EYTB 3P77A 4TVPD 4GUPB 4O02H 1QR1B 4Y1AA 2F19L 5J1AA 5JIIA 1GIGH 5GRUL 1CGSL 1XMWA 3RI5F 4PR5A 4BZ2L 1IGJA 1RQ5A 1BD2D 3ULVL 1NAMA 4OD2B 2H2SD 1UT9A 4P9HC 3CFEA 5J9PA 3CCHA 4QWWC 2YMXH 4W68A 5D6CB 3NFNB 5D6DA 2MHAA 5IROA 1KIQA 4XWOC 4OLEA 5H37H 1EGJL 3G6JE 4GUPA 4LCCC 4XP6L 1P2CB 4S0SD 4ELMB 3UJIH 3BKMH 3EYFA 4KKCD 2H32B 3L1OH 5BRZA 1Q38A 2MCPH 4HUXB 5JXEA 3X12B 4P2OA 4ZFGH 4RRPG 4WTZA 4JREC 4HLJA 3FZUD 1JRHI 1RK1B 1YN7B 4P2QA 3BSZH 4G6KL 4PJXE 3P73A 3BN9C 4BQ8A 3OMZA 5D1XC 1IAKA 3VWKA 2NY5L 2YK1H 5JA9A 4I3RH 3R06A 1JMXA 3IKCB 5C0ND 3GHEH 1CL7H 4K3HA 5IHUL 4XVTH 3VFOA 5IBLC 1QSED 3RIFF 4KV5E 1RUAH 1S3KL 1HIML 1CTOA 3T8XA 2GHWB 4OLYH 5DGQA 3V5HA 1MCEA 1FCCA 3O3DB 4JHAH 4XCEB 2V2WB 3IJHB 4Z7WE 2ATPA 1HHJB 1UWGH 4DEPB 2ERJB 3QIBC 2X44D 1T66C 2P5WB 4MD4A 2IBZY 3BRGC 1AXTL 1AGFB 1KJVB 3SGEI 4JRXE 1UKTA 2GW5A 1B90A 3WJJC 3SE4C 4MXQD 4NZRL 1PEZA 3B9VA 5DJZA 3DPBA 1SBSH 3LRSA 2FATH 4Z77B 4KROC 4GMTL 5IB4B 3O2DH 1QBLL 3QUYB 4QTIH 3VXPB 5HVGB 4X99A 1RZ8B 1ND0A 3VRIB 1JGVL 2VZ3A 1G7HB 1Z3GH 3CXHJ 5BW7C 1KPVB 1MHEA 3F62A 2VXTL 4MB3A 1QD0A 1PX3A 1CGTA 2MMXA 4JO4L 1KB9K 1LGVA 2F8OA 3BP6B 1FO0H 3B8SA 4ELMA 4DZBA 4I8DA 4KGJA 4JKPL 3HRZB 1NUFA 2VDNH 4P23D 1Y18A 4WWKD 5L7XH 5D2NE 5JLZA 3V7AE 4BZ1H 3OJVC 4G3YL 3FRPA 1RZJL 3TCXA 1A9BA 4ZS7H 1SEBB 2R56L 2AJZA 2JJUA 4MAUL 2NX5B 1E28B 4TVPH 3V0VA 4PLKC 4MQXC 1JZ6A 3GMLA 2BC4A 4C56A 1MFAL 5C07E 3U6RB 1JN6B 4I0PA 1UQSB 3WIHA 2DICA 3HE7B 2KQNA 5C0FB 3OR7A 5JOFB 2HFEB 4R4NC 3MLZH 4G42B 5FO8A 4H8WH 3L3HB 5ISZE 3S6CA 4OF6A 4C56B 4FG6D 3TBWB 4RFEB 4O5LH 2QR0A 5KSAD 3KLAA 4WTXA 3ARPA 2V17H 1UZ8B 3O4LE 3PWPE 1DLFH 3BH8A 2LFGA 1O7VA 3IAGC 3PQYD 2FECI 1RAMA 4D8PA 1DQDL 1JRHL 4HPYL 4BKLA 3B83A 1WTLA 4I4WA 3ARFB 1IKNA 3EJZD 3CLFH 1YECL 3MV11 1PZ5A 5D2NA 2C3VA 2KH2B 3NA9H 4G6JH 1MCPH 5C0JA 4L1DA 4S11A 1E0OB 1L7IL 4FQXB 1ZGLP 3C08L 2ILLA 4EI5C 5T3ZE 1T21B 1D5ZB 1A7RL 2YD4A 3N1FC 1QBBA 3V6OA 3S36X 4DZ8B 4OZHE 4LRIC 2VZUA 2EC8A 3R06B 4TVPE 1OWWA 3SE3C 4IMLA 5DJCA 4MA1C 4PBVC 3VFNA 5T33L 5F1OB 3GSWA 3P0VL 5T1MB 2ZG2A 2EH7L 4LEXH 2WZPD 3D2UD 3FB5A 4Y8AA 1DDHB 3GI8H 4HIHB 3TH4T 5AZEH 2F5AH 3MPCA 5T1LD 2XXCB 3WNLA 2BX5A 5DRWB 4CNIA 5I1CL 3BQUA 3O8XD 2DDQH 1TZHA 1ZAGA 2CDFA 1PD6A 1KF9B 3QP3A 3PHQB 4NZUH 3TO4B 2HAZA 4FQHA 4E42A 3MLRH 3Q0HA 5DUMH 3S3SA 2ICWB 4YHKL 1RZFH 2E27H 3MXWH 5DUPH 5EU3A 2IPKB 1YMME 4WDIA 3GIVA 4HC1A 3UPRB 3T09A 4U6XB 5C1MB 2NTSP 3G04B 5HHOD 3WJLA 1JE6A 2VISA 4JFFD 4NBXB 4MQ7A 2I5YH 1SM3H 3KLAB 1BQLL 4M4PA 2P48B 4XNMB 3FAXA 3RWJB 4JY4A 4FQIL 2RHEA 4K3JH 4M43L 1PYWB 1DE4B 4MA7L 3QRGL 2J8UE 1LNUA 3VMNA 1GC1C 4KV5F 4KWUA 5LAXB 4J4PA 1EHAA 3QA3B 4RZCA 4P5KB 1JMZA 3GJFA 3MNWB 3QCUL 5SWSE 2CSPA 3F7VB 2NYYC 4MCZA 4PGCA 3KPSD 3CFJA 5HI3C 1CT8B 43C9B 1A3RH 8FABA 5HHPA 1OAQH 3WUWG 5DS8A 1MFAH 5HSFA 3AUVA 2BMKB 2DL2A 4JN2A 3O3BA 5FA4A 5MENE 3U1SL 2C1PB 3MLZL 4QRRD 3QNXB 5F7EL 5IWLA 2R8SH 3QUZD 3GSQA 3S4SG 2VQ1B 4PJDE 2R1XB 3MA7B 3QDMD 1TFHA 2GJ6E 3C87A 4OLZH 2J7LA 1MEXH 4XNQB 4UINH 3HS0A 4CW1B 3B9KC 5D1ZA 2GY5A 2CIKA 1IM9B 2JB6B 4DGYL 3X3GH 2AV1A 1CK0L 2GUOB 3C2AH 1KCSH 1NC2D 1JGUH 3RVWD 2YPLB 2A0LC 1OB1B 1E6OL 1MCJA 3QNZB 2CDGB 3CLFL 3LV3A 3EYUH 4G7VL 1UB5A 4U1IB 5IJKC 1ZSDB 3QJHA 4NCC1 5EZLA 4O00A 3IDGB 1PDKA 4NGHH 1C5CH 3HUJB 5E5RB 1T20A 5ACLA 1A7RH 3RX5A 4JFEB 3QFDB 4I5BB 4OCWH 4QO1A 2EYRB 4PRBB 1YJDL 4JZJA 2CDEA 3BAEL 3OKEB 3E8UH 5IVXF 2VAAB 1HSAA 4IS6A 3AXLB 1OM3H 3UTTD 3VGAB 1U92B 4LEXL 1RUPL 5E7BA 4ZD3H 2VSDA 5DEZA 4GRLC 1LEKB 3U36B 2AEQL 2AGJH 3CLEH 3OGCB 2DN7A 2ESVB 4NIKB 4CU8A 4YDKH 1KJ2L 5KW9H 4OZHB 3P9LA 4PJDA 3PL6D 5T1DL 4P2RB 2DD8H 1DR9A 1ZHLA 2CLZB 1XZ0A 4OZIB 5I18L 1DDHA 3NN8B 3L3HA 4JM4H 1QG3A 2PKDA 3WN5C 5AUMB 1QHOA 2YD6A 1OAYH 5LCVL 5DRNB 2GYSA 5DFVC 3WO4C 1CGSH 2Q1EA 2QHRH 5CBEA 3ULVD 5IB4A 2P45B 2YXFA 3RGVA 1XGPA 3RTQB 1FFNA 5DD0H 5HHME 5A3IC 5SWQA 3V0VB 3GGWA 1QEWA 4XPTL 4IRZH 2WAHA 1KB9J 3HPJB 5LGJA 3BIBX 2I5YL 4RGND 5FHBL 1Y18B 3TN0D 5L2JB 1G84A 5CHNA 3DYOA 2YKLH 1NGWB 4FQIH 1ZHBA 4UV4H 1HI6A 4HW6A 4YGVA 5IF0A 4PB9L 1IZJA 4PGBB 4K94L 4KJPD 4YWGL 2IFFH 4NO2A 1UYWH 5TF1L 4GRWE 3RWGB 1RIVH 5ETUB 4J1UA 2X4TA 3I02A 3EOYG 3MV7A 3CC5A 2AJVH 3IDNA 4JFDE 1VACA 3D6GA 2Y5EA 4NT6B 4D0DB 5I8OL 1SBBA 3TJEL 4U1JB 2ZSVA 1EEUA 5E8PB 1AKJD 4YHOL 1F6FB 1U8PB 1ZA6B 3RWJA 2NY2D 3FQNB 1YN7A 2D7TL 2Y7QB 1YYMH 4QHKJ 5IROC 3T0DA 2LQRA 2Q6WB 3L3KA 4IRJD 5F3HB 1WIOA 3CXDH 4HF5L 3QXAB 2ID5A 3ILPA 5AD0B 2VE6A 4ACPA 2ZKHL 1ZKAA 2AJ3A 3NIDF 2OZ4L 4WW1B 1F4XH 1OQOA 3CFKA 5GS0D 3KLHD 4OCSH 4OD1L 3GHBH 1YDPA 2HTLC 3QSKB 4ODUB 3LN4A 2HT2D 2BSTA 3WN5A 1ROWA 3HZKB 3PUCA 2ZCLL 3MCKB 3P0YH 5HHVL 5JTWA 4LGSB 2Z35A 1BWWA 2EDLA 3D0LA 5GGSB 5TE7H 5DSCA 3E8UL 1IC7H 5HDOA 4YDIH 5E9DE 3JXAA 4G6FB 4G9FE 5E70A 1TPXB 1OM3L 1EVTC 4M1CC 5JDSB 4EOWH 1FL3A 2FSEB 1FRGH 1VENA 4JZJC 4K2UL 5JPMB 3HLAB 4M5ZL 1W0VA 4PV9A 3CLEL 2HVJB 2XYCA 3ES6A 5I6XC 2LU4A 3FB8B 5L8JB 4G80A 4K07A 1A7BA 1RZ7H 3QUXD 5F9WB 1J0JA 1FORH 5IB3A 1JWUA 3HE7D 3BHBA 4ZUUA 5DC9B 4BYHA 3MJ9L 1FZOB 1OAYL 4KRNA 1J5OH 2IQAA 5EUOE 4MCYB 1OCWL 1P9MA 3SGKA 3WXWH 2EYRA 4MNQD 3MA9H 1A1MB 4J3VA 3LKQB 3KXFB 2VH5H 4JRXA 3KPRE 1X5AA 3O6FC 7CGTA 1SYSB 1F3RB 3BFOA 1MLBA 3NCJH 2DKSA 4XXCA 5JHDD 2P49B 4KKBC 1DBBH 3JV6B 3C6LB 3FOMB 5TGBA 3VXUE 2DWEA 2NY6C 3C8KB 3FFCD 1OGAD 1BVLA 4CVXB 2FWOB 5IIEA 5D4QA 2FX9H 5IHZA 3BW9B 1EEYB 3LS5L 5L2KB 1ORQB 1AGEB 4GKOA 3V6ZB 3OZ9L 4R7NB 1D5BB 1CN4A 3O9WC 2WV3A 5H37G 2UUDH 1L7TH 2X4PB 4MNQE 3GMPB 3CK0H 1JI2A 3S9DB 5CZKA 3C08H 4M7JL 4OGZA 1UXWB 4PGBA 1JPST 1TJHL 2RFXB 5EBMB 5KSBB 5ESVA 2Z91B 3D2UB 3GIZL 4MXVE 3ZE2F 5I8OH 3ESUF 3WFHA 15C8L 5D1QA 1KJ3H 3RDTA 1ZGLM 4YO0B 4HUVB 4OCYL 5IV2B 2DTMH 1WBYB 5T33H 3LSOB 3VD9A 1NEZA 5I8KL 5J1TC 3O3EA 3BH9A 2FJHB 1I7UA 3FQRA 3HG1E 1FAIH 3LEYH 1CDUA 4UDTB 1FLTX 1RUQH 3MV9D 4MAYD 4Z7OE 4NQCA 2Y7QA 1BF2A 1LP9F 5A2LH 3QEUA 3SCMA 5LQBL 4RAUA 1LD9A 4PD4K 2QTEA 4JY4B 4AEIL 3ARGD 5TFSL 2IAMD 1OLLA 3L7FB 4TTDC 1PKOA 4I18B 4OCSL 5I1CH 1BX2B 4OD1H 3SN6N 2HLFD 3Q5OA 5EIVA 5CIPA 3EJYC 3MLUH 3D1MC 4XPBH 3IDNB 5CEZE 2BFVH 1D9KA 5DJZB 1JGDB 3MODH 3KPLB 1DBJL 1S5IL 2R0ZL 3NN8A 1WZ1H 3MXWL 3UYRL 5E00A 4N0FB 3OXRB 5IP4A 4YXKH 3G5XA 4QXTB 3L6FB 1NMAL 3ME0A 5TE7L 3KNBA 4LCUA 3OB0K 4QNPF 3W39A 5E2VL 2DJ4A 1SM3L 2BSRB 2BVTA 4WFGD 1IJ9A 1TTFA 4CNIB 3FOLB 3F7YA 2R29L 4K2UH 3AMKA 3I2CL 4TSCH 4KDWA 4BFEA 3LDBC 1M7DB 1NSNL 5DI8A 3HNVL 2HKHL 4NC1E 1KT2A 4X6DA 4I9WD 2EIDA 4L9LB 4Z0BL