2J1KA

Cav-2 fibre head in complex with car d1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
SLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus/receptor
molecule keywords COXSACKIEVIRUS AND ADENOVIRUS RECEPTOR
publication title Structural and Mutational Analysis of Human Ad37 and Canine Adenovirus 2 Fiber Heads in Complex with the D1 Domain of Coxsackie and Adenovirus Receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 117
sequence length 117
chains with identical sequence B, G, J, K, O, P, T, V, X, Y, Z
ec nomenclature
pdb deposition date 2006-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2j1kA00
5I1LB 4WUKL 1I3GL 4PJHA 3MRHA 5DSCA 4QF1A 1P4LA 1DL7L 1A9EB 1V3JA 2F8VA 1KIRA 4N8VG 3MRGA 1MCSA 4KDTC 4LLWB 3VXNA 4KI5C 1R24A 2NY6C 4WJ5B 5F89A 4JQVA 4LLYB 2OMNA 1M6OB 4S1RL 5EOCL 1XGRA 1EBPA 4I3SH 4JY6A 3U36A 1I8IA 3ZYIA 3NABH 1SJHB 3O4LB 1E4KA 1IGMH 3GUTA 5CJQH 1ADQA 4NJAH 4OZGB 2AJVH 4M62H 5J6GB 1MCKA 3I9GL 3Q1SH 4NP4H 1Q72L 3V0VB 3MX0A 2HJKA 3U1SL 1J8KA 5I1AB 3P2TA 3U48A 4KKCC 5IOPA 2GTWA 1TVDA 2SEBA 4K94H 4CAGA 2HWZL 6CGTA 1P7KA 4UQ2B 1PQZB 2WWMC 4LNRB 2QHRL 3HTLX 4XCNB 1NAMH 3D6GA 1CXEA 2OTPA 4W4NA 2OJZL 1GC1C 3MJ9H 1D5XB 4D2NA 4QO1A 4P5TC 3U83A 1XMWA 3QEUB 3MV8D 2GAZA 3VXRE 3MGTA 2AEPL 2DMCA 1W2KT 4FQCH 2MHAB 1KPUA 1ORQA 1PG7H 1FZMB 4MWFA 4DGYL 1YPZA 4LLVB 1Q1JH 5E9DD 1XGPB 4S1QH 5D7KE 1NLBL 2YMXL 2ITCB 3QIWC 4FQPA 4UU9B 2R2EB 5LBSH 3O3UN 3VXMD 1A0QH 2D0GA 2AAVA 5TQ2H 1RUPH 3GJFH 3BDYL 15C8L 2Z93A 4QYOA 3LZFH 4LFHD 3HE6D 2OTWB 4LIQE 1QYGL 1BOGB 1WZMA 2AQ1A 2B39A 4P0DA 4UQ3A 2B4CH 2YD8A 5LKNA 5EZLA 4PJBF 1T1ZB 3ARYA 1FO0A 3DX9B 4NKDA 3QWOB 2J8HA 1IGFL 3NAAH 1DVFD 3AROA 4K8RC 1SQ2N 4MB5A 3SDCC 3ZSSA 3D87B 1YEFH 1SJEA 2XTJC 3WHE0 2IADB 5HHQB 5GGSB 4M1DH 2GK2A 1Q9LB 1NGXA 4OZFA 2P44B 3BMWA 4PP1C 2VZVA 4LDOB 5ISZB 2XZQL 4LCCB 2WZPD 2KQNA 4JANA 4PLJC 3EGSB 3VWJB 4Z7VA 2ZZUT 4Z95H 3BKMH 1QOKA 4PJGA 2GJZB 1WVZA 5FKAA 4P46C 1X5IA 2PTTA 2QJDA 1R3KA 4YWGL 5FB8A 4DZ8A 3DETC 4ZPTA 1X5XA 4Z7QF 2NX5B 4Y5YB 5C0EA 5IFJA 4NRXA 4PV8A 3I3DA 3NA9L 4PJ9C 3IJYA 3WLWC 5L88L 5I6XC 2CO7B 4ORGB 4G9FE 4DVRL 3KPLB 4KK6D 4DGIL 4WVRA 1QLRA 5E4EB 1QFUH 5MENA 2ICWJ 4QXUH 4D9LH 4ZFFA 3VXSA 5IW3A 3QUMH 3RHWK 1YZZA 2HP4A 3OJVC 4CMMB 3PIQA 5DJDA 3RX5A 5EU6D 4O2CB 5FF6A 3MBEB 4FQLH 4KJWD 2YPKB 3PWJA 4OZIA 2C3WA 4G6JH 1KTRL 1K5NA 3HLAA 4KV5E 2QTEA 5KSVA 3DMMD 4NCC2 4ZAKD 1BLNA 4QOKA 4KTDH 5HDBE 2D31A 3BOVA 3RWHA 1I7UA 3JV6B 3D39B 5F72S 5KZCB 3LS4H 3UC0L 1TCRB 4XNXH 4MAYD 5EOTB 4YHYB 4HG4K 5JZ7C 4BSWB 4QRTA 4XAWH 1S7XA 12E8H 4RGND 2NY1C 2Y07L 4KROC 4H1LH 4L4TA 1MI5D 1ZXQA 4HMDA 2P42B 3ARBC 4I8DA 2B7DT 3V6BR 1IE5A 4F58L 4OZHE 5D7JD 3SO5A 5TGBB 5GGQL 4JLRA 3SGKA 2OK0H 3KDMA 4G3YL 1FIGH 2PCPA 2MPAH 1QR1B 3MO1A 4WUUE 1L4IA 4FP8H 3RAJH 1XCTB 1DBJL 4M4PA 3L5WB 5SV4A 3STLA 2F53E 5C09E 1YMME 2CLZB 4MA3B 1HIMH 2DN7A 2VDML 5TFSH 2EDQA 2UZYB 1R3HA 4RMRA 1NAMB 1IGJB 1K4DB 5C0AE 2MTPA 1CT8A 2VDRL 5IB3A 1JBJA 4LU5L 1UJ3A 3RY6A 3W9EA 2DTSA 3F58H 2AXGB 2VLKB 5EUOE 3IAQA 2EDEA 5T5FL 1ZT4A 2AK4D 4K3DH 1S9KC 1UT9A 2H2PC 4FA8A 3OG4B 3BEWA 1L0XA 2WV3A 3B2UC 4GKNB 4G8IA 5B8CC 5CMAA 3EOTH 3V4VH 3VG9C 3GJFB 2HVJB 1RURH 2Z31A 3RWFB 3BE1L 5H8DA 3ARRA 3K4ZA 2JCCE 3VW3H 3LV3B 4CW1B 2AK1L 1F90H 4P2RA 3FQNA 3QEHB 1U8LA 1G6RL 5C0IB 3O6MH 3RBSA 1FLTX 4EKXA 1MRCH 3WUZA 2PYED 1JTPA 1AO7B 4ZG1A 3N9GL 5BZDB 4BKLB 1RJLB 2OTWA 1N0XH 1P5UA 4B41A 2BHUA 4N1EA 1T22B 5GGTL 2E7LC 1VKXA 3RWDA 3S9DB 5AEAA 1KJVA 1PSKH 1U8PA 2GSGA 3K46A 4LSVH 1JRHI 4UTBH 1JFQL 1F00I 2MQ3A 4KJYB 4PJ7F 2Q86A 4I2XE 3SJVB 3FFCD 1YEEH 3DRQA 3OAUH 4NQSA 3CVHL 4PJHF 3EYUH 3MODH 3RZWA 5ISZA 5IWLC 1NBZB 1C16B 5KVEH 4TTDC 2DJ4A 3G6DH 4JRXD 3KPSB 4H20L 2IAMC 4JVUA 4J3OC 3PV6B 1UM6H 5IEHA 4JQIL 5KW9H 3K2UL 2EDYA 2X70A 4PJDA 3SDYL 2W92A 4K3EL 3JTSB 1X5GA 1UWEH 2DQJL 1RJCA 3CGTA 3GRWH 4PPTA 2NX5A 4PJAE 4ZOCA 1U8IA 5IF0B 3FB5B 3QUMB 2NY0C 4R8WL 5K9JH 4V1DE 2GJ6B 3BX7C 1UACH 3JTTB 4X80L 4XNUL 1HKLH 4G6FB 2BX5A 4NQDB 3LDBC 4IDLA 1KCSH 4KHTL 1J1PH 1I1RA 3LQMA 2R4RL 4FTVD 1T1XB 2Q6WB 3SDXB 2P5WE 1B2WL 1XF4B 3BH9A 4FOMA 3C09C 2I24N 1GL4B 4BQ6A 1A4KA 1Z0NA 4Y1AB 3STBA 3I3EA 1G0XA 1I9JH 4OGXL 4Y4FA 1R5WB 5DC0A 2C3VB 2EKSA 5I30H 4M1GH 1WUNT 1JMXA 4I0CC 4EIZC 4HZLB 3LKOB 1AHWA 4O2CA 2F15A 4L9LC 3OR6B 1X6LA 4TSCH 2YPKA 2P8MB 5F1NA 2CLRB 4KTEH 4GW1B 4HKXB 3QWRA 3LQZA 4YIQA 5IK3B 1S7UA 4K7PY 4JPKL 4L8DA 4Y4KA 5CHNB 4JZJA 5FYJE 4JHAH 1T03L 1D9KB 3MLVH 1FBIL 3G5ZA 5DGQA 3MV9B 3DIFB 5EFIA 2F5AL 3PWUA 5A2FA 3WFCL 4H1LB 1JPSH 1RUQL 4D9QD 2RAMA 1TCRA 2WLYA 2W0PA 4YBQD 3DV6A 4PYGA 2WIMA 1YEHL 1HH6A 2AEIT 1AI1L 2HT4C 1KXVC 3JV4A 4CKVX 2DWEA 1NFDA 3ULSB 1BFOB 1P69B 2PN5A 2NYYC 1JPGB 5DEFB 1DQTA 3D3VA 3K81A 1F4XH 2ARJB 1IAIL 1LO4H 2DQIH 3QI9D 2WBJC 5F8RC 2OP4H 2ENYA 2K7PA 5TGBA 2IQ9L 4GG6E 4J4PA 1ZA3A 3VD5A 1LNUA 2FL5A 4WCYH 4FG6D 2YKLH 4XPBL 1XCTA 4OLZH 1ROWA 1F2XK 4CVXB 1NCDH 4G42A 4XWGH 4Z7VF 5FO7B 2R2HB 4X8XA 4JFPB 1TXKA 5E5RB 2CLZA 1ZLUH 3VGDA 4QWWC 2ORBL 5TE6H 4X7DC 5EBWB 2YK1L 5ESQB 3FT2B 5GGVY 1KBGH 5L7XL 3MJ9A 5LQBL 3ARFB 1A1OB 3HC0B 3HUJA 3BP6B 5KS9B 1AGEB 25C8L 3DSFL 2QKIA 2LV4A 4F7EA 5FO9B 4ZYKB 1FNHA 3MREB 4OCSH 1IGIH 4FQHA 4Y2DB 5EU7C 3HRZA 4LPCA 4HJGB 3IETA 2XNAB 2BC4B 4HEPG 4NUJA 1MRFL 4K7FA 4DWHA 3VD7A 2X4QA 4HWZB 1NC4B 2V5YA 3RNKB 4EBQL 5JQ6H 1MCOL 3JWDH 3RWFA 3MXWH 3FO1B 4UTAL 4X5XB 5E6ID 2Z92B 4OCXL 4DN4H 4R4BA 3BUYA 3PGDB 2BOCB 4OCLC 5C0FA 2EC9U 2AEQL 5F6HJ 5ANMA 3T0EE 4CN4A 1IM9B 3BISA 3OPZL 4LCWB 4P5KB 1GIGL 4PRBA 2HJLA 3GM0A 5DUBA 4AL8H 3W0WB 5I66A 3L7FB 5DD6B 4HV8B 2AQ3A 2X4PB 1MRDL 3ECBB 4HS8H 2FEEI 4KTYA 3U4EA 5F9WB 3K4DA 2FD6H 1EFXD 2E9WA 1H3TA 2YA2A 3TT3L 2C3HA 1DUYB 5TDOB 4P2YA 1PYWB 5D71L 1H5BC 3UTSA 3MA7B 2J4WL 1IJ9A 1NCBL 1RHHB 2H32A 1KIQB 5FUCC 3IDNB 2ZUWA 2H26A 3L3KB 1A1MB 1ZMYA 4FQ2H 3TA3B 2QADC 4IRSB 5C0CB 3TC9A 3O8XD 4BELD 4NPYA 2D9QB 3IDIB 1FL5A 3PWPD 5IHUH 4F2MB 4KK5D 3IDJB 1SVCP 2HFEB 2ZOLB 3UTPD 4N0YH 4OB5L 4M61A 1SY6L 2Y6SC 3MRDB 4IMKC 4MX7B 1F42A 4BH7B 4I18B 4JFXB 3H3PH 1D5MA 3PWVB 1PDKA 4LHUA 4DTGL 1T7YA 2PO6B 4OZGF 1MAML 4X0KA 2YSSB 5D7LB 2W0FB 2IAND 1HEZB 1S5IL 1KJMA 5CD5D 3CMOH 2W07A 5C0BB 5GS0D 2HJFB 4J6RL 5EZIH 2NY3D 4LPVA 3O6FD 4HWUA 5D93B 4Y1AA 5HHOD 4XZUA 3CK0L 4LVOC 2RBLA 2XT1B 1LHZA 4PY8I 4M5ZH 3VRLF 5J3HD 2XZCL 3BD4A 3VDCA 2G5BB 1ZTXH 3RZCC 1KLFA 4HKJB 4FRWA 4DVBA 3RKPA 3OZ9H 1N3NA 4PRNB 4IBLT 1BQHA 4H1LA 4ONOA 2AP2A 2WSKA 5HYJE 3ARDC 2IH1B 3NIDE 1B6UA 2BOBB 2CDFB 3B6SB 3WMSA 1U3YA 1MELA 4GRMB 1OP3K 5D1XB 1RZ7H 2NLJA 1KNOA 5A2KH 4U6YA 1U42A 2R1WB 2HMIC 4AH2B 2ZSVA 3BWAA 1M7IB 5CBAB 5F7DB 2ARJA 1B0RB 3S3JA 1RV6X 5BW7A 2BXZA 2G9HA 3MUGB 1SMAA 1HXMA 3DUUB 1R5IB 1WEJH 1OGTB 5KSBA 4WV1C 4L3EA 4RMTA 4S2SA 4U1SB 3TESA 3HI5H 3D18B 1XF3A 1P9MA 4CVXA 3RA7L 3AREA 4U2YA 2R2HA 3VD9A 1UJTA 5GGRB 4DN3H 4KVNL 3VE0B 2BERA 4NC1E 3AAZB 4QRPB 3KPRA 4Z7NE 3VJ6B 1ZKAA 2DQEL 2Z8VC 1UZ6F 4JFFD 1OGAE 3WEXB 3HC4L 3RBGA 5IV2A 3RIFK 1A1OA 3HC0A 3F6IA 5KS9A 2VL5A 3FQUA 4EDWL 1A22B 2OZ4L 5DFVC 5HYSA 5ADOL 4KMTL 2BVYA 3OGCA 4GRLD 2FBJH 2AJXL 4LSUL 2R56H 2WANA 3UTTD 4MAUL 1N7MH 1FDLH 1A1NB 2ZCKL 4N0CD 1FQ9C 5IEKB 1EDQA 4U6TA 5GS1A 4HJGA 2NY5C 1N5AA 2BC4A 1RAMA 3C8HA 2V5RA 4TRPH 1YJDL 3VA2C 4R4ND 4H88H 4R2GD 5J13B 2W0KA 4MB4A 4QKXB 3UJIL 1SBBA 1QVOA 4XNQB 1TQCC 4N8CH 3TJHC 3WKMH 3QZWA 4IDJH 2UZXB 5DD3L 4F7MB 3WUWB 3DECA 4BK5A 5D2NB 5FOBB 3VXUE 1IM9A 2NXZC 3QHFH 1FZKA 3VFRB 1ERNA 4P5KA 2WUCL 3W0WA 5JLZB 3T2NL 2X4PA 3VXRA 1YEIL 1RZ8B 2EDDA 3SOBH 5ADPL 5JUEL 4ELMA 5TDOA 3V5HA 1RHHA 3CFEB 4ZFZB 3IDNA 4Y8DC 3OBAA 5IMMA 4POYA 2NXYC 1ZLWH 3GJEA 4PJXB 5D7IB 4TVPE 1AGBB 2ADJB 1TETH 3I6LD 3ZYZA 3QQ9C 1KN4H 1NBYB 1U2CA 4NQEE 3TYFB 5JDJA 5DQDL 4L4JA 1CFSA 4X7TB 5L2KD 4HC1L 3MRKB 4LSSL 3PL6A 3P4OA 3NFSH 5FYKE 1F6FB 4JAMA 3B9KB 1UCBH 1I9IL 3NPSC 4BH7A 1OARH 4G6KH 2YWYA 3SGJA 5JXEC 1CK0H 1FLRH 3PWVA 4K9EH 1OLZA 3O3BB 5GJTL 3AXLB 3NGBC 3REWB 3QFDB 4P57A 1RZIB 4EI5B 4F8QA 3T0BA 2M8XA 3KXFB 1HEZA 2Q76A 2XWBB 3SHSA 4APQB 1ETZA 3V4PL 2RGSA 5D8JL 1IGCL 2DAVA 1A7OL 4F15B 4P5MA 4XGZB 3BZEA 3P9MB 2HKFH 4U7MA 2B1AL 1QNZH 5ETUA 3ETBF 2D7MA 4ZFOL 4NM4H 2MJWA 2DLHA 1RZJH 3ARGC 1HXYA 2Y4SA 4N68A 3JZ7A 5IB5B 2A83B 3MXVH 2AXFA 3P4MB 5E5MA 5HYFA 3ZKQD 4BUGA 1XR8B 4H0IA 3R4DA 3QP3A 4QHKJ 1LGVA 5FEBA 5TDPA 3N50A 3H9SB 4G9FA 1LK3H 2RHEA 4PRNA 4U1MB 4TUOB 3T3ME 1INQB 1CN4A 1T83A 1JHKL 3TCLA 1LO2H 2FDBP 5DHYB 5EOQH 5MEOB 2RB8A 5I1CH 2GIYA 1YC7A 3W39A 2NW3A 4NO0B 2FEDD 4QT5A 1ZHBA 1BWWA 1MAKA 1K6QH 2A9ML 2Y5TB 4CMHB 5D7SH 3B8SA 1NJ9B 2VH5L 5HGHB 1EV2E 3K3QA 4JG1H 5MP6L 1OGTA 1CICA 3EO9H 4PREB 5IUSA 1CF8H 1CFVL 5IROC 2R1YA 1B6DA 2DJUA 2VZSA 4MHHI 5DVMA 5BRZD 4PRHE 3V8OA 5GGRA 1MREL 1EK3A 1Z9LA 4MA8H 4BM7A 3VE0A 5JO5B 8CGTA 1FVDB 4PJIE 3AAZA 1G9NH 1B4RA 1HHHB 1T2QL 2FX7L 3DLQR 4OZHA 4ZTPL 4BFIB 3TZVB 4D9RE 2OI9B 3ZKMC 4M5YL 5DQ9B 2MMXA 2MWCA 4KRPB 2BCKA 1VFBA 2IFFH 4WUUA 2KKQA 4LCIL 1QEWB 5HPMA 3DUSB 2F53A 1MNUH 1CYGA 3GIZL 2XA8H 5C09A 1YMMA 3CMGA 5CP7A 3VU2A 5T3ZH 4BZ1L 4MSWA 3SDXF 1KCRH 3WIIL 3U0PB 2JK5B 2R2BB 3QQ4A 4XTRC 5GS0L 3BQUA 4D94A 3MRJA 5C0AA 1AIFA 4DKAA 1AGDB 5ICXA 5GHWH 3ZKNC 2Y72A 3THMH 3RVXC 2ZWLT 3SE3C 5JA9A 1A6UL 2BK8A 1RULL 5I17A 1Z3GH 2VDPH 1PFCA 4FQQB 4EUPH 2V5SA 4RMUA 3PDOA 5D2NA 1R3IL 3FN0L 3SEPA 4G5ZL 3RVVC 2ADIB 1BBJB 3FTGB 4ODSL 1NCAL 3LQAL 3I6KA 4LARL 5JW5B 2P49B 1XF1A 4ZTOH 3QDJD 2NZIA 3ZL4H 2P5EE 4JFOB 5AAMA 2YZ8A 3BAEH 1QSZA 3TN0A 3ZTJH 2JCCA 4ZS7L 4P2CG 1A02N 3EHBC 4RWYH 4P2QE 4UIMA 2E8ZA 1GGTA 2MCPH 5CEYA 5J1SC 4I77L 2H1PL 3DXAE 3MV7B 4OT1H 1HHIB 3LIZH 4X8JB 1JE6A 2AKRA 1MFEL 3L5HA 1G7HA 3CU1A 3QXAA 2FJHA 1MFDL 3TYFA 3AGVA 3OKMA 4UDTB 3J8F7 4RQQB 3A67L 4LRNL 1CD8A 4IRJC 3CFDB 3E6HB 2Y36L 4FQXD 4POUB 1UM4H 5L9DH 1MCPH 4MJ6B 3O4OC 1DDHA 4XPAL 1J1XL 3O3BA 4HPYL 4AZ8A 3QNZB 4I2XA 3VXOB 2CLVA 3ZSTA 2R8SL 1QPXA 1QA9B 5E94B 4Q74A 1XFPA 2VLLB 5EBLA 1AJ7L 1V5JA 1NL0L 2D7NA 1HH9B 1DJSA 4ZUSB 4JFQB 4J3UA 1YNTB 3GMLB 5DT1L 1AXSA 3QRGH 5I9QC 3P9MA 5HHVL 2ZUTA 1KB9K 5FECA 1YYLL 2Z8RA 4PG2A 1E4JA 4NFDA 3BN3B 4YHIB 1KPRB 3TO4D 4EXPX 4KKAC 4K7PH 5IB5A 4IOIB 2AABL 3P4MA 5E6ZA 4NN7C 1T1WB 4V1DA 1XR8A 1H15B 4GKSB 4MLSA 1BGXL 1TZGH 1UM5H 3I50H 4MQ7A 2R15A 5CGYD 3H9SA 3DX8A 2I60L 4DKFL 2XN9B 2Z8WC 2JB5H 2ZUQB 2MKLC 1C7TA 3MNVA 5C6WH 1KEML 3G08B 1LO3L 2FO4A 3BPOC 1GJIA 1F11A 4O2EB 4JY5L 2BNRD 4UILL 3VGBA 4JO3H 4Z76B 3FJTA 2X89A 2YXFA 3TIEB 4JO1L 4PJ5D 1J0KA 4XC3H 3TCXA 4MDIA 3X12A 5DWUH 2CJUL 4OM0H 3LPWA 5CZVH 4NO0A 1KJ3H 3GMRB 3GMNA 3RTQC 1JGVH 1ZSDB 3W5MA 2ZOKA 1QLEH 1LDSA 2GCYA 2Y5TA 4WWKA 2J6EA 3W2DL 1S9YB 1WBXB 3OKKA 4LEOB 2XRAH 3O6KL 3DGCR 2HTLC 2VDKH 3UYRH 1JHTB 2GJJA 3MLUL 3O0RL 2WQ8A 2PTUA 2X4TB 3MUZ1 5J11B 3D9AL 1IAIM 5AZEH 4XBEL 1JF5A 3KR3L 1RIUL 3ULUH 3KPOA 2UVFA 5GGVH 1ZLVH 4HUXA 1NBQA 2VXUL 2IEPA 1TVHB 2P4AB 3GSUA 4YAQB 1A7RH 1BOYA 4OD1L 3L3OB 3DURA 5FM5O 2XI9A 32C2B 4GG6A 1NDGA 1A7BA 3BPLC 5GS2D 1MHEA 1ED3A 4HIJB 5F70A 1LDPL 2HG5B 2JELH 2D9CA 2A6DA 2A0LC 4Z7OF 4JN2A 2OBGA 4O02H 5F7FA 2VJXA 3TH4T 2RFXA 1CGYA 5DMJB 1P84K 3KYKL 5JW4R 1IAII 1U95A 5IBLC 5I76B 4EUPB 4U7KA 4JQVC 2PYFB 4ZSOA 4OQTH 5DJZB 1AE6H 3UCRA 3HCVB 4LLUA 4WY7H 5DJ2A 3WIHL 4ESKA 1E4KC 1QUNA 4DUWA 4PJCA 5AAWA 3QULA 3DSNA 3G5YB 5DVLA 3KGRA 3EUUA 1XIWD 1I1YB 2BVUA 4UINL 4Y2OA 2DLGA 1DLFH 4E0RB 5BS0B 1GOFA 3ALXA 2EZ0C 4YC2B 2R23A 5CINL 1JF6A 4G6AD 4QHNA 3UZEA 3QRFM 2OM5A 4DKEH 2DBLL 1EMTH 5A3ID 5LAXB 2PW1A 5E00B 4KI5E 1W8OA 4WHYG 5T1LB 2PKDA 3VWKB 3BT2L 1AD0A 1BWMA 3IGAA 1CTNA 5E1HB 4NKIL 3F5WA 1QLFA 1QBLL 3TO2B 3HAEA 2X44D 4WU5A 1G0DA 4YDJA 5GRJL 3HFMH 5BV7H 2ITDB 4JO4H 1AGFB 5DRNA 3I2CH 5JOFA 3FB6B 4UDTA 1H3XA 4ODXA 4OZFG 2DQHL 1Y6MR 3E6HA 2EE6A 4GW4B 4KQ4H 1KIPB 2PW2A 4MJ6A 4RAVA 1EJOL 2HKHL 4HWBH 1T3FA 1YDPA 5I15L 1BVLA 3VXOA 5C2BL 1AGCB 3D0LB 1KTLA 5FGBC 3C6LA 2FYYA 4LSPH 3ZYJA 4ZUSA 2ZUVA 4HUVA 1UCTA 1WWBX 3GMLA 3QUXA 4GUPA 5C7XH 4OCRH 1HSAA 4TYUA 4KQ3H 2VISA 4P3DB 4RGOL 4JN1H 5HSFA 43CAB 4WUKH 1I3GH 4R3SA 1VGEL 2ATKA 1OQXA 3S4SB 2DQTL 1F3JA 3B9VA 2M26A 3U82B 1T1WA 3BZFA 5BCAA 5I16B 1H15A 1DL7H 2R39A 3HPLA 3SPVA 1U92A 1XH3A 3V6ZB 5KJRL 4C4KO 1KTDB 1WFOA 2EC8A 1KACB 2XN9A 3PDDA 4S1RH 5EOCH 5HDQL 4YHPA 2VLJE 3O9WB 4YR6B 4AIZB 5T1KA 1JN6B 2Q7NA 3HG1A 2VAAA 3HMWL 4I4WA 1CGTA 1CR9L 4KMQA 3H0TB 3SY0A 2EDBA 2A73B 1NMCC 4QXTA 1J86A 4W4OC 1T5WA 5CZXC 1FVEB 1Q72H 2ICWI 1SJVA 2I07A 3U1SH 1GZQA 4HKZB 3SDAA 4N0UB 5EDXA 1ORSB 1II4E 2COQA 3SCMA 2HWZH 1L6ZA 2BVTA 4J3SA 3VWJD 2QHRH 3MOBL 4OF6A 4Y4HD 2VXTL 1T89A 3WLBA 5K9KA 2OJZH 1Z5LB 5HY9B 3FQXA 1G9ML 1N0LA 1W0VB 2WINA 4PJXF 5D7IF 1J1OL 5I8CB 5T1MA 1BBDL 3QDGB 4L8BA 3GSVB 3MRMB 2QHLA 1MAJA 3IFLL 4NC0B 3HPJA 4DGYH 1JUFB 1S9WB 1C08A 1NLBH 2YMXH 4AT6B 4LMQE 1PZUB 5ICYA 1CFTA 3D1MC 1A7PL 4HUWA 5J4MA 4Z0BL 3WJLA 2JJUA 3QCTL 4WFHE 3BDYH 15C8H 4TTGA 4JDZB 1FZOB 2IH3B 5DVKA 3SGKC 1DEEA 4FFWC 1QYGH 4S11A 3V95A 5I74B 4LCUB 1KT2A 4JPVL 2IFGA 4EN3B 1G7LA 3QUZA 5F88B 2R0WL 2VN4A 4D0BA 1LP9B 4TTDD 1A4JA 2W9EL 3MBED 1IGFH 4HJJL 2PYFA 2R2CA 1MJJB 4OIIL 2YN5A 4F33B 3ZZ1A 4LRIA 1DN0B 3FO9B 2FJGB 1B0GB 4P23A 2VLMD 3D39D 3QT2A 2H6PA 2XZQH 4MNGE 3RI5K 1I1AA 1UJ3C 4P9HC 4JFDE 3RY6C 4X9FA 4UT7L 2ZUXA 1FL3B 4QRRA 5J9PA 3OV6A 2PETA 5JQHC 3EFFA 3T2QA 2X7LB 1R3LA 3BHBA 3JUZA 4YWGH 1T04B 3FRPA 4U3CA 2WK2A 5D1ZD 1K3IA 1YQVL 2EEBA 1OSZA 5BV7B 5ENWA 3NA9H 2Z31C 2HLAB 5L88H 1CLZL 1RMFL 5AZ2L 4BYHA 1M7DA 4DVRH 5LXGL 4DGIH 5DJ0A 4I9WD 5EO1B 4OGAD 5F7LB 5CD3B 3N1FC 3TO2A 4R26L 5HGBA 2NTSP 3H7BB 3BGFC 5C92A 3G5XB 1JTTA 5I8OL 4DUVA 4GW4A 3CU7A 4LPXA 2KUTA 3WO4C 2CMRL 3OMZA 1KLUB 1XGTB 4G80A 3VDBA 4S0TD 3BRGC 3EO1B 1D5BB 2VLKD 1A2YA 3UC0H 3AS1A 4YFLI 3Q6FB 1H3GA 3MGAA 5I71B 1QD0A 1UVQB 1MOEA 2XV6B 2XG4A 5DGRA 2DTML 1RJYA 2H8PA 2WIIB 1QRNB 3LKQA 4RZCA 4L9DA 1OTUC 4C59B 4MJIB 4LCCC 3SGDI 1RY7B 1MCJA 2P46B 2VE6B 2Y07H 5BQ7A 5JHDA 1CLCA 5ACLA 3SDDD 3SKJL 5HVFB 3MSPA 2X4OB 3KPMB 4X6FA 5D1QA 3QEQD 4F58H 1TNNA 1I8LA 5GGQH 3C60A 1G1CA 4WW2B 4G3YH 3H3KA 4Y5YC 4K71B 2D7QA 2P8LB 1LEGA 1I7ZB 1DBJH 1AO7D 4JRYB 1U93B 5I19L 1AD9B 1KGCD 2VDMH 5CILL 2I9LA 5JIPA 4KJPD 5E4EC 4XPFL 1OF2A 4ERSL 1MSPA 3D69B 1RQ5A 3OSKA 4Y4FC 1RZFL 5JPMA 2VDRH 1KC5L 4LU5H 1AHWC 3SJVD 2E27L 5FCSH 1G7IB 5E8PB 5T5FH 3WSQL 3K8LA 1AQDA 4Y4KC 5IM7A 2YC1A 4U1GB 5FV1L 1IT9L 1XAUA 5DJYA 2W91A 1W0VA 4RWHA 2B2XL 3Q5TA 4CADB 4YHYC 2Q8AL 3BRDA 1R0AL 4Z7UE 1OD9A 1A3RL 3BE1H 3WCYA 4HULB 4EVNB 5LCVL 4OFYD 2AK1H 2GJ6D 2O26U 2IQAB 4DUXA 2B8OT 3VFTA 4AT6A 3GBNL 1G6RH 4G6FD 4WO4A 5DEGA 4NQDD 1OB1A 5F44A 1CG9A 3MLTA 1FZOA 2R4SL 3N9GH 1DQJB 4J4PC 3MMEA 5EH1A 5GGTH 1DFBL 5F88A 5IJVB 4WDIB 4Y19B 1JWUA 2X42A 4JY4B 5IFAL 3TBTA 3K74B 4C57C 3QIBA 2RJMA 2XWJA 1JFQH 4PGDA 3T0WA 2Y6SD 3I6GB 4JM2A 1AQKL 4QY8A 5JW4Q 3CVHH 4F9PA 1BZ9B 3VXPA 4HMEA 5IVXB 3NOIA 1D5ZB 4X7CC 2C4FU 3HI1A 5SX4I 4P2OA 3V6FA 4H20H 5DYOA 3RGVB 5C08D 2QQQA 3MLRL 2P1YA 4JQIH 4Z78B 2AS5M 3K2UH 3EJZC 3SDYH 4KH2A 2DWDA 4L8SA 5DTFB 4K3EH 3S96A 1T04A 2DQJH 3G6AB 3O3AA 4O2FA 4R8WH 4KDWA 3KYAA 5IW1B 5E99L 4X80H 4XNUH 3UPRB 1VDGA 3DRTA 5SWZB 2HN7B 4LK4A 4KHTH 3WNMA 2R4RH 3H6JA 3L6FB 5CEZD 4HS6B 1B2WH 4PG9B 1U6AL 3CXHJ 1OT1A 3RGHA 1M71B 2OXHA 2W38A 4GAYA 4OGXH 5F6HI 5JHLL 3D25B 5HGDB 1RK0A 4G8EB 2P5EA 3MNWB 1KN2L 3K80A 3FQRB 3ARFD 3CPLA 4JPKH 4MNQB 4F8TA 4HBCL 4P2QA 1T03H 5SWQA 1FBIH 1MCQA 1PBYA 3B4NA 2F5AH 3OAZH 4ENEC 3L3IB 3ULVD 3WFCH 1RUQH 1P7QB 3L9RA 4LAJH 3NZ8B 2A77L 2Z4QB 4HBQA 4Y2DD 4TULL 1NC2B 1FP5A 4OV5B 1YEHH 1AI1H 2WIIA 4LHUG 3WFDL 2WBKA 1EVUA 2A1WL 3AC0A 4WI4A 4U05A 1E27A 3LSOA 4Z9KB 3CX5J 1IAIH 3HKFA 5CZKA 2BSTB 3OKNA 3GFUA 5IHLB 3Q0HA 4GKZB 2I9TB 5EU3B 4C55A 2IQ9H 1QSFD 3U6RA 2CRYA 3CCHB 1PY9A 4KXZI 8FABB 5C07D 1Q9KA 3PQYE 2VERN 2V2WB 4NKOB 1KG0A 4XPBH 5FYLD 2ARWA 1YY9C 4NQVB 1WJ3A 3FRUA 1MPAL 3HZVB 4FXLA 1TDQA 5I8KL 2O5ZL 1G7PB 5FM8A 4XHJC 3T4AB 5K59E 2KZ1B 4FN0A 3X14A 1JF1B 2ORBH 1QACA 3L3DA 1U3HB 2VZTA 4RIRA 4C56E 2C1PA 2YK1H 1BQHG 4PGEA 1UEMA 2BVQB 2EO1A 5L7XH 1JNJA 1EEZB 3I84A 5LQBH 3L5IA 3T3PE 5KSAA 25C8H 2R29L 1ZS8A 3DSFH 2EXWD 1H0DA 1C12B 4IRSD 4AY0A 4GO6B 3VMPA 5C0CD 3TBVB 4NBZB 1EEYA 4RNRB 1R5VB 3BIKA 4NO2B 1D9KC 3PXJA 5DURB 3G9AB 4ZPVB 1A6ZB 1IRAY 4E41E 1G6RB 3EYOB 4F7PB 5HI5C 1MRFH 3A6BL 1EZVY 4EBQH 1HHJB 1MCOH 5FIEA 2BHZA 4FZEL 5AG8A 5BMFL 4UTAH 2QL1A 2F74A 1E4XI 3NACL 4OCXH 3KS0H 3FQWB 4EDXB 2AI0L 5ESVB 2AEQH 2A6IA 3RWIB 4ZS6C 2VIRA 3REVA 3O3DB 1NAML 4YHNA 2PXYD 5C0BD 5BW7C 4MHHG 3OPZH 1GIGH 4XNYL 1N64L 1TJHL 3C2AL 3GMPA 5IB4B 5INDB 1MRDH 3RIAK 1HDMA 3T09A 3CVHB 4XHQA 1VGKA 1P9MC 3NN8A 5F7WC 5HYSG 1G7MA 3AREC 2JIXA 3TT3H 1EPFA 3ROLB 4OTXL 1G7QB 3ORJA 1WBZB 5D71H 4MMXC 2J4WH 3UTQB 1NCBH 1A0QL 4HLZH 4PLKD 1MWAL 4LQFL 5J7CC 5HVWA 4NQXB 3O11B 3I6GA 4MZ3A 4Z6AT 1MHPL 5J1AA 5EO0B 2HRLA 2JB6A 2W65B 3LN9A 3DBXA 2OL3A 1I4FA 2HLFD 3Q48A 4J12A 4X4YA 5C3TA 1ZAGA 4OB5H 1UB6B 1SY6H 4YPGB 3BZ4B 5GGUA 5IQ9A 2PUQT 3TJEL 5BJTA 3RL1B 1DZBA 4DTGH 4NQTA 5HGAA 1AXTL 4UT9L 2FZ3B 5F7NC 2CIIB 1RUAL 1MAMH 5DRXA 1S5IH 3IJSB 4NRYA 4RGMB 3WO3B 4HIXL 4WRLA 1XT5A 4J6RH 5TE7L 4R90L 1G6VK 1INDL 2BNQE 3ULUF 3MV8B 1OAUL 1TZHB 1TLKA 2J8UE 3CK0H 1ND0B 3GBML 1IAOB 5DC4B 3EJYD 3W9DA 1WFNA 5F6IB 1KFAL 2DIAA 2XZCH 4PRIA 4KDTA 4XP4H 2O93L 5E9DB 2HFFA 1MVFA 3VXMB 1FZJB 1J0JA 1Q94B 3RKDD 2XYCA 4PRAB 4O51A 2GY5A 1Q0XL 4UOW0 4ZDHB 3O2DL 2ZUUA 1NC2A 1J0YA 1FGNL 5F7YC 3Q5OA 1G9EA 3MJ6A 3ZHLA 4ZUTB 3UTPE 1UXSA 3B3IB 3VFWB 2ENSA 2FHBA 5HI4D 4ZUWA 3F7QA 1DVFB 5DS8A 3VRIB 5FA4B 5EUOB 4X98A 3R06A 4Q6IB 1T0NB 3PL6C 1LP9F 3SKMA 2BSTA 4KU1A 5E2UL 3IAPA 4GKZA 4FNLL 4WTZG 4P9ML 1NLDL 4QHMA 4KK8D 2PO6C 5I1IL 3VFSB 1QSEE 4NKOA 3W5NA 2WM0A 1DANU 1VSCA 5EWIL 3RA7H 4PY7A 4JGUA 5T3XD 4L1DA 4KVNH 4ZXBD 1OAQL 5CCKL 1HILB 1JF1A 1CXLA 2J1KA 2Y7QA 2Z8SA 2BXYA 2DQEH 3HC4H 1CIUA 5GZNC 2DKSA 2AJSL 5DJ6A 2W9DL 4Z77B 4EDWH 5C0JA 2OZ4H 5ADOH 4KMTH 4YXKL 4LSUH 1ZWIB 2AJXH 4XCFL 2BDNL 4X7FC 3TBVA 4KZEL 3BJ91 4MAUH 4HDIB 2VXVL 1I8KA 4JHWL 5GSRB 2ZCKH 5FOJA 3T08A 1OCWL 4QHKI 2VLJA 4W81A 4ELKA 4F37K 1WWCA 1YJDH 5H2BB 4NQUA 2DQFB 4XXCC 1FN4B 3CC5A 3B9KD 1DANT 1T83C 3NCEB 5DC9B 4V2BA 5CEZL 3MV11 4PP2A 3UJIH 1UYWL 4MVBD 2LQRA 3MOQA 3WS3B 3AUVA 4DZBB 3RFZC 3EOYG 3FQWA 1DLHA 1VADA 4DOHE 2DLFL 3KXFD 3F8UB 4M93C 5DD3H 5B39A 4APQD 3DVGB 4MAYB 4I0KA 5HDOA 3QDME 1BJ8A 3OKDB 2J5LC 4U1JB 1O7VA 2WUCH 4BH8A 4RDQG 3OF6D 4NYLA 4PJAB 4XCYA 4Q58C 3T2NH 3DYOA 1BQUA 5FAAA 2P24B 4RGNB 1BZ7B 1CICC 1JGDB 3ULVL 1EEUA 4RX4A 1OD7A 3CFJB 1MI5B 3M17B 3QUYB 2VSDA 2BFVL 3QIUA 3RQ3A 5ADPH 5MEPB 1S78D 1J05A 5D7JB 5JUEH 4LF3B 1WBZA 3OXSA 5GZOD 1V3LA 3CZFB 3O6ML 2H41A 1Q9OA 2W65A 4NSKB 4WW2F 4QHLB 2E6QA 3CZJA 5DQDH 1Q9WA 4Y16D 4HC1H 4LSSH 4KFZC 3V7AE 3DV4B 3JWDC 2ICWB 4QCIB 5JPNB 5SWSE 3G04A 4G9DA 4HS3B 4AEIL 5FYLL 1I9IH 3FOLB 3GSQB 5GJTH 3WHXA 4L3CB 2R0KL 1N2RB 3K1DA 1U8MB 2Y06L 3BQUC 3P30L 3Q3GA 5EN2A 1AC0A 3SKOA 4KKAD 2VKWA 2AK4B 2EDJA 4DGVL 3V4PH 4MNGA 5CSGA 1ZANL 3QNYB 2QSTA 5D8JH 1IGCH 1A7OH 5D2LB 4HHAA 1XF2A 5F9JA 2B1AH 3ARBA 2UY7A 3HE7D 1UM6L 3VFUB 5D2NC 4LHQB 5KTEL 1NBVL 1EAPA 5DK0B 1ND0A 3L3GB 4H0GA 2A74B 1GH7A 3V4UL 3GSXB 4HXBL 1QRKA 3V2AR 4M7LT 2D7PA 3AS3A 5DI8B 3ZYOA 1FZJA 4KRPD 5EU4A 4KJQD 3TN0C 1NSNL 4BSJA 5C86A 1ES0A 3ISWA 3TLRA 3X11A 4LSRL 5C0ND 3OHXA 4GBXD 3HE6A 5I1GL 3GI9L 4DFHA 4L5FL 2GITB 4Z7QE 1S9XB 3VGAB 1JHKH 5L2KE 5D96C 3BP7B 5FK9B 2P7TB 1FAIL 5B21A 1DVFA 2FR4B 1KENL 1DQQB 1G7JB 3LD8B 1T0NA 1YA5A 1J8HE 1L9MA 2A9NL 3ILQC 5IW6A 1JYNA 3BVNB 2XFXA 1F8TL 4LKCA 2A9MH 4RFEA 5HHPA 1ZVSA 2VH5H 2YPLE 1KYOK 4JRXB 5A16B 5MP6H 3S5LA 1NKOA 5BVJB 4JE4B 2NTFA 4MJ2A 1OSPL 1CFVH 4HLZG 5IVXF 3LEYL 4DCQA 1WC7B 4LBEB 3UZVB 1TZIA 2G2RB 1F3RB 1MREH 5SX4H 4P4KB 2X4UB 3IKCB 4F15C 3T0EB 1HILA 1M1SA 4KKBC 3WV0A 1BVKB 1XR9B 1T2QH 4PG2C 2FX7H 4ZTPH 4A2LA 1IARB 4M5YH 3IJHB 1WAAA 3FCTB 4NT6B 5ACZB 1BF8A 4PB0L 2CDGA 3EJJX 3RWCA 2VZOA 2R69L 4FTVB 4LCIH 2E7LA 3MV7D 1OP5H 4HIIB 5HD8D 1NCCL 5B38G 2C7UB 4XAKE 3GIZH 5ACMA 4BZ1H 3WL9B 3TFKD 2CUHA 3WIIH 2X1OA 1F3DJ 3MFFB 3QFJE 5TE6L 5EU6A 4NQCE 1U8HA 4ODWA 5GS0H 4Q9QL 4E5XA 2DL9A 1GGBH 4NDMA 2DM7A 4LSDA 1AY1L 2IALA 3MLXL 3QCUL 3DMMA 1A6UH 4U1IB 4ZAKA 1RULH 1H3VA 5HYQA 1K2DA 1UB5B 3FONB 5EZOL 2NY2C 2WP3T 3GK8L 2EIDA 3MLYL 4JDVA 1RI8A 2YR3A 4JQXA 1CD1B 1R3IH 4MAYA 4OCWL 3FN0H 2X9WA 4OKVA 4G5ZH 4FMFA 4I0PB 4ODSH 5A2LH 3V79C 1NCAH 3LQAH 4WWKC 5BRZE 4LARH 4YK4B 1HYSC 3IYLW 1DE4A 3LHPL 2DMKA 2BY2A 5SV3A 1MI5A 5FYKH 4LMQI 4ZS7H 4P48A 1PEZA 2YA0A 5D7JA 3ROOB 1ZGLB 2VXQL 1W8NA 1BX2B 4M7LL 2YZ1A 5HI3C 1CBVL 3CZFA 4I77H 2H1PH 3VD4A 1HOCA 3TZVC 3J7HA 1S7WB 3QA3B 5KVFL 2VLRD 4DQOL 1MFEH 2DD8L 1MFDH 4L29B 4R0LA 1C7SA 3CFIC 5GGSY 3A67H 4LRNH 4XCEA 1J7VR 2DMBA 4LKXB 5IKCB 3WNOA 1MVUB 1IGYB 2Y36H 4BSVB 4I3RL 2VNCA 2F54E 1QFHA 2VABA 4MCZA 3IU4L 4XPAH 2CKBL 1J1XH 5HYJB 5BZWA 1A14L 2VL4A 1XGUB 3GSWB 4ZFOB 4HPYH 2E7BA 3RU8L 5T3XL 2R8SH 5CGTA 2FB4L 1SEBB 2BVOB 5F7EL 1AJ7H 2J88L 1NL0H 4JKWA 4L4VD 4JJHA 3HS0A 4G43A 4PTUB 1F02I 2YBRB 1CL7I 4H26B 3GSNL 5IG7B 2A6JA 1ONQA 5DT1H 3F7VB 4DEPC 2ZCHL 2XIDA 4KRMB 4F7TB 2AJZA 5HHVH 1YYLH 4F3FB 3EFDL 2X1XR 3WKNA 1YEDB 2ZKHH 2JJWA 4XPGL 4PJHE 4WFFE 3E2HC 2AABH 3LEXA 5SX5K 3MNZB 2FSEA 2R0ZL 5T3ZD 1JMZA 4RFNB 1BGXH 4PV9A 4TNVK 5DI8A 2K9UA 3U46B 1EHLH 1FL6A 5AYQA 2I60H 4DKFH 4DW2L 2NR6C 2PYEA 1U8JB 1V05A 3KPNA 2DDQL 1BIHA 5F71A 1KEMH 1DTUA 1LO3H 5CIPA 1FNGA 1YNLL 3TT1L 4JY5H 2EYTA 4UILH 4OCNC 2MKWA 3IKKA 4JO1H 2Z9TA 1VFOA 4UAOB 1XGQB 1NQBA 1RZKC 3U79A 3TBWA 1S7VB 2NNAA 2CJUH 1YY8A 4Q0XL 5DEZA 3FFCA 5H35B 2XG5A 3KYOB 4CDGC 3MRFA 1BQSA 1RHFA 3O8XB 3LKPA 3W2DH 4UBDC 1TCMA 4HQQL 1SHMA 3O6KH 4JRXA 4L4TD 4NM8L 2HRPL 1JZ7A 1RZJC 2HH0L 4PRDA 3PWPB 4FMKA 5BVJA 2APXA 4YPJA 4NO5A 3P4NB 1HK6A 3MLUH 1FG9C 3O0RH 5GSVB 1LO5A 3C6LC 3D9AH 4XBEH 3KR3H 3ARTA 1DBML 2XWTB 3DHMA 2VXUH 4K3JL 3TVMB 3LN4A 1Z9OA 1EO5A 4OD1H 5KG9B 5HDBF 2IANB 5T1LD 4ONHB 4U4BA 2XZAL 4WW1A 3VWKD 3F7YA 1LDPH 3S37L 3PQYA 3UBXA 3BN9D 3QO1B 4A6YA 4FTVA 5EPMB 3CH1A 5DD1L 2FWOB 3MJ7B 2NY3B 3O6FB 3OG6B 5ITFB 3QQ3B 3KYKH 4XVUD 5HHOB 2DF3A 3QHZL 2BNRE 3GMOB 4UIKL 1IM3B 3TNNA 3U7YL 2ZUQC 5DRZA 3Q5YA 2CQVA 4IJ3B 4WNQB 5DFTA 2NY4B 3BPCB 3MCKB 3RVUC 3WIHH 3L95B 3JV0A 3TH3T 1ZA6A 5JW3L 1CI5A 4NQEB 1IMHC 4Z7VE 4GSDL 2EYRA 3C5ZA 3MCLL 3SDAC 2AV7A 4UDUB 3HZYB 3V5KA 3SCMC 4MCYB 4UINH 3LS5L 2Z0BA 5FDYA 3T0XA 1CFQB 5JORA 5KANG 1YC8A 4HCRA 2AJYL 4PGZA 5CINH 4E41A 3IDMA 1T89C 3DVNA 4P2RD 2V5MA 4KK9D 4WENB 4UMGA 5IQ7L 3TGXA 1FORL 4J8RA 3RY5A 2DBLH 4ONFL 4MD4B 5CJXC 1F4HA 3QI9A 3OX8A 2X4NA 4N8CL 5ESAA 1EXUB 1ZGLA 5EUOF 3SQBA 2FCBA 3EBAA 3BT2H 1S8DA 4NKIH 5MENE 3T8XA 1QBLH 2X1PA 3VXSE 3BP5B 5GRJH 3WJLC 3C8KA 1JPFB 3IFPA 4YEEA 3O9WD 3OJMB 3QNXA 3RZCA 3AM8A 5EU5B 2DQHH 2EO9A 1IGYA 5DHVH 3WIFA 3MR9B 1JK8A 4PJ8A 2DB8A 4WTWA 1EJOH 1LMKA 2HKHH 1V3KA 4IOSD 4PRPE 3D48R 4QOKE 4RAUB 3TBYA 5I15H 2OYPA 4LOUC 3ILPA 1V7NL 1HHKA 1HQRB 3ULUD 3QXWA 5C2BH 2DBJA 4KGLA 4JG0L 4IOFC 1WAAF 5HHMB 1PG7X 4P23C 3RRQA 1A9BA 5D70L 1MF2L 4H26A 1I1AC 2J7LA 3PNWA 1NEZB 3T0AA 4PBVC 4RGOH 4HK3N 4R2GB 3QDGD 2VR5A 1ADQL 3D85D 1VGEH 2GTZB 2H2SC 4OAWB 5ITBL 2DQTH 2GFBB 1VPOL 3CX2A 3DX6B 5E6IA 4U1HB 3TP4A 4XVTL 2DLEA 4M6ML 5EG6C 1WBYA 4PJBB 3H9HA 4PRHB 5KJRH 3FB8B 4ETQB 2QR0B 4PJIB 1U8JA 4S1DC 2Q8BL 4HMCA 5EC1B 5HDQH 2HT3C 4LLDB 4EN3D 3WDJA 5CKAA 1KELL 2J8UA 3HMWH 3O4LE 2HT2C 4OZGE 3QPQD 2F58L 1EFXA 4PJAF 3LVEA 3RWGA 3K8KA 4HIEB 4CU7A 1RPQA 3VI4E 5MHSD 4R97B 2EDLA 1KXTB 4HJ0D 3MOBH 2QQLL 5FM5M 2VXTH 3O8XA 1T4KA 2GEEA 1NEUA 2RR3A 3G6JB 4XPHH 1I9EA 4X5LA 1CDIA 3VRLE 2OR7A 3VFNA 1G9MH 1IEBA 3BPNB 2EXYD 3BW9A 1J1OH 1XZ0B 1J87A 1BBDH 3TBSA 4CJ0A 1FO0L 3PABB 1VHPA 3IFLH 1HHGA 2LTQC 3GI8H 3UBXI 2O61B 1A7PH 2X05A 4Z0BH 4F57L 3QCTH 1JYVA 2RIKA 1JRHL 4WFED 3N85L 1I8LC 3T77B 1QSEA 3EO0B 5EPMA 2HYMA 5LWYL 3WFZA 4JPVH 1LE5A 2R0WH 5J89A 2W9EH 5DF0A 5D2LF 4HJJH 2CIKB 4L1HA 3DXAB 4U6XB 4OIIH 4O5LL 1XF5A 3BPCA 1LILA 4MXQD 4UOW1 3L95A 1EH9A 2W0LA 5DJCB 5H94B 3SO3B 5KSUB 1F58L 3KPQA 4OD3L 5DMKA 1QFWM 5ISZE 1YUHA 5CP3A 4UT7H 1IILE 1QRND 2DLTA 1UADC 3V6OE 4IIQA 4LSTL 5HHNB 4MJID 1WT5A 3BFOA 1CD9B 4WHTB 3HB3D 1JGEB 1MLBA 4PJDE 4J3XA 3W81A 1C5BL 2NX5E 3HR5B 1YQVH 3L3HA 2FIKA 1QFWI 4X9HA 1FC2D 1JI1A 3OAYK 1Q8MA 2W59A 5MEQA 3MRBB 1CLZH 3MACL 1D6EB 1RMFH 2X4RB 3R1GL 4KI1A 5AZ2H 5LXGH 5DHVB 3QHTC 1DBAL 4JRYD 3AS0A 2GY7B 3BP5A 4R26H 2AJ3A 4OV6F 3OKOB 3IXTB 1W0YT 2X2YA 5BO1L 3U30C 1AR2A 1L7TL 4CVZB 5I8OH 1T1YA 4JFFA 2CMRH 1B4JL 3LKSB 3IVKB 4AJ0A 4RAUA 4OBRA 2CDEA 3IDUA 3QIBC 3LMJL 1YYML 3KHQA 4GRLA 1GHFL 3UTTA 4JM2C 2DTMH 4F9PC 1WV7T 1S7QB 2G60L 1WZ1L 4LHUD 2ZUYA 4TUKL 1SYSB 1NFDE 2HTKC 1NCUA 4X6DB 1PW3A 3RDTB 5CBEB 4LLQB 1LO0L 3N1QC 3D3VE 5HVGB 1WZLA 4XHJD 1U9KA 5E8NB 3SKJH 4FFYL 4JPIB 5JTWA 5F96L 1A7QL 4L8SC 1QQDA 4U1HA 4KZDL 1FNFA 4P9HL 4LDLB 2JE8A 3P9LB 3HZKB 4RFOL 4PJBA 2OR9L 4I9WE 4YFLF 5I19H 4U3XA 4XP6L 3O2WL 4Y5XB 2DIBA 4PTTB 5CEXB 3VXQA 5DJXB 5CILH 4YXLL 1T20B 4XPFH 4ERSH 4Y19D 1GZPB 1FVCA 1RZFH 1UH3A 2EDKA 2R9HC 3AY4C 2GK0B 4LSQL 3QJFA 5GIRA 2MCG1 4U6HA 4TSAL 2L7JA 1KC5H 4ZUVB 3HUJE 4FFVC 5F7KC 5E8OA 2E27H 4ZNEE 4OIBA 5JA8B 3WSQH 4FXKA 3WFHB 4L8CA 3DO3A 1HQ4A 4XNMB 3BJLA 1RU9L 4JKMA 4HH9A 2V6HA 1IT9H 3T1FA 4JZNB 4H5SB 3RUGB 3S36L 2FNBA 2UV3A 3RGVD 5EC2B 3BP4B 3E3QE 5L2KA 5I71C 4KUCD 1W0WB 2B2XH 4NKMB 5AYUL 1MHCB 3SE3A 1WSST 2Q8AH 3QISA 1R0AH 2WUBL 2ED8A 4FQXB 1A3RH 2NW2A 1JZ4A 3GMQA 2FEEL 5D6CA 2OLDA 5CWSB 5LCVH 4L3ED 3VH8B 3MGOA 5ANME 3D5OF 3GBNH 3M45A 1FYTB 4XP1L 1C1EL 1CS6A 5AD0A 2YPLA 2R4SH 2AJUL 3KPRD 1FGVL 1MCLA 4RBPH 3WIHA 3U9UB 3LRGA 1TTFA 4K71C 5T33L 5FGSA 1KGCE 5EORL 1DFBH 1UQSB 3ARPA 4X6CB 1FFPA 4MS8C 1JV5B 3TO4B 3ZE0F 1D5IL 5IFAH 5CLWA 2L7UA 4MNQD 5E8DL 2P8PA 3SJVE 2UUDK 2KL6A 1AQKH 5KSUA 1NGWA 4N8VB 4I5BA 1IGTA 1YECL 5C9KA 3TWCL 3P9WB 3E6FA 1Q38A 3PP4L 5KSAC 3KPSE 4OLUL 3UTZB 3DHJA 2QQNL 3MLRH 4WHTA 1CCZA 1F2QA 4OD2B 4Z7NF 3PP3K 1OAXL 4P5TB 2MQCA 3KPPB 5E4IA 2GJ6E 1ZLSL 5J6HB 1VFAB 1WLHA 1MCHA 5E99H 5CSZB 2OSLB 4NQDE 5IB1B 5HYEA 1D6EA 3VXRD 3C8DA 4Q2ZA 2YUWA 3QIWB 2BSSB 5DHVA 3SDXE 1X4XA 1U6AH 4MDJA 1DCLA 3ESVF 3PGCB 4Y1AE 1MIEL 5JHLH 5BRZA 3HC3L 5D7KD 3OKOA 3O81A 1RD6A 4F9LC 5DHXB 5L2JB 4U1LB 1U3HD 2AGJH 3PWNB 3SE9L 1HI6A 6FABL 1U91B 1KN2H 4YGAB 1X7QA 3IVKA 4HBCH 3N06B 3EDKA 4R7NB 3MV9E 3SDCB 1B90A 1YN7B 2XTJB 4QRSA 2A77H 2OJEA 1F6AA 4TULH 3TPKA 4Z7WB 4JZOB 3U2SB 3DROB 5MERA 4X4XB 4GXUN 3WFDH 3GMMA 4MNHB 4OF0A 2WWKT 4BQ9A 1P4BL 4FFZL 4YGVB 2A1WH 3O45B 5CBEA 5BOZG 2BY3A 1FE8L 4P46B 2F54A 4RA0C 5DFWH 1S5HB 2P48B 3IXAA 4Z5RB 1CDBA 4B5EA 3NIGF 1NMBL 1R3JB 2CRIA 1I3RB 4WI8A 5KSBE 3P9LA 4XWOC 3HZKA 1V3MA 4PJ9B 1MPAH 5I8KH 1JWMB 2O5ZH 2VN7A 4NNPL 4QRQB 4HX1A 4XI5C 5I6XB 1JIBA 4X9IA 5E8EB 5HHXL 3C08L 5EZJA 4AEFA 3S98A 3F6LA 4JPWL 3BI9X 1QBAA 1T20A 3QDJA 1KB5B 4PJ7A 3MLPA 4G9FD 3ARVA 1N59A 1ULVA 5TH2A 4I48B 3WJJA 5LGJA 4HIHB 1KCUL 3AU1A 3BZDA 5KS9E 2R29H 3FOMA 4PJEB 5IBUG 3OKEB 5INCA 1WCBA 4X99B 3WFHA 1QFPA 4GG8A 3SPVB 3W11C 3MRCA 3R0NA 1UZ8A 2K1MA 3VFOB 3VRJB 1FFOA 4HWEL 3B43A 3C5JA 5IIEA 4OJFH 3A6BH 1VENA 2JF1A 3NFNA 2BSRA 5IR1A 1X4ZA 5C8JA 5LJYH 1PZ5A 4FZEH 5BMFH 3EYFB 5F1IB 2V7HA 3NACH 4D0DA 2NY1B 3BXNB 4EQ3A 5I2IB 4KROB 1MIML 1RZGB 1F97A 2AI0H 1F4YL 4AENB 1CLYL 4P3CL 1M05B 3T3MF 3RL2B 4FXGA 4HD9A 4LCWE 5TDNB 1IFHL 3MYJB 3KYMA 4XNYH 1N64H 3W0WE 1TJHH 4EEEA 4YHZL 3C2AH 4ODTL 2JJVA 1IC7L 3BESR 4POZD 3STZA 1ITCA 3V5DA 3NFPB 2GT9A 3VFGL 2A6KA 3LRSA 1CFBA 3MFGB 4OTXH 5JDSA 4ELME 2G75A 3PJSA 2OTUB 1FNEB 3LB6C 2F53D 2X41A 1T66C 1MWAH 4LQFH 5C09D 1YMMD 1MHPH 3MQIA 1YEJL 5C0CE 3UO1L 2ICEB 1U8OA 5ID1B 5C0AD 5LGHL 3IU3A 2UWEB 3BDXA 4HK0B 5FGCE 2EDXA 5ID0B 5D9SA 2V7NB 4WGWB 1X5LA 2BNRA 2GSIA 3WN5A 5IFHL 1PKQB 2DYPA 4PJIF 4PJ5A 1CFNB 5B39G 3TJEH 3BRFA 4WI2A 5B8CB 4IEFB 2BVPB 1AXTH 4UT9H 2ILLA 1RUAH 5FGBA 4Z7OE 5EBGA 1A6AA 1FJ1A 2Z35A 5D7LE 5J6HA 3KAAA 4R7DB 1PG7W 2EH7L 3T0DA 4Y4HB 4XXDA 3JVGA 1E28B 4HIXH 3CFKB 2F9BT 2ADGB 3EYVB 1P1ZA 5TE7H 2E8YA 4R90H 1INDH 2D7OA 1OAUH 3NIFF 1ZT7A 1GSMA 3G6JF 3GBMH 5I1JL 5L2JA 5IMKB 4NRZB 5DRWB 1KFAH 3L1OL 3OB8A 3S8WA 1PJ9A 1S7SA 2YD4A 3ZE2E 1HN1A 3BEVA 3UMTA 2XXMB 4JR9L 4PGCB 3QIUC 4OI7A 1CWVA 2Z91B 4R7NA 4M8QB 1Q0XH 2OQJA 3VFMB 2YD1A 4MJ5B 1HSBB 5KVDL 1BFTA 3O2DH 4JZOA 1FGNH 5D4QA 1I7RB 4W4OA 5D5MB 2IC2A 1CE6B 3LPFA 3OB0K 5ERWA 2IAMB 3FT3A 4YGVA 5C0GA 2BMKA 3DTXA 2CKNA 3OJDA 4OF8A 5I1DB 3M1BB 4PRPA 1OTTD 2YUZA 4YHLL 5E2UH 4BK4A 4FNLH 1QO3A 1JJUA 5EBMA 3KWWA 4P9MH 1NLDH 2NY0B 4M8VA 4M1CD 1I3RA 5I1IH 1XIWA 5IMLB 4Z7UB 4HGWB 5DO2D 1BIIA 4LCYB 5CJOL 4IHOB 1FV1B 5EWIH 3BMVA 4HFUH 4DK3A 1V8HA 3S88H 1OAQH 4RGMC 3L7EA 1W72A 3C09B 5CCKH 1RJZB 1VACB 1ZVHA 1I1FB 4DFIA 1BD2B 5C71A 3QUYD 4QRPE 4LQ1A 5D1ZB 3SE8L 5I8EB 3CAFA 5I1LA 1BAFL 2VDQL 4TUJB 1NCWL 4LFHG 2DLIA 2P5WD 2AJSH 2W9DH 4L9LB 5F6IC 3ALWA 1A9EA 4PJEA 3O3EB 1JVKA 4YXKH 4LLWA 2V2XB 4XCFH 2JTDA 2BDNH 4H25B 2LAAA 4KZEH 3S3SA 3WNPA 2VXVH 1CD0A 3FFDB 4JHWH 4WJ5A 5K9OB 4PR5B 4LLYA 3SKNB 1M6OA 4G7YL 1OCWH 4QEGA 4G8GB 3MRQB 4KY1L 1HCFX 1SJHA 5FYJD 3O4LA 3WYRA 3HE6C 4B0MM 4X4ZA 4OZGA 5J6GA 3CSGA 3D0VB 5CEZH 1UYWH 2XKNB 3L3JB 3V0VA 3PDGA 3S5LG 3P40A 1HYSD 5I1AA 1UWGL 1DVFC 5E7FA 2DQCL 3CIQA 5J06A 2DLFH 4BZ2L 2YEZB 2YD6A 4UQ2A 1PQZA 2WBJB 4Q6IC 4LNRA 5D2NE 4XCNA 1KULA 2Y5EA 1OT2A 4PUBL 1U41A 4NCC1 1MFCL 4IMLB 1D5XA 4LIQL 1MWAB 3QEUA 4XH2B 3ULVH 4NHUB 1NUGA 3SDDB 2BFVH 2HFTA 2MHAA 3QEQB 1FZMA 4HUUB 4X6DF 4LLVA 4RMVA 1FNSL 1JZ3A 1XGPA 2D4DA 1ZT1B 2ITCA 1FNEA 2R2EA 4UU9A 3TV3L 4N9GB 5HPOA 1JNNL 4TOYL 4PJXE 5D7IE 1SBSL 4LPUA 3MRNB 4TNWF 1VEOA 3P0YL 2H9GB 2ATPB 4HGMA 1BOGA 2UWEA 1WFTA 3WBDA 4KK6C 1UKSA 1T1ZA 3INUL 4XC1L 4NZTL 1C5DB 5C0DB 4OLWL 3DX9A 3UROR 3QWOA 4AEIH 1ZHLB 5FYLH 4R6UA 1CFNA 4UT6L 3O41B 4NWTL 5B4MD 2R0KH 2ZNWA 2IADA 5HHQA 5GGSA 2Y06H 4ODVL 4KJWC 3P30H 4OLXL 1Q9LA 1AP2B 3KXFE 4LCCA 5HJ3B 3RNQB 3VWJA 4DGVH 3EGSA 3D2UB 1ZANH 3DMMC 4ZAKC 1A64A 3ARSA 3EYVA 2GJZA 3V6OA 4KKLD 3AMKA 3QEGL 4JQXC 4MAYC 5KTEH 1NBVH 4P4KD 3T0ED 2APBA 1YN6B 3RUGF 5DMIL 3V4UH 3C5SB 4Y5YA 1C8PA 4HXBH 4JO2L 3KLHD 2NZ9D 5D6DA 5DD5L 5DDHB 3CSYB 3CXHK 1RSFA 1F4WL 1NSNH 1DBKL 4ORGA 3H9SE 1JHLL 3KPLA 1H5BB 4M7ZC 4GW5B 5D7JC 4LSRH 4M8QA 4EIGB 4EOWL 1AKJD 3GHBL 4C56B 5I1GH 3GI9H 5J12C 4L5FH 1Y18B 3MUY1 3EYSL 2WLZA 2BY1A 3VG0L 1TNMA 5DUML 4H8WL 4CMMA 2VYRE 1TVBB 1JNHB 5C6PB 3VGGA 2XY1A 1L0QA 1FAIH 3MBEA 4D0CB 4R0LC 1KENH 4S1SL 2X4SB 4KI5F 4X6CF 1NANH 1FFNB 4GAJL 2A9NH 1J88A 2BNUB 1F8TH 3QUXD 3JV6A 3D39A 1T5XB 4QTIH 3JWNC 4YDVB 3F7PC 3IS1X 5EOTA 1V7ML 2EDRA 4I0PD 1DBBL 1OSPH 3RVTD 4GXVL 3WXWL 4U6VL 5C08B 1OLLA 3LEYH 3CX5K 4BSWA 1E6JL 1KYOJ 1FFRA 1WICA 4GLRI 4N5ED 4E42B 1RJZA 1I1FA 4EQ2A 1U8KB 3QG7L 2YUVA 2QLVB 3TIDB 3AB0B 5CJ8A 1X5ZA 4PB0H 3T65B 1QR1A 2R69H 5C1MB 4CN6A 3L5WA 4ZOBA 5F3BB 1NCCH 4GT7A 3B9EA 1N6QL 4MA3A 5IB2B 3TPUB 3ARDB 4ZSOE 3SCMD 3U9PL 1NAMA 4Q9QH 1IGJA 1K4DA 4U0RC 3FN3A 4UV4L 3VGAC 1MCFA 3CUPB 2XKNA 4NOFA 4KC3B 5HYJD 1AY1H 3MLXH 4PJCE 3QCUH 4ZO9A 4XBGB 1NFIB 4ZNEA 2AXGA 4M9OA 5EZOH 2VLKA 4BQ8A 2FX9L 3GK8H 3MLYH 3LD8C 4NN6C 4TQEL 3EOBB 4OCWH 1YMHB 3PHQB 4OGYL 5ABDE 1NH6A 4IMLA 4GKNA 4ZOAA 4Z7WF 1J5OL 4XMLL 3GJFA 3LHPH 2HVJA 1YEGL 4X6BB 3UBXG 4J3VA 4HK3J 5DVNA 3LV3A 4CW1A 2VXQH 4N1CA 4WIQA 5M7QA 5DMGD 4M7LH 1QSFB 4UOJA 3QEHA 2BNQB 1CBVH 2VZ1A 5C07B 3DYMA 3QUZD 1SYVB 5C0IA 5ICZB 1AO7A 1KSRA 3MRNA 5KVFH 5BZDA 4DQOH 4BKLA 4CRPA 2DD8H 4R96B 1RJLA 1F4AA 2ATPA 2D3VA 1OGAD 1T22A 4QRUB 2YD3A 4P23D 3S34L 4ZFGL 3FAXA 1K8IB 4I3RH 1I1AD 4ISVB 5FFLA 3IU4H 3LKRB 3O41A 4CL7A 2CKBH 1A14H 5CKGA 4KJYA 3RU8H 5T3XH 3SJVA 5IVNA 4YO0B 4X6EB 1DEDA 1MHHB 4N0FB 3U0TB 2FB4H 3KYNB 1NDMB 4OCYL 5F7EH 4P99A 2J88H 1NBZA 3G9VA 1C16A 3RJDA 1AR1D 3KPSA 4PJEF 3GSNH 5IJKA 1WQVT 3EOAB 2ZSWB 2ZCHH 2FECI 3A6CL 3C5ZC 3QJHB 3PV6A 3EFDH 4YBQC 1MJ7L 1RVFL 3JTSA 2OCFD 4XPGH 1KXQE 3P77B 3TVMD 5IF0A 3VXUD 3LN5B 3FB5A 5EA0L 3QUMA 2R0ZH 2GJ6A 2HT2D 3JTTA 3GGWB 1UA6L 1A6TB 1TQBB 5FYJL 1UFUA 4XNZC 4NQDA 3QI9C 2PXYB 1IBGL 4JKKA 4GQPH 4DW2H 1T1XA 3MRLB 2ESVB 2Q6WA 3SDXA 2XN9E 3E0GA 1XF4A 2J6EL 2DDQH 3QDAA 1OP3H 2NXYB 3WE6B 1R5WA 1YNLH 2C3VA 1OM3L 3HG1E 4FG6C 3TH2T 3TT1H 4XMKL 5CGMA 4LL9A 1CQYA 4ZQKB 4FQIL 4HZLA 3LKNB 3JWOC 3LKOA 3OR6A 3IDGB 2NY4D 1H8NA 2P8MA 4XP4L 2CLRA 4Y5VB 3AM8C 4TVPD 4GW1A 4HKXA 1VFUA 5IK3A 4AM0B 5CHNA 1X3DA 4NQED 2IMMA 4Q0XH 3H2WA 3NPSB 1D9KA 1K4CB 4PJ8C 3MV9A 3DIFA 1WZKA 1DUZB 3MRPB 1WISA 2EH8L 4PGBB 4XP9L 5FYKD 4HQQH 3NGBB 4NM8H 1LK2B 2HRPH 3UJJL 2HH0H 5IMOB 2DQUL 4JFYB 5D1QD 2B1HL 4EXKA 1GGUA 5B22A 3C60D 3ULSA 1BFOA 1DBMH 2UWEF 1JPGA 4HZAA 5DEFA 3WFEL 1FNAA 4OLVL 2LABA 4PY8J 4CNIB 4K3JH 1DP0A 1U8KA 3ARGB 1RUKL 2GYSA 4QNPF 3OR7B 3HZMB 5FA3B 4HAGA 5T3ZE 4U1KB 1TPXB 4O4YL 2XZAH 3O2VL 3HRPA 3S37H 5E6IC 1UWXK 1A6PA 2IBZY 4GMSL 5DD1H 1NGPL 4UZGA 4LAQL 5KVGL 5F3BA 4GKOA 3TNMB 1JWSB 5FO7A 4JFPA 3QHZH 4GAGL 2Q3ZA 4UIKH 3U7YH 5EBWA 4IM8A 1UC6A 3WXVL 3F7RA 5ESQA 3RVWD 3FT2A 3K8MA 1S7TB 2ZP0T 3ARFA 5JR1L 5JW3H 3T0VA 3BP6A 1AGEA 4UAOC 4XBGA 3KNBB 3BH8B 3F12B 5FO9A 1NFIA 4GSDH 2PTVA 4ZYKA 4N90E 1MLCB 3MCLH 3MREA 5TF1L 4YLQT 5HHMD 2BRRL 4Y2DA 4MXVF 3H8NA 4QRRE 4A2MA 3LS5H 5BS0E 2AJYH 1QG3A 2XNAA 3OWEA 4ZO8A 3O8XC 1RZKL 3K7UA 5C9JB 5IQ7H 2ERJC 4HWZA 1GGIL 1FORH 1NC4A 1P2CB 3LEVL 4KK5C 4ONFH 4WO4D 5D5MF 3RNKA 2E6JA 5EIIB 3FO1A 5E1AB 3VMOA 4X5XA 2Z92A 1REIA 4PD4J 1QZ1A 3PGDA 3UAJD 2BOCA 3HHRB 3BKYL 5C07A 4PRHD 2Y9RT 2I25N 2NMSA 1HZHL 1VERA 4LCWA 3VD3A 3SE4C 2CKBB 5F3HB 3L7FA 3QIBD 5DD6A 4HV8A 5CD5C 1ZHNB 3HNVL 3ECBA 5GS0C 4ZXBB 4D9RD 2L4OA 4Z7UF 1J12A 4NO3B 2NY3C 3O6FC 3GSNB 5H37G 3PGFL 1DUYA 4P2OD 1PYWA 3MA7A 3C6SB 4RSVA 5DJ8B 1KIQA 5J3HC 4MA1C 1DQDL 1V7NH 4IJ3C 3L3KA 1A1MA 3TA3A 3U0TA 1KUMA 1F6LL 4IRSA 5C0CA 5EOCJ 4JG0H 2R1XB 3GRWA 5FYKU 5D70H 4QHUB 1MF2H 3IDIA 1Y0LB 4LASL 3VFVB 4F2MA 3IDJA 1KLGB 4TSBL 2HFEA 4KVCL 2ZOLA 4JJ5B 3MRDA 5JHDE 4MX7A 1QHPA 4IIQC 4I18A 4JFXA 1ADQH 1WT5C 5ITBH 1VPOH 2PO6A 4XMPL 3QO0B 4XVTH 2YSSA 5D7LA 1MH5B 2W0FA 4YE4L 4M6MH 1K3ZA 3C9NB 4J1UB 3CVIL 5C0BA 2VQ1B 5B3JE 2HJFA 2Q8BH 2P5ED 4M3KB 2IPUK 1T0MB 1S7RB 3JXAA 1T80A 1KELH 1NGYB 4XRCB 3HNSL 1HKFA 2F58H 4Z8FL 3DXAD 2G5BA 3RPIB 4IRJB 1NGZB 4HKJA 3M8OL 3H3BC 4M6NL 4UNTA 3DO7B 5EIQA 3O4OB 3EYQD 3V7AG 3VI3F 3ULUE 4U49A 4G6ML 2QQLH 1P6FA 2XTLA 2IH1A 2BOBA 2CDFA 4XXCA 3B6SA 4GRMA 3PHSA 1OW0A 5D1XA 1J0ZA 5F7HA 5FXCH 4WHYH 4Y16B 3GIVB 4GRLC 4OQ1A 2VWEE 4K55A 2R1WA 1KCVL 4N0CC 3QDGE 4AH2A 2XPGB 3MRRB 1FO0H 1M7IA 4K3HA 1CXIA 2AV1B 3EIFA 5I9QB 3VGEA 5CBAA 5F7DA 3BD5A 2E3VA 3B5TA 1B0RA 4R4NC 3FB7B 1K8DB 4R2GC 4F7CB 3MUGA 3P0VL 1KPVB 5DLML 4F57H 4KMLB 4OZFH 4BQBA 1JRHH 3DUUA 4NN7B 3N85H 1R5IA 3RHWF 1LEIB 1K85A 2C1OB 4U1SA 5LWYH 1F3DH 3D18A 2AXHA 3HE7B 1FNLA 3OXRB 4YNYB 1JWSA 1IQDB 4B7IA 4D3CL 4UV7L 1LP9E 4KAQL 5KVMC 2H45A 5JOPE 3ZHDA 1N8ZB 4QRPA 3BPOB 1ZGLP 1IC5L 3VJ6A 1A6WL 4JVWA 4O5LH 3WEXA 4BA8A 5K9QI 1HWHB 5DUPL 1NUDA 4ZUUB 2ZG2A 3PG2A 1IEAB 1F58H 1LEKB 3NTCL 1G0YR 4OD3H 2FO1A 3KNBA 4KRLB 1I7TB 2R0LL 4WFGD 4N5UA 3BH8A 1MUJB 5JNYB 2LU3A 1ZOXA 4GBXB 1IL1B 4PJFB 1A5FL 1A1NA 5IEKA 1NMAL 1OL0A 4R97C 3RTQB 4LSTH 1S9VB 3VCLB 4CDHA 1MFAL 3RDTD 1C5BH 1RFDL 1EGJL 3KVQA 1GGBL 3BPNC 2YRZA 4XNQA 5E1AA 4JHZA 5E6YA 3RY4A 4Z18A 4I1NB 3MACH 2V9RA 3IFOB 3R1GH 4F7MA 3WUWA 4JFEB 1DBAH 5FOBA 3VFRA 4TVPL 3BPLB 3MRHB 2QSCL 5JLZA 5DSCB 2DM4A 1MQ8A 2LU7A 4QF1B 4ZXBA 1P4LB 3BYTA 4B53A 5BO1H 4GQ9L 1L7TH 1KIRB 1RZ8A 3MRGB 3OL2A 3PV7A 4NO3A 5FYKL 3VXNB 1R24B 2KDGA 5F89B 1JP5A 5J0BA 1B4JH 3O6LL 4KUZL 1XGRB 2EDFA 4JY6B 3U36B 3CFEA 4ZFZA 3H9ZA 1I8IB 3LMJH 1YYMH 1RIHL 1MEXL 3GUTB 1GHFH 4PJXA 5D7IA 4M9PA 1T2JA 1AGBA 2ADJA 1K9TA 2R1XA 2O5YL 1QRNE 4W70A 1NBYA 2CK0H 2G60H 1WZ1H 4P3WA 4TUKH 3VFVA 4HKBB 4X7TA 4JM4L 5A40E 3MRKA 5IOPB 2GTWB 2SEBB 1LO0H 3I75B 1ACZA 4JJ5A 4MXWL 3QAZC 1P7KB 3B9KA 2GUOB 1JL8A 4PGJA 4MQXD 4FFYH 3AXLA 5F96H 1A7QH 3REWA 5I1KL 3QFDA 3HMXL 3QO0A 4KZDH 3N1MC 4P9HH 1FYTD 1RZIA 4EI5A 2ZNXA 2GAZB 3KXFA 2XWBA 3MGTB 4APQA 4RFOH 2FEDC 2OR9H 2DQGL 4JRYE 4XP6H 1FC1A 3O2WH 1ORQB 4XGZA 4MWFB 1YPZB 3ULVF 3OF6A 4JCLA 4KI5D 4NN5C 1H3UA 5E7BA 5C0JB 4YXLH 2NY6D 1INEL 1SEQL 4FQ1L 4XB8A 2ZKHL 5FKPB 2Z93B 4QYOB 1PKOA 4LSQH 2A83A 4TSAH 1VEMA 5I18L 4UQ3B 4LVHC 5EZLB 1EHLL 3I3BA 3LH2L 1FO0B 4NKDB 5D72L 1E4XL 4KKCD 1WITA 1RU9H 4TUOA 4U1MA 2VLRB 2AVGA 4HPOL 1INQA 4JEGB 4U1NB 3S36H 2N7AA 2WWMD 1SJEB 1BM3L 3MZGB 1IEHA 1NGXB 1CGSL 5DHYA 5AYUH 4OZFB 5MEOA 2WUBH 2GI7A 4JANB 2FLBT 4P5TD 4WI7A 2QV2A 2AV1A 4PIRF 1BEYL 1O5DT 1B0WA 4PJGB 4HFWB 3GKWL 5FKAB 2EICA 4NFBA 4XP1H 1AC6A 5JMRA 1C1EH 2PTTB 1MCNA 1R3KB 4L4VB 1NJ9A 3QIWD 5ALBL 5HGHA 5FB8B 2AJUH 4DZ8B 4ZPTB 1FGVH 5C0EB 5IFJB 2Y25A 4PREA 4NRXB 5T33H 2KQMA 1BFVL 5EORH 1ZE3C 1IQDA 3IJYB 4QXGL 3PHOB 4GH7B 5JO5A 1FVDA 1D5IH 4PLOB 1QLRB 3EDJA 5MENB 1HHHA 5E8DH 4BFIA 2IPUG 3TZVA 3VXSB 1JZ8A 4LNVA 5DQ9A 4K8RD 1LEKA 4MQTB 3SDCD 1YECH 3PIQB 2EDWA 2XTJD 5DJDB 3TWCH 3WJJC 1QR4A 5FF6B 1QEWA 3PP4H 3MA9L 3PWJB 5E70A 4OZIB 3FQTB 3DUSA 7CGTA 4PP1D 4OLUH 4Q6YA 3BWUC 2BP3A 3HLAB 2QQNH 4PLJD 5KSVB 4ZD3L 3HN3A 1BLNB 4QOKB 3V7MA 2D31B 1CGXA 3U0PA 1I7UB 2JK5A 2R2BA 1OAXH 4P46D 3T2PA 2DS4A 1AGDA 4WWID 1ZLSH 2YHGA 2VOTA 3DETD 2XQBL 1N6VA 5DZLA 1KV3A 4QRTB 5I1HL 4FQQA 1S7XB 5SWZE 1IKFL 3NCMA 4PJ9D 4RX4D 4L4TB 3WLWD 4KHXL 1CE1L 2X5PA 2ADIA 2OS7A 3MCG1 1BBJA 3FTGA 1MIEH 3HC3H 5JW5A 4JLRB 5L6YL 3KDMB 4G8FB 2PCPB 3SE9H 4MD0B 4YDKH 3MO1B 4WFHD 4PRIE 4JFOA 6FABH 4YX2L 1H3PL 4JHBA 3STLB 4MNQE 5FCUL 3IFNL 4OF5A 3TO4C 3X3GL 3OKYA 1FHGA 5IGXL 3IS0X 4GFTB 1R3HB 3MV7A 1HHIA 4X8JA 1CT8B 4L3AA 4GS7B 5IB3B 5CGYC 1BP3B 1UJ3B 4HKBA 4RQQA 1NCNA 1P4BH 2JJTA 4FFZH 3W9EB 2EEAA 5I73C 3CFDA 3ZDZF 3I75A 1ZT4B 5JZ7D 1FE8H 2GUOA 5TE4L 4JFDD 3WN5C 3BEWB 2NY1D 4KROD 3QNZA 4G8IB 3ARBD 1NMBH 5CMAB 2CO6B 1QA9A 5E94A 2VLLA 5FHBL 1HH9A 2Z31B 4C58B 2NQCA 4JFQA 4NNPH 1YNTA 3NPZB 5HHXH 4HXAL 1HINL 3C08H 3JVGC 4P2RB 1C5CL 3FQNB 3QH3B 4JPWH 1U8LB 3KG5A 4YHIA 1KPRA 5FKPA 2EDTA 3KS0J 4OUUB 1A7NL 3BGFB 4IOIA 3V9FA 1CGWA 1KCUH 3GO1L 3L5JA 4GKSA 1NFKA 1BZQK 4NHCL 1VKXB 3RWDB 4P59L 3MZTA 2D0FA 3WO4B 1KJVB 1U8PB 2GSGB 1SVZA 2VLRA 3R8QA 4U1NA 3G08A 4HWEH 4O2EA 2Q86B 2H2PD 1KIUA 1LWRA 3DRQB 4Z76A 4NQSB 4DK6A 3GJFK 3TIEA 5BXFB 3B2UD 4X7SL 1P6AB 3QCVL 2VB5A 2CXKA 3ARXA 1NAKL 3T4YB 1A3LL 1MIMH 4HFWA 1A6VL 3GMRA 2H32H 1F4YH 3N1GC 5IEHB 1CLYH 4P3CH 1ZSDA 2X09A 2X70B 4PJDB 1IFHH 4L4VA 1S9YA 1PVHA 1WBXA 1B3JA 4LEOA 4XPHL 4YHZH 4ODTH 1U8IB 2OL3L 3K1KC 1BVZA 1IC7H 1JHTA 1XIWC 5CJXA 2X4TA 3QXUA 2BY0A 3VFGH 2N1KA 4YZFF 1EHAA 3PHOA 3D85B 3UZQA 4P4RB 1TVHA 4YAQA 4G6AC 3BH9B 1JZ2A 1A4KB 3GI8L 4WEUD 3L3OA 3IAGC 4Y4FB 32C2A 2EKSB 2C3GA 5A3IC 4HIJA 2HG5A 1YEJH 3VA6A 3UO1H 4FZ8L 1AHWB 3CDYA 1JPTL 2B0SL 5LGHH 5JW4N 3FAWA 1U3ZA 4RMWA 5F1NB 3FQTA 4XPTL 3LQZB 4YIQB 1S7UB 4L8DB 4Y4KB 4JZJB 1BJ1H 4CU8A 5I76A 3OJ2C 4EUPA 5IFHH 1WIPA 2IAMD 3E8UL 3G5ZB 4KKNA 5EFIB 3HNTL 3PWUB 5DJZA 2M1KA 3HCVA 1I1CA 3DV6B 1HH6B 5DK3A 4XVJH 1MJ8L 3JV4B 1HNGA 2DWEB 1NFDB 2XOTA 3G5YA 2EH7H 1U58B 2NY0D 1WWWX 3CLEL 2V9QA 2EECA 3D3VB 1Z9SA 1I1YA 4E0RA 3QB7C 5BS0A 4AK1A 4OUOA 3MV8E 5I1JH 1ZA3B 1LNUB 1BD2D 1XGYL 4G8FA 2FL5B 4MD0A 4HW6A 3RIFF 3L1OH 2QEJA 5LAXA 3CSPA 5E9DE 5E00A 9CGTA 4G42B 3VXME 4JR9H 5T1LA 3VWKA 1GC1L 5GRUL 2EYSB 4YH6A 5KVDH 4JFZL 1ZEAL 4RMSA 2ITDA 4G8GD 1AGFA 5EB9A 3FB6A 5GJSL 3HUJB 5L8JB 1WIUA 2E7CA 3N1PC 2QKIB 4F7EB 2EIBA 2HT4D 4NUGL 2QQKL 2WMPA 4ONGL 1SMOA 4JB9L 1KIPA 1BF2A 4FQHB 2BSED 3HRZB 1NUFA 1KJ2L 2NYYD 3IF1B 4YHLH 2B20A 3IETB 3BD3A 3V0WL 4NBXB 4NUJB 1LD9B 2WBJD 4K7FB 3ARZA 1AGCA 1X4YA 2X4QB 3D0LA 5F1OB 5CJOH 1ODAA 2LVCA 4XBPB 3VWJC 5T5NG 4K8RL 4Y4HC 4R4BB 3BUYB 4P3DA 5C0FB 2VUOA 4PJFF 5FO8B 3QH3A 5ANMB 3V6OC 3DPBA 3SE8H 3LY6A 43CAA 1BAFH 1PD6A 4PRBB 2VDQH 3EZJB 4K3GA 2HJLB 1GPOL 5DUBB 1NCWH 4OUUA 3S4SA 5I66B 4QWWD 2YRLA 5C70A 1WAAE 2EIZB 1R6VA 5I16A 3EAKA 1GAFL 3QDHA 3U4EB 3V6ZA 5D6DC 1KTDA 2LE9A 5M95B 3F65A 4G7YH 3UTSB 5HXMA 4JREB 3O9WA 4YR6A 4AIZA 4KY1H 1JN6A 2H32B 2X10A 3BIBX 1T7XA 5EU6E 2H26B 1A47A 1Z6JT 3WFBL 5F9DC 3H0TA 5F1KC 2A73A 2ZCLL 5ILTL 5BXFA 4LLAA 1FVEA 1FH5L 4NPYB 3L5XL 1MFBL 3T4YA 1FL5B 3MBEC 4HKZA 1UWGH 4N0UA 4OI9A 1ORSA 4YHOL 2DQCH 4BZ2H 4M61B 1KB5L 1BHGA 3D2UD 3QQNA 4PUBH 1MFCH 3U7AA 1D5MB 1Z5LA 1X5AA 1VFMA 2HFGL 4LHUB 5HY9A 4YEFA 4LIQH 3ARWA 3FO0L 1ZV5A 5HGGS 4X0KB 3U4BL 5I8CA 2CRZA 4RGNE 5KANI 5HTSA 5L8LB 3QDGA 1MI5E 3GSVA 1KJMB 3MRMA 1TIUA 3PQYD 3D85A 1I9RL 4P4RA 1JUFA 1FNSH 1S9WA 3TV3H 5D1ZC 4XZUB 1E0OB 1JNNH 4TOYH 2XQYK 2VZUA 4JDZA 3WD5L 1SBSH 2IH3A 4OQTA 5DA4A 4C56D 3P0YH 2QADD 4LCUA 4EN3A 2DQDL 3INUH 4XC1H 4NZTH 1CU4L 1LP9A 4DVBB 4OLWH 4OGAC 1X5JA 1CL7L 3CDCA 1N3NB 3U0WL 1YPZF 1BQHB 2QSVA 4UT6H 4K94C 3C5ZD 1MJJA 4NWTH 3VGHA 4F33A 4M6OL 4OIAA 4K2UL 1DN0A 4ODVH 3FO9A 4OLXH 2FJGA 5EO9B 1B0GA 1I75A 2NLJB 1KNOB 4GRWE 2AK4E 3CSBA 4U6YB 2V2TB 4E41D 3ZHKA 1MCRA 1U58A 2ZSVB 2VMFA 3BWAB 5F1SA 3NCJL 5D2LE 1FL3A 3NCCB 4JGJA 1EO7A 2AERT 3QEGH 2X7LA 3OGOE 2G9HB 3NVQA 2IJ0C 5GRXG 1HXMB 5DMIH 3SQOH 3E3QC 4XP5L 4JO2H 4DKDC 4S10A 5KSBB 4L3EB 4S2SB 1NKRA 3NCYS 4O58L 5DD5H 1XF3B 1TJIL 2HLAA 3AREB 1CZ8L 3SDDC 4HF5L 3VGFA 1F4WH 1DBKH 1JHLH 3RZCD 2B4CC 2PYEE 4OF7