2J1KA

Cav-2 fibre head in complex with car d1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
SLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COXSACKIEVIRUS AND ADENOVIRUS RECEPTOR
publication title Structural and Mutational Analysis of Human Ad37 and Canine Adenovirus 2 Fiber Heads in Complex with the D1 Domain of Coxsackie and Adenovirus Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Virus/receptor
total genus 25
structure length 117
sequence length 117
chains with identical sequence B, G, J, K, O, P, T, V, X, Y, Z
ec nomenclature
pdb deposition date 2006-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2j1kA00
3WHXB 1UZ8B 1PW3A 4NRXB 3VA2C 2EDWA 4HJGB 1EMTH 1T4KB 4F8TA 5T3XD 5ANMB 1QVOA 1MCNA 2IH3B 1NUGA 1N8ZB 2D9QB 1U8KB 4Z7QF 3GHEH 3RU8H 4WV1B 5KG9A 1JPGB 1CFVH 3AS1A 1S9YB 2GK0B 2HWZH 3GMQA 3QO1A 4FTVA 4G6JL 5IVOA 1IMHC 2NZIA 1H8NA 2F8OA 2LU7A 1NCBH 1TTGA 4MCZA 4DVRL 4JFYB 1BQHG 4KKLC 3HPLB 5FYLH 2VDOH 3PWNB 5C0DA 1DLHA 2PO6B 1YEDA 3MRCB 3U7WL 4J4PA 4LLMB 1DQQA 4OLXL 2APBA 2A73A 1OP5H 4UAOC 3NH7L 1Q0XH 3P4LA 5DJ0B 4KY1H 4ODTL 4ONFL 4EIZC 4PV9B 1AO7D 1W0WB 2B4CC 5D5ME 2F5AH 3DTXB 1BVLB 5EU6E 4HV8A 4PJIF 4XMKH 3SDXB 5I18L 1V5JA 3G5XA 1X5LA 2IBBA 3R0NA 1SEQL 2ZJSH 4RMQA 3PWPA 1CLZH 3HC4L 3V5HA 4LDLB 4POUB 4YR6B 4TOYL 3WDJA 4TSBH 1Q1JH 1AXSA 2YKLH 5GGUB 1XCQA 5MHSD 4AM0B 5C0BE 5DEGB 1MCDA 4LF3A 4NQDE 5DK2B 1ODAA 3ROLB 2MFNA 3VFNB 4RZCB 3A6BH 3CXDH 3FQTA 1I1YB 4Z77B 3T8XA 4R4BA 3OKMA 4PP1D 4HKXB 2DQUL 2YOCA 1AQDB 4S1DC 3KPLB 2FL5A 4LAQH 3AGVA 2F54A 4JRYB 4GG8A 4U1HB 5FOBA 1T04A 4RRPG 5ESQB 5I74C 5HHMB 1JNHB 1XGQA 2CIIA 1SJXA 1WZLA 1LO2L 5C09A 1Q72L 4MB4A 4B7IA 1CXIA 1HHJA 4PB9H 4ELKA 1YDPB 1Z2KA 2EYRB 4K8RC 5CBAB 4PJBF 3LZFL 4GSDL 4XB7A 2BC4A 2DLGA 2O26U 5AZ2L 1EO7A 4HUWB 3CD4A 3WEXB 2BRQA 1HEZA 3JWDL 3ZTNL 5IFAH 5KVFL 3QI9C 2FCBA 4NQSA 3PL6B 3T09A 1WBXB 3VXQA 4TULL 2HFFB 2ATKB 5DYOA 4K94L 2IAMC 3BVNA 1INQA 1MNUL 5TE4H 5ITFA 2PYFA 5L6YH 1T5WA 2XN9D 5DD1H 4PGCB 3GRWH 1GOGA 3CDGA 2MMXA 1KCLA 4FFYH 2NY2D 1TJGH 5L2JA 4WI2A 1QRNE 1T21A 1CXFA 1LNUB 1S7WB 3OF6D 5DUBA 2A6IA 3AM8C 2HVKA 4JFEE 5DJ8B 5HGAA 1HK6A 2YD8A 1KLGB 3DETC 1CD0A 3MLSL 4JE4B 5K9OA 3TN0A 5C0CD 4O2EB 3VD4A 5DVOA 1HINL 2YPLE 5A2KH 1KTKE 1CCZA 3T2QA 3MJ9L 3MRFA 3F7VB 2V7NB 4GBXC 4ZUVA 1OAYH 3S5LA 3BSZH 3B6SB 3UDWA 4X4MA 5DVLA 4HS6A 3I50H 4R3SA 3BP6B 1MCQA 4ZUWB 4KC3B 5FA3B 3BN3B 1HSBB 4MNQD 2MKWA 5K59F 2IBZX 3CXHJ 1SMAA 3C5ZC 4PJ8B 5T1KA 3O6KL 1GGYA 5F6HJ 5C0RL 1CWVA 2DLEA 4R26L 4YBHA 4YUEH 3KXFE 4ZOCA 5C6WH 3R06B 4K7FA 3DVGA 2J1KA 2DJ4A 4XMLL 1DANT 3S8WA 4NO5B 1FPTH 1QPPA 2P24A 3BWAA 2VLJA 1EHNA 5ETUB 5EC2B 5I30H 3SE4C 5CEXA 1RUQH 2DQEH 5AUMA 1R5IB 2YEZA 3ARDA 3QH3A 2O5ZL 4GW4B 1KENL 3ULUE 1XAUA 5EBWB 1AFVH 1IZJA 1V05A 2OTWB 2GT9B 3EYFA 3DHJA 1Q9KB 5TPWH 1VFOA 4M4RA 4Y5VA 3SJVA 1FIGH 5J6HA 2ZSVB 4YQXL 4XP6H 1U9KA 2XN9B 1CGWA 1EEYA 2K7PA 1ADQH 3BJ91 2W9LA 2XZQL 1G84A 4YX2L 3SE3A 4D94A 1KXQE 1T22A 4LSDA 5BJTB 4XAKD 5E7FA 3EDDA 3QHZH 5EN2B 5JA9A 2FR4A 1RZIA 3BN9D 1IKNA 4GRLD 1L0YA 4Y5YB 1EAJA 1U3HD 4Z7UF 3BE1H 4UINL 3VGAB 2YA2A 3O6LH 2RCSL 2VAAB 3PV6B 5C0CB 2WUBH 4LLUB 2ARWA 1R3HA 1ZS8A 4BQ9A 3VFRB 4DCQA 2PR4L 3BUYA 3REVB 2BDNL 4DKFL 3GMOA 3KLAB 3B8YA 5T1LA 2I9TB 4ESKA 4JZJA 4MDJA 2FH6A 4QCIA 5CZXD 3ARGC 4YK4B 2APTA 5E4EC 4FN0A 4U1KA 5AD0B 4Z95H 3QHFH 5TQ0H 2D7TH 4MJ2A 5J89A 3MO1A 2M2DA 5EPMB 2GSIA 1AC6A 1ZT7A 4ZAKD 4NKMA 5F6IB 2DBJA 4KVCH 5DJAA 1KNOA 2KBGA 1OL0A 5DDHA 4CDGC 4JO4H 3STLB 1CFSB 4MNQB 1MHHA 3A6CH 3AB0B 1EA9C 5JW5B 1DN0A 1K3ZA 2R8SL 3UTZB 2G60H 2APFA 1SY6L 1QO3A 3PGFL 2DIJA 4NO3A 3LKOA 5ENWB 1RUPH 2I07B 4MZ3A 3MODL 4E41D 2VDLL 3OGCB 3I6GA 4HXAL 1IRAY 2BVQA 2JCCA 3HKFA 4PLJC 5J1SC 3MBXH 3RDTC 2P5WE 4NCC1 1U8QA 1F4HA 3LQZB 1EVUA 3C8HA 3RZCC 3PJSA 3P9LA 1A9EA 3MREA 4PJGB 4O9HH 2QKIA 4BSJA 2DQHH 1OARH 3L7FA 3LKSA 3VFSB 4S1SL 2NY4D 3RVVD 1N6UA 4HZLB 4RBPK 4S10A 4J12A 3ULVD 3QRGH 1XCTB 1Z0NA 2VQTA 4JFHE 5KVGH 1XF4A 2X7LB 2FLBT 1Y6KR 4PJHE 3TC9A 5E2UL 4P4KA 3A67H 1X5GA 3U2SA 5GGQL 3PWPD 2LABA 4RMRA 1YEKH 2C5DC 4L3EA 1ADQA 3CGTA 3P4NA 4GRLB 4WW2B 5EB9A 1FAIH 1MWAB 1OB1B 1U3HB 1EFXA 3S96A 3FO2B 5TDNA 4WFGD 3EKCA 2X4SA 4RFOL 1WJ3A 1QZ1A 4TSAL 3U30C 1C08B 3LOWA 3INUL 2I25N 5ACMA 4CMMA 3C8KB 1MI5D 3MUGB 2EEAA 1YYLL 3F65A 3CVHL 5LJYH 4BYHA 4QRPA 3HPJB 1ZGLM 2F54D 4TRPH 2MPAH 1IEBB 4HUVB 5K9KB 2GQHA 3QDGA 3DGGA 4GG6F 3VGDA 2H1PH 2ZOKA 3MGOA 5BVPL 2FGWH 4JFDA 2C3XA 3GSWA 3NFSH 5MI0B 4Z8FH 1Z9LA 3UTSA 5HYJA 3L6FA 3BAEH 3D2UA 2VZTA 3T3MF 1B6DA 1FORL 5HVWA 5LG1A 4XNXH 2FSEB 4P3DA 1E27A 1K4DA 2EDBA 4H25A 3O9WC 3B2UD 4OV6F 4E41B 5E5UB 3HE7C 4QHLA 1P1ZB 4Q2ZA 1QFPA 1QVOB 3UZEA 5J13C 4ZYKA 5KW9L 3GI8L 3MLXH 5KG9B 1JNLH 2JJWA 3QO1B 3GMQB 4FTVB 4IOSD 3RWDA 4MVBC 3W82A 4DKEL 3F6LA 1K8DA 5IG7A 2NY4B 1KACB 4RCAA 1TPXB 2JJTA 2GYSA 5C0DB 3ROOA 1DLHB 2PUQT 1YEDB 3GM8A 1DQQB 2A73B 5DURD 4L8SC 1NMCC 4KRPC 4KKBC 1OSZA 4F15B 4HV8B 4UZGA 2AQ1A 3U48A 4KJWD 1IC7H 1WIUA 3G5XB 2R69H 1XGTA 3PWPB 2IF7A 3IKKA 5DC9B 3RUGA 4G7YH 3V5HB 3F12A 1A7PL 4J3SA 1V7NL 1AXSB 5CZVL 3AC0A 1XCQB 4RFNB 1DBJL 3FQXA 1WLHA 4LF3B 4IRSD 1OGTA 3VDBA 3BJLA 1WV7T 4U3CA 3UZVB 4NNXA 4L4TE 4PPTA 4UILL 2QHRL 3SKNA 3FQTB 3T8XB 5C0ND 5T1KD 4R4BB 3OKMB 3S4SG 2DM2A 1I9IH 3BH8A 4JKMA 1AHWA 1CD8A 2FL5B 3OAYK 2F54B 1BFVH 4GG8B 1MPAL 5FOBB 3RJQB 3NPSC 2NR6C 1WWBX 4JCMA 1RZJH 5J1TC 4YXLL 3S6CA 2CIIB 5IB5A 3LDBB 3RA7H 3ZE1E 5C09B 1VA9A 5KAQG 1HHJB 4ELKB 1TETL 4U1NB 4F8QA 5M7QA 2YN5A 2O5YH 4YE4H 3ARDD 4WI6A 1HEZB 1NAKH 3RWIA 1F00I 4NQSB 2D03H 3M45A 2H3NA 3VXQB 3CMOH 5DYOB 3BVNB 4R90H 1INQB 1CFQA 1Z0MA 4Y1AE 5ITFB 1P7QD 2PYFB 1NGQH 3WL9A 1N4XH 1T5WB 4CBPA 4HIIA 2NNAA 1J1XH 2HTKC 3ET9F 3CDGB 5L88L 1QSVA 1F4YH 1OP3H 3BW9A 3BD5A 3LN9A 3EFDL 1MQKL 2BP3A 1X44A 1MF2H 5J1AA 4ZD3L 4MD4A 1T21B 4QLRA 4OM1H 4MHHI 5DUBB 4UT9L 5EO0A 5B38A 1GPOL 2A6IB 4ZFOA 2HVKB 3M1BA 5HGAB 1FC2D 2VZ1A 4QRRE 4JPWL 2R4SH 3MBED 5EOCH 3TN0B 5K9OB 2AGJH 3NACL 1C16A 3G9VA 1LO3L 1MIEH 5KVEL 1KIQA 5EWIH 3MRFB 4G6MH 4WV1C 5FGBC 2YMXL 1JPST 4ZUVB 5ICXA 1UH3A 3S5LB 5DA4A 4XPBH 1I8KA 1HI6A 3VFUA 5IHLB 1A7OL 2SEBA 4PB0H 2B5IC 1JFQH 1X7QA 2A9MH 3QQNA 1T2XA 4RGMC 3QG6A 5EZOL 4HS6B 3RPKA 4GAYA 3WHE0 4R3SB 3EIFA 1VFUA 2Y5EA 2PW2A 1VENA 1WEJH 3QXUA 4J6RL 2AJUL 1KYOK 4JO1H 5T1KB 3WIHH 1BZ9A 2UY6A 3SDYL 2WP3O 4U2ZA 1PKQA 2I5YL 3B9AA 4N5ED 3TYFA 4AEEA 1NC4D 3VRIA 5JMOC 4K7FB 4ELMA 4YXHH 1MFBL 1PLGL 4LLYA 4YEEA 1TNMA 5FAAA 3BWAB 2VLJB 3QUML 5I73B 4UNTA 3NA9H 3LRGA 1MCJA 5KANI 1I85C 5DMGD 3NCEB 4RQQA 5CEXB 1NGWA 1T7VA 1XGYL 5AUMB 1XGUA 3ARDB 3QH3B 3EYVA 5IVZA 3MGTA 5FGCB 2AVGA 4IOFC 4YBLC 4L9LC 1WAAE 4LHJB 1G0DA 3ZL4H 3P11H 1KB5H 2AK4A 3EYFB 4Q58C 2Z35A 1A7BA 1Y6MR 4Y5VB 4OIAA 3SJVB 2YRPA 3UJJL 5J6HB 5DLMH 3ARVA 3VGHA 2HN7A 5CGYC 4XX1E 1EEYB 3IKCA 4DN4H 5IBLD 4XX1G 5FHBL 3PL6C 3BESR 2QR0A 4ONGL 2E9JA 4GUPA 1FO0A 1WQVT 1RZIB 1AE6H 4U1SA 3FOLA 3VCLA 3I6KA 2AKRA 4LSVH 5BO1L 1UJ3C 5T5FH 3HMWL 3QFJE 3FO0H 4Y19D 3ZKXC 1ZS8B 3BPLB 5H35A 2CJUH 4DCQB 3BUYB 4CNIA 3GMOB 4NN7B 5IKCA 5T1LB 3FOMA 2PXYA 2X4NB 4JZJB 4MDJB 4QCIB 4JM2F 3LEVH 4GOSA 3RBSA 4QRPD 3JTSA 4NN5B 4K9EH 4U1KB 2AW2A 3QDGD 4ZO7A 5DWUH 5MEPB 3U83A 1CBVH 1FHGA 3IAGC 3MO1B 1E4WH 1ITBB 4UOW1 2GSIB 4BJLA 1PG7W 1ZT7B 1NH6A 4NKMB 2Q3AA 2UWEA 3TBVB 2FX7H 4NM8L 1KEML 1CXKA 4OI7A 1S7XA 3L1OL 4OF7A 5DJAB 1KNOB 2BY1A 2D7OA 1A7QL 2H2PD 3BHBA 3AY4A 4F7TA 3UTSD 5HYJD 1MHHB 5DR5H 4BFGA 4H1LB 2WANA 4QTIH 1DN0B 3GMLA 4OFYA 2NY1D 3SY0A 5GQBA 1PGRB 4X0KA 1ZLUH 3SGDI 1QO3B 4NO3B 3LKOB 4PJDF 4FABH 3DSFH 4CJ0A 1NFDB 2YZ8A 4NOBA 3MRIA 5FKAA 4R2GD 4MXVE 3I6GB 4ZFGL 5JXAL 4Z5RA 5JW4N 2BVQB 4GMTL 1OTTD 1NEZA 1VB9A 4MJIE 4PJ8C 3BO8A 1TJIL 4WEUD 1MCKA 1U8QB 5F7HA 5BRZD 5IVXE 3T08A 1JPFA 3PJSB 1NGPH 3P9LB 3MREB 3DXAA 1T2QH 2QKIB 4PD4K 4L8DA 4OCNC 4H8WH 3L7FB 2H32H 3LKSB 1MRDL 1INEH 5J06A 2DLFH 1HZHL 1K8IA 1XF4B 2QSCH 4C59B 3SBWC 1P4IH 2ZZUT 2YSSA 4WHYG 3TA3C 4HD9A 1KB5A 3UCRA 5D72H 5D8JL 4P4KB 2FIKA 4DEPB 3H42L 4X83A 2BXZA 2P8PB 3U2SB 2IG2H 3CK0L 1BWWA 4G8GE 1KJ3H 5DUPH 4GKSA 4P2OA 2R4RH 4ZS7L 4R7NA 4HUXA 4PBXA 2IPKA 4L3EB 2XZCH 3TFKC 4OTXL 3TH4T 3Q6GL 3P4NB 2EXYC 3S96B 1EFXB 2MOVA 3MLWH 4PJ5D 5TDNB 4KGJA 2B8OT 2X4SB 5HVHB 1AP2A 4ZODA 3K0WA 3HMXH 4HLZG 1M6OA 4KKCC 5GS0D 3SQBA 4CMMB 5L0QB 4ZS6D 3D0VA 4PJFA 3ZDZF 4QRPB 3GBMH 1UM6H 2IAND 3QDGB 4XH2A 1CQYA 4RSVA 5J3HC 2N1KA 3DGGB 4LCWE 2VXVL 3QQ3A 3SQOL 2ZOKB 3MGOB 3SDAC 4JFDB 2X1PA 4M6NH 2V2WA 2VLRA 3BEVA 3MUZ1 1MFEH 3GSWB 1KN4L 3UROR 1VGKA 4H20L 4TUKL 5E03A 3H9YA 3L6FB 2PETA 4MSWA 4ZPVA 3T0VA 3UTSB 5HYJB 2VWEC 3LS4H 5KS9F 3CZFA 4X7DC 4OLYL 2NY1B 4OCYL 3E6FA 4RWHA 2CGRH 5C0AE 4P3DB 1E27B 1K4DB 4H25B 3QUYC 3QQ9D 1NGXB 1S7VA 4O58H 1NCAH 4QHLB 1L9MA 4FFVD 3TWCH 1JYNA 3BT2L 4Q2ZB 4PS4H 5LGHH 5T3ZH 1NKOA 1AGFA 4XPTH 4ZYKB 5BRZB 2JELH 5E1AA 1X5AA 4ORGA 2CIKA 1QNZH 3NN8A 1YMMD 3RWDB 4M43L 1K8DB 1HDMA 5IG7B 5EORL 4C4KT 3ALWA 1OAKH 4F9PC 1IGMH 1IEHA 5GJSH 1FE8H 4K7PL 3W2DL 5DD3H 4P5TD 3X3GH 4EEEA 4M7ZB 4HC1L 1HE7A 2BFVH 5C9JA 3F8UB 1OSZB 5D7KE 4LBEA 3W9EA 1CD9B 2CH8A 2JJUA 1P69B 1W72B 3TJEL 5MP6H 2Y06L 1XGTB 1T2JA 2VLKA 3RUGB 1BQSA 4GQ9H 4H0GA 3F12B 3T0EA 1B9ZA 5E0QA 3CFBB 2EDJA 3TZVA 4KAQH 5HHOA 3FQXB 4LHUA 5D7IF 1E6OH 3RIAF 1NCWH 5ABDE 3H3BC 1OGTB 4PJ7E 4MA7H 5HHXL 4NNXB 4NZDA 3GJFH 3BDYH 3SKNB 4FQ2H 3KDMA 2YD4A 1EUTA 4M00A 1TQBB 4XPFL 3BH8B 3O6MH 1WBYA 1AHWB 4CN6A 1GGUA 2KUTA 4WW2C 1U6AH 4LLDA 4PRAA 4U6VH 3LS5L 1C5CH 4KV5F 3N9GH 1YNKH 3IJHA 2YWYA 4KTYA 5IB5B 1JJUA 1UC6A 3OAUH 5D1QA 2GTWA 5CEZD 5KSBA 5C2BL 1NLDH 1XIWA 1NL0H 1DR9A 3CC5A 4YHZH 1D5XA 1N26A 1BP3B 1QRNA 1U8OA 3RWIB 4FP8H 4K3JH 3IFLH 2H3NB 3FZUD 1MJUL 2X9XA 5EA0H 4KHTH 1CFQB 1P2CA 1G9ML 4MQ7B 3UBXI 2F9BT 2J7LA 4D2NA 5MI0C 1F13A 2CPCA 1OAQL 4ZSOA 3WL9B 3HAEH 4HIIB 2NNAB 4S0TD 2E6JA 1KIPA 1LMKA 1G9NC 3QCTL 5SWZD 3BW9B 5J1AB 5DJ6A 4MD4B 5FHAL 5GS3A 4XI5D 5EO0B 2NY6D 5B38B 1JWSB 3UBXA 4ZFOB 3M1BB 4X4YA 3P3YA 2IMMA 4HIXH 5JW4R 3ZDXE 1C16B 2E5EA 5IQ9A 4P2RE 3RU8L 3U46A 2EC9U 1KIQB 1CFVL 2HWZL 4O02L 5ICXB 2E27H 1JK8A 2PXYD 1BF2A 5IQ7H 1AR2A 1NCBL 1I8KB 3RI5K 5H94B 1HI6B 3LD8C 3OPZH 1TJHH 2VDOL 5F96H 5FYLL 5LCVH 3VFUB 4NWUH 5AZEH 2SEBB 1TPXC 3T3PE 1Q0XL 1X7QB 2YUVA 4FQXA 4HEPG 4ZUTA 1FIEA 4J4PC 3QG6B 3BP5A 2F5AL 1ZV5A 5C08A 5B39B 2YPVL 4GAYB 3ARTA 5D2LE 2CSPA 4RFEA 4F15C 1Y0LA 2E9WA 1XF1A 2PW2B 2ZJSL 3D3VE 1CLZL 1NDMA 1T0NA 2XFXA 1BZ9B 4F7PA 1JCKA 1JWUB 4WFED 1EJ6A 1PKQB 1F2XK 3TYFB 3GJFA 3VRIB 4U3HA 4X6DE 1J0IA 4ELMB 4HBCL 1EHXA 4LLYB 4TVPL 3L5WB 4UNUA 5IROA 3A6BL 3CXDL 3EOBA 5FECA 2CO7B 4LCUA 1ZEAH 4OD2A 1BJ8A 2CR3A 4D0DA 1LILA 4RQQB 4LAQL 4PJEE 1NGWB 1JZ6A 4YFLI 2A74B 1F4AA 4HW6A 1G0XA 1XGUB 5ALBH 4FG6C 1JF6A 5IVZB 3G6AA 3OGOE 3ZHKA 5CD3A 3R4DA 3OKKA 5TF1H 1EZVY 2NZ9D 1Y18A 2R0LL 4PB9L 3OWEA 1V7ML 4KJPD 2AK4B 4NNPH 2Z35B 4MS8C 5E8NA 3QCVH 4XP5H 3MOAH 3MNWA 3O4LA 2FO1A 2Y36H 2XIDA 4Y4KA 2HN7B 4HKZA 3IKCB 4AQ1B 3MV7E 3H7LA 4I4WA 4LEXH 1KSRA 5DZNA 1JPSH 2QR0B 35C8H 4GUPB 1A6AA 4P2OD 1FO0B 5TE4L 4U1SB 2AXGA 5L6YL 3VCLB 3I6KB 5DD1L 2AKRB 3QZWG 4Z7WE 2VL5A 3GRWL 2AS5M 1MRCH 1EO5A 4LIQH 4FFYL 3QJFB 3W81A 1I1AD 1L7TH 2XPGA 2FX9H 4CNIB 5IKCB 3FOMB 2PXYB 1FBIL 4XWOD 3WUWB 2EKJA 5FYJU 5C0FA 3JTSB 5HSFA 3BRDA 3T1FA 1OAZL 3RX7A 5BS0D 3TN0C 2FJFA 4AEHL 4PRPD 5F7DA 2ESVA 5F7WC 1OAYL 5JZ7C 1JV5A 2NY0D 3AXLA 3BSZL 5FB8A 3C2AL 4OGYH 2UWEB 2VLRD 1KYOJ 4YDLC 1S7XB 3RNQA 4OJFH 2C3GA 2EIBA 3BHBB 4F7TB 1CDBA 3ZT6A 1RI8A 1RU9L 1YECH 3SY0B 3I50L 3KG5A 3UDWC 4PGBA 4X0KB 5KAQF 4JVWA 2PTTA 2NCMA 3DMMA 3MRIB 4YHOH 5C07E 2VR4A 4X4XA 2GFBA 2OL3H 3NABH 4Z5RB 4MAYA 3TBYA 5JOPD 3BO8B 4F3FA 4YUEL 4U31A 4CUCA 1ZA6A 4KQ3H 3HNTH 5EU6D 1JPFB 4G9DA 1LK3L 3PQYE 1KPRA 2PNDA 3CVIH 4L8DB 3PWLA 2X4RA 1FPTL 5JXEA 2DB8A 3HTLX 3ZYOA 1F02I 2YK1H 2Y9RT 1U93A 3O3AA 1EIBA 4F37F 3LB6D 2XQYG 1K8IB 4DGIH 1RUQL 3TT1H 2DQEL 2EDDA 1Q38A 4N68A 1DVFA 2A2QT 5C0BD 4XP4L 1AR1D 5BZDA 3MMEA 2YSSB 2NXYD 5EIIA 1QR1A 4JN2B 1KB5B 2F8VA 4HH9A 1N7MH 4ETQA 1AFVL 2AEQH 1IC1A 5FYKE 2FIKB 1UH4A 1FRGH 1M1SA 4GAJH 2VLME 2VLKD 3SDDD 1WFTA 1RIHH 4GKSB 1DANU 4P2OB 4NGHH 1FIGL 3VXOA 5DD5L 4R7NB 2AABL 4DKAA 4HUXB 3T0ED 2IPKB 1KN2H 4XP6L 1I3RB 4LHUD 1AP2B 2BHUA 4CMHB 3MV01 4WHTA 4G7VH 5ISZE 2VQ1A 5DI8A 1M6OB 32C2A 3QHZL 2BSRA 3FKUS 1HH6A 5L8JB 3BE1L 3D0VB 5DC0A 3JXAA 3O6LL 4Q0XL 3VRLE 5I1IL 4KZEH 2WUBL 1G7LA 4DZ8B 4XH2B 4OIBA 4M1DH 4JY5H 1B88A 3WXVH 4N8VG 5D1QD 4IHOA 4NN7C 3AMLA 2V2WB 2VLRB 1FL5B 3BEVB 3MUY1 3WD5L 4JANA 2BZDA 5DHYA 4CKVX 4D9QD 2UVEA 1VGKB 3QHFL 4ZPVB 2D7TL 4MSWB 5TQ0L 3IU3A 4YDKL 3VD3A 3CZFB 4LVNB 1QRND 5DFVC 3HCVA 1A7RH 3PDOA 4HDIA 2DKMA 4OGXH 2LVEA 5E8EA 3GJFK 3LQAL 4Q74A 1QHPA 3V6OA 1YJDH 4QGTA 3E6FB 2GJ6E 4JFED 4KVCL 3EZ8A 4JO4L 2ICEA 4PJXA 1FJ1A 4LPCA 5KSUA 1LDSA 1S7VB 2DYPA 4WJ5A 1QKZH 1LEIA 2G60L 5DJXA 2DMKA 4NBZB 2EEBA 1AGFB 4PD4J 1K3IA 4P5KA 5E1AB 1T7WA 4WO4D 2OL3A 4LMQE 4ORGB 3GDBA 2DF3A 2CIKB 3ZTJG 2MTPA 3NN8B 2RHEA 1V3LA 1HDMB 2QQNH 3MBXL 3OXSA 5AEAA 4FRWA 4UU9A 3DJ9A 1D9KC 2WQ8A 1MRFH 5C9JB 3QEUA 1M7XA 2DQHL 5C70A 4AENA 3W9EB 1KPUA 1Q8MA 4NO0A 3THML 4PJIA 2A1WH 3IAPA 4R0LA 1CVSC 1WWCA 3QRGL 4XBGA 2AP2A 4KTDH 4OF8A 1S7UA 3KXFD 2VLKB 1RUMH 2DQDL 4FQXD 1FGNH 1Q9OA 3PG2A 3T0EB 3O3DA 5C08D 4PLKD 5E1HB 5HHOB 4LHUB 3IB4A 1D3CA 2Z31A 1FN4A 1U42A 4XMPL 3A67L 2L4OA 4P4KC 2UUDK 4DEPC 3KDMB 4P2QA 1YEKL 1WC7A 4MA3A 3NFNA 4XCEA 1CGYA 3LPWA 1FAIL 3IFPA 1UWGL 1WBYB 5J12B 4AIZA 4LLDB 4PRAB 3GKWH 2EXWD 2W65A 3IJHB 2YD9A 4HF5H 2P48B 4MNHA 1MCHA 1CT8A 5E2VL 5CMAA 2QADD 2ZUXA 3DHMA 5D1QB 4Y1AA 2GTWB 3VXMA 3I3DA 4ZO9A 4LVHB 5KSBB 1OHQA 4MJ4A 1JGUH 2MPAL 3AVEA 4NT6A 5A16A 4NRZA 4PJBA 2XACC 3CC5B 1QRNB 5EUOF 3KYOA 2DJSA 2H1PL 4J3TA 5C7XH 2H8PB 4Z76A 1F90H 3NFSL 3R1GH 4Z8FL 4K2UH 3MRDA 1P2CB 5E5MA 3OR7A 1FLRL 1HYRC 3ARRA 1HXMA 3QWQB 5GGVH 4Y4KD 4ZSOB 3BAEL 2OBGA 3ZE0E 5IVXF 4WNQA 3RWCA 5I1GH 3VXSE 3G6JF 4YHKH 1KIPB 3UXFA 4JAMA 5JO5A 4FQLH 4XNXL 4OZHE 4JPKH 3IS1X 3KNBA 1IJ9A 5DJ6B 1ZXQA 1T03L 2VXUL 2CRYA 1F3RB 1PQZA 3C5JB 3UBXB 4NRYA 3V6ZA 4X4YB 2D9CA 3ZKMC 2ID5A 2W91A 5IQ9B 4TUOA 4I0PA 3RFZC 3U46B 3S37H 3MLXL 1JNLL 1FVDA 4AEIH 2B39A 5E6IC 2HFGH 1JK8B 1UACL 2EE6A 3UAJD 2ZSWA 5DD0L 3WN5A 4ZTOH 1U0QA 5EZJA 1AIFA 3NZHL 1FDLL 2JJTC 1R5VA 4ZUTB 4FQXB 4GKNA 5E6ZA 5F9WB 3BP5B 5C08B 2X4TA 1IC7L 3V7AE 4RFEB 4UTAH 1Y0LB 5INDA 4S1RL 3V7AG 2MQ3A 2DTMH 1NDMB 4G7YL 2J8OA 3OG6B 2XFXB 2AEIT 4F7PB 3E8UH 1WCQA 4OGZA 4RMUA 5BXFA 5GS0H 1VSCA 2LE9A 1LP9E 3GJFB 4QOKA 2CRZA 2Z8VC 3K8KA 4LFHD 3WFZA 4KDWA 5FECB 2OMBA 3EOBB 2QADB 4GO6B 5BOZG 1PBYA 2EEDA 4LCUB 1UYWL 1I9IL 3QIUA 4OD2B 1L6XA 1PG7H 1G1YA 4D0DB 1RD6A 2HLFC 4CN1A 1AHWC 1CXLA 5JIIA 4OZGF 1CL7H 5DXWA 3TO4A 1BJMA 3CUPA 1RZJL 4ZXBA 2NTSP 5CD3B 3OKKB 1XF2A 3RNKA 3AROA 5JXED 3T2PA 2EDRA 1GGTA 3GM0A 4K3HA 4OV5A 2HTLD 2V5MA 4N90E 2O5YL 5E8NB 3DSNA 1MHPL 3O4LB 1BD2A 3MNWB 3WO3B 3MLYL 3MXWL 4Y4KB 1BVKA 1J1PH 3JZ7A 1N0XH 1NAKL 2GW5A 4HKZB 4XB8A 5ELIA 3RVWC 4YFEA 3FFCE 2F15A 5DT1H 2Q87A 4U0RB 4I4WB 3EO9H 3D6GA 4LPYA 4R90L 5CJ5A 5CBEA 1A6AB 2NY5H 4CVUA 1E4XL 2MCPH 4HK3J 2AXGB 1NGQL 1N4XL 1BECA 2VL5B 1J1XL 4Z7UA 4X8XA 1F4YL 2KZWA 2AV1A 4IS6A 2WWKT 3S36X 1MF2L 3GSUA 4U6TA 2QV2A 2XPGB 4OM1L 1L6ZA 1BFOA 3O8XD 4K23H 4U0QB 5C0FB 3KLDA 5EOCL 2AGJL 3T1FB 1MIEL 4FXKA 1G6RH 2FJFB 2NPLX 5ANME 1Z5LA 4G6ML 4OM0H 1R5WA 5F7DB 2ESVB 4NFCA 5IWLA 3AXLB 5FB8B 5K9QG 1JMZA 4TPRL 4XPBL 1S3KH 4YZFE 3RNQB 4PB0L 4ZNEE 1UB6A 1JFQL 5I0ZA 4PRDA 5BV7H 2CUHA 5AWNH 3EW3B 4P9HH 5IW6B 2V5SA 2P1YA 5GRVL 4PGBB 2VNCA 3EGSA 5JUEH 5J56B 3SDXE 2HKFH 2PTTB 4Y89A 1WEJL 2J8UF 5M95B 1XR9A 1H9VA 4FMFA 4HKBA 4NDMA 4JO1L 4X4XB 2GFBB 4RGNC 3WIHL 1GGIL 4MAYB 1CL7I 3TBYB 4H26A 4NKQB 4F3FB 2CD0A 5D2NC 5TE6H 1ZA6B 3DV4A 3TH2T 1NCTA 4G9DB 5IVNA 1F58H 1KPRB 3NOIA 3LQMA 3I75A 2X4RB 4JQIH 4MNGA 3EJYC 3O3AB 1U93B 1QD0A 3P73A 3MA7A 4L8BA 4KMLB 4WFFE 1X9QA 4P23A 2A0LC 4QGYA 4EUPA 1DVFB 3RIFF 1RZJC 5DFWH 3U9UA 5BZDB 3MMEB 4L4TD 4JRYE 5EIIB 1QR1B 3LPGA 3SGKA 4F57H 4HH9B 4ETQB 4NO0D 5HHME 4OFKA 2W9EH 5F7YC 4QTHA 1BWMA 4RMTA 4QXGH 3TVMC 1DE4A 1J5OL 3SOBL 2C3WA 4J23A 2WUCL 3VXOB 1EVTC 5JLZA 3CH1A 1QSZA 5E70A 2VZOA 2FNBA 4DN4L 2HJFA 4HWBA 2Z31D 2W9DH 4PBWD 4J1UA 1UA6H 3NAAH 4WHTB 4G6KH 5DI8B 32C2B 4MJ5A 2BSRB 4P2QD 1AE6L 4EI6A 5T3XL 3RVTC 1HH6B 4MCYA 4M5YH 4F2MB 4LSVL 2L7UA 2FBOJ 5T5FL 3DUSA 3U6RB 5A40E 4QWWD 2GKIA 1G7LB 3FO0L 2Y5TA 2V7HA 2CJUL 4GG6A 4G6FD 3QPQC 3NCMA 4Y1AD 2R15A 1SBBA 4IHOB 1RVFL 1MCSA 1NAMA 3OL2A 3C8DA 4JANB 5ID1B 4K9EL 1JNNH 5EIVA 5HXMA 2EDEA 1VERA 5DWUL 3IU3B 5GS2D 1CBVL 5SX4H 4ERSH 1T66C 1E4WL 5C0JA 3HCVB 3PDOB 1OAUH 4HDIB 5E8EB 1UQSA 2FX7L 3JWOL 1A14H 2ICEB 4PJXB 1FJ1B 2PYEA 3AREA 5KSUB 4QTIL 3EYQD 2DYPB 3AY4C 4WJ5B 3RY5A 1B4RA 1LEIB 2JJSC 2JK5A 5DJXB 2R1XA 2CKBL 5F3BA 4KROC 1B0GA 5MHSE 4FABL 4P5KB 2OL3B 4PJ9A 2CR6A 2YA1A 3NTCH 1OPGH 1G7MA 4AZ8A 4PRBA 3OXRA 1NBQA 3B9KA 3CSYA 3BP4B 3BD4A 1AGBA 3EOTH 3OXSB 3L5HA 3DO3A 1OD7A 5GRWA 4UU9B 2GJZA 5HHNA 3N1QC 4P2YA 3UZQA 1NGPL 2CUMA 2D4DA 1T2QL 5E00A 3QEUB 2KKQA 1MFCL 4AENB 1CICA 1KPUB 4NO0B 2DLFL 4PJIB 3QEQA 4R0LB 1KJ2H 3BPOB 4XBGB 5IMMA 3PHOA 1S7UB 4EXKA 4NJ9L 2QSCL 4GRWH 1Q9OB 5F9OH 2RBLA 3RRQA 4OCRH 2BCKA 3ZLQC 3O3DB 1KJMA 3ETBF 1F8TL 1JYWA 2Z31B 1FN4B 1FZKA 4WCYL 2DMCA 2Y4SA 1KXTB 3MLZL 4P2QB 2J12B 1WC7B 4MA3B 3NFNB 2XZCL 1FNLA 4XCEB 1O0VA 3KYNA 1TCRA 2J8HA 3IFPB 1I1RA 1R3LA 4AIZB 4QOKD 2XN9E 1S78D 1VGEH 2W65B 1CU4H 1JF5A 1UWEH 4MNHB 1CT8B 5CMAB 2H9GB 4Y1AB 1LDPH 3VXMB 5SX4I 3D9AH 3U7YH 4NT6B 3GBML 5A16B 3OG4B 1UM6L 4NRZB 4PJBB 4AL8H 2NY7H 3TO4D 4ZXBD 4KTEH 12E8L 3KYOB 4TNWK 3TJHC 1DEDA 2WK2A 1YY9D 3MJ6A 5E7BA 4GW5A 4FZEH 4Z76B 5C86A 4M6NL 4XNMA 1MFEL 1U91B 4RMSA 3MRDB 1MCPL 5E5MB 3OR7B 1A1OA 4D9RD 5HHPA 1HXMB 3QFJD 3RGHA 1R3KA 2MCG1 3LS4L 3OAZK 2P4AB 2VWEE 1X5HA 3CSGA 4WNQB 3RWCB 4J3VA 5TFSH 5INCA 4JAMB 1KTRL 1QSEA 5JO5B 3ARSA 3KNBB 4KK8C 4M7KL 43C9A 4OZIF 3MA9H 2AEPL 4AMKH 1AGDA 3X13A 1PQZB 1ZOXA 1ORSB 4O58L 3TYGH 4DVRH 4NRYB 3TWCL 3V6ZB 3T4YA 4MNQE 4PS4L 5LGHL 3U7WH 5T3ZL 2IQ9H 4GKOA 3RGVD 2FIRT 4PP1C 1F97A 4TUOB 4I0PB 2YS4A 3D5OF 1FVDB 1N0LA 1QNZL 3CLFL 5I9QB 4JREB 1RIUL 3WSQH 2ZSWB 3WN5B 1IGML 6FABL 5GJSL 5EZJB 1AIFB 1R5VB 3X3GL 4GKNB 2BFVL 4H8WC 2X4TB 4HT1H 1KJ2A 4PJGE 5MP6L 1YEIL 3VI4F 4I13B 4TNVF 5INDB 2P44B 2B2XL 2FEDD 3I3BA 2DQUH 1EXUA 4OT1H 4GQ9L 5I2IB 1JZ8A 1LE9A 5E8OA 1CQKA 4KAQL 2AK1L 5B3JE 5BXFB 3WFHA 4KK5D 4QOKB 3TZVC 4NHCH 2DKUA 4MA7L 3DWTA 5DQ9A 1MWAL 4OSUL 3BDYL 3QNZA 4PJAA 1LO2H 5B3NA 4FQ2L 1CDCA 4Z7OE 2NY2C 4XAKE 1XMWA 3QIUB 4JHAL 3LZFH 5E9DA 5J9PA 1U6AL 4U6VL 1B4JL 1I8MA 1U3JA 4U05A 4QT5A 3TO4B 3CUPB 4JVPA 1YNKL 4ZXBB 1VEPA 4POZD 3ZTNH 5KVFH 1TLKA 1NCUA 1XF2B 2IAMA 4KXZH 3RNKB 1EZVX 1OAXH 2FYYB 3OAUL 5FEBA 4L4JA 5C0GA 1VKXA 4LSQH 1MNUH 2NYYC 2BOCA 2XQBL 4OV5B 1NLDL 5EZLA 4I3SL 2Q1EA 3MNVA 3LHPL 1RK1A 3G04A 3X14A 1XIWC 1BVKB 2YUXA 4KU1A 2OQJA 3V5KA 1CLCA 3RKDD 3WBDA 1KTLB 4K3JL 4OF5A 2Y6SD 1RURH 3AM8A 5CBEB 1BQHA 3WUZA 3GMMA 1N5AA 3ARBC 2HT4C 2OS7A 1QLEH 1RK0A 3EYUH 3B8SA 6CGTA 3GFUA 1BJ1J 1HINH 4ONOA 2AV1B 4HBQA 4IS6B 3GSUB 1CG9A 3W11C 2Q8AL 1IM3A 2FECL 3NIGF 4DGYL 5LBSH 1BFOB 5FDWA 4E41E 4ETYA 4JM2A 3VXRA 1BX2A 5DQDL 1MELA 4Q6YA 4FXKB 1MAJA 5GZND 5C0AD 1HCVA 2FRGP 3ULVL 1R5WB 2WBJC 4OZFA 1GXEA 4FXGA 3QDJA 4FTVE 4LSSH 5F96L 1TJHL 3OPZL 1XGPA 5LCVL 4NWUL 4EN3C 1MCCA 1UB6B 4PRDB 1G7IA 2YRZA 4H0HB 5TGBA 4R26H 2NY3D 2QLVB 3WFDL 1H3XA 1U36A 4RMVA 2MWCA 3P40A 3EGSB 4XMLH 4Y4HC 1GJIA 1IC5L 1PSKH 3IETA 2LAAA 4KKNA 4PJDA 3ARED 1MCFA 4QHKI 1XR9B 3SE4A 4HKBB 4NDMB 3ULUH 4WEBL 3ARFC 3PWPE 4D0BA 2PCPA 2XG4A 2DM3A 1PVHA 1URLA 4EKXA 4H26B 2VAJA 5EUKA 4Y7MA 1GOFA 3DV4B 4KXZI 5D7KD 5DTFA 3RVUC 2YPKA 5GRYA 1I1FA 5IBUB 2O5ZH 1XH3A 2COQA 4KDTC 4M3KB 3GEWB 3I75B 4MNGB 5IROC 2VC2L 1QBAA 3P73B 3MA7B 4L8BB 1TXKA 3BP7A 4EUPB 5ALBL 1Q0YH 2F54E 5CJQL 3U9UB 2X4UA 2H2SC 5TF1L 2EE2A 5IOPA 4QTHB 4NNPL 2E9BA 1DE4B 4Y4FC 5C09E 4QHMA 3QCVL 3VXNA 5JLZB 3MOAL 3CH1B 3QUZA 4X9IA 3OB0H 2RCSH 2D7MA 2HJFB 2MQCA 4DN3H 3V0AC 4JJHA 4PGJA 4LEXL 4J1UB 1I3GH 3UEZA 35C8L 5JDJA 4MJ5B 4O51A 2Y07L 3QCUL 5HBBA 4EI6B 3ARGA 1HN1A 4MCYB 4Q9QH 5HGGS 3DUSB 4YHNA 2FB4L 3MJ9A 3QUKA 4LIQL 2XT1B 3BIBX 4PRHA 2Y5TB 2V7HB 4NBYB 4MLIA 1R3IL 1FZOA 3DX9A 1NJ9A 2FX9L 4OZ4A 3Q2CA 4GG6B 4PY8I 2JE8A 4UIMA 3W5MA 3DOSA 1NAMB 3S97C 2OYPA 1RSFA 1LGVA 5D1ZA 3RVVC 5AG8A 4P59H 3U82B 4Y5XC 5C0JB 2X40A 5KS9A 4JJ5A 3CU1A 5AYQA 1EGJH 1JUFA 1UQSB 4OGYL 1P84K 3HC3H 1JZ3A 1UXSA 1KBGL 5I76A 4RX4D 2PYEB 3AREB 3RDTA 2OZ4H 1PD6A 3WKMH 1A1MA 4P2RD 3MCLL 1YECL 5CSBA 3SDCC 2JK5B 2R1XB 3WFBH 3IXTA 4X4ME 3EHBC 1QSED 3ME0A 3OHXA 1LEKA 5CIPA 5F3BB 5I1LA 1B0GB 2VLLA 3FONA 2QSTA 4KKLD 4YHOL 1IM9D 4B7LA 3DMMC 3FT4A 3NABL 1GZPA 3OXRB 4PRBB 4YH6A 3CSYB 1YPZF 1AGBB 1UKQA 4MAYC 3ESUF 4KQ3L 3HNTL 2GJZB 5HHNB 4M7LL 1PZ5A 2R39A 4PRIA 5EIQA 2OR9L 3WDIA 5E00B 3D3VD 5A43C 2R1WA 5ADPL 3V7MA 4NUGL 4EQ3A 3I9GH 4Y2DC 4I8DA 3QEQB 5GGQH 1KULA 2VLJE 5IMMB 3TT1L 4LCIL 3SO3B 4QRTA 1RV6X 4YHLL 3FT3A 4LLVA 2BCKB 1DVFC 1QR4A 5JIHA 2EO9A 3VI3F 2L0DA 1T7XA 3B9EA 1F3DJ 1KJMB 5I66A 4TSAH 2AEQL 1FZKB 1X5FA 5D7IA 2R0WL 1FRGL 1X5JA 2HLAA 4S1DD 3HUJF 1RIHL 3R0MA 5SX5K 2BVEA 1KN2L 4B53A 3KYNB 1TCRB 3H3PL 3SJVE 2C1PA 1EAPB 2KH2B 1R3LB 1EEUA 2FLRT 2EE3A 4G7VL 3WXWH 2BVPA 3RX8A 5CHNA 4K8RD 3OB8A 5DA0B 4BFEA 2NW3A 4R4FH 4LSTH 3Q5OA 4EDWH 1SEBA 2XTJC 3K1DA 4M1CC 3PWUA 4KZEL 4J2XA 3QI9D 3MV7D 3GMRA 1U58A 3MRPA 3TBSA 4JY5L 4I9WE 2IAMD 4M02A 3O9WA 3NBNA 1VFMA 4XVUC 4XNMB 4K71C 3F7QA 3HB3C 4JRXA 3VFOA 3GSRA 1A6ZA 1A1OB 4X8JA 5HHPB 1R3KB 1SY6A 2ERJC 4OLUH 1X5ZA 4PJCE 1B0RA 1A7RL 4HS8H 3TBTA 4OGXL 5HDBE 1YJDL 5KW9H 5INCB 1QSEB 3BMWA 3QAZC 3P4MA 43C9B 2G2RA 2R56H 5SV4A 5CUSL 3DETD 4DKEH 2BY2A 1AGDB 3X13B 1Z9MA 3EYSH 3DYPA 1T7YA 3KAAA 4IMLA 1QKZL 1TTFA 3T4YB 4XGZA 4GBXD 2P8MA 4H1LG 5D2LB 4X7SL 2P7TA 1DBAL 5DK0A 2QQNL 5I75B 5HGDA 4N0CC 3BGFC 3ILQC 3PHQA 2JCCE 2MNUA 1V7NH 4OCMC 5FXCH 5CZVH 4X6DB 2R0KL 5C07D 3LCYA 3KS0J 4N8CH 3C5ZD 3D39A 3EFFA 5DJYA 2QHRH 3V8CA 4KTDL 4YBQC 4R0LC 3RWEA 5ITBH 1EXUB 4XNQA 1FGNL 4JHZA 1CGUA 5E8OB 1LE9B 1A0QH 1REIA 1UWXH 3WFHB 3LKQA 5IM7B 3EJJX 3PV7A 5DQ9B 4YXLH 2YZ1A 3CVHA 3L3GA 4PTTA 3QNZB 4PJAB 4M03A 1GYAA 2W60A 4C55A 1OLLA 5E9DB 4L3EE 5J9PB 4AY0A 4F58H 3QUXC 4WW1A 3GKWL 4Z78A 5I1DB 1I8MB 3JV5A 3MV7B 2C1OA 4QT5B 5FYKD 4HF5L 4OKDA 5CJXC 2IAMB 1T1ZA 1UGNA 1VPOH 2VLMD 3BISA 3RAJH 5C0GB 2EZ0D 1WZMA 3O2VH 3FL7A 2BOCB 2E7LC 1JGUL 5EZLB 3VXPA 2C4FT 3MNVB 3VGBA 2ARJQ 1RK1B 4A2MA 3G04B 4OUUA 3X14B 5ISZD 3QRFM 3SEPA 5L88H 2OQJB 3V5KB 5C7XL 1AXIB 1CGSH 4K55A 4G8IA 3EFDH 1MQKH 4NC1C 5H37G 3NCYP 4Z18A 1MCWM 1UEMA 3R1GL 5J6GA 3MQIA 1QSFA 3UP1A 1BQHB 4UT9H 4BFBD 5CLWA 3LEXA 3GMMB 1GPOH 1N5AB 4JFDE 1CDJA 5F88A 2ILLA 4UT7L 4GAFB 4JPWH 3UTSE 1LO5A 5HYJE 3HE6C 4YHKL 3KLSA 1YJDC 4GBXB 4FQLL 4JPKL 5KVEH 5DEZA 5GHWH 2YMXH 2FGZA 1FGVH 3ARGD 5EULV 5F3HA 2VN4A 1IM3B 4NQCA 5T5NF 5IJKA 5FDWB 4JM2B 3VXRB 1D5MA 3RZWA 4LSPH 4NKIL 2VDMH 3K2MC 1EPFA 5EZOH 3S37L 5E2WH 2GJ6D 3FQRA 3K74B 4AEIL 4I0PC 1B90A 2HFGL 4OZFB 1RQ5A 5IV2A 4NQVA 4FXGB 4XC1L 4JEGB 3QDJB 4ZDHA 5I9QC 4JREC 3RIAK 1CK0H 2CUIA 1XGPB 4ZTOL 4LQ1A 2AJUH 2WSKA 2HFTA 3SDYH 1G7IB 1W72L 4NN6B 5TGBB 2G5BA 1K6QH 3O6FA 2P49B 2N7BA 4Z0XB 1JE6A 4MD5A 1X3DA 1XFPA 3VWJD 3X17A 4UTAL 2ADGA 4PLJD 1U41A 4AH2A 3IETB 4PJDB 2DTML 3RDTD 3ARYA 3PE9A 3N06B 3QUMH 1HNGA 1IC4H 2E6PA 3RZCD 4D0BB 1TVBA 2PCPB 3RUGE 4XCCL 5EUKB 5GS0L 1TCMA 4XZUA 2IMNA 4M62H 3O3EA 5DTFB 1RULL 2YD7A 1BM3H 3B4NA 4L9LA 2C4XA 1I1FB 4JKPH 1XH3B 1UCTA 3PIQA 2BNUA 1S5IL 4JDZA 2XYCA 4HWUA 5D7JA 4X6CF 1PG7L 5E2TH 2EICA 3KYAA 4BM7A 5E8DH 3QIUC 4QRUA 3U4BH 3BP7B 2EDOA 1CL7L 2BOBA 1CFTA 5F8QC 1A3QA 2X4UB 5ISZB 3SE9H 1E28A 4NJAH 1UZ6F 2GSGA 4KUCD 5IOPB 5D1XC 4KI5C 5D71H 2R1YA 1ZK9A 5HD8C 3L7EA 2X44D 3HRPA 3QT2A 2RQ8A 1EFQA 1UJ3A 2ADFH 4QHMB 4LVOC 3VXNB 3NGBB 3QUZB 3QIBD 4P46A 5BO1H 3HMWH 1VFBB 1FVCA 3TLRA 3EO9L 1BZQK 5I6XC 1ZLWH 3IYLW 2HT3C 4ZMAT 1MCBA 4O51B 4MQSB 3CSPA 3D85D 3ARGB 2VDNH 5E4EB 5GISL 5FM5M 1TFHA 4OD3H 4TTDC 5C0EA 4YHNB 1JRHH 3QUKB 4PRHB 3DROA 3SCMC 4D9LH 3PXHA 1A9BB 1FZOB 3DX9B 4OZ4B 4YFDB 5KZCD 3MRGA 3L1OH 4UIMB 5FM8A 5GJTH 5DO2C 5BOPA 3VXSD 4QRSA 2CLZA 5B38G 5D1ZB 3WE6A 3UMTA 1DTUA 1G6RL 2XZZA 4OM0L 5KS9B 3GB7A 4JJ5B 3F7RA 3O9WD 3BPNB 1JUFB 1IAMA 5SV3A 3HE7D 1IQWH 1CTOA 2APWA 5IWLC 1UXSB 4GFTB 5I76B 4JRXD 1ZVSA 2MQ0A 3RDTB 5BV7L 1A1MB 5AWNL 4P9HL 3C2SA 5IBTH 3DPBA 3IXTB 1LEKB 3OHXB 2XTLA 4MVBD 4WHYH 5CIPB 3T2NH 5I1LB 3Q6FA 3QUMA 3FONB 4X80H 3KPRA 5B39G 1SM3L 3FT4B 4XVSL 1GZPB 1PKOA 2Q7YB 2OX5A 5GPRA 4V1DA 3SBWA 1P5UA 5TE6L 1JZ2A 4KRPD 3VFVA 4KKBD 4M8VA 4YEFA 3TA3A 3RQ3A 1PKQE 4PRIB 4ZQKA 4QNPE 4AYFA 3W0WA 1R6VA 4ELME 3PABA 2OLDA 4JQIL 2R1WB 3CPLA 2FO4A 3QIWC 4BUHA 4HLZH 1AI1H 1T1XA 5IFHH 4ZS7H 2R2CA 4RWYH 4QRTB 4P23C 5CEZE 3FT3B 1D7FA 1KT2A 4LLVB 5KSVA 5T1MB 2NX5A 4OF0A 2W92A 1WWAX 5CP3H 5I66B 1ZTXH 3BZDA 2W9EL 5D7IB 4CN4A 4QXGL 3E3QC 2HLAB 1A6VH 2AK4E 1JRHI 2NR6D 4WUUA 2A83A 2C1PB 3PP3K 4HFUL 2OJEA 2WZPD 1FLTX 1UA6L 3NAAL 1ACYL 2BVPB 4G6KL 3SDAA 2VXVH 1T1YA 4PR5A 2NY5C 2A6DA 4LGRB 1YC7A 4X6FA 1GGBL 3NZ8A 2NW3B 5KZCB 4M5YL 4C4KO 1SEBB 3ULVF 3PWUB 4TUKH 3GMRB 1U58B 3MRPB 3TBSB 1IZKA 4OZHB 4U1GC 4L29A 1P84J 3HHRB 1IT9L 5EUOA 3O9WB 2ED8A 3QUYA 1IQDA 3NIFE 2DBLH 4P5TC 1K5NA 3VE0A 1KIRA 1DN2A 3ISWA 2HG5A 3O2DH 3L3IA 3HZVA 1RJYB 4JFFA 1JNNL 2HTKD 3N1MC 4JRXB 2AQ3A 3VFOB 1A6ZB 2VZSA 3WUWG 3BT2H 5J13B 4ERSL 4HCRH 1QHOA 1ORQB 1FL6A 5J7CC 1B0RB 1OAUL 1P7KA 2JB6A 5GS1A 4C56A 4ONHA 3FN3A 3G6JA 2BX5A 4BZ2H 3P4MB 1A14L 2G2RB 1A3RH 2HRLA 2UWEE 1FL3B 4F9PA 4JQXA 5KVMC 5EORH 4P9HC 4IMLB 4JKLA 1NMCB 4K7PH 1MSPA 5DS8B 2P8MB 3NTCL 2P7TB 4NQCD 3AAZA 4PJ9C 4LRIA 2KL6A 5DRWA 1IKFL 2CLVA 5DK0B 3EOTL 3IAQA 1B0WA 5HGDB 3B9KC 3EBAA 1LP9B 4HPOL 2EYSA 4HKJA 5CGTA 2W0FA 3JTTA 5FYJE 1JI1A 4XNYL 4DTGH 3DXAE 4QXWA 3EFFB 5DJYB 1T1WA 2XZAL 1CICC 4DUWA 3RWEB 1U3ZA 1OWRM 4XPFH 4XNQB 2O61A 2UZYB 5B22A 1VEMA 4OCRL 5FUCC 3OR6A 2EDNA 4BZYA 1UVQA 3AS0A 3LKRA 3C5SA 1XT5A 4ODSH 1MVFA 2IQAA 1EJOH 5EG6C 3KPSA 2AXHA 1PEZA 4NHUA 1Q94A 4X98A 3VXUA 4LKXA 3CVHB 4PTTB 3L3GB 3QNXA 1JGEA 1GL4B 2W60B 2Y7QA 1R0AL 3QO0A 4K07A 2XY2A 3TIEA 4WI9A 5GGRA 4FFZH 2IPUK 3FRPA 4FQQA 1T83A 4WW1B 2NTFA 4IOFD 4Z78B 5HHMD 2C1OB 3STZA 1E4KC 3L5XL 2ZP0T 1CU4L 4OZGA 2DN7A 1AC0A 1T1ZB 4LPXA 3MRNA 4O4YH 4D8PB 4OBRA 1LDPL 1G9MH 3D9AL 4NQEA 1F42A 5CGYD 3VXPB 3ULSA 2C9AA 4AL8L 5M94B 4PJFE 4OUUB 4KTEL 3PL6D 5I1EL 4WI4A 1KCVL 4FZEL 4G8IB 3LN4A 3VRJA 2YRLA 1RFDL 5J6GB 3CFIC 1QSFB 3MV9A 3LEXB 2VLRE 3UTTA 5F88B 1B6UA 3ZE2E 3HI1A 4D3CH 3I3EA 2ORBH 3W39A 5I8OH 1UEYA 3KGRA 3J7HA 1LO5B 5TFSL 5IB4A 1QYGL 1CXEA 1WFOA 4A6YH 1QA9A 1UCBH 3MA9L 4O02H 4AMKL 4CJ1A 5F3HB 5L7XH 3F7YA 4NQCB 2B5IB 3TYGL 1QUNA 1HHGA 4YPJA 1D5MB 4HC1A 4HK3N 4RGMB 3R8BB 2IQ9L 5FF6A 4KH2A 2X9YA 5JOPE 3FQRB 1KEGL 2YPVH 4KHXH 3O2WH 2HFEB 5IB1A 3WSQL 5IV2B 3CCHB 4NQVB 5E24E 5C1MB 4ZDHB 2XOTA 5BCAA 4I18A 5EOTA 2WM0A 5I75C 3BWUC 2XA3A 3NPZB 4NM4L 4KJPC 2G5BB 3O6FB 3WYRA 4HT1L 3SN6N 1LE5A 1J1OH 3CFKA 4HBCH 4MD5B 2ZUVA 3P9MA 1U3YA 4TVPH 3ESVF 2ADGB 4OI9A 4PJ8D 4AH2B 2J8UA 4OT1L 4CAGA 3BFOA 1PX3A 3BYTA 3P9WB 3IDXH 2VLKE 1TVBB 2AJVH 3WV0A 2EH7H 4RDQF 3T0EE 3WJLC 5I17A 4XZUB 3O3EB 4NHCL 4YBLB 2FJHA 4L9LB 1RZ7H 5HHOE 1GCFA 4FQCH 3PIQB 4HAFA 4NSKA 4LHUG 2BNUB 5FO9A 2R0LH 1V7MH 4JDZB 1JTOA 1OGAA 4MDIA 2B7DT 3LKPA 1DQDL 1Z9SA 3IDGA 1CGVA 4YAQA 2FH8A 4Q9RL 2FHFA 1RZKL 2V2TA 3TA3D 4QRUB 1B2WH 3V52L 3S34L 2BOBB 1CFTB 3W0WD 5FV2A 5JPNA 1E28B 2VOTA 1OAXL 2GSGB 3OKYA 2R1YB 3TFKD 4LSQL 1H3PL 3L7EB 2EXYD 1UJ3B 4RAVA 8CGTA 5KSBE 1AJ7H 1ERNA 4P46B 1OSPH 2NX5D 3ZKXB 2HJLA 2JIXA 4YGAB 4D9QE 3DVNA 3KYMA 4KKCD 1MFDH 3ZYZA 1FVCB 1JWMA 1RURL 1NFDF 5ECJE 1UKTA 1J10A 3MROA 3ZDYE 1YY8A 1FBIH 3LIZL 2V5YA 1QLEL 4OFIA 5FIEA 3EYUL 5J3HD 1OQXA 5C0EB 4ZSOE 1OAZH 3DROB 4AEHH 4KQ4H 5E94A 4NC2B 1QFOA 5DGRA 1C8PA 3MZGB 5J8OA 1NKRA 3SGJC 4ZUSA 2J6EL 3C60C 3MLPA 3C2AH 2FD6L 5LBSL 3MRGB 3V0VA 3ZKSD 4QRSB 2CLZB 4JM2C 3ZKNC 3UBXG 1RU9H 2X4PA 3WE6B 4LCCC 2EO1A 1BGXL 3H8NA 4GLRH 3GB7B 3QUYD 4LSSL 4A2LA 2N4IA 4N0UA 2DM4A 1ZVSB 4Z7NF 1RJLA 2DD8H 1WZKA 2BMKA 3K4ZA 2JF1A 3UPCA 1UB5A 4NN6C 2X1XR 3TPKA 3SDDC 2CK2A 3DRQA 2H26A 5C08E 4UV7H 1LK3H 1IE5A 3BQUA 3Q6FB 1V8HA 1J0ZA 3QUMB 1PSKL 3KPRB 2YHGA 4TQEH 2HT2C 4AIXA 3ULUL 1MJ8L 2B1HH 3GK8H 3HRZA 4ZFFA 4V1DB 4U7KA 3OKEA 4XP4H 4JPVH 3TA3B 1EK3A 4KI5F 3C6SA 4ZQKB 3W0WB 2ADIA 3PABB 1Q9LA 3CPLB 2FO4B 2VERN 4PREA 5HPMA 1T1XB 2VUYA 5DD5H 2AABH 4BZ1H 4PLOB 2CK0L 5DEFA 1Q0YL 2D0FA 1RUAL 3JWDC 1KT2B 4L8CA 5KSVB 2DWEA 1BEYH 2NX5B 3ECBA 3VMPA 3I02A 5D6CA 4K94C 4WUKH 4FFWC 1OD9A 2DI8A 3HN3A 4I1NB 3K8LA 4E42A 3GRWA 1UKSA 1IFHH 4Q0XH 4WUUB 3NGBC 5I1IH 3QUZC 1X6LA 3IRZA 2OJEB 3O4LE 4DN3L 4APQC 4M1GL 3GSNH 1IEAA 3UPRA 1I3GL 2J2ZA 3KPSD 4J3XA 3MLVH 3SDAB 4BK5A 2OCFD 4PR5B 2A6DB 3HNVL 4X6FB 3T4AA 5TDPA 5HI5C 3NZ8B 4ZUUA 1QFHA 1J0YA 3WD5H 4Q9QL 2IEPA 4HJ0C 3S88H 3MLRL 4PJCA 5FUZH 4J3UA 1AQKH 4PRNA 4P5MA 4GLRI 4YDKH 5IEKA 3P2TA 1J7VR 4L29B 3S3JA 3LQAH 3MRRA 3QJHA 5GRJL 3QULA 5EUOB 5KSAC 4L5FH 1G9EA 3QUYB 3FQNA 1K5NB 4GXUN 3VE0B 3ZTJH 1KIRB 3H7BA 4NQED 1A1NA 2HG5B 4JFFB 3L3IB 3HZVB 5I19L 5KVDL 3CFEA 4P59L 5D1ZC 2G75A 1P7KB 1EGJL 2JB6B 5GS1B 4C56B 3AS2A 4ONHB 2Y72A 3G6JB 3HC3L 4U49A 3BPNC 2ESVE 1DJSA 1GH7A 1AY1H 3TF7C 4OZIA 2OZ4L 3WKML 3N1PC 2PKDA 4WI5A 5SWQA 4P9MH 1D9KA 3MC0A 1W8OA 3WFBL 2C3HA 4G8EB 4FTVD 1KUMA 5ICYA 4Z7VF 4UNVA 1CE1H 3BMVA 1F6AA 3THMH 3C09C 3AAZB 3ULUC 4OCWH 5DRWB 4J3WA 1PY9A 4LFHG 3MYZA 1I9RL 1QFWH 4J4PD 4L4VA 4YJZL 2DQDH 4I3GA 3RP1A 2EYSB 4HKJB 3JTTB 1O7SA 4XBPA 4XMPH 4MD0A 1A22B 2CDEA 5IGXL 4XT1C 4I5BA 3I9GL 5CSGA 1II4E 1T1WB 3EUUA 3EDJA 4OFDA 5DUML 2QTEA 2Y1VA 3K2UL 1UWGH 3B3IA 3S35X 3HI5L 4ODHH 1QP1A 2F8XC 5ADOL 4N8VA 3BZEA 3OR6B 2CLRA 3LKRB 2DKSA 3C5SB 1NFIA 2IQAB 1PJ9A 3HS0A 3KPSB 1P6FA 3VXUB 1Q94B 4X98B 4LKXB 5CD5C 5E2VH 3QNXB 4ZOEA 1JGEB 5IR1B 5I71C 2Y7QB 1OP5K 4CU8A 4FG6D 3TIEB 3H9ZA 1N59B 5GGRB 4FQQB 1FNAA 5HGBB 4KI1A 2NTFB 4QYOA 3WXWL 3STZB 4OZGB 5GGTL 5C09D 1ULVA 5KN5A 4LMQI 3MRNB 1OGAD 4LARL 3QDMA 4R4FL 4LSTL 4MS8D 4GJTB 4QXTA 4EDWL 3MR9B 2XTJE 4NQEB 1FLRH 4GS7C 3ULSB 4H5SA 1H3VA 2ZOLA 2EH8L 2BSED 3V8OA 4MXQC 1F4WH 4CDHA 1NC2A 3GUTA 5IW1A 1RJCA 3B83A 3VWKC 3LN4B 1T03H 2CRMA 1KF9B 1BBDL 2VXUH 5LQBH 3MV9B 3AFLA 3UTTB 5D9SA 3HI1B 4OLUL 2NXZC 3W39B 2HMIC 2JIXD 5L8KB 4HS8L 1F11A 5IB4B 2F5BL 5E6IA 2LQRA 2XG5A 4G3YH 1QA9B 2O5XH 2R56L 3V6OE 4KPHL 5HHQA 1P9MC 1UACH 3LD8B 2KQMA 1NBYA 4B50A 3F7YB 4MCZB 3EYSL 4UOW0 3LMJL 5DD0H 4PJXE 4QHUA 1HHGB 1XF5A 3TN0D 4W4NA 4DOHE 2AXFA 3U4EA 3NZHH 4JGUA 1FDLH 4UI2A 5FF6B 3FO9A 5F7UA 5JZ7D 5HDQL 3RY4A 5IB1B 1A7NH 4Z7QE 2V5TA 3OTTA 1CF8H 4S1RH 3HA0A 4I18B 5LKNA 5EOTB 5CGMA 3TNNA 2APXA 1TVDA 4KMTL 4DW2H 1LE5B 3CFKB 4N8CL 4WU5A 3DX8A 1FZJA 1U8PA 4BH8A 4PJIE 1A5FH 3GHBH 1UYWH 2J8UB 5ITBL 4CU6A 3IDMA 1A0QL 4X6BA 1DFBH 3NCJH 5I17B 5F6HI 3DBXA 1T04B 2D31A 2WWKO 3DX7A 2FJHB 1YUHA 1XGQB 3JV4A 5DC4B 3SE8H 1S9XA 2K3TA 2VLJD 4NSKB 4PIRF 3D1MC 5FO9B 5EU7E 3GMPA 3H9SE 1OGAB 4MDIB 1JPTH 4XCNA 3LKPB 4P2QE 3PDGA 4I48A 2J5LC 4EBQL 3IDGB 2CO6B 4YAQB 2BC4B 1HCFX 1ETZA 4F58L 2V2TB 1MHPH 3MLYH 3MXWH 4QHNA 2DI9A 3G5ZA 1ZLSH 3KHQA 1VPOL 5JPNB 5F70A 4TTGA 5HVGB 3RAJL 1IAKA 2BNQA 3UTQA 3O2VL 3SJVD 2V9QA 1E4XH 3VXME 3OJDA 5CEYA 1SVZA 4PJBE 1J9CT 2HJLB 2JIXB 5DD6A 3DVNB 3KYMB 1ES0A 1CGSL 3VXTA 5L2JB 2D3VA 1JWMB 2V5RA 3MROB 1X4XA 2EDYA 2UZXB 1DLFL 2DIAA 1YY8B 1YMHA 3DI3B 4EZMA 2FZ3A 5D7LA 5JQHC 2X2YA 4NFDA 4G6AD 4I9WD 1R24A 2C4FU 5E94B 3U7AA 5GHWL 3RVXC 5T1LD 1FGVL 4YDLB 4ZUSB 5ESVA 4TPRH 3DI2B 3V0VB 2JLLA 4LSPL 5IJKC 2VDML 1HILA 3MYJA 5DFVD 2X4PB 5JHLH 5E2WL 3PXJA 5EBMA 4HGKC 1Z3GH 3CH8A 4LPUA 4GRWF 3ALXA 2IFGA 4G9FA 3RI5F 3BPCA 1CK0L 4KKAD 5SWSA 4N0UB 2IFFH 1A3LL 2WINA 1FZMA 1GGIH 5D2NA 1RJLB 3EDEA 4X9BA 2BMKB 4QRQA 2DDQH 1UB5B 1K6QL 1B3JA 3BUTA 2ICWI 4FQIH 3RTQA 3DVGB 3O6FC 3DRQB 2H26B 4JG0H 4PGDA 3MLUH 4KGLA 2P24B 3HG1A 1ZLVH 1BBJA 3L3HA 3MRBA 2VYRE 3BRGC 1IC4L 2XKNA 3HRZB 4HWNA 4ZFFB 1D9KD 1YPZA 3OKEB 4GT7A 4M93C 5K59E 4XNZC 5DRNA 1J8HA 4M62L 5D93C 2ICWA 2YEZB 1BM3L 2LU4A 3C6SB 1TIUA 1RZFL 4PYHA 4JKPL 2P5EA 4QOKE 5DVKA 1WSST 2FHBA 3TVMA 1KTDA 2ADIB 3KYKL 1E4XI 4HMDA 1Q9LB 4PREB 1J5OH 3SOBH 3F5WA 5HPMB 5E2TL 5HYIA 1I7UA 5D7JC 5E8DL 2WUCH 3U4BL 3WDHA 3NFPA 5DEFB 4GKZA 4M7LT 4L8CB 3WIFA 2WIMA 1CLOL 2DWEB 4HAGA 4HH8A 3ECBB 1DCLA 3MOBH 3SE9L 4NJAL 4P4KD 2M8XA 3I02B 2KDGA 5D6CB 4DJMA 3TCXA 1T22B 5K9QI 5D71L 2GUOA 2FR4B 4J8RA 4U1IA 1AD0A 1G7JA 4L3ED 4N0YH 5T3XH 2ZUQB 5ILTL 4E42B 2ADFL 7FABH 2MJWA 3HUJA 1EFXD 4IM8A 4HPYH 5D5MF 4HZAA 4YWGH 4D9RE 3OSKA 4P46C 1BD2E 2ATPA 5IF0A 1R3HB 1IEAB 2V17H 3UPRB 2VXQH 2WWMC 2VXSL 3H0TA 3V5DA 4MZ2A 2GK0A 3T4AB 2VDNL 3HZKA 1TVHA 1J87A 1RY7B 1WISA 4ZUUB 1RVFH 1X5YA 3F6IA 3NCBB 4CW1A 4OD3L 3JV6A 4CVZA 4PJCB 2E6QA 3HR5A 1JRHL 4PRNB 1DBBL 4P5MB 5KOMC 2ED7A 3ES6A 4XP1L 5IEKB 4D9LL 4Z7UE 3J8F7 5A3IC 2AJYL 1FFOA 1JIBA 3LRSA 1YEFL 3MRRB 2QBWA 1OVZA 3QJHB 4JFDD 3QULB 4NOFA 3VDCA 4JLRA 5GJTL 3FQNB 3JWOH 3K3QA 5DDHB 3H7BB 3O45A 4WY7H 1A1NB 4IIQC 2R2EA 2JJSA 3H3KA 3D2UD 3PNWA 1BOGA 4Y16A 1JZ4A 3CFEB 4XPHL 1OWWA 2G75B 1ZHBA 5GGUA 3EDKA 2CKBH 3L3KA 3M17A 2G5RA 5DEGA 3WIHA 1IQWL 3L3JA 5E99H 2OP4L 2GK2A 4LLAA 4OZIB 3L5IA 4X7CC 2EYTA 2JCCB 3ZKMD 4FS0A 4KK6C 5SWQB 2RB8A 5IBTL 4LCYA 1D9KB 1RHHA 4LSRH 5E6ID 1ITCA 1QBBA 1A9EB 3T2NL 4EI5A 2AJSH 4X80L 4L9DA 1D6EA 5FDYA 1MFCH 5ALCL 2RJMA 1F6AB 1YDPA 3CLEH 3KPQA 4L4VB 5CBAA 4NJ9H 2WV3A 3WS3A 2HVJA 1ZANH 3DVIA 1YNLL 4IRJC 1F8TH 4YC2B 3O0RL 4XBPB 2F53A 4MD0B 2PF6A 2CDEB 4WCYH 4I5BB 2GY5A 5IBUG 3MLZH 3FB8A 1AI1L 2YA0A 4MNGE 5JORA 5IFHL 5EOQH 2J3SA 4RWYL 1YY9C 5FO8A 5DMYA 3HNSL 3B3IB 5HYEA 1D6VH 3O4OC 2VH5H 1ZTXL 1NGZA 4N8VB 3BZEB 4EUPG 2M26A 2CLRB 4JFZH 1NFIB 1BOYA 3HS0B 1MREH 2DL9A 1JGLL 1A6VL 1XZ0A 2IH1A 1SJHA 2HLFD 3L95A 4RGOL 2PN5A 4UDTA 4OGAC 3SKMA 1JHLH 2VZUA 4QYOB 2PTUA 3TESA 12E8H 1KG0A 1NSNL 1MIMH 2WLYA 3GNMH 2J4WL 1WBZA 1AO7A 3U1SH 3QDMB 4OD1L 1VACA 4NQXA 4QXTB 2X6MA 5GGSA 1MCPH 1MFNA 43CAA 3VFTA 3EYOA 3RVWD 4H5SB 3D2UB 2VDKL 3Q1SH 1S8DA 2ZOLB 5D4QA 1AGEA 4PUBL 1NC2B 4XHJD 3GUTB 4FQHA 5IW1B 4M7KH 4BQ6A 2DBLL 2AEPH 4GG6E 1ONQA 2WNGA 3O2DL 4NFBA 2V9TA 1X6NA 2BSTA 2BRRH 2ZUTA 2CKBA 4HCRL 4HUKB 1MQ8A 1F11B 3SPVA 2FEDC 4QXUL 3ULUF 5E6IB 4ZOBA 4BZ2L 3QHTC 4NYLA 5GS1C 1A3RL 2H45A 3CLFH 3T3ME 2K9UA 1RIUH 5HHQB 2ADJA 2E7CA 1NBYB 5I15L 5HDOA 5EC1A 4JQXC 2W0LA 1XF5B 2PYEE 4QHUB 5EC2A 3ROOB 6FABH 2AXFB 4IMKA 1YC8A 2H32A 3FO9B 4WRLA 3MCG1 2L7JA 3SGEH 4X5WA 2XV6B 1YEIH 3BD3A 3OBAA 4LRIC 1S7QA 2B2XH 1IGFL 1TQCB 3OX8A 1CDUA 3TNNB 1U8LA 2AI0L 2D4FA 5T33H 1RPQA 1OP3K 1OOAA 2AK1H 2B0SH 5BVJA 5JW4Q 1ZKAA 4DTGL 1MWAH 4OSUH 3DX8B 4RGND 4WU5B 1P53A 2D0GA 1FZJB 4IRZH 5C3LD 2HRPH 1L4IA 4BH8B 2AXJA 3RJDA 1D5BA 3QEQE 2IC2A 3T1WA 4JHAH 5C71A 2R29H 4HK0A 4Y5YA 3HMXA 2IJ0C 4OCSH 3QP3A 4X6BB 5FUCE 5AYUL 1B4JH 3DBXB 4ODSL 2D31B 3DX7B 1EJOL 3ZT5A 5C0CA 1YUHB 3EJYD 4OQTL 2DQJL 4L1HA 1S9XB 3JVGC 4ZOAA 1X5XA 3GMPB 1HQ4A 4KJQC 5IHUH 1GZQA 4XCNB 5TJWK 2XQBH 4I48B 4XHQA 3BZ4A 4X6CA 3I84A 4FFZL 4I3SH 4JHBA 1J8HD 1ETZB 3LHPH 4Z0BL 5GRVK 3WKNA 4QHNB 3TCLA 1DUZA 1T83C 2P5ED 2Q8BH 3G5ZB 2VIRA 4PBVC 3TVMD 4I0CC 4O4YL 5C8JA 1RIVL 2AK4D 3H2WA 5BW7A 1LK2A 2EDKA 3ARBA 5IFJA 1GHFH 3UTQB 2W59A 4UT6H 1ZA3A 1CFSA 4ZTPH 5I0DA 1NDGA 3OJDB 5CEYB 3T0BA 4MA8H 5DD6B 4EOWH 2ZUYA 3P30H 1ES0B 1NANH 3UPAA 3VXTB 2E3VA 4X7FC 4J7RA 4GAGH 3RVTD 1V3MA 5A2IH 2Q8AH 3DNKA 3X11A 4DGYH 2FZ3B 4D3CL 1HNFA 3RY6C 2ORBL 3IXAA 5DQDH 5I8OL 4NZUH 3W9DA 3ZYJA 1R24B 3SGEI 1MJ7H 4PJHF 2WBJA 3QPQD 4AJ0A 4A6YL 3ULVH 1MCOL 1UCBL 2DQCH 1QSEE 3ILPA 1CGXA 2HKHH 5ESVB 5L7XL 4EN3A 3KJ6H 5DRXA 4NQUA 5DVNA 2D7PA 4JQVC 1T66D 1HILB 3MYJB 5DK3A 3WO4C 3L5JA 4KMQA 3WFDH 4EIGB 1JNJA 5I8CA 4KHXL 4Y4HA 3O2WL 1HYSC 1IC5H 1HKLH 3BPCB 4RGNB 5HVFB 3MRQA 3ARFA 2FATH 5SWSB 1CGTA 2WINB 4WEBH 1FZMB 5D2NB 4POYA 4I18C 4OFYD 4QRQB 5F89A 5HI3C 4KROD 3D0LA 1MWAA 4WIQA 4KDTA 4OLVH 1J1OL 1L9NA 4PGDB 4KWUA 1F4XH 1MCLA 3REWA 3WFEH 1BBJB 2VC2H 3L3HB 1VADA 2B20A 4XVTH 3QWRA 2XICA 5LVEA 1GOHA 3TBWA 3IDXL 2XKNB 2AJVL 2EH7L 4N0RA 1YPZB 4GQPH 1FYTA 5FYJD 5DRNB 1J8HB 2ICWB 3EYVB 4HUVA 3MGTB 1P4LA 5CJQH 1RZ7L 3DXAD 2VXTL 2P5EB 4FQCL 1CR9H 3DUHA 3TVMB 15C8L 4Y4FA 1GSMA 3CFDA 3I6LE 1T0PB 1J0KA 4PJAE 4ZAKA 2R9HC 5L8LB 3F5WB 3W5NA 1I7UB 4UV4L 5C6TH 4LOUC 5E08L 2VDPH 1B2WL 1NANI 3WIIH 5E9DE 3NFPB 4RBPH 4GKZB 1ZLUK 4PGZA 2EC9T 5C0IA 5F7EH 3WIFB 1QFUH 3MRLA 4DVBA 4RISL 4H88L 2FECI 5JHDA 2GUOB 2GJJA 1G9MC 3HAEA 4J8RB 4YHPA 2Y07H 3QCUH 1CDHA 4PJXF 4U1IB 5EFIA 1AD0B 1G7JB 3BIKA 4Q97A 4XVJH 3FOLB 3HUJB 3CAFA 1AJ7L 1A02N 3FB6A 1OSPL 1P1ZA 2FB4H 1DP0A 3CNKA 3UTOA 1MFDL 2ATPB 4NPYA 5IF0B 5H35B 5B8CC 1R3IH 1SJVA 3H0TB 3V5DB 3CX2A 5JDSA 3HZKB 1TVHB 2VDQH 3EAKA 4CW1B 3JV6B 3BKMH 3OKLA 4CVZB 3HR5B 2QHLA 4Y5XA 4LP5A 4Q9CA 5I8EA 3TJHD 3ES6B 4KQ4L 1FFOB 3LRSB 2DWDA 4DZBA 5FUOH 3MPCA 4JLRB 2EECA 1Y6NR 3P0VH 3UYRH 1KBGH 2Z91A 3O45B 1SHMA 2R2EB 3CSBA 4MXWH 3SDCA 5E8PA 1ZGLP 2YUZA 3PNWB 3MCLH 3VXRE 3ZHLA 3GMLB 1BOGB 4Y16B 2BXYA 2EDFA 4KK8D 4KROB 3IDYC 1ZHBB 3OZ9L 3L3KB 1P6AB 3M17B 3QEGH 3ZE1F 1K4CA 5MENA 1KCRL 2VUOA 3QISA 1FSKC 5FKAB 2LV4A 3L3JB 3QDJE 3VH8A 5I1JL 4OZFG 2DD8L 1NEZB 2EYTB 3U0TA 1NUFA 1MI5A 5E2JA 3WLWD 4LCYB 1RHHB 4R8WL 4M7LH 1YEJH 1TNNA 1F2QA 2OR9H 4UV7L 4EI5B 3UO1H 3DXAB 4Y2DA 1D6EB 5ADPH 4TQEL 4KVNH 4NUGH 3BQUC 3GBNH 2OM5A 2B1HL 3GK8L 1FQ9C 4PJDE 5FYKL 4XXCC 2XA8H 1YA5A 4LCIH 3KPQB 4U1NA 2BVOA 4YHLH 4JPVL 2IBGA 3QWOA 3QPXH 1OTSC 3WS3B 5IB2A 1ZT4A 2HVJB 5F8RC 3ELAT 4ZPTA 2F53B 1FP5A 4BQCA 2R0WH 2BVTA 3TGXA 1QG3A 3FB8B 5JORB 5FKPA 1PFCA 5LXGH 2FBJH 4BZ1L 5FO8B 3WNNA 1C1EH 4M61A 3TZVD 3H3PH 3V4UH 3NA4A 5HHOD 1BEYL 3ZYIA 5GSVA 3UX9B 1NGZB 1LWRA 4WUKL 3WNOA 2ARJA 1A21A 2YD5A 4MGXA 2IH1B 1XZ0B 1FFRA 1SJHB 1IFHL 3L95B 4U1LA 4R4NC 2ICCA 2ZUQC 4PJFB 4UDTB 4PLNC 1CDIA 2VE6A 3VG9C 2IADA 3SKMB 5A2JH 2NMSA 3GSNL 5HHVH 4P57A 1KG0B 3MLVL 1X5KA 3OAYH 4OBSA 2NYYD 3QQ3B 5JR1L 1WBZB 4X99A 1AO7B 1VACB 1UM4L 4NQXB 5B21A 5GGSB 1XIWD 3S88L 5FUZL 4N8PA 1AQKL 43CAB 3VFTB 3EYOB 5EO9A 1S8DB 3G6DH 1IGTA 3ZDZE 5IMLA 4PRHE 4BSWA 4H1LH 1AGEB 4L5FL 2VZ3A 3ARBD 4FQHB 2HT4D 1FG2A 4IRSA 5FFLA 5CUSH 4URTB 1ONQB 3ARUA 3MACH 1N3NA 3PUCA 4X6EA 5AG9A 2BSTB 1T20A 2E7MA 3WLBA 2CKBB 4FQ1L 1BFSA 5F1NA 3SPVB 4EXPX 3W11D 4RAUA 1WAAF 3ALPA 4YHYC 4X7SH 1QBLH 5KS9E 3STBA 4IDJH 1DBAH 4NYLB 4BELD 1AY1L 3BOVA 2ADJB 3JWNC 5T3ZD 5EC1B 4P9ML 5J11C 2WBJD 5L2KA 2H32B 4JR9H 2I9LA 3WJJA 2R0KH 4MAUL 4LBEB 1CE1L 4X5WB 4IJ3C 4EN3D 4OCWL 2J88H 5CINL 1QFWL 1S7QB 4Y8AA 3OX8B 5JNYA 1U8LB 4AT6A 4BSVA 5D70H 3TZVB 5K9JL 2EZ0C 1P7QA 4Y4HD 3U0PA 4PRIE 5BVJB 1NMBL 4YC2C 1N6QH 1AKJA 5GIRA 1U2HA 4BFIA 3H9SA 1MEXL 1GAFL 2NY2B 3ARFD 4LDEB 5ERWA 1D5BB 1HHIA 4Y8DC 4U1JA 3RVUD 3QUXA 3BKCH 4ODHL 1NMAH 2Q86A 4HK0B 5K33A 5CJXA 1BF8A 2E7HA 3MBEA 3CDFA 2DQGL 5DFTA 4OFPA 4CADA 4M48L 5D7IE 2W38A 5H37H 3QWRD 4F7MA 2E7LA 1GC1H 1HQ4B 2X4NA 1GZQB 1CVRA 5I1CL 3BZ4B 1FYTD 1XIWB 4X6CB 4F9LC 3IJYA 1BAFL 2H2SD 1GVIA 1DZBA 1JTTA 1D5XB 3TCLB 1DUZB 5MEPA 3B43A 2VIRB 1U8OB 2VR9A 4Y4FD 2Z9TA 1VFAA 4MXVF 5C8JB 3T77A 1KFAH 4KV5E 4CVXA 1LK2B 5DMJB 3ARBB 4HFWA 3TBVA 5IFJB 4WHDA 1RHFA 4MLSA 3QDHA 3O4LD 3S7GA 3HE6A 1ZA3B 4UT7H 1NDGB 2K1MA 4H1LA 2ICWJ 4TNWF 3LQAC 1OM3H 1F4WL 2GCYA 2F74A 5JHDD 1GGCL 1NC4A 5HY9A 5LQBL 1FCCA 1NFDA 3X11B 4XPGH 5GGSY 3VWJC 3IXAB 4NKIH 4JRXE 3WCYA 3W9DB 2ZCHL 1S9VA 5H2BA 3PHSA 3PGCA 2WBJB 5FGSA 5HI4C 4G80A 4G3YL 5GRUL 2O5XL 4TSCH 3ILPB 4XC1H 3H9HA 1YN7A 3QNYA 4EN3B 1TMCB 5DSCA 5DRXB 3KLHC 3SHSA 2WW8A 3KVQA 3RHWF 3DYOA 1F45A 1W72H 5IJVA 4HUNB 3KPPA 2ESVD 1MY5A 5I8CB 3D48R 3E2HC 4Y4HB 3BKYL 1KPVA 4HS3A 3BRFA 2A38A 4K3DL 1G0YR 1A7NL 1KLFA 1CF8L 1MFAH 4OKVA 1ND0A 3MRQB 3ARFB 5EOCJ 4HQQL 1T0NB 2P8PA 3SDCD 4ODWA 4K7PX 1C12A 1JGVL 1TQCC 3EHBD 4GXUM 4XCCH 5F89B 4DW2L 3D0LB 3CX5K 3O3BA 1RULH 4WEMB 4F7CA 3U79A 3EO1A 4WI8A 3TPUA 4I77H 5MEND 4P4RA 1RMFH 3DMMD 3QIBC 2EIEA 1PDKA 4Y19A 1DUYA 1S5IH 3REWB 1A5FL 3D39E 4MAYD 3GHBL 2YBRA 1VADB 3TBWB 4TUJA 3L3OA 5JTWA 4JFPA 1DFBL 3NCJL 1FYTB 4NCC2 5EU5A 2ZCLL 2RGSA 1P4LB 5FCSH 3G6AB 1ZVHA 3ZT7A 5D1XA 4Y2DD 4DKDC 4JB9L 3SE8L 4JDVA 4HGWA 1O7VA 1Y18B 1HWGB 4Y4FB 2DS4A 1SYVA 2AEWA 3CFDB 1JPTL 5FM5O 4ZAKB 2M1KA 1IAIH 3LVEA 1DVFD 4JGJA 4WWKC 4W68A 2JJVA 4YGVA 4ALAL 3V4PH 3QEHA 4RAHA 5C0IB 2HYMA 1ZLSL 2WBWB 3M8OL 3MRLB 4DVBB 5B4MC 5JHDB 1A6TA 3HAEB 4GXVL 4YHPB 5IUSA 5I8KH 5EFIB 3BIKB 5GISH 5IT2H 1A2YA 5I1KL 1NGXA 3FB6B 4WTZG 3D18A 3SCMA 2LTQB 1YQVH 1NGYA 4UBDC 2I26N 5HYSA 4NPYB 4QF1A 5BRZA 3DYMA 1ZHLA 2XTJD 4M1CD 5JDSB 5GZOC 1C7TA 1QSFE 5E6YA 3IRPX 3LPFA 4P49A 3OKLB 2IWGA 4U2YA 2AJXH 4Y5XB 5I8EB 1U8IA 1IGJA 3GI9H 4PJ7F 2XWBA 1IBGH 4LL9A 4XVUD 2D2OA 2DWDB 1WCBA 1JV5B 1NLBH 4DZBB 1EHLH 3HB3D 3DARA 3DURA 4ZO8A 3RWFA 3KHOA 1W72A 3L3DA 2Z91B 4NQCE 5IHZA 3O11A 4OB5H 5E8PB 3SDCB 5JHLL 1QEWA 1QQDA 3CFBA 1Z3GL 5A2LH 4PJ5A 1K4CB 4LQFH 2RR3A 5MENB 3K8MA 3DMMB 4AEFA 1SM3H 4FQJH 1MJJA 3GSVA 3NCYS 2IFFL 3VH8B 2Z8RA 4U3XA 2DYPD 4XVSH 3U0TB 3OJ2C 2DDQL 1AXTH 3GBLA 1MI5B 3LKNA