2J1LA

Crystal structure of human rho-related gtp-binding protein rhod
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
179
structure length
157
Chain Sequence
VRSVKVVLVGDGGCGKTSLLMVFADTPTVFERYMVNLQVKGKPVHLHIWDTDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKVPIIVVGCKTDLRKDKSLVNKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Rho-Related GTP-Binding Protein Rhod
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords RHO-RELATED GTP-BINDING PROTEIN RHOD
total genus 50
structure length 157
sequence length 179
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2006-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2j1lA00
1VIYA 1GSIA 2DPXA 4PAOA 5G53C 1KK1A 3T61A 1FQJA 1SVIA 2I3BA 1E96A 1E2MA 1LF5A 1ZNYA 4B6EA 4XSGA 3MJHA 3ZVLA 1EGAA 1W49A 2JLYA 5AR1A 2XB4A 1AKEA 1MO4A 3FHCB 4Q66C 1KIMA 3BFVA 5CIQA 4KLZA 3Q85A 4TYWA 4Q4JB 2ODNA 3GFOA 4R2IA 2AK2A 2G0NA 2OCAA 3NTUA 3LBNA 2PJRA 4D4KA 3CIOA 2H5EA 1UBCA 3ZQJA 1FNNA 4ABYA 2CK3A 2MSCB 4NPHA 4NE2A 4Q4AA 1LVGA 1EWRA 4DT1B 2XJ4A 2FPMA 3F5FA 1ZC4A 1HH4A 1SQ5A 1TU4A 1UEJA 3WNBA 2G0TA 1VIAA 1G3UA 2GBLA 4F7WA 4RD3A 3NHBA 1VTKA 2HLDA 3A4MA 3AP3A 3ZQ6A 1P9WA 4B2LA 2BBTA 3PUZA 4NKRA 1D5CA 2AFIE 1GRQA 1XCGB 5F98A 4JS0A 1TU3A 3AF1A 4LRWA 3TLXA 4QFMA 2WOOA 3E5HA 1XTRA 3GD7A 4RD0A 4Z54A 3Q72A 1S9HA 2QE7A 2XOKA 4CVNA 1N6HA 1UF9A 2XZPA 2O8DB 2OBMA 1Z07A 3PUVA 1KI2A 5BYKA 1MOZA 3AP1A 2NO9A 4A8JC 2OO7A 4B2PA 5FBVB 4H9GA 1H65A 1R7RA 1KMHB 4TT3A 5IF9A 4UNNA 1HQYE 2QAGB 1XMSA 2X2EA 3I8SA 5DO9A 4JLOA 3PEWA 2AR7A 5JRZA 3CNLA 2AFHE 4OI4A 2H16A 1IY1A 1UAAA 3I5YA 1ZUIA 2VSFA 5FBRB 1XBTA 3W34A 1ZM2A 4HDOB 1GZSA 4KYIB 5CM8B 4RD1A 4LHVA 1PJRA 1HUQA 1R2QA 4M9XA 2WKRA 1YZLA 2XSZD 3NBZC 4DUGD 1XEFA 4BFTA 2ZE7A 4CEHA 3WYGA 2GJAA 3QKSB 3X1WA 4B34A 4Q9IA 4Y0VA 1CR1A 2FZ4A 3HP1A 2ZS9A 1W46A 1JR3D 2Z4RA 3LXRA 2IF0A 4HUQA 4M53A 5SZJA 2OM2A 5HZHA 2PZEA 1ESNA 4NCJA 5L8VA 5C18A 4HDCA 2GCNA 4P4TA 2ERXA 2ATVA 1E1RD 1TAGA 1II8A 1QHNA 1RRGA 3L0PA 5AUOB 2NMVA 3EPLA 2D2FA 4M1OA 4YMUA 1ZM7A 1FUKA 2EFDB 5G40A 1YZQA 4PHGA 2FFHA 3THOA 4ERNA 2JJ2D 4KCGA 3SS8A 3KTAB 5JFGA 3ICEA 4BLSA 2FMXA 1KJYA 1G19A 1VCOA 3R8CA 2QM8A 2ZREA 4II7A 3KJGA 3SJCA 3TMKA 4OI1A 1KNQA 1G20E 4NH0A 4POAA 4CEJB 4RKEA 5AK0A 1MO3A 3CM0A 4S2EA 1XJQA 1ZNZA 4NCIA 4GL2A 4D80A 3IO3A 2F9LA 2GXUA 3OE7A 3H1TA 2OILA 3LVQE 4GOXA 121PA 3AVUA 3L2OB 3GJ3A 1E2FA 1HE1C 3M0EA 5EP2A 4RFSB 1OB2A 3CW2A 4EJSA 2IXGA 1DARA 1OIVA 3D8BA 4D4JA 2F1JA 4V0LA 3RABA 4D82A 1AS2A 1Z0FA 1XX6A 1WF3A 3IQXA 4TWZA 1E4VA 2BM0A 621PA 4RFVA 4A0HA 4PC1A 2BKEA 4IXMA 4OI0A 5BQ5A 2X77A 2FH5B 5HE8A 4A9AA 2ANCA 3SC3A 3LH5A 1SHKA 3AF4A 1UBEA 4BLQA 4LV6A 3ZVNA 5G41A 4UXJA 1K8RA 4EFNA 2C77A 2BCJQ 3EZ2A 1CXZA 1K5DA 5FUYA 4EPYA 5AUNB 1G8GA 3B7GA 2WV9A 4TLAA 3KUDA 1GUAA 1KDOA 4XWAA 3AVQA 5FTNA 4AG5A 5FH9A 1XD2B 1KSFX 3CX7A 3EW9A 3ZS8A 2P0EA 4C0QC 4NCKA 4QHTA 5FI1B 1XPOA 2ODEA 4URXR 1OIWA 2ECKA 1E2QA 4Z8YA 2J0VA 4PZZA 2ZR7A 4OQLA 4C7OB 4DLVA 4ZCMA 1R10A 4AURA 5C2JB 2AK3A 3EG5A 3LWNA 1TUEA 2ASEA 2F3RA 4EPVA 5CK4A 1CKEA 1GRNA 3ZD7A 3L43A 3U7GA 2A30A 2YV5A 3Q5DA 1Y63A 1J7KA 1OKKA 3DVLA 5BXQC 5J4VA 4HYYA 2QAGA 3RS7A 5H8WA 4S35A 1Z0KA 3CNOA 3FKSD 2QPAA 2Q3MA 3TH5A 1JR6A 3T5GA 3K70C 1GILA 2Q21A 4URZR 1KK2A 1KY2A 2MMGA 3GLHE 4G3XA 1XD8A 2KI5A 3FWYA 5JWRA 3AV0B 3J81k 1TX4B 1GNRA 3K0AA 3HR8A 3IHWA 4Q47A 3MWJA 1UEIA 3OFNA 3OZXA 4A82A 3DOEA 4JVLA 1BO6A 1Z6AA 5JJKA 2F1HA 3TE6A 2V1UA 2FOLA 1XTQA 4MGIR 2VTKA 1DAEA 3LNCA 2C2HA 2PL3A 4F93B 2OBNA 2ZE5A 5GVSA 3S1AB 1GL6A 3K53A 3NIBA 3W6NA 4EAQA 1NKTA 5AWFC 2XAUA 3A37A 2VP5A 3AB3A 1A82A 2ZANA 4OI2A 1OLOA 5LBIA 3N5CA 5JI2E 4QM7A 4KFRA 2J9RA 3CF2A 1M7BA 4RZUA 2YWHA 4X8HA 3A58B 1TQ4A 1UDXA 4LYJA 4PPGA 1IY2A 1E1RA 1G8HA 5B57C 1KMHA 1DPFA 1Q20A 2WICA 2OZEA 2F7SA 4QXAA 2PLFA 5SZIA 1JR3E 1OYWA 3AKEA 1TQDA 1E2JA 2P5TB 4LPKA 3RRYA 1RPZA 3AVTA 3BAFA 1EX7A 3UMSA 3H84A 3K0FA 4B48A 1FNMA 1W36C 1JXMA 4BPBA 1PLKA 3O8BA 3PQCA 1II9A 1XXHA 1ZM4A 1TTTA 1S3GA 3B13B 4MYCA 1Z6TA 2B7BA 3WYFA 3OHMA 2WWFA 1T0HB 5FOXA 4HZUA 3EWSA 5JCZA 3QKUA 1Z0AA 1G1MA 1ZNWA 5E7MA 3VMFA 1IBRA 2OFXA 1DG1G 3K0SA 3PEYA 1QHHB 4V0OA 4C0KA 3AEZA 4B3XA 4YMVA 4LHYA 2RGXA 3RS0A 2GK7A 3D3QA 3FDIA 4B43A 3IBGA 4PC3A 2ZRMA 4L8GA 1VHTA 1P62B 1FP6A 2CK3D 3CNNA 4FW9A 3CH5A 1DAFA 3RS5A 4U02A 4AKHA 1E3MA 1WE2A 4IJMA 4D25A 3UK6A 5F3WB 1RYHA 1HTWA 1U99A 4DB2A 2EU8A 2QTHA 4GRAA 4M9QA 3X1ZA 2QN6A 4PC6A 5KUTA 4EQ6B 2B8TA 5KHOC 2P6RA 3CLVA 1G8FA 1CIPA 3T1VA 1JNYA 1W5TA 4PHFA 3QSYA 4MKHA 5CB8A 1LS1A 1Z0IA 2CCJA 1ZINA 5FBWB 1D9ZA 2QG6A 5DI3B 4IRUB 4OHXA 2F6RA 4LC1A 4DVGA 4XWOA 4LHXA 2XEXA 2P65A 1OV4A 3VHLB 1X86B 1XMVA 1IJFA 1DO0A 2HDNB 2AN9A 4WIAA 4ASUD 2O5VA 4MDFA 1U90A 4FIDA 4R98A 3KJHA 3QXXA 1AJEA 5DE3A 2BVNA 1EFCA 1OFIA 3UG7A 4MRRA 1OYYA 3DKPA 1RYFA 1TF2A 4O2LA 4Q5IA 1CTQA 1ZYUA 5GJCA 1JQJC 2LKDA 2X8AA 3GJ4A 2G6BA 1GVNB 1J90A 2RGNC 1O3YA 3X1DA 1IOZA 1AKYA 4AWXA 4DLRA 3AF3A 4HB2A 4YC7A 3EPJA 3U44B 1E2HA 4PO1A 2HXSA 4A2QA 4WW0A 1ZJ6A 1VG0B 4OQMA 2FPLA 4M1KA 2IT1A 3EC2A 1S9DA 3VR1A 4TLEA 3IILA 1KKMA 4K8OA 2SHKA 3VR2A 2DR3A 4Q1DA 2A7QA 1XF9A 4URWR 4HB3A 4KO8A 1YR9A 3LO5A 4JLKA 3PXGA 3T35A 5JJLA 1F2TB 1FX0A 3FMFA 4KYUA 3DKVA 2HYIC 5FL7D 3AVWA 4CGZA 4HATA 3PJRA 4PSVA 1I2DA 5EXTA 3L82B 2RHDA 1Q57A 3BS4A 1XD2A 4O25A 2B92A 2IYUA 4IEEA 1CJVC 4HAXA 2Z5FA 3KKNA 1MO6A 2J7PD 5AJXA 2WKPA 4OHZA 821PA 4AKIA 3LXXA 4ZI3A 2ZRBA 3QENA 4DWJA 1ZVQA 5FUWA 3ZJYA 1YZUA 3BK7A 4PX9A 5D3MA 1W0KD 3UATA 2JIZA 4HB4A 4WXRA 3GLIB 5CLQA 5DYGA 1XZQA 2W00A 4EPXA 4DSUA 4QL3A 3VX4A 4ASUA 4BLPA 3EIHA 1V5WA 4B32A 4LPSA 1Q1BA 4M1TA 3A4LA 1E2GA 5TMPA 4BE7B 4L5BA 1BS1A 2C9CA 2KWIA 4M1SA 1OXXK 1P60A 4WVFA 3I61A 3QKSA 1VMAA 5FOWA 1OHHD 1X6VA 2QMHA 2A9KA 2IWHA 3ZH9B 1PUJA 3UG6A 5DSZA 3K9NA 1U9IA 3U4QA 4DJTA 3U61B 1EFRD 3WBKA 3H4MA 3CH4B 1OFHA 4HAZA 2O8DA 4Q7KA 3QXJA 4MUBA 3KKPA 3KX2A 4G01B 4JJKA 4NL4H 4OBEA 3BORA 4NYIQ 3W5JA 4D0LB 3GFTA 4PSAA 3QXHA 4C2UA 5KSYA 4DSNA 3FHOA 1LV7A 2WJIA 5BWMA 5KSOA 3PEVA 1R8SA 1Z8FA 1VCIA 2G1JA 1NVVQ 1QVAA 3CRQA 2CE7A 2D74A 4PR0A 3AVXA 3TNFA 4QGAA 5HKKD 3RLFA 2ZIAA 3NVAA 1L2TA 4P32A 4BGDA 5FOTA 2OCPA 4C7OA 2A5JA 1S96A 2VHUA 3A36A 1QDEA 4CEJA 1HE8B 1SVMA 1LY1A 5AJZA 2BDTA 3I3SR 1KI3A 3DM5A 2IA5A 5EE5B 1CLUA 4MDEA 2YKGA 3W8RA 1KI7A 1XDBA 1NVWQ 1UBFA 5DH9A 2ZITA 4Q4HA 2CL6X 3TQFA 4D0NA 3W9YA 1JAIA 5H70A 3C4JA 1QHGA 2REBA 2GA8A 2EVWX 3T15A 3Q8XB 2DB3A 4GOJA 2KBFA 3C8UA 2PBRA 2PMKA 4MYHA 3W5IA 3GJ5A 1ANKA 1QHSA 3CZQA 1ZU5A 3QPVA 1TQ6A 4YDHB 4CZ2A 5DLQC 3EPKA 5H1YA 3HU3A 1X8JA 2PEZA 4JBYA 2JLQA 1SGWA 2OEPA 4HZUB 5KNDA 2ODBA 3WRYC 2GRJA 4Q4HB 3U3RA 3UWKA 2QTFA 1BYUA 1NP6A 4LBVA 1R0ZA 3DEFA 3OIVA 4X8OA 3BERA 1KDPA 1RE0A 1W1WA 3U3OA 4DCTA 1PV4A 3BWDD 2F55A 1G7TA 3GFPA 2R62A 3FFAA 2H92A 3GQBA 3VAAA 1HQCA 4R2HA 4YQFA 1X1RA 2PX3A 2YWFA 4JVNA 2RGBA 1DEKA 4IVPA 1GKYA 1EFHA 1OB5A 1KO1A 1JPJA 1ZD1A 3FYHA 5LD2C 1FPMA 1Y3AA 3DO6A 1LFDB 2NZ8A 2C78A 2OFOA 3IIMA 1OXTA 3W6OA 2ZETA 2NO0A 4C0SA 4PFSA 4Q1EA 4H1UA 2C04A 2NO1A 5KNCA 2VEDA 3QY0A 4Q9LA 3SNHA 2AD5A 1VYTA 3ZGXA 1G3RA 1YU9A 3IDQA 3M6AA 4KFTA 1DE0A 1LW7A 4Q48A 4C0HA 4B33A 2CJWB 2CLDX 3K0FB 3PUYA 1NL3A 1IONA 2YHSA 3LW8A 1WA5A 2IEYA 3OAAD 3TR0A 3K09A 3B6EA 3K09C 3B82A 4TTPA 1H8HD 1RC8A 1UPTA 4Q7MB 5DYIA 2ZI3A 3N2IA 2XXAB 3QQ5A 3H0KA 2VP2A 3EA0A 2NZJA 1N5IA 3VU9B 2A5GA 4E22A 3OAAA 2AWNA 2MSEB 2ZAMA 3V00A 3NC1C 4JYCA 4DC9A 2IYWA 3DM9B 1GRRA 4TQAA 4IKEA 4KBFA 2R6FA 1SVOA 2N1BA 3MGCA 5EP1A 2GWHA 4QG7A 4KU4A 4QGGA 4BZPA 1JEEA 4YDSA 3MWLA 3PITA 4XVUA 2VA8A 4IDOA 4GT1A 1CRQA 3B1XA 4UXIA 5FBQB 5CB6A 1G3MA 4XWKA 3L0OA 4ZDJA 1MKYA 4GMDA 3GJ0A 4QBHA 4MUAA 4R9UC 2RGGA 4RY2A 3QI2A 3I5XA 4MKFA 4ZO4A 2J46A 3QF4B 4RD6A 5TV2A 3ND9A 2QUZA 1F5NA 1NVUQ 1TUIA 2B8WA 1XB2A 2XNDD 2XSZA 3WNCA 4Y0AA 4A8JB 5JMTA 2V1XA 3V4RA 2ZUBA 4BFZA 2B21A 1P6XA 4EJSB 1U2RA 4C2TA 2IS4A 4LJ9A 3THYB 1YRAA 1T0JB 4GOKA 4JLDA 1P2TA 1T4GA 1YKSA 1JALA 2ZTSA 3U7HB 3B60A 4OKSA 2QSZA 5FBLB 2GF0A 3I92A 2GEUA 2XZOA 1RRPA 3DHWC 2Q9BA 4FWIB 3NKVA 5BN5A 1CS4C 3AVVA 3BD9A 4MRSA 2ZSAA 4V02A 3LLMA 4W7SA 5G3YA 1N6NA 4B44A 1W2GA 4QRHA 2AX4A 3DDCA 3GMTA 4PANA 2O8FB 3I4LA 3DMNA 1YR7A 3GLGA 5CK5A 4F38A 4BFUA 1KOFA 4X8MA 4X8LA 1E0JA 2L0XA 5FOUA 2P6UA 3RSLA 3NBFA 1DADA 4AY2A 1XFAA 4Q01A 5JEDA 4DLZA 2YWEA 2BEKA 3FE2A 1EX6A 2QRZA 4BFSA 2QNRA 2VRWA 2YNMA 1Q0UA 1E2DA 4RJLA 2A5DA 4M8NE 4BUJA 2VHJA 4PZYA 2V4ZA 4PPFA 4F4JA 3C41J 1MH1A 2QM7A 1YJ5A 4KFSA 3AGPA 3R7WB 2IYSA 3ICQB 1VCNA 3CRVA 5FR1A 4Q18A 2J87A 4DLSA 2QROA 4DSOA 1U8AA 2GJKA 3U4QB 3GLHA 5TXGA 2W2TA 1J70A 4Q21A 1KJWA 3B5JA 4TYNA 1MR3F 5IHPA 5FPYA 1E9BA 3N2EA 3RWOA 2AXNA 3PG5A 1G4AE 2YJTD 3EARA 2G1KA 2RGCA 4Q1CA 4BLRA 5K8LA 3LY5A 3SHWA 2GK6A 4L16A 3LBHA 1T3LA 4HLUC 2EFCB 3S1AA 1OHHA 2FFAA 5FOSA 1ZCAA 2FU5C 1XPRA 1LB1B 2NO6A 5AJVB 4I81A 1G5RA 2D4HA 1G8YA 2VSXA 2ZJYA 3SOPA 1IXSB 1E9EA 1F60A 1KDTA 1Q1QA 1PVOA 1E32A 2IXEA 2W0MA 4LV5B 1TEVA 4I1VA 4LJ4A 5GJWC 2AL7A 3CRMA 1CJUC 1KO7A 3Q3JB 1TF7A 2R6GA 3RSOA 3O8CA 4DB4A 1V43A 4TL8A 3LV8A 4RSGA 4EPWA 2O8CB 1FW6A 1E9AA 1FL9A 2IYZA 5HCIA 4WBSA 1K6MA 1Z6XA 5KU1A 4P4SA 4OQXA 4H1VA 1UFQA 2GZDA 3QBTA 1ZCBA 5DNYB 4BFXA 4RCZA 2OCYC 2VPPA 4LBZA 2ZRPA 3ZVMA 2ZRJA 4XIGS 1PLJA 2ZXUA 4LJ6A 3AF2A 1NJGA 3FTQA 1U0LA 5TY0A 2I1QA 1SVLA 3TUJC 5L3SB 1A2KC 2JDIA 2O8CA 2FNAA 1DAMA 1NI3A 3RVBA 1CEEA 1X3SA 4RD2A 5FUVA 4ZKEA 2ORVA 3CONA 4RFSA 5F9HA 3R8FA 2QT1A 5H68A 2E9SA 1K5GA 1OW3B 2FGJA 4B6FA 2ZI6A 3VHXA 5E4FA 3GPLA 1XU4A 2LWIA 4TMWA 2KE5A 1DAGA 4ITRC 5A4JA 3NG1A 4JLMA 4MRNA 5E95A 2GILA 1KHTA 2UZIR 2ANBA 2JATA 1UKZA 4YLGA 3DMDA 5EUMA 5FTKA 4QGFA 4AYWA 1HY3A 1NMZA 1SXJE 3HU2A 2C8VA 3RDPA 4DCVA 3AP2A 1NJFA 2HXYA 3KQUA 4DDUA 4I1OA 2OCBA 5EXPA 1AZTA 4ZKDA 3QVVA 1KSGA 3LD9A 5DIFA 3GCGA 3UXMA 3KDSE 1HEIA 1VDZA 5KSPA 1P5ZB 4DLXA 2D7DA 4P3YA 4JKIA 2ZU0C 1J2JA 2ZE8A 1US8B 3LDAA 5FTLA 2JAQA 1G7RA 2V6JA 1YZGA 4JMPA 2QTVB 3BH0A 1QVRA 3IPYA 3BOSA 4NBSA 4TN1A 4URYR 2FX3A 5KYKA 2FEMA 3RRNA 2VYFA 1ZNXA 1XJ0A 2WM9B 2BOVA 3TJZA 2YWGA 4KLNA 3WP0A 4LBYA 2WWYA 2ZAOA 4KXFB 3IO5A 2Q9AA 5G3ZA 3V4FA 3CPEA 5E3HA 3CX8A 2XJ9A 1SXJB 2ONKA 4NCHA 3W90A 2OHFA 3PVSA 5IK2D 4L4UA 2O8BB 2ZEJA 1EFUA 2VBCA 3RS2A 3A1WA 2ZYTX 4LDJA 1Q3TA 2NIPA 3PEUA 4KHZA 4M0LA 1JJ7A 1EFTA 2R9VA 4HSEA 4RKFA 3BH7A 2Q3FA 5FTJA 2BBSA 4DIEA 4DDWA 2JLVA 4I1UA 4LWZA 1AGRA 2V6IA 4FWTA 1KK3A 1XTSA 2IUTA 3MG9A 3TBKA 2O52A 3OEEA 1JECA 1G17A 3IQWA 3V9PA 2O8EB 4EIWA 2ZVPX 4CIDA 2G77B 1RJ9B 5J40A 4UNQA 2NGRA 5FTMA 4E03A 4F92B 2REOA 3K1JA 4M4SA 2QEQA 3K8YA 5CJ2A 2HEIA 4QBFA 2R2AA 3MRSA 2O0HA 2ZYUX 3EWAA 2YOHA 5A0FA 1W0JA 1T9HA 2QE7D 2XOKD 2D62A 1W44A 1T5IA 2IX3A 1MT0A 2WHXA 1QBKC 1E0KA 4N0DA 4TTQA 4TLDA 1WBBA 1PLLA 3G5UA 4ACBA 4HLCA 3THXA 4URVR 2ZRAA 4KODA 4U00A 2QGZA 2YZ2A 2VP6A 3U5ZB 4BZXA 2P6NA 4ARZB 4B35A 4IOLA 1M74A 2OAQ1 3ND8A 4J0QA 2VHQA 1FUUA 2CMKA 3KQLA 1UKEA 2IC5A 2RCNA 3OEHA 3AVOA 3U3JA 3MD0A 2VL7A 4F4CA 3K0CC 2F1RA 4RZXA 1KZ7B 3TK1A 1P75A 2YINC 4JKYA 1FZQA 3AKDA 2C5LA 2PMDA 1EFRA 3EAQA 3RAPR 5D3MB 4P4SB 5BN3A 5KNBA 1LS6A 2F3TA 3KKOA 4GPTA 2JLZA 2O0KA 1TNDA 2UZ3A 1CU1A 3AGQA 4XJXA 4URUR 3JVVA 2ZVQX 3VNUA 2ZYWX 4LCBA 4Q1BA 3D31A 1E99A 1W36B 1NN0A 4DRZA 1XRJA 4N1AA 4KITB 3OFND 4CEIA 3JVUA 4FINA 4HDQB 2CLSA 3LVRE 3CRRA 4DBLC 2RMKA 5IDVA 1NBMD 1BKDR 5BW8A 2ZM5A 3TSWA 2YC4C 2FDCA 1SZPA 3X1YA 2OE2A 2A3RA 1W48A 3NEYA 4B71A 1KI9A 3QKTA 1OIXA 2J7PA 2ZQ5A 2ORWA 4PQFA 2CHVA 2ZI9A 4JL5A 4V0KA 1KKLA 1XCPA 4L15A 4WZ6A 4UNSA 4TMXA 5JZVA 1MRNA 3ETLA 4IVRA 3T12A 5UKDA 2AKYA 2GVDC 3IEVA 2WKQA 1VKJA 3CF0A 1XP8A 2Z83A 3M4YA 2CE2X 4KV9A 3U7FB 4LBWA 2G9NA 3NEJA 4TMKA 1W0JD 4JL8A 4PPNA 4FN5A 1Z06A 1S3SA 3GJXC 2QMUA 1F2UA 4FMDF 4ON9A 4PAQA 3AUXA 3CR8A 3TQCA 3WXMA 5KO2A 2NO7A 3CUEF 3FOZA 2IXFA 2FEOA 3SJZA 4N0EA 3Q5EA 1E79A 5LDDC 3HR7A 3ZD6A 1FOEB 3IUYA 4UQOA 2GAAA 4MKIA 4JT4A 1E0AA 3W3AA 1KO4A 3VR4A 4AIIA 2JA1A 4Z1MD 4Q7LA 2BJVA 3O8RA 3QXSA 2R6DA 4Q9KA 5B58C 2HCJB 4OK5A 2GXAA 1M2OB 4LC0A 4U7DA 2ZJAA 4DLYA 2WMOB 4PTLA 3TVDA 4QOSA 2CDNA 2FPKA 4TZ6A 2VHTA 1C4OA 1HV8A 3CR7A 1UJ2A 3EZFA 4LJYA 4ZCIA 4LOAA 2CVFA 2PJZA 4JJZA 1LTQA 3CPJB 1N25A 3Q9LA 2GDJA 5CDFA 1XPUA 4GMXA 1XTKA 1CJTC 2XTMA 4LYHA 2W58A 5KOYA 1JAHA 2ODWA 3PENA 4YMWA 4CF7A 4Q4AB 4TYPA 4JSTA 3U60B 1LNZA 1SKQA 3HYTA 5DISB 2O8EA 4HUTA 1FX0B 2FFBA 1G5TA 3QEOA 1W2HA 3QOFA 1MABA 1ZD9A 5K8UA 1OF1A 2J7KA 2OV2A 3BBPA 1COWD 2XITA 4EPTA 3W3ZB 2EQBA 2JIZD 2PCLA 2OFWA 4KI0A 3SZRA 2QY9A 1NLZA 3L0IB 4JLNA 1ZAKA 1J8MF 5A5GA 3B85A 2ORIA 2QU8A 4QJ3A 1COWA 1F2TA 2GF9A 2IK8A 3CO5A 4A15A 2JJ2A 2ZRCA 4ZDIA 1JXOA 2WZQA 3NDBB 3OEHD 1WP9A 3C5HA 2X1VA 4C0JA 1ZMXA 2PCJA 4GDFA 1NNEA 2IUSA 3A1SA 3OEED 2J0UA 4A2WA 2H1LA 1IXRC 3HJNA 1IM2A 4AG6A 2N46A 3KFXA 1CULC 2JDID 2DFKB 1QG4A 3PV0A 4FCVA 2WTUA 1SHZA 4KSCA 1XTJA 4YMTA 4C3ZA 1R5NA 2FFQA 1E9FA 1W4CA 4AKGA 2F1IA 2PH1A 4MGZR 2FSFA 3F0TA 2WWIA 1T5LA 1ZBDA 1BMFD 3MMPA 3K0EA 2BHRA 2QAJA 4WXPA 3SR0A 2Q9CA 4PXAA 3I73A 5E7JA 2ZSEA 3T1TA 4CEHB 4Q1FA 4V0NA 1EESA 1R0WA 5DGXA 3R7WA 1N6OA 2GEVA 1ZUNB 4M22A 2ZRKA 3NBXX 4DT1A 1E9RA 4PSKA 2GESA 4KAXA 1G41A 1X1SA 2LKCA 3EXAA 2FV8A 4TL9A 1KI8A 3VR5A 1ZD8A 2Z43A 2CLCX 3ZVRA 4V0MA 3QIAA 2WWHA 5L3QB 3RANA 1JBKA 1U8YA 1AA9A 2W6IA 1W0KA 2QORA 4JYBA 3REGA 1EK0A 5LD2B 3QPUA 3KB1A 5JECA 2IF2A 3WMGA 1U81A 1GKUB 1VECA 2KBEA 3UIEA 2WPDA 1UBGA 2H57A 4AK9A 2ZRNA 2FE4A 3QBVA 2ZUCA 1QHXA 4GFDA 1YE8A 5CYOA 721PA 3REFA 5JRJA 2XZLA 1NG9A 1NKSA 1GNQA 1TADA 1W4BA 3IPXA 3NXSA 5J4YA 1GFIA 2ZJ8A 3BC1A 1KJZA 3AVPA 4WOPA 4AKEA 3PUWA 2FSGA 1L4YA 4HZIA 2R65A 2BMFA 3PUXA 4RVCA 4B2IA 5IRCD 2WWXA 2DBYA 4B3BA 3TAHA 4JIMA 3O8DA 3THWA 4DIDA 5HR5A 2F43B 1N5LA 2IHYA 2DY1A 1ZP6A 1R0YA 4XTRA 1RFLA 3RS4A 1ESMA 3U3KA 3NBYC 5IT5A 4B47A 2JLUA 3HWSA 3FFBA 2QL6A 4GZMA 1G7CA 4A36A 3TAUA 2VHCA 2ZYVX 5K8IA 2P3SA 1E1QA 2C03A 2JJ1A 3CF6R 4G5QA 2ZRFA 4G1UC 1SKYB 3DPUA 4KSBA 5JHHB 1W4RA 1YQTA 3AF0A 1RRCA 1GM5A 4ZI2A 2IYYA 1SXJC 2ATXA 3A8TA 4IFBA 1OJLA 4R7ZA 5J47A 3GLIE 3UKDA 1N0VC 4NU0A 5EE0A 2ZJ5A 1D2EA 3CWZA 2D2EA 3SDZA 1ODFA 4PC2A 3QUSA 4B76A 1P3JA 4KBGA 2ERYA 2GJ8A 1QZXA 1N6RA 4NHOA 1WRBA 3P1JA 2J3EA 1CJMA 4M9ZA 1DAKA 5FL3A 3Q7QA 1CR4A 5EZ6B 3ZS9A 1U8ZA 3WRXC 3AM1A 1N0UA 3KFVA 1S1CA 1QHIA 2E87A 4LUCA 2ZI4A 3CRW1 4Q02A 3MWKA 4AI6A 3KJEA 1XEWX 2Q0HA 3GEHA 3WP1B 1NG1A 3AVYA 4C4PA 1GG2A 1Q1EA 3QKRA 5HKKA 4HEJA 4ZIRB 1GTVA 2IW3A 3B1YA 1R5BA 2OESA 3DL0A 4GSYA 3VU9A 5L3SA 1G5PA 2ZROA 2WSSD 1E94E 3LX5A 2HF8A 4QJ5A 3ADBA 1E4YA 2C96A 3K9HA 4NYMQ 2BMJA 3IBYA 2ZE6A 1MO5A 3UPUA 4KVAA 4WA7A 4TL6A 2C9OA 4E07A 4CT4B 2JLSA 3TSZA 5KTYA 1Z2CA 1S8FA 3BFXA 5CYPA 3RS3A 2IYQA 5CITA 4JLPA 4RCYA 2A2ZA 3ZIAD 3GLGB 3LLUA 5E7IA 3FPAA 3KUCA 4ZPXA 2HT1A 4QNRA 2E1RA 2QQ0A 3AQ4A 3CKLA 2GXQA 2BJWA 3LW7A 3LRPA 3G0HA 1KZGB 5AJWA 3QNUA 3KL4A 421PA 2XB2A 4UKDA 1G4UR 3C15C 1SXJA 4V0ME 4Q4JA 1E98A 4YXWD 3P4XA 2P67A 2HUPA 3KXKA 4IHQA 4UJ3A 1TL7C 1W7AA 1YRBA 2J0UB 3BB3A 2QPOA 1G18A 4O3MA 1FTSA 4CRWB 2DWOA 3W8NA 4FMCB 1FP7A 1YZTA 2DFTA 4NTZA 1T8UA 4TTRA 1Q1ZA 1NSTA 1G16A 5FPKA 4QM6A 3VNVA 4MYUA 4DUGA 2OXCA 2ZRHA 2AD1A 3EIEA 4PHHA 1GL9B 4FCTA 1XNJA 1NN3A 1XD9A 3MFYA 5DHFA 1AM4D 1ZM9A 4A0GA 2BM1A 3GEIA 2EFGA 4D4MA 4LY6A 4RZ2A 4BECA 2ZUDA 1TPZA 2EYQA 2OSBA 2XTNA 4DEYA 5JLJA 2PX0A 4HAUA 5JWOA 2R44A 1QHHA 3OIWA 4Q9HA 5J4HA 3BJIC 1XCMA 3JZMA 4A1FA 4OHVA 5C1BA 4NYMR 2XNSA 3QPWA 4QHYA 5FPSA 2PEYA 4M9SA 1KNXA 4JLVA 1BYIA 3E1SA 3T1OA 4C0BA 3KXLA 4TMZA 4B75A 3GLFA 3UWOA 1HYQA 3CPHA 5AJYA 2HLDD 5M04A 3QE0A 4BEBA 5GVRA 1N5KA 3RRMA 1M34E 5KPJA 4G5RA 3BH6A 3PR1A 1ZIPA 2W6JD 1Q21A 4TQUS 3FKSA 3CWQA 1WXQA 1OPXA 5HTKA 3VX3A 5EE9A 3ASZA 3ZZ0A 1CR2A 1UKVY 2ZU6A 4M21A 5CDFE 2J59A 3B1WA 2JJ8A 5ANRB 1BIFA 4LSGA 2QP4A 2GTPA 3QG1A 3F8TA 3MLEA 5C4GB 1JI0A 2WJHA 1IN4A 3TKLA 5TVKA 4OK3A 1L4UA 4QKQA 2ZR0A 4IOMA 3TRFA 4L9SA 1DELA 3QJYA 1JJVA 3MCAA 2CBZA 3TR5A 2VO1A 3BRWD 4P31A 5KDDA 1B23P 1KO5A 3PIRA 4LJAA 4DLTA 1J99A 1QRAA 2K5UA 1FTNA 1R8QA 2BEJA 5EP4A 4ACAA 2ZR9A 3F3YA 2ZRLA 2WVJA 4K81B 4OL0A 4DCNA 2V54A 1OH5A 4NYJQ 5TDHA 3SBDA 4GI7A 2CL7X 1E9SA 1OFUX 2QAGC 4TYYA 1F2UB 1NRJB 3SFZA 3GEEA 2QP9X 4GP7A 4EPRA 3M1IA 3WY9A 1KYIA 3E2IA 2C95A 2WBLC 4D26A 3CBQA 1GITA 1XTIA 3IIKA 3SN6A 1P73A 3P32A 3I32A 4BFWA 2J1LA 4NYIR 4TL7A 1KI6A 2ONJA 1TQ2A 2QQEA 5CLLA 4JZKA 4LZZA 2PT7A 2VSOA 2JGNA 4D0GA 3E70C 4MYTA 3FMOB 2HT6A 3U6BA 1GDDA 3C14C 3ADDA 4IFEA 3RWMB 1P7CA 1F48A 3SYKA 5HZKA 2H7VA 5EP3A 3U7EB 2DFLA 2OLJA 4DKXA 3RYTC 3THYA 1S0UA 2NTYC 4DDVA 3VKGA 3EZ6A 1A7JA 1U94A 2IHBA 2WJJA 2ZRGA 1NIJA 2ZI5A 2A78A 3BE4A 2ZRDA 3C16C 4O0MA 4DZZA 5EXXA 5EUQB 2OBLA 4GP6A 5AUQA 1AGPA 2R6CA 1RZ3A 2G3YA 1N3BA 3L8ZA 1T6NA 1KGDA 2YOFA 1KK0A 1YZNA 4M1MA 2ZSFA 3GJ7A 1AN0A 3X1XA 2KSQA 4F91B 2Z4SA 3U44A 1UM8A 2H8KA 4HAVA 4Q00A 1T3HA 4IDHA 1T91A 2IS1A 1EXMA 5JWHA 2J0SA 1U98A 3KKMA 2Q6TA 2I4IA 4FMCF 1KY3A 1OKKD 1XZPA 4FI3C 1VCMA 4XTCS 3L0SA 4O2RA 5SZHB 2BIFA 1G64A 5EZ5A 2RGDA 3TUIC 3I72A 3K70D 1T8TA 3BB4A 5CJPA 4LX0A 1H8ED 1Z22A 3QKRB 2ZJOA 3QXCA 1P9NA 4JBWA 3WYAA 4PC7A 1FFHA 2IL1A 3D7MA 4TYQA 5JI3E 2RAPA 2JEOA 2QMEA 4B73A 4TLBA 2A5FA 4G5SA 4US2R 2MSDB 4M1YA 6Q21A 1U9IC 4E5UA 4BWYA 1ELOA 1A5TA 3SJBA 1P2UA 4A6XA 3GLFE 5B64A 1Z5ZA 2WWGA 3OF5A 3IKJA 3NH9A 2CHQA 2GCPA 1Z63A 2GJ9A 1E2PA 1FMJA 2A5YB 3PCRB 3HPQA 1RJ9A 1VYUA 1E0SA 1HT2E 4IW3B 5C4MA 5F2EA 4HAWA 4KFUA 4A2PA 4Q7JB 2J5XA 4MA4A 5GJBA 2IUUA 3QF7A 3SEAA 1Q44A 1G6OA 4JSYA 2ZJ2A 2FSIA 2ZI7A 1P72A 2JCSA 2VP0A 4IEIA 1Q3HA 1NVXQ 4ZV4A 4C0LA 4MITA 5J5CA 3AKCA 3HPRA 1AS0A 4ZDWA 4ZCLA 3RHFA 1I4LD 4CW7A 1X8KA 1W36D 4G5OA 5J4LA 2IYLD 3RC3A 5ELXA 2Y8EA 5KDOA 1QF9A 1X8LA 1D8TA 3N70A 4DSTA 4QNMA 1Q12A 2B6HA 2CL0X 3R9IA 4Q9JA 1ZIOA 2ZSDA 2OUKA 1AQUA 4A0RA 3DZDA 2IEZA 4XVQA 1RKBA 2IYTA 4Q1AA 3TUZC 3AUYA 5FPTA 4Q03A 5AUPB 4TSFD 3TW8B 4LYAA 4EQ6A 3SYLA 3C7KA 1F3OA 2D06A 3NWJA 4OYHA 5KSZA 2NOAA 3T5DA 1AZSC 3C5CA 4W5JA 3VQTA 3CX6A 1Z6YA 4BFYA 3FKQA 3FHTA 4LV8B 2BWJA 2OT3B 2VF7A 3GJ6A 4KVGA 4LI0A 3EPHA 5FI0B 1R5OA 3KQHA 4JBXA 5D3QA 2FG5A 2C9YA 1KAOA 4QBIA 4PHTA 1YZKA 2FN4A 4QBGB 3A1VA 2UVQA 3B9QA 4KJZA 2W2VA 3X2SA 4L9WA 5EE3A 1KTVA 1A1VA 1Z2AA 5JJIA 3R20A 2GHIA 3H86A 1KI1A 1YR6A 4A6PA 4I4LA 5DN6A 4K46A 1IY0A 2Z6VA 2FZLA 1XEXA 1OXVA 3P4YA 4FXPA 5HPYB 1GWNA 2PT5A 4XSHA 2CCKA 1IJEA 5FL7A 5BYJA 2EWWA 1JQLB 1OH6A 2FA9A 1AIPA 1Z47A 2WOJA 4AC9A 3B9PA 1N6LA 1U0HC 4HLUA 5EQTA 1P61B 3KJIA 1U0JA 1GL7A 2CXXA 1A4RA 1DG3A 4NMMA 1E2NA 3P27A 4PZLA 4EFLA 1N6KA 2BBWA 4A8JA 3EA5A 1S2MA 4W5WA 1SXJD 4GZLA 4C9BA 1KSHA 5FFMA 4W9MC 3K70B 1Q22A 2GEDA 4Q19A 5L3RA 2WPDD 2PZGA 2VQSA 5IK2A 3SE0A 3IGFA 3OE7D 3QVUA 1G7SA 3IHLA 1OT3A 2GJSA 2VP9A 2XTZA 3B2EA 4PQRA 5FUXA 3KQKA 4Z51A 2V7QA 2PZFA 2P2LA 2CHGA 4IDQA 1NIPA 1OFTA 1ZM3A 2DWQA 2W83A 2WAYA 1M6NA 4BRUA 5JHGB 1N2CE 4BLTA 4OHWA 4DLWA 2DCUA 4DDTA 3MAAC 1H8EA 1JEDA 1TMKA 4HB0A 4TQ9A 4D81A 2JLXA 5J4KA 2O8FA 1J8YF 5EXSA 1E79D 1TF5A 2CJWA 1Z0JA 2I1VB 2CCGA 1HURA 1SKYE 5BN4A 2F9MA 3ZDQA 4LJ7A 4YONB 2DHRA 4IXNA 1ETUA 4HAYA 5JEEA 2QA5A 2QENA 4ESHA 2J0QA 1C9KA 1PZNA 1AS3A 1G8PA 1HA3A 3LQRA 3GLIA 2KB0A 4BZQA 3ZYCA 1M7GA 1NLYA 3SQXA 1IN5A 2BCGY 4OQFA 1GKIA 2RGEA 2GAOA 4FMDB 1N0WA 2H17A 3VKHA 3LX8A 2ZSBA 1IN7A 1Z0DA 2TMKA 4C0AC 2GETA 2WIBA 4CT5A 2C99A 1P4SA 2OG2A 4Q4LA 1B0UA 2YOGA 1EWQA 1NVVR 3GLHB 1RIFA 1R0XA 2FF7A 3BIFA 4ZIRA 4YMSA 4A4DA 3THXB 2ZPTX 1W4AA 1NN1A 2V9PA 1E6CA 1KI4A 1W5SA 3BGWA 4XOIA 4BEJA 1W47A 1ZC3A 4TT3D 3GP8A 1A2BA 1IXZA 4GNKA 5FPHA 2CVHA 3KB2A 4NONA 4R71A 2QT0A 3SI7A 1E9DA 2GZHA 2AXPA 3SBEA 1CR0A 4EUNA 2ZS8A 3WNDA 4US1R 2WMNB 2BMDA 2IYVA 3LAWA 1P9RA 1NY5A 3NHAA 3SFVA 2JASA 3MSXA 4DHEA 1VG9B 4N3NA 4YXWA 5JS8A 3U2QA 4RZ3A 4MRPA 1CBUA 4NP6A 2MMCA 2RHMA 2WJYA 4QGHA 3SHFA 2EW1A 1VG1A 3KQNA 4IOJA 5K8TA 1S1MA 3P20A 4M2LA 3FGNA 3W6PA 4NCNA 3ADKA 2AHOA 4XD7D 3WBJA 2RGAA 4MKGA 2WJGA 1JR3A 1DTSA 3GLGE 1GNPA 3OIUA 4MRVA 4QHSA 1E2EA 3GJ8A 1GP2A 2HJGA 4LHWA 1DS6A 1O87A 1YR8A 1R4AA 3PFIA 4ESVA 2HJVA 3A1TA 1II8B 5TARA 3KZ1E 2X2FA 1IHUA 5EE1A 221PA 2NPIA 3HYRA 2DYKA 2XGJA 2RKOA 3TSOA 2O0JA 5L3VA 2ZS7A 8OHMA 3LBIA 4LJ8A 5JS7A 521PA 3NC0C 3LFUA 1EG7A 1G3QA 1D2NA 1NBMA 2G88A 4JLBA 4TLCA 3EIQA 1Z6GA 4HI0E 2V3CC 4I99A 1MV5A 2VH5R 1E69A 2VLIA 5TB5A 3I1FA 1JB1A 3Q7PA 1WDTA 2KJQA 2R8RA 4MGYR 4DCUA 1BH2A 3T34A 3ZZTA 4B3GA 4LYFA 1N6IA 2W2XA 1E1QD 3I8XA 5FOVA 2BV3A 4V03A 1D2MA 2QBYB 3ONWA 1C1YA 2FJUA 3WMFA 3RC8A 3RRZA 2W6ID 2NPFA 1KDRA 2CEAA 4MH0R 1CF4A 3O47A 1IAQA 1WBDA 4I1SA 3THWB 2NQ2C 3IIJA 2RB4A 1RRFA 2DFNA 2WJVA 1UKYA 1ZW6A 1WB9A 3EZ9A 4WZBE 5CIWA 1VYVA 3TVTA 2YVUA 1OXUA 4D4LA 4FCWA 4IDNA 4PAMA 5P21A 5B30A 2QMOA 5JCPA 5DI3A 1BOFA 1SVWA 1Z83A 2BKUA 2VP4A 4ZDKA 1DBSA 1DO2A 5CM9C 3VKWA 3B8HA 1OH8A 2ZJZA 1L8QA 3GLFB 2IYRA 4UXHA 4PO9A 4OHYA 5HCNA 4BLOA 4US0R 3SQWA 4IOKA 1NY6A 3K9LA 4HUQB 2F43A 1ZU4A 2YC2C 1DOAA 3MJRA 3OESA 4HLDA 4C30A 3T06B 3WHKA 3WHLA 4D2IA 2G83A 2BC9A 2FGKA 1S4QA 4JT2A 5KDLA 1MABB 5KPDA 3AH8A 3FMPB 2HYDA 4AD8A 1AQYA 1XEWY 2QPTA 4B3DA 3CZPA 1XJCA 1OE0A 3L8YA 4PO8A 2IS2A 1L7VC 4UNPA 2BBOA 4QJ4A 4W5HA 1M7HA 3G82C 4B3CA 1DVRA 1XMJA 3LA6A 3LQQA 3P26A 1Z08A 2C98A 4EDHA 3R9WA 1VHLA 4HLQB 1N5JA 1E2LA 1JPNA 2QGNA 2WSMA 2QRNA 2XX3A 4Z8XA 5DI9A 2VIIA 1KI6B 4F4IA 2WIAA 3MUFA 4G0NA 3QF4A 5C46F 2H18A 1E2KA 2UKDA 2B7CA 2YYZA 3HDTA 4JLJA 1OH7A 1CP2A 2WAXA 4DXAA 1IN8A 1T3SA 2J45A 5SZKB 1KSJA 3A6PC 1WQ1R 1YVDA 3ZLJA 3B1ZA 3H2YA 1VG8A 3ECCA 4D6PA 4EFMA 3K0CA 3UMRA 3EC1A 2GCOB 3FVQA 3JZAA 2W6JA 2X19A 1NLFA 3A4NA 3TIFA 4A0FA 1IQPA 3DOFA 4DLUA 2ZJBA 4EKDA 2OAP1 1SVKA 4FMBB 3VFDA 1KO8A 5LB2A 3IEUA 1KAGA 2VF8A 1G291 2GXSA 1M1YE 2LCFA 4G5GA 2J41A 1I4DD 3SYNA 1D9XA 4WZAE 2GCOA 3RNLA 2WWWA 2GVZC 1WCV1 1DAHA 2GZAA 4QC2A 1UADA 5GJVC 4ARZA 3I62A 2O8BA 1CRPA 3T1QA 2FSHA 3NDPA 4P33A 4WAUA 4CYMA 5F9FA 2CNWD 1NBME 3EX7C 1P2SA 1YHNA 1NN5A 4UJ5A 4RD4A 1E9CA 1Z3IX 2N42A 1UDWA 4OQNA 3SU8A 2ZRIA 4B3FX 1N6PA 5HE9A 1P2VA 3WMEA 1R6BX 3FMIA 2QSYA 1D6JA 1AK2A 2EYUA 5L3QA 1GAJA 3QEJA 4IVQA 2FWRA 3AKYA 5EJEA 1E2IA 2REXB 4FD2A 4LJ5A 1VPLA 4NZYA 1NMYA 4JL6A 4BQSA 1GIAA 4DCSA 1ONBA 2GKSA 3DZ8A 3OIYA 3ASYA 2V8OA 1ZUHA 3VR6A 4P4UA 3BXZA 4PPQA 2QZ4A 1Z29A 3K9GA 1NMXA 1XEXB 2JJ1D 1G21E 4UNRA 4TMVA 2W0SA 4BFVA 1XXHB 3CB4A 3MWYW 2D7CA 3EASA 4NYJR 3B78A 3KXIA 4XH9B 4JVSB 1M8PA 2IBMA 1F6BA 3VTKA 2IWRA 3U6KA 1XMIA 2NG1A 4CEIB 2GBLC 2RH5A 4MGKR 4P0TA 2D3WA 4GBMA 1SULA 4XD7A 1OSNA 3EZ7A 1G9XA 2V55B 5JSZA 1RVDA 1XWIA 4MQBA 1CJKC 2HCBA 3A1UA 3SJAA 4OJKA 4LHZA 1NSFA 1Z28A 5FR2A 5B2ZA 2AKAB 4LGMA 3TW4A 4PQYA 4TSFA 2CNWA 1WMSA 2OLKA 1G6HA 2Q3HA 4XVRA 4ILEA 4JLAA 3KKQA 2EFEB 2HF9A 2XNDA 3QG5A 2QP3A 2R6AA 4OK6A 4EJSC 4LK2A 5LPNA 1GOTA 2GNOA 3ADCA 3B1VA 5JSZB 4AYXA 3TGPA 3FB4A 3HU1A 2IYXA 4M1WA 3ZZUA 4Z1MA 2JLWA 2WSSA 5JBQA 2JLRA 4BRWA 4TZ0A 4TMTA 4E09A 1OXSC 1QHYA 2OXRA 1IN6A 1I4TD 1RW4A 3BFKA 3VR3A 2DWPA 5GADl 1H8HA 1QG2A 2P5SA 3ZIAA 4JVMA 4DEXA 2XXAA 1US8A 2HV8A 1MRSA 2PLRA 1II0A 4OJQA 3U3MA 4B74A 3KTAA 1SVSA 1FMLA 4IDPA 3UANA 2AWOA 4U5XA 1LF0A 2QI9C 1TEXA 2EWVA 1G3IA 4NDZA 4A92A 4AYTA 1HT1E 5DN6D 2IS6A 2RGNA 2V7QD 1NF3A 3BB1A 3R9XA 3UMFA 1PUIA 1KMQA 1DAIA 3D6TB 2BMEA 1BMFA 1I2MA 1ZRHA 2QBYA 5LB4A 3K0AB 4BASA 2EFHB 4CDGA 2Z0MA 1FQKA 5DHAA 3NH6A 1XXHE
chains in the Genus database with same CATH superfamily
1DWPA 1TPYA 5K0NA 3WGNA 4LZWA 3T61A 1KYVA 1W9MA 3NVMB 4TWRA 4CM3A 3EXIA 3QVGA 2EJWA 4AF6A 4LJLA 1H6CA 3VO8A 1CPYA 1E2MA 1E96A 4O33A 3WGVA 1GN9A 1ZNYA 1S4MA 1EGAA 2QD1A 2UUBB 1BU5A 3JQEA 2FP4A 2JLYA 2R7LA 3SIPA 2OY0A 3ZDZB 2XB4A 3NTQA 2YJ3A 3P2YA 1GGMA 3BGVA 4PLZA 3L6RA 3ZR4B 4DOMA 3FHCB 4FKMA 5KNDD 3OKPA 3DF7A 3KR1A 1YNOA 3LECA 1XCLA 1OWPA 4MULA 5IU6A 2ODNA 3WMXA 3ZCUA 1P80A 3G2JA 3QE2A 2PJRA 1SD2A 5A7HA 2IDZA 4G1EB 2MWMA 3TB6A 4E4TA 4LF7B 4UM9D 4G1VA 2R97A 1V8OA 3ZQJA 4MCAA 3BSFA 1KBZA 5EJ2A 3RVJA 3D6UA 4AX8A 1H2EA 3Q7TA 3N0TA 1FU4A 2H00A 2NUPB 3WO0A 5JYBA 2GO7A 2MSCB 3KSDO 1S2LA 4Q4AA 1TZBA 1EWRA 4DT1B 1W1IA 4PE5B 4DMCA 2FWAA 2XJ4A 3UCXA 5EJ9A 3TB4A 1RQLA 2FPMA 2VP3A 3OQJA 4EHBA 2C4WA 1WW2A 5FI3A 2H08A 1N2GA 4A3SA 2PAAA 4H7IA 4RD3A 4H6WA 1V0JA 1VTKA 2HLDA 3F74A 4MMYB 3A4MA 5DP2A 1L5NA 4YLYA 1MFZA 3ZQ6A 1RRMA 4HL6A 2VHZA 2IOFA 4RVDA 1GPDG 4B2LA 5JD6A 4NKRA 1D5CA 1DQSA 3GA0A 3NFYA 1KZYC 5KOHA 1GRQA 2D54A 3KYDA 2JBWA 4LZNA 3IKVA 1WF6A 4JS0A 3VDXA 3DDWA 3TLXA 3V97A 1PQ4A 5IAOA 2G63A 2BGKA 5KQLA 4QFMA 3Q8WA 4AF8A 4RD0A 1C0PA 4WLOA 4ER0A 4M55A 3RJ9A 4CTMA 2FPOA 4RO0A 2APJA 4JR0A 4IO0A 1TFRA 1DZIA 1BCRA 1Z7GA 2R96A 3M5PA 3QVMA 1Z07A 4CTJA 3OZFA 1OLUA 3JQAB 4FHCA 2O2EA 2WM2A 3TTUA 4A8JC 1D0SA 4B2PA 4LCEA 5JNVA 4B3SB 2OG1A 4Y6SA 4ZO8A 1XSEA 2A94A 2AN4A 4GC9A 5DXAA 3K1AB 3UC9A 3VOAA 2X0NA 1P1HA 5IF9A 3RSGA 5U4XA 2RBEA 1BHQ1 5DO9A 4MOWA 1YFJA 4CNQA 4AN1A 2DY0A 1CETA 4EJ0A 5JH7A 4WCVA 3UJ8A 2AR7A 2H16A 1IY1A 3DE0X 1SC1A 3GJTA 4ZODA 3A2NA 3I5YA 1JNXX 1VSVA 2IY9A 2Z9CA 1ZUIA 2VSFA 3PC7A 1XBTA 4H6PA 1ZM2A 1ODSA 1B6RA 3G2OA 3IP1A 3KHTA 4HDOB 4KKXB 3WXBA 3UV6A 4M9XA 4MZDA 4XPIB 5KMGA 2Q9UA 2WKRA 2A9FA 1T13A 2Q2OA 4CUJA 4F6LA 1QTRA 1V16B 1XEFA 2VYNA 5B58T 2UZ0A 1FNBA 1V8DA 3WYGA 2IZ1A 4KK3A 4V38A 3ONDA 4B34A 1VKRA 4MUGA 5EERA 3AFGA 3LDHA 2Q2NA 1CR1A 5F5LA 3W6UA 5HKOA 3HB9A 2OCIA 4JK3A 4LRXA 4XRRA 3DR5A 2Z4RA 3LXRA 1GEGA 5EIHA 2L69A 5CFPA 4NZZA 1RPTA 4UD2A 2BZ0A 1I3KA 3HKDA 2WYHA 5C18A 1G0OA 2CN1A 1U7ZA 2AOTA 1GL3A 3L84A 4HX9A 1E1RD 3DPSA 2JFXA 1RRGA 2CNLA 1RMYA 4IJKA 3IT0A 4M1OA 5LYJA 4TLMB 1PJLA 2NU9B 4YMUA 5EPUA 2AR0A 5AHWA 2QB5A 5EXEA 3OCJA 2EFDB 3AO0B 1B76A 2PKQP 4J0CA 4W8HA 5G40A 4TPKA 3JQ6A 3TEJA 5JFGA 3SS8A 3KTAB 1AKNA 1M6VA 4YJGB 1PWEA 2ECQA 1KJYA 3P0RA 3R8CA 2NSLA 2AJCA 4ZXPA 3SJCA 3HB7A 3OBBA 3TMKA 1V8ZA 3KAKA 3ZBUA 1DCFA 6ABPA 5KTOA 1JYSA 3GUCA 4CEJB 5DLDA 2A67A 3AHCA 1T9ZA 4OBXA 3IXLA 4S2EA 3C85A 3CHYA 3PZBA 1PG0A 2J5QA 4XCQA 2H06A 1C1DB 4NCIA 3WDKA 4D80A 4GPBA 4JBLA 4GI2A 5IXJA 1JDTA 1JHOA 3L46A 4MIOA 2CMDA 4U5QA 2GN9A 3H1TA 5IAKA 2O3QA 1L4EA 4PZDA 4WVLA 4XD2A 5J3JA 1VLVA 3GJ3A 4OXKA 1HE1C 2RSLA 4O5OA 4G0ZA 4PLCA 3S0JA 3U13A 2QJRA 3BF7A 3AETB 2JW5A 4RAOA 1DARA 1ZO8A 3EVNA 3EDOA 3IR7A 3Q7SA 5DMHA 4EF6A 1Y34E 2F1JA 5H3CA 1HDYA 4DGQA 3A9TA 5AM3A 4J0JA 4M9RA 1ZMRA 2ZKIA 2O5EA 1Z0FA 1WF3A 2AOVA 3IQXA 3P2IA 2G9VA 3EQ2A 1E4VA 3GUZA 4WEQA 4ZI7F 2FPSA 3DBRA 3W79A 4BVBA 4FHGA 5G0WA 4D4HA 3D8UA 3AESA 3LVFO 3NKLA 1IZ8A 1IB0A 4FNGA 3EK2A 4IXMA 2OXIA 2XQIA 1FX1A 3A6EA 5HE8A 5A7FA 1PQYA 4C1NA 2Q4TA 3JWHA 2AW3A 1A0OA 3AEUB 4MRAA 4X65B 4FFBB 1U5AA 2ATCA 5H7XA 3AF4A 1I51A 3GRCA 5TQ0B 1IH8A 4FI3F 5SYNA 2JF0A 2B1GA 4QEZA 2ZULA 2IXDA 4UXJA 1WB6A 4V3BA 4IF4A 2PSSA 2WYVA 4XEUA 3V7UA 2BCJQ 3JQQA 3EZ2A 3SS9X 2I78A 2Y1FA 5HKAA 4UC0A 3WLTA 3E7XA 3EEQA 1ORWA 1ES9A 3I2KA 1G8GA 3YASA 2Q5IA 5EKXA 3A0UA 1YA8A 2WV9A 3F2IA 3RIHA 3T3DA 2WUEA 1GUAA 1CS0A 1KDOA 1V5EA 4MTLA 4AVYA 1SC9A 3DAPA 1GPAA 1KSFX 1FK8A 3B5IA 4O4HB 4WQMA 1JL3A 3EW9A 3PD1A 4M99A 3F98A 4NCKA 4QHTA 3UHOA 3RGGA 2B30A 1YJCA 2ODEA 1OIWA 3PPVA 1F14A 2ECKA 4P98A 3GDOA 1E2QA 1FYXA 2C31A 2XYVA 2YY5A 2J0VA 3DVAA 1VI5A 2Y05A 3MCTA 4Z8YA 4OQLA 4LXYA 3TD2A 4EK9A 3BVPA 1R10A 2XGSA 4ZCMA 5HQ3A 4C7OB 3IE0A 2YMPA 3EG5A 1G2PA 3ET5A 2SBTA 4C07A 2ASEA 3DZFA 4LN1A 1KEVA 1GRNA 1Q2XA 2X5OA 4ZEXA 3THSA 2YV5A 3EDMA 1J7KA 1OKKA 1RYEA 3K8QA 1P8JA 3OEYA 4H3VA 3SVZA 1D4OA 1EJ2A 2YRXA 1U8FO 1MENA 5DHRA 2PS1A 4S35A 3ZGZA 4S04A 3W7VA 3HRKA 4YUVA 1NI4A 1K5PA 5BMVF 1QMGA 1GILA 2H59A 1FVXA 1N8TA 2DGDA 1KK2A 1KY2A 2I3ZA 1W8IA 2I4MA 2Z2XA 2FRVA 1T9KA 1U2DC 1AKTA 2KI5A 3J81k 3AV0B 1TX4B 1GNRA 4CMEA 4B3MB 3HR8A 4KR9A 4XGNA 4Q47A 3KEFA 3MWJA 4NMXB 3MOIA 1SEVA 3DOEA 4E4RA 4U2KA 5JXJA 1BO6A 3PFCA 3L49A 1N2IA 4PBRA 4TSRA 3G8DA 4XR4A 5ALYA 2C3UA 4HGNA 4DA4A 4J4TA 2ERCA 4L4SA 2C7VA 2ZIXA 2PKWA 5E4TA 4F93B 2YWJA 1B43A 2R68A 3K53A 4JN6B 1ZN2A 4QYIB 3S1AB 5J59A 1UXJA 1GZVA 2WU0A 2FE1A 4U7HA 4MQUA 4N40A 3U7QA 1SCUA 5AWFC 4HUJA 3VNRA 4B0OA 2XAUA 4BTLA 1O6BA 2E6KA 3C8HA 2VP5A 4JQYA 3RC9A 1K89A 3TMAA 3A9SA 1EZ1A 2YICA 1OLOA 2RH4A 1JTVA 4JROA 4BFLA 4QM7A 1X15A 4RH0A 3MWDA 1M7BA 1JVSA 4CLDA 4KL8S 1UDXA 1B8VA 4XLLA 2PX5A 2GAJA 5IDQA 5EPOA 4CIAA 1MH9A 1E6WA 1OMOA 2SKEA 1DPFA 1K6JA 5DHQA 2WICA 4LX8A 4XDGA 1NR5A 5EIBC 5ESDA 4U2FA 1ZHOA 1ZI9A 2PLFA 4CQLA 3DOOA 3MUOA 4JI7B 4UPEA 1GUDA 4RELA 3E4DA 3R7SA 3LT5A 3E82A 4GPAA 3H84A 2AUNA 2PVSA 1FNMA 4FEGA 4TM7A 5TGTA 3AXTA 1PLKA 3O8BA 4S0XA 3GGCA 3PQCA 1ZM4A 3OECA 4J75A 4X85A 4TUYB 4TZKA 2ORED 1M6WA 1PWXA 4KO2S 2AQHA 5G0UA 3WYFA 3V6MA 4X90A 2R4TA 3HMKA 4L4RA 1SU6A 2HGZA 1HYBA 3EFBA 3EXHA 4DR4B 3N74A 1J8DA 1SBCA 1W35A 2O23A 3J81A 1K7CA 1WCYA 5HZMA 1BEZA 4KR0A 3RU3A 3TW8A 3MELA 2LPMA 2Q27A 1GYRA 2I1LA 3CC8A 3DZGA 4YP0A 1WXWA 4PCAA 2PUVA 2LCQA 3MEQA 2LBPA 1VJTA 3MB8A 4RHCA 3SLRA 4GXQA 4B43A 3IBGA 2ZRMA 1DT5A 1FP6A 2CK3D 3CNNA 3IVRA 4FW9A 1DAFA 1TYBE 1YB4A 4N6OA 1AHPA 4C5CA 1KAEA 2NU7B 1YJAA 3UK6A 4IWXA 3R44A 4XQ0A 1RYHA 3ZE0B 1TJYA 5C3MA 5BQPA 3K2QA 1K8QA 1YMUA 4R68A 1VL8A 4ODIA 3X1ZA 4PC6A 5GM2A 3ASUA 1KRHA 2Y0EA 3CLVA 3VYRB 1GQSA 4JD5A 1JNYA 1W5TA 4ZWNA 1PI3A 2OOSA 2D1QA 1LS1A 4W8OA 3ZU4A 5CB8A 4BNYA 1KS9A 1U2GA 3EGDB 5A4FS 2PUBA 1U2GC 5C34B 5DW0A 1QX4A 4I6GA 1DFIA 2NO5A 4BVKA 3NGMA 4XWOA 2YXNA 2XEXA 3P4UA 3AJRA 3EYWA 4YPOA 3SK0A 1S02A 1X86B 3LGAA 5JU6A 4MROA 2GBGA 4FIDA 4MW0A 4QUDA 2W2MA 1IHPA 1KH3A 4AS1A 1K63A 3FNFA 1Z34A 4BNKA 2IY8A 3PDCA 3DULA 1OYYA 1ZUWA 5IWCA 1RYFA 1BWRA 1Q77A 3ENWA 1V1MA 4N12A 4O2LA 1CUFA 1CTQA 2Q50A 3WLQA 2B1JA 1MDBA 3IP9A 4MR7B 4BQIA 3DZHA 4TV9A 2CF5A 2G6BA 1AKWA 2XNCA 1A9TA 1JIJA 3AF3A 4YC7A 3UT0A 3BCHA 1E2HA 5A1JA 3PHLA 5D51S 4OQMA 1V5FA 4B4WA 4LNAA 3PQ3A 2GLUA 4M1KA 3FPHA 2VWQA 2ZB3A 3I12A 3KT6A 4ER6A 4QPCA 4DA7A 1UJNA 2HSZA 1HNWB 2G70A 2YWDA 3VR2A 3M9LA 3N39C 5K7SA 4URWR 1O0CA 3ZUGA 5JJLA 4WOJA 4FDVA 3AM3A 2SCUB 4KYUA 2HYIC 1X42A 3EGIA 4Q4DA 3S8EA 4LF6B 3PJRA 4ME6A 2KS6A 3R0VA 1Y7IA 2QTRA 2I4LA 4O4IB 1FS6A 4HVTA 4QOHA 1EA5A 3KZCA 7MDHA 2QIOA 3HM2A 3VPGA 1JWLA 1LDMA 3KQSA 5E4YA 5LDHA 1OH5A 2O3TA 4IRXA 4MEJA 2B92A 1E4EA 3QHAA 5I7RA 4J1QA 1J24A 2VYCA 2ZJ1A 1I9CA 1Z4NA 2HTEA 2J7PD 3O1JC 4UASA 2CYBA 3LX4A 5KVAA 4OUDB 4AKIA 1LBSA 1XR3A 3E7PA 4DWJA 3ZJYA 2IZ0A 2O6LA 3BK7A 3L40A 3QJGA 4K9PA 4LF9B 2XT9A 3HYCA 4Y2VA 1AV6A 3EGOA 4HB4A 4WXRA 5AIAA 4PN3A 3HB4X 4I4CA 4EPXA 4BS9A 2BI7A 3K3PA 3B5EA 4DSUA 5BMVB 5C4IA 1XZNA 3TKAA 4ASUA 4BLPA 9GPBA 2TMGA 3KB8A 1OASA 1YE3A 4LPSA 1P0PA 2OYSA 3NIDB 4L5BA 3WYCA 4M1SA 4QLAA 1P60A 4KBYA 2K6GA 3QKSA 1OGIA 2DLCX 1OHHD 2QMHA 2JH3A 3DDSA 4H4DA 4Y0NA 1PUJA 3UG6A 1E20A 2PD4A 4DJJA 4PNZA 2FOXA 1C14A 1YJBA 2PGLA 3KS9A 4IZIA 5C8DA 4ED9A 3U4QA 3PC8A 3WBKA 5EZSA 1B6SA 2JGFA 3F6RA 3KJZA 4HAZA 3SEFA 3ESQA 3STYA 1U7WA 1ZESA 2H7XA 3CBGA 1SC4A 2P6PA 2TRSB 2B6NA 2VJQA 3KKPA 3KX2A 2ZIWB 3QXJA 4JJKA 3ZYZA 1UDRA 3KE9A 4XZ3A 3BULA 4D0LB 2FPIA 1MG5A 3QXHA 2HSDA 3CZ4A 3KQPA 4MWDA 4C2UA 3DC7A 3FHOA 4OD0A 1R4NA 5KSOA 4OXQA 5HMLA 5DRYA 3UFXB 5KYYB 4NHEA 1O57A 2G1JA 4EY7A 1NVVQ 1SHUX 4OB7A 1WL8A 2D74A 4PR0A 4DC0A 3AVXA 2JFOA 5HKKD 3RLFA 5AW0A 3NVAA 5A9RA 4QYSA 5F7JA 4C7OA 1VJGA 2RGWA 2A5JA 1GUZA 2BFPA 1O9GA 4OJYA 3UCEA 1HE8B 1SVMA 3HNOA 1ZOPA 1RAEA 1VSUA 3KWFA 3L7CA 4V0RA 5EE5B 2Q7OE 4MDEA 1CQJA 1U0FA 3A6JA 2X0JA 3MIZA 2BD0A 4KPUA 4OAOA 4ZO7A 4D41A 1KJ8A 2E4ZA 4G8CA 4XWYA 5IEJA 4OU5A 1KARA 5DH9A 2I03A 1UQRA 2QRHA 3PNSA 3TTXA 3WGOA 3GCWA 3IRVA 4NJMA 5C1PA 1FSFA 2JBAA 2AOWA 3MIIA 4D99A 4JHXA 4JWTA 3FWZA 4E5PA 2GA8A 2EVWX 2IUFA 2DB3A 1ONNA 2YJ6A 1J0CA 4RHEA 2PXCA 3GJ5A 3U3DA 4GLLA 4DM3A 1PU2A 1SA0A 3CZQA 3Q10A 1PZGA 3QPVA 4B87A 4BNIA 4YDHB 5C81A 3ZIDA 2GM9A 4PG8A 2BFWA 3GROA 3HU3A 4JBYA 1SGWA 4HZUB 1P1JA 3AR9A 4FFOA 5LXTB 3NUZA 2DE0X 5DMXA 4B80A 4P6VF 2DFDA 4YRJA 4LBVA 5IABA 1R0ZA 4X8OA 3EHDA 3O31A 4JY7A 4RZSA 3SSMA 3U3OA 1BU8A 4DCTA 2QOEA 3DE6X 4K8RB 4YUXA 2I4RA 2ZJFA 3AY6A 3ELBA 3GFPA 3FFAA 2H92A 3ABQB 3COSA 3OE5A 1BQ4A 4KQFA 4PG7A 3IQDB 3VAAA 2B3TA 2C2MA 5IXYA 3PFKA 2J4CA 3V4VB 1OB5A 1JPJA 2I4OA 3FCOA 2IEIA 4J9VA 5EPEA 4BJ5A 4I6EA 5CH5A 3DO6A 2NZ8A 1KVQA 3L05A 1U1FA 1OXTA 2FPXA 2OAGA 5F12A 4O5AA 2FW1A 4C0SA 2GT1A 1LK0A 3FTPA 3P7MA 2NO1A 1NOIA 1R6UA 3QPBA 4Q1EA 5KNCA 1RCUA 2VEDA 3ZGXA 3RK0A 2E7ZA 3HZZA 1L1RA 1G3RA 3AHHA 3OX1A 4IF6A 1DE0A 5EUCA 4ZRMA 3V8EA 4C0HA 5JTTA 3C43A 4ZC1A 2VLBA 2M6LA 3EH2A 3CSDA 2Q6OA 1DCTA 2V0GA 1QZZA 3UMGA 4F9EA 3D0OA 2QYTA 3K09A 1TVKB 3K09C 2JJMA 2C3OA 2P9EA 1D4AA 2YMMA 4J6EA 2PUCA 1E2UA 2ZI3A 5DYIA 5IAAA 1KYTA 3QQ5A 1X39A 3BA1A 2I7DA 1PD1A 4GMKA 2AVNA 2NZJA 4RK5A 3MJCA 2E55A 3OAAA 4CMIA 2PJUA 2ZAMA 1ADFA 3AWIA 3E9EA 3NWBA 3PPXA 4JYCA 2OL4A 4MQFB 5F4ZA 4DC9A 1RHMA 2ARKA 4C7VA 1SG6A 3LUFA 4GXNA 4NQZA 3BJMA 4DCPA 1SVOA 2V7EA 3MGCA 4KQGA 2B7LA 5FO1A 2GN1A 1L9XA 2BFEA 5KSWB 3F6CA 3ESDA 5E6RA 3NVKI 3PITA 1WZEA 2VA8A 4GT1A 4ZVUA 5FBQB 2WQ7A 3RUCA 3TMYA 4GMDA 3IAHA 3FUUA 4AX4A 4QBHA 4R9UC 5KYTA 5EMKA 3I5XA 4CKBA 1T10A 3C0KA 4MKFA 3WDLA 4JI8B 2DTEA 3EGXA 5IW8A 4JENA 4ARUA 1A8PA 1F5NA 2H2FA 1NX9A 2QUZA 4IDAA 3WNCA 5FQNA 4A8JB 4UNIA 5B55A 5B6PA 5K8VA 2C7QA 4P22A 4RSHA 4X94A 3GFVA 2B21A 1HSZA 4EJSB 2JAPA 3D8NA 5CFOA 2IS4A 1JDJA 3UJPA 1YRAA 1LZKA 1T0JB 1H6AA 3BWMA 3GYBA 4XQGA 1YUNA 3HSSA 1QWSA 2GF0A 3I92A 2XZOA 5T4EA 5CLIA 4WHMA 1X87A 3DMTC 3NKVA 4FWIB 1CS4C 1U9YA 2FEPA 1JA0A 1JLRA 4MRSA 4WLFA 2VUUA 3I2HA 3KJFA 2CVQA 3GNSA 4IY1A 4AL4A 5DHPA 4IGKA 1PEDA 1W2GA 1YB5A 3DDCA 4LECA 4WY8A 4F21A 1SCBA 3UKJA 3DMNA 4B0PA 2NUBA 4L74A 1YR7A 4NEQA 2QRQA 4ZK2A 3GLGA 2QD2A 5JIBA 4BFUA 1HDRA 2P6OA 2NXCA 3BWVA 4X8MA 3NASA 1DHRA 1E0JA 3CUYA 4DJDC 1QP4A 2ZIFA 1XFAA 3NIWA 3L1HA 1Z0ZA 2YWEA 3PHGA 4BO6A 4KRXA 2G1UA 4EHDA 1V4NA 1VBNA 4RQBA 1D7OA 2QNRA 2WU8A 1U4SA 1IIBA 5BQ3A 4H7JA 1NVFA 1TYCA 3ZOZA 1NW6A 1RP1A 3PNKA 4TXNA 5JQGB 3ZCXA 4C7XA 2VHJA 3PDJA 3G17A 2HFKA 2A4KA 1V6SA 3R7WB 4U7FA 4DRXB 2QYSA 4Q18A 3PKZA 3UV3A 4ARAA 2PH5A 2QROA 4TWIA 1M6YA 5GGYA 1U8AA 4MO9A 2WWRA 4GECA 1UAYA 4PWYA 2DEUA 3ET4A 3GVXA 4ZICA 3KTOA 3KHUA 3R3WA 3K0BA 2JFYA 1E9BA 3I34X 3KKKA 1THZA 1AH2A 1K3UB 1R0RE 2AXNA 1HZZA 2GAFA 1CY0A 4IJ6A 1MEEA 2YJTD 1RT9A 1WTAA 3H17A 2F8MA 2RGCA 4X5OA 4QULA 4BLRA 4ITVA 2NNWB 3LY5A 4HFNA 5JXGA 2FEWB 4W8GA 3EXFB 3HCDA 2HC9A 5JTUA 3V4PB 3LBHA 3M6XA 3OSZA 4G25A 3MGBA 2GYUA 2EFCB 4WFJA 1Z15A 4ZREA 1NXXA 3S1AA 2C07A 2BFNA 4LQCA 4AP6A 4KAFA 5AI5A 3HXOA 3AOEC 2ECPA 2D4HA 5K5EA 1JSZA 1IXSB 3QX9A 2WA1A 3A3YA 4W9NA 1TYZA 4E1AA 2CL5A 1QZTA 1JEAA 2ON6A 3ICVA 1O94C 4KE7A 2P2GA 2FSVA 4XW2A 3H5RA 1E3QA 1XU9A 1YIAA 2IXEA 1T3GA 3S1LA 1L7DA 1QV7A 1YMQA 1UBJS 3N28A 3WGGA 4EGAA 1F8GA 5CU7A 1KVUA 2FFJA 3CRMA 2GCGA 1CJUC 3KQWA 4GRIA 1TF7A 4DB4A 3O8CA 1NJ2A 3JSXA 1V43A 1RM4A 1P8AA 3N2KA 4RSGA 4TL8A 2O8CB 1W19A 5YASA 4BHTA 4YJGA 5CCDA 2PT9A 3DWGA 1LQ2A 2FZGA 1Y8AA 4IIUA 2VG8A 4OQXA 3MILA 1ORVA 4LA4A 3QBTA 3PDUA 4OP1A 1FVFA 2OCYC 1DIAA 3ZVMA 2ZRJA 4XIGS 4EJ6A 5EHQA 1WXXA 3FTQA 4B7ZA 2I1QA 4IQFA 5T4FA 4A23A 3N9IA 2J9YB 1TM4E 4KVZA 1DAMA 4RK4A 3S7ZA 3G6KA 1Z7BA 4OHRA 2VJDA 1L1FA 1IZ7A 3AUTA 4ZKEA 2CNNA 5J58A 2GN0A 5H68A 1JQ5A 2E9SA 5LVAA 1NURA 1PD0A 1WV0A 1XZEA 4MWBA 3SJUA 3VHXA 5E4FA 4BRZA 3RVSA 3RAEC 1VIDA 2VZ0A 5C1IA 2KE5A 1VZ3A 2VRCA 3TCXB 1FRQA 3D8RA 3GZTB 3WQQA 3S40A 1SUBA 1N0IA 1JDBC 2P6MA 5E95A 1OZGA 2P27A 2QR2A 3L8GA 1FMFA 3FYUA 4REQA 1V48A 4EY4A 4CDNA 1UC9A 1UKZA 1HG1A 3KYJB 3PHIA 3DBHA 4YLGA 5EUMA 2AFVA 1CUEA 3CXRA 3UKOA 1QIJA 2WQZA 3OPYA 2C8VA 4DCVA 3FCSB 2FN7A 1NJFA 2HXYA 3BJRA 5JNRA 4IZ6A 4O08A 1XRMA 1Q6YA 2EFYA 4XCXA 4ZKDA 4MKXA 1JE0A 3G5AA 5DIFA 3UXMA 1BFKA 5EJ4A 3M6IA 1PNRA 1O8BA 3HTXA 4MP3A 2G5PA 4B46A 4RY9A 1VZ2A 2C5BA 4FZRA 3SR4A 3BM5A 5FTLA 3IBSA 1Y3FE 1TKAA 1JHPA 4FR2A 4JI2B 2QTGA 1C7JA 2X15A 3VOBA 4NBSA 5JAHA 1LPMA 2A14A 3BOSA 3OCYA 4ICIA 1DUSA 5FO0A 4H77A 5FNVF 2FEMA 4CKCB 5G2OA 3RRNA 3SM9A 4MPTA 1UOQA 2VYFA 3R6TA 4O4LF 2KX7A 1U1EA 1AQNA 2Q2VA 3NGLA 1RJGA 3AEKB 4AS3A 2OZPA 3NDIA 3NUGA 3DOUA 1OXKB 1XZFA 4Y18A 4LBYA 1VFPA 5H3LA 3K7EA 3E5RA 1R00A 2H3HA 2R8PA 3J7TA 3WLEA 5E3HA 4B81A 2XR1A 5EZYB 3P97A 5A5VA 1Y1TA 3D6MA 4LI3X 5JC8A 1C2TA 5AW2A 1RZVA 1XVIA 5A9SA 1BKYA 2QG9A 2OHFA 4KLRA 4JQOA 1XPJA 4TTAA 4EKNB 2H9YA 4YRIA 1EFUA 4Q05A 4YROA 5C9ZA 3U19A 5T4BA 1RI1A 3RS2A 1SM4A 3A1WA 3K6KA 4KHZA 1FDOA 3KEGA 4QLOA 4J0FA 4B6RA 2ZK7A 2B2CA 2Q3FA 2ZIZA 4DDWA 3H7IA 4OJNA 1KJ9A 4JJGA 3WV4A 2Z08A 3RSSA 3WJ1A 1Q7RA 2IIVA 3QLUA 3IQWA 1QQTA 4EIWA 1CRWG 4WLEA 4CIDA 5J40A 1RJ9B 4K9RA 2Q5JA 3VOSA 3G9ZA 4RTQA 3EG9B 5E1MA 1DC6A 5AVQA 1RZRD 2DULA 4RVOA 3VPSA 2QEQA 3VR0A 3IS3A 1JG1A 4HHEA 4FFWA 4N8DA 1THTA 1JUDA 2ZYUX 2XV1A 3EWAA 4F3YA 4I9NA 2C61A 1A9OA 5EG5A 5DEOA 3VJRA 3S5JA 1VJ5A 1X13A 2P4QA 2V7UA 2FF5A 2XUPA 1NPDA 1T5IA 3VJMA 1RRKA 2B83A 4TTQA 1AHHA 2P78A 2XE7A 3BICA 1YJXA 3ZCQA 3UM9A 1WCIA 4HLCA 1YS6A 2MR5A 5A62A 3PSHA 1BG6A 3UT5B 3U5ZB 3VYUB 4YO8A 2N3ZA 3JQGA 1PJBA 3N53A 4WZBB 2IBTA 3MYYA 4MK4A 3U9LA 4FDLA 3OEHA 3UN1A 2H9IA 4DLPA 3AIKA 4CJXA 4F4CA 5IYZF 1QFXA 2Q0SA 5EIWA 4IIYA 1CZUA 4ZZIA 2C5LA 2PMDA 1EFRA 3JARA 3GFQA 5D3MB 3VR3D 3B9BA 2F3TA 3CLRD 2JLZA 2KM1A 2UUPA 2UZ3A 1CU1A 3WL3A 2Z6UA 4XJXA 5D3KA 4Z2AA 3KPJA 4HWSA 3JVVA 2ZYWX 3DYBA 4LDNA 3O84A 4DJAA 1E99A 1T5DX 5J1SB 1S2IA 2DKFA 3C7DB 4F56A 3GP3A 4YX9A 4KITB 1XHEA 1GZDA 2F9FA 3A05A 3KQQA 4UPVA 2CLSA 3LVRE 3CRRA 1JZTA 2RMKA 4JODA 3RTAA 3T1HB 4WCDA 1BKDR 1WMBA 3BXOA 1QKIA 4IBOA 4OIMA 5M2QA 3ABIA 4PIMA 3X1YA 5BOSA 1W48A 4EELA 5GIPE 2WLTA 1PT7A 1KI9A 3KLMX 3MTBA 2JZNA 3TZ6A 3KUXA 3NO4A 1R8XA 2ORWA 4JL5A 1FLVA 3MCZA 4HWPA 2HHAA 1M75A 3OU2A 1KKLA 1NW5A 4WZ6A 4UNSA 1F4LA 3F96A 4XX0A 4KRGA 1R88A 3D6AA 3MRVA 1JEYA 2PSFA 2NT4A 2GVDC 1V8PA 1VIVA 1WB5A 2PVPA 3EDQA 1NOKA 2WKQA 4R6XA 1X70A 2VPZA 2XXBA 3D4IA 1VB5A 3V4LA 4HDAA 4RZIA 1UANA 3H6KA 3ZJ5A 4PAQA 1F2UA 3A2LA 1VDMA 4FMDF 3AUXA 3WXMA 5KO2A 1STOA 2IKQA 3VPHA 1JQAA 3FOZA 4C4SA 3B6ZA 4L8YA 4I46A 3K2IA 2FEOA 2PS3A 2W6NA 3CFYA 3UAWA 2I9PA 2XQGA 3AL2A 1FP4A 3UVEA 2VDRB 2WTEA 1NPTO 2OCLA 1MEOA 3EIXA 3ZD6A 1FOEB 1NXOA 4ANFA 4KGVA 2AJLI 3HVUA 3AUFA 3O8QA 3RR2A 1BDIA 4JT4A 3WB2A 2WM3A 1LLFA 3Q3EA 3QOXA 4UM5A 2P2CA 4DCOA 4FUTA 3FDXA 5EHZA 4L85A 1KO4A 1LNSA 1N9GA 2JA1A 4OATA 4NG5A 1KFJB 1QYVA 2XKKA 4YIKA 2H29A 2GXAA 2QJFA 3ILSA 1NJ8A 2RIPA 3IUMA 4M7PA 5I9SA 1WABA 3H87A 4JUDX 4LC0A 4N0QA 5L40A 4YB8A 2WMOB 4OSOA 5EMJA 4DLYA 1QRUA 1V71A 3TVDA 2CDNA 3T1YB 1XNHA 4TZ6A 2VHTA 4CTOA 1UJ2A 3EZFA 4LJYA 1N1MA 4D96A 4ZCIA 1X3LA 2CVFA 2QTAA 2P1ZA 1LTQA 2P9TA 2X8JA 3IQEA 1I4OA 3GQBB 4AJJA 1N25A 2G8LA 2X1LA 4RF2A 1XPUA 3N2LA 3PFHA 2EKPA 2HWXA 3BGOS 1T2VA 2ODWA 3QLVC 4NU5A 4Q4AB 5EQFA 2PGDA 3ZJUA 3U60B 1SKQA 3D1JA 4GLOA 1FX0B 2HB6A 2OZLA 2WTMA 2QUIA 3AI7A 2WUDA 2ZKLA 5CVUA 1MABA 3KL2A 4FLFA 3NTRA 5K0JA 3QNWA 3M1AA 3T5PA 2RFLA 3D4PA 3DVRX 3B70A 5BSKA 1YA4A 2XITA 4EPTA 4QTZA 1T1GA 2BMWA 2F3UA 3W3ZB 2GYWA 3D3WB 4GYYA 2PCLA 4TVSA 1DRJA 4BX2A 2QY9A 3L0IB 1A4UA 4IZHA 1EVEA 4O2BF 2BMVA 4BWGA 5I7VA 2QU8A 4MR9B 3OHPA 1GPBA 2RHGB 5JAZA 2O54A 1FC0A 2ZZKA 2JL1A 1B3RA 1WVMA 3CKKA 2B4KA 3CO5A 4A15A 4N3CA 4ZDIA 4XUEA 1WUIS 3BAZA 4HCJA 3HVIA 1X1CA 3SBOA 5IFLA 1KWGA 1H4TA 1Y6GA 3DFMA 3CYFA 5IC4A 4GDFA 1MDFA 3IAAA 4M88A 4JGIA 3IEMA 3OCWA 4BVFA 3F6EX 3A1SA 3N0RA 4R01A 1K8YB 1XEAA 2H3EA 5IZ4A 2BLNA 2L17A 5M5BA 2N46A 3L8HA 3OPQA 1KMIY 4DKJA 2B4QA 4WBNF 3PV0A 2KLHA 1QLHA 4FCVA 4MUHA 3SPXA 4AY4A 3OPNA 1I8TA 4BL5A 4Q3KA 4YMTA 3BHJA 2CVOA 1KU6A 2HI0A 1R5NA 3IL2A 1JEQA 4P7KA 1I2CA 2PH1A 4JJ7A 4NFHA 5IHXA 4MGZR 1OD6A 1MVLA 3ML1A 2E6UX 5KCZA 2P9QA 4LRQA 1X7DA 3P94A 3K0EA 4ZCPA 1H66A 4ZAGA 3NZEA 1X7XB 2Q9CA 1U28A 2PZMA 2UVDA 3M6UA 1MQAA 4PS1A 1QCYA 5DWQA 4C43A 1CQXA 3HSYA 4V0NA 4ZQHA 1R0WA 4PX3A 1NQOA 3KJXA 4D3ZA 1N6OA 4P80A 5BSHA 4IRMA 4R5HA 5J2UF 2GSWA 2VNIA 5I7AA 1RZUA 1O5IA 3M2TA 1Y6ZA 4E32A 4I2NA 3DEIA 3HL0A 3ZI7A 3ZZ1A 1G41A 2NSHA 4DG5A 5I7WA 3GG2A 1O7JA 4JCCA 4C5BA 3WNQA 1ZD8A 1WLYA 4K26A 1DIGA 3GAMA 4EGQA 3QIAA 3SAJA 1U1GA 5LOVF 4HEA1 1JBKA 4OLHA 1U8YA 3FF1A 1GSAA 1SNYA 2FDXA 4JYBA 4TWBA 3SZOA 2Y99A 2AJDA 3GJSA 3GN1A 1IUNA 3PUIA 4HNUA 1U81A 1URPA 1VECA 2A8YA 5EIBD 1ZWKA 1J0DA 1GU7A 4ZVSA 2ZRNA 2FE4A 3TKYA 3KD3A 3DGFC 3KOZA 1YL6A 2XYPA 3M82A 1A76A 4NATA 3REFA 2YJNA 5JRJA 2I2FA 2XZLA 4ZYUA 1QM5A 2R8EA 3AZQA 3I6QA 5HA5A 3RPEA 1GNQA 1TADA 1X9IA 1X2BA 2YWRA 2IV2X 5LP6B 1EBUA 4JC8A 4M7OA 1Z37A 1QK5A 4BQNA 4D42A 4CKZA 1BE1A 2ZJ8A 5F3RA 3GGSA 2HZBA 5ITZB 5DGDA 3OA0A 4IVNA 1M1UA 3ANNA 4QODA 4E0BA 3PUWA 3NIGB 2WNHA 1AF7A 5D2CA 2YUTA 1L4YA 3IT1A 3KOXA 2R65A 1VFNA 3LP6A 5LBUA 3FDZA 2EIXA 1F2DA 1V7PC 1H0HA 3G85A 4RVCA 1RLUA 1N5DA 3MTIA 4BAUA 4D9HA 5JMWA 1GZHB 2CLFB 4AJ4A 4CHGA 1VBFA 4FYXA 3F7NA 1KZ9A 1RFLA 2PO5A 3EC7A 1QRSA 5D1HA 1O94D 3U3KA 1V11A 1OZHA 4EKGA 2P4EA 2Y77A 1WXFA 4FFNA 4ID9A 3ZE2B 1YJQA 1A8QA 2VDWA 3FFBA 4P54A 2QL6A 1JR2A 5FD8A 1SOUA 1NNSA 5K8IA 3V8MA 1Y5LA 3H5LA 1W2WB 3QVWA 5BR1A 3NOXA 2ZRFA 4G5QA 3C3MA 5LU9A 3QWBA 1SKYB 1ZEJA 2Y1WA 2RJ3A 4KSBA 2HZ7A 3RU2A 4D9BA 5ISMA 1YQTA 3DCJA 4RHUA 5CX1B 4ZI2A 2ATXA 1L1QA 3A8TA 3RIYA 4ETMA 4R7ZA 3JYPA 2JGAA 3UCFA 2DBRA 3K5IA 3UKDA 4G0XA 1N0VC 1H2AS 3GLIE 1IZZA 4IWYA 3KETA 2A1UB 3O5AA 3I30X 4NU0A 5KX5F 2OORC 4AZ3A 1ZAYA 3CWZA 2HSWA 2X4IA 1BDMA 3DCNA 3O94A 4FFRA 3OG9A 2O8BB 4BVEA 2NU9A 2JGJA 1SOWA 1T6YA 3D6NB 1N6RA 1ZRMA 5DU2A 4ARCA 4DQKA 1MLDA 3P1JA 4ILKA 1CJMA 3MRTA 1Q14A 4M9ZA 1IQ0A 1DINA 3INYA 2J48A 4AO8A 4PIVA 1QIDA 5FL3A 5EZ6B 3QHPA