2J1NA

Osmoporin ompc
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
346
structure length
346
Chain Sequence
AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN C
publication title Crystal Structure of Osmoporin Ompc from E. Coli at 2.0 A.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 102
structure length 346
sequence length 346
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2j1nA00
8PRNA 2FGRA 4GCPA 3T0SA 2ODJA 5DL8A 4FSOA 5FVNA 3WI4A 2Y0KA 4FRXA 1HXXA 5DL7A 3POQA 3FYXA 3POUA 7PRNA 1GFPA 2FGQX 3UPGA 4D64A 2XE1A 4BUMX 4FT6A 1BH3A 2OMFA 3NSGA 3A2SX 4C69X 3T20A 5PRNA 5DL5A 2J1NA 1GFMA 2Y0LA 4RJXA 3SZVA 3VZUX 4FMSA 2ZFGA 1GFNA 4LSIA 1OPFA 3EMNX 3VZWX 4GCQA 3SY9A 3POXA 3T24A 5DL6A 2J4UP 2QTKA 2O4VA 3SYBA 3SYSA 3WI5A 4D65A 1OSMA 3PRNA 1PRNA 2XE3A 1GFOA 3UU2A 1GFQA 4JFBA 2XE2A 4KR4A 2Y2XA 1PHOA 4LSFA 4RJWA 3VY9X 3SY7A 1HXTA 4KR8A 4AUIA 2Y0HA 1HXUA 3VZTX 1E54A 3O0EA 4FSPA 2ZLDA 1H6S1 1MPFA 4D5UA 1BT9A 2K4TA 3HW9A 4FOZA 4GCSA 3SZDA 3JTYA 4LSEA 3K19A 3PORA 5JDPA 4LSHA 6PRNA 3VY8X 2PRNA 4KRAA 2XG6A 2XE5A 4FRTA 3HWBA 2PORA
chains in the Genus database with same CATH superfamily
2WVPA 8PRNA 2FGRA 4GCPA 3T0SA 2LHFA 3AA1A 4AYMC 2ODJA 3AA0B 4QQ1A 4FSOA 5DL8A 3BRYA 2R8AA 5FVNA 3V8UA 3AA6A 3WI4A 3GP6A 4O3ZA 2Y0KA 2X9KA 4FRXA 1HXXA 5DL7A 7PRNA 3POQA 3FYXA 2AXTO 2M07A 3POUA 4U9CA 4K3CA 4E1SA 1GFPA 2FGQX 1ZHYA 4C4VB 3UPGA 2XMXA 5G39A 3WU2O 4FZLA 4AKRB 4FUVA 4D64A 3DZMA 2KZ7B 2XE1A 5TISO 4BUMX 2Y7SA 4FESA 4E1TA 4FT6A 1BH3A 1THQA 2OMFA 1T16A 3A2SX 3NSGA 4C69X 4XNLA 3T20A 5PRNA 5DL5A 2R4LA 5G3AA 3RBHA 2J1NA 5GTHO 1GFMA 2LFUA 2Y0LA 2KXPA 3KZIO 4AYEC 4N59A 2R88A 5ADXK 1G90A 4RLCA 4AKMA 1Q9FA 4RJXA 3SZVA 3VZUX 4AKRA 1BXWA 3NJTA 3AAAA 4FMSA 3LK41 2ZFGA 5G26A 4AYDC 1MM4A 1GFNA 4LSIA 2MNHA 2K0LA 3AA7A 1OPFA 4G76A 2YPVA 3EMNX 4IL6O 3VZWX 2MHLA 4GCQA 3BRZA 3SY9A 4RL9A 5EE2A 5B66O 3POXA 4PUXA 3DWNA 3T24A 4FZNA 5AFUK 3C5OA 3TZGA 3AAEB 1YS5A 3DA4A 4O3YA 2KC0A 3PGRA 2XTQA 4O3WA 1MM5A 2QTKA 3AA0A 4PJ0O 2O4VA 3UAQA 3SYBA 1IZNB 3QRAA 4UB8O 3SYSA 2IWVA 2WJRA 4FZMA 5KAIO 3WI5A 4AYID 2R4NA 1ZHXA 1OSMA 3PRNA 4D65A 1PRNA 1QJPA 1QJ9A 2XE3A 3DA3A 2F1CX 2X27X 4AZLA 4C4VA 4JCHA 3KVDD 2N2LA 5GV0A 1GFOA 3A0HO 3UU2A 4B61A 5IYUA 3LK2B 1GFQA 2KZ7A 4JFBA 4UB6O 3AA1B 4GF4A 2XE2A 2IWWA 1S5LO 4F4BA 4XNKA 2R4OA 2WJQA 3AA6B 4KR4A 5ADXL 4N75A 2F1TA 2Y2XA 1IZNA 5H2FO 1PHOA 4LSFA 4PR7A 3PQSA 4RJWA 3HOLA 3VY9X 2F1VA 3VE1A 4RLBA 3SY7A 3PQUA 1P4TA 4O4XA 2J4UP 1HXTA 4G75A 4KR8A 2GE4A 4FQEA 2KDYA 5GTIO 3LK2A 4AFKA 2N2MA 3VE2A 5B5EO 4GHBA 3DWOX 1ZHZA 4O4UA 4AUIA 3JCUO 4Z3TA 1T1LA 2W80C 2Y0HA 1HXUA 3LK3B 5DL6A 5AFUL 2R4PA 1ZHWA 5KAFO 2W81C 4N74A 3VZTX 2JMMA 1E54A 2XTRA 3O0EA 4C00A 4N58A 2JQYA 3LK42 4O49A 5E79O 3BS0A 2KXPB 3G7GA 4FSPA 4K3BA 2ERVA 2ZLDA 3A0BO 1H6S1 3HWBA 3AAEA 2M06A 4CTDA 1MPFA 3AAAB 4D5UA 1BT9A 3PGSA 1QJ8A 2K4TA 3HW9A 3AA7B 4FOZA 5T5FA 1Q9GA 4GCSA 5D5DA 3SZDA 3JTYA 4LSEA 4O3XB 4AYNA 3LK3A 1ORMA 2YNKA 3QRCA 3PF1A 3K19A 3PORA 5JDPA 3PGUA 4LSHA 3VY8X 6PRNA 2PRNA 4KRAA 2XG6A 2XE5A 1ZHTA 4FRTA 3HOEA 2R89A 5G38A 2PORA
chains in the Genus database with same CATH topology
8PRNA 2FGRA 4GCPA 3T0SA 2LHFA 3AA1A 4AYMC 2ODJA 3AA0B 4QQ1A 4FSOA 5DL8A 5FVNA 3V8UA 3AA6A 3WI4A 3GP6A 4O3ZA 2Y0KA 4FRXA 1HXXA 5DL7A 3POQA 3FYXA 2M07A 3POUA 4U9CA 7PRNA 4E1SA 1GFPA 2FGQX 1ZHYA 3UPGA 2XMXA 4FZLA 4AKRB 4FUVA 4D64A 2KZ7B 2XE1A 4BUMX 2Y7SA 4FESA 4E1TA 4FT6A 1BH3A 1THQA 2OMFA 3NSGA 3A2SX 4C69X 4XNLA 3T20A 5PRNA 5DL5A 3RBHA 2J1NA 1GFMA 2LFUA 2Y0LA 2KXPA 4AYEC 4N59A 5ADXK 1G90A 4RLCA 4AKMA 1Q9FA 4RJXA 3SZVA 3VZUX 4AKRA 1BXWA 4FMSA 3AAAA 3LK41 2ZFGA 5G26A 4AYDC 1MM4A 1GFNA 4LSIA 2MNHA 2K0LA 3AA7A 1OPFA 4G76A 2YPVA 3EMNX 3VZWX 2MHLA 4GCQA 3SY9A 4RL9A 5EE2A 3POXA 4PUXA 3T24A 5AFUK 4FZNA 3C5OA 3TZGA 3AAEB 1YS5A 3DA4A 4O3YA 2KC0A 4O3WA 2XTQA 5DL6A 1MM5A 2QTKA 3AA0A 3UAQA 2O4VA 2J4UP 3SYBA 1IZNB 3QRAA 3SYSA 4FZMA 3WI5A 4AYID 1ZHXA 1OSMA 3PRNA 4D65A 1PRNA 1QJPA 1QJ9A 2XE3A 3DA3A 2X27X 4AZLA 4JCHA 3KVDD 2N2LA 5GV0A 1GFOA 4B61A 3UU2A 5IYUA 3LK2B 1GFQA 2KZ7A 4JFBA 3AA1B 4GF4A 2XE2A 4F4BA 4XNKA 3AA6B 4KR4A 5ADXL 2F1TA 2Y2XA 1IZNA 1PHOA 4LSFA 3PQSA 4RJWA 3HOLA 3VY9X 2F1VA 3VE1A 4RLBA 3SY7A 3PQUA 1P4TA 4O4XA 1HXTA 4G75A 4KR8A 2GE4A 2KDYA 4AFKA 3LK2A 2N2MA 3VE2A 4GHBA 4O4UA 1ZHZA 4AUIA 5AFUL 4Z3TA 2W80C 2Y0HA 1HXUA 3LK3B 1ZHWA 2W81C 3VZTX 2JMMA 1E54A 2XTRA 3O0EA 4N58A 3LK42 4O49A 2KXPB 3G7GA 4FSPA 2ERVA 2ZLDA 1H6S1 3HWBA 3AAEA 2M06A 1MPFA 3AAAB 4D5UA 1BT9A 1QJ8A 2K4TA 3HW9A 3AA7B 4FOZA 5T5FA 1Q9GA 4GCSA 5D5DA 3SZDA 3JTYA 4LSEA 4O3XB 4AYNA 3LK3A 1ORMA 2YNKA 3QRCA 3K19A 3PORA 5JDPA 4LSHA 6PRNA 3VY8X 2PRNA 4KRAA 2XG6A 2XE5A 1ZHTA 4FRTA 3HOEA 2PORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 8PRN A;  2FGR A;  4GCP A;  3T0S A;  2ODJ A;  5DL8 A;  4FSO A;  5FVN A;  3WI4 A;  2Y0K A;  4FRX A;  1HXX A;  5DL7 A;  3POQ A;  3FYX A;  3POU A;  7PRN A;  1GFP A;  2FGQ X;  3UPG A;  4D64 A;  2XE1 A;  4BUM X;  4FT6 A;  1BH3 A;  2OMF A;  3NSG A;  3A2S X;  4C69 X;  3T20 A;  5PRN A;  5DL5 A;  2J1N A;  1GFM A;  2Y0L A;  4RJX A;  3SZV A;  3VZU X;  4FMS A;  2ZFG A;  1GFN A;  4LSI A;  1OPF A;  3EMN X;  3VZW X;  4GCQ A;  3SY9 A;  3POX A;  3T24 A;  5DL6 A;  2J4U P;  2QTK A;  2O4V A;  3SYB A;  3SYS A;  3WI5 A;  4D65 A;  1OSM A;  3PRN A;  1PRN A;  2XE3 A;  1GFO A;  3UU2 A;  1GFQ A;  4JFB A;  2XE2 A;  4KR4 A;  2Y2X A;  1PHO A;  4LSF A;  4RJW A;  3VY9 X;  3SY7 A;  1HXT A;  4KR8 A;  4AUI A;  2Y0H A;  1HXU A;  3VZT X;  1E54 A;  3O0E A;  4FSP A;  2ZLD A;  1H6S 1;  1MPF A;  4D5U A;  1BT9 A;  2K4T A;  3HW9 A;  4FOZ A;  4GCS A;  3SZD A;  3JTY A;  4LSE A;  3K19 A;  3POR A;  5JDP A;  4LSH A;  6PRN A;  3VY8 X;  2PRN A;  4KRA A;  2XG6 A;  2XE5 A;  4FRT A;  3HWB A;  2POR A; 
#chains in the Genus database with same CATH topology
 2WVP A;  8PRN A;  2FGR A;  4GCP A;  3T0S A;  2LHF A;  3AA1 A;  4AYM C;  2ODJ A;  3AA0 B;  4QQ1 A;  4FSO A;  5DL8 A;  3BRY A;  2R8A A;  5FVN A;  3V8U A;  3AA6 A;  3WI4 A;  3GP6 A;  4O3Z A;  2Y0K A;  2X9K A;  4FRX A;  1HXX A;  5DL7 A;  7PRN A;  3POQ A;  3FYX A;  2AXT O;  2M07 A;  3POU A;  4U9C A;  4K3C A;  4E1S A;  1GFP A;  2FGQ X;  1ZHY A;  4C4V B;  3UPG A;  2XMX A;  5G39 A;  3WU2 O;  4FZL A;  4AKR B;  4FUV A;  4D64 A;  3DZM A;  2KZ7 B;  2XE1 A;  5TIS O;  4BUM X;  2Y7S A;  4FES A;  4E1T A;  4FT6 A;  1BH3 A;  1THQ A;  2OMF A;  1T16 A;  3A2S X;  3NSG A;  4C69 X;  4XNL A;  3T20 A;  5PRN A;  5DL5 A;  2R4L A;  5G3A A;  3RBH A;  2J1N A;  5GTH O;  1GFM A;  2LFU A;  2Y0L A;  2KXP A;  3KZI O;  4AYE C;  4N59 A;  2R88 A;  5ADX K;  1G90 A;  4RLC A;  4AKM A;  1Q9F A;  4RJX A;  3SZV A;  3VZU X;  4AKR A;  1BXW A;  3NJT A;  3AAA A;  4FMS A;  3LK4 1;  2ZFG A;  5G26 A;  4AYD C;  1MM4 A;  1GFN A;  4LSI A;  2MNH A;  2K0L A;  3AA7 A;  1OPF A;  4G76 A;  2YPV A;  3EMN X;  4IL6 O;  3VZW X;  2MHL A;  4GCQ A;  3BRZ A;  3SY9 A;  4RL9 A;  5EE2 A;  5B66 O;  3POX A;  4PUX A;  3DWN A;  3T24 A;  4FZN A;  5AFU K;  3C5O A;  3TZG A;  3AAE B;  1YS5 A;  3DA4 A;  4O3Y A;  2KC0 A;  3PGR A;  2XTQ A;  4O3W A;  1MM5 A;  2QTK A;  3AA0 A;  4PJ0 O;  2O4V A;  3UAQ A;  3SYB A;  1IZN B;  3QRA A;  4UB8 O;  3SYS A;  2IWV A;  2WJR A;  4FZM A;  5KAI O;  3WI5 A;  4AYI D;  2R4N A;  1ZHX A;  1OSM A;  3PRN A;  4D65 A;  1PRN A;  1QJP A;  1QJ9 A;  2XE3 A;  3DA3 A;  2F1C X;  2X27 X;  4AZL A;  4C4V A;  4JCH A;  3KVD D;  2N2L A;  5GV0 A;  1GFO A;  3A0H O;  3UU2 A;  4B61 A;  5IYU A;  3LK2 B;  1GFQ A;  2KZ7 A;  4JFB A;  4UB6 O;  3AA1 B;  4GF4 A;  2XE2 A;  2IWW A;  1S5L O;  4F4B A;  4XNK A;  2R4O A;  2WJQ A;  3AA6 B;  4KR4 A;  5ADX L;  4N75 A;  2F1T A;  2Y2X A;  1IZN A;  5H2F O;  1PHO A;  4LSF A;  4PR7 A;  3PQS A;  4RJW A;  3HOL A;  3VY9 X;  2F1V A;  3VE1 A;  4RLB A;  3SY7 A;  3PQU A;  1P4T A;  4O4X A;  2J4U P;  1HXT A;  4G75 A;  4KR8 A;  2GE4 A;  4FQE A;  2KDY A;  5GTI O;  3LK2 A;  4AFK A;  2N2M A;  3VE2 A;  5B5E O;  4GHB A;  3DWO X;  1ZHZ A;  4O4U A;  4AUI A;  3JCU O;  4Z3T A;  1T1L A;  2W80 C;  2Y0H A;  1HXU A;  3LK3 B;  5DL6 A;  5AFU L;  2R4P A;  1ZHW A;  5KAF O;  2W81 C;  4N74 A;  3VZT X;  2JMM A;  1E54 A;  2XTR A;  3O0E A;  4C00 A;  4N58 A;  2JQY A;  3LK4 2;  4O49 A;  5E79 O;  3BS0 A;  2KXP B;  3G7G A;  4FSP A;  4K3B A;  2ERV A;  2ZLD A;  3A0B O;  1H6S 1;  3HWB A;  3AAE A;  2M06 A;  4CTD A;  1MPF A;  3AAA B;  4D5U A;  1BT9 A;  3PGS A;  1QJ8 A;  2K4T A;  3HW9 A;  3AA7 B;  4FOZ A;  5T5F A;  1Q9G A;  4GCS A;  5D5D A;  3SZD A;  3JTY A;  4LSE A;  4O3X B;  4AYN A;  3LK3 A;  1ORM A;  2YNK A;  3QRC A;  3PF1 A;  3K19 A;  3POR A;  5JDP A;  3PGU A;  4LSH A;  3VY8 X;  6PRN A;  2PRN A;  4KRA A;  2XG6 A;  2XE5 A;  1ZHT A;  4FRT A;  3HOE A;  2R89 A;  5G38 A;  2POR A; 
#chains in the Genus database with same CATH homology
 8PRN A;  2FGR A;  4GCP A;  3T0S A;  2LHF A;  3AA1 A;  4AYM C;  2ODJ A;  3AA0 B;  4QQ1 A;  4FSO A;  5DL8 A;  5FVN A;  3V8U A;  3AA6 A;  3WI4 A;  3GP6 A;  4O3Z A;  2Y0K A;  4FRX A;  1HXX A;  5DL7 A;  3POQ A;  3FYX A;  2M07 A;  3POU A;  4U9C A;  7PRN A;  4E1S A;  1GFP A;  2FGQ X;  1ZHY A;  3UPG A;  2XMX A;  4FZL A;  4AKR B;  4FUV A;  4D64 A;  2KZ7 B;  2XE1 A;  4BUM X;  2Y7S A;  4FES A;  4E1T A;  4FT6 A;  1BH3 A;  1THQ A;  2OMF A;  3NSG A;  3A2S X;  4C69 X;  4XNL A;  3T20 A;  5PRN A;  5DL5 A;  3RBH A;  2J1N A;  1GFM A;  2LFU A;  2Y0L A;  2KXP A;  4AYE C;  4N59 A;  5ADX K;  1G90 A;  4RLC A;  4AKM A;  1Q9F A;  4RJX A;  3SZV A;  3VZU X;  4AKR A;  1BXW A;  4FMS A;  3AAA A;  3LK4 1;  2ZFG A;  5G26 A;  4AYD C;  1MM4 A;  1GFN A;  4LSI A;  2MNH A;  2K0L A;  3AA7 A;  1OPF A;  4G76 A;  2YPV A;  3EMN X;  3VZW X;  2MHL A;  4GCQ A;  3SY9 A;  4RL9 A;  5EE2 A;  3POX A;  4PUX A;  3T24 A;  5AFU K;  4FZN A;  3C5O A;  3TZG A;  3AAE B;  1YS5 A;  3DA4 A;  4O3Y A;  2KC0 A;  4O3W A;  2XTQ A;  5DL6 A;  1MM5 A;  2QTK A;  3AA0 A;  3UAQ A;  2O4V A;  2J4U P;  3SYB A;  1IZN B;  3QRA A;  3SYS A;  4FZM A;  3WI5 A;  4AYI D;  1ZHX A;  1OSM A;  3PRN A;  4D65 A;  1PRN A;  1QJP A;  1QJ9 A;  2XE3 A;  3DA3 A;  2X27 X;  4AZL A;  4JCH A;  3KVD D;  2N2L A;  5GV0 A;  1GFO A;  4B61 A;  3UU2 A;  5IYU A;  3LK2 B;  1GFQ A;  2KZ7 A;  4JFB A;  3AA1 B;  4GF4 A;  2XE2 A;  4F4B A;  4XNK A;  3AA6 B;  4KR4 A;  5ADX L;  2F1T A;  2Y2X A;  1IZN A;  1PHO A;  4LSF A;  3PQS A;  4RJW A;  3HOL A;  3VY9 X;  2F1V A;  3VE1 A;  4RLB A;  3SY7 A;  3PQU A;  1P4T A;  4O4X A;  1HXT A;  4G75 A;  4KR8 A;  2GE4 A;  2KDY A;  4AFK A;  3LK2 A;  2N2M A;  3VE2 A;  4GHB A;  4O4U A;  1ZHZ A;  4AUI A;  5AFU L;  4Z3T A;  2W80 C;  2Y0H A;  1HXU A;  3LK3 B;  1ZHW A;  2W81 C;  3VZT X;  2JMM A;  1E54 A;  2XTR A;  3O0E A;  4N58 A;  3LK4 2;  4O49 A;  2KXP B;  3G7G A;  4FSP A;  2ERV A;  2ZLD A;  1H6S 1;  3HWB A;  3AAE A;  2M06 A;  1MPF A;  3AAA B;  4D5U A;  1BT9 A;  1QJ8 A;  2K4T A;  3HW9 A;  3AA7 B;  4FOZ A;  5T5F A;  1Q9G A;  4GCS A;  5D5D A;  3SZD A;  3JTY A;  4LSE A;  4O3X B;  4AYN A;  3LK3 A;  1ORM A;  2YNK A;  3QRC A;  3K19 A;  3POR A;  5JDP A;  4LSH A;  6PRN A;  3VY8 X;  2PRN A;  4KRA A;  2XG6 A;  2XE5 A;  1ZHT A;  4FRT A;  3HOE A;  2POR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...