2J1NA

Osmoporin ompc
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
346
structure length
346
Chain Sequence
b'AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN C
publication title Crystal Structure of Osmoporin Ompc from E. Coli at 2.0 A.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 102
structure length 346
sequence length 346
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2j1nA00
2XG6A 5DL8A 2PORA 1E54A 5FVNA 3EMNX 4GCPA 3HWBA 1GFMA 3SYBA 8PRNA 1GFPA 3T24A 2J4UP 3SZVA 3VZUX 4GCQA 3WI5A 1OSMA 4KR4A 1GFNA 1MPFA 2O4VA 1H6S1 3WI4A 2ZFGA 5DL7A 4LSIA 3HW9A 4GCSA 3POUA 2Y0HA 2Y0LA 2QTKA 2K4TA 3T0SA 1HXUA 5DL5A 2FGRA 2XE3A 1BT9A 3FYXA 1GFOA 2FGQX 2Y2XA 4LSHA 4D64A 3A2SX 2OMFA 1BH3A 4LSFA 4FOZA 2Y0KA 2ZLDA 2XE1A 1HXTA 3T20A 3VY8X 4AUIA 3UPGA 4KRAA 3NSGA 2J1NA 4RJXA 3VY9X 7PRNA 4FMSA 4FSOA 4JFBA 1OPFA 1PRNA 3UU2A 3VZTX 3POQA 4D65A 3SYSA 2XE2A 3O0EA 3POXA 3VZWX 3SY7A 2XE5A 3JTYA 4BUMX 4RJWA 3SY9A 5DL6A 4FT6A 3K19A 3SZDA 3PRNA 3PORA 4KR8A 4LSEA 4D5UA 1GFQA 2ODJA 5JDPA 2PRNA 4FRTA 4FRXA 5PRNA 1HXXA 4FSPA 6PRNA 4C69X 1PHOA
chains in the Genus database with same CATH superfamily
2XG6A 3NJTA 4RL9A 5DL8A 4XNLA 5G26A 2PORA 3V8UA 3KZIO 1E54A 5FVNA 5GTHO 5G38A 3EMNX 4GCPA 3HWBA 4O49A 4E1SA 1GFMA 3SYBA 1QJPA 2JMMA 2N2MA 3DWNA 8PRNA 1GFPA 2IWVA 4AFKA 1Q9GA 4O3ZA 3T24A 5H2FO 2J4UP 2GE4A 1ZHWA 3SZVA 3PGUA 2LFUA 4O3WA 2K0LA 4E1TA 5B66O 2XTQA 2R4OA 3HOEA 3VZUX 4GCQA 3WI5A 1OSMA 4C00A 4KR4A 5G39A 3AAEA 4AYMC 2F1VA 2X9KA 1GFNA 1MPFA 2O4VA 3DA4A 5AFUL 4RLBA 1H6S1 4PR7A 3PQSA 4N59A 3WI4A 2YNKA 3HOLA 4QQ1A 2KZ7B 4G75A 3JCUO 2R89A 4GHBA 1YS5A 4K3CA 3RBHA 2ZFGA 3QRAA 4O3XB 3PGRA 4AYEC 5DL7A 4FZNA 5AFUK 3AAAB 2IWWA 4LSIA 3HW9A 4GCSA 2WVPA 2XTRA 5G3AA 4AYID 2MHLA 4K3BA 4IL6O 5GTIO 3POUA 2KZ7A 2Y0HA 3LK2B 5ADXK 2Y0LA 1IZNB 1MM5A 2K4TA 2QTKA 3AAEB 4UB6O 4PUXA 4UB8O 3T0SA 5IYUA 2W81C 3AAAA 3VE1A 1ZHTA 1HXUA 3A0BO 2FGRA 2XE3A 5DL5A 4F4BA 2XMXA 4O3YA 1BT9A 4U9CA 3FYXA 3LK2A 3LK41 1GFOA 1IZNA 2FGQX 2Y2XA 4Z3TA 4LSHA 4D64A 5B5EO 3A2SX 4O4UA 2OMFA 1BH3A 4LSFA 4JCHA 2Y0KA 2ZLDA 4FOZA 1HXTA 2XE1A 3G7GA 2KDYA 3UAQA 5EE2A 2F1CX 3VY8X 3T20A 1ZHZA 2AXTO 4AUIA 2R4NA 3UPGA 1T1LA 1ORMA 4KRAA 4C69X 1G90A 3WU2O 2F1TA 2X27X 4G76A 3NSGA 1P4TA 1QJ9A 2R8AA 3PF1A 2J1NA 4RLCA 4RJXA 5D5DA 3AA6B 3TZGA 4CTDA 2JQYA 2M06A 4PJ0O 3VY9X 4FZMA 4FZLA 1ZHXA 2MNHA 7PRNA 5KAIO 3AA0B 4FMSA 4FSOA 2N2LA 4JFBA 4AZLA 4B61A 3GP6A 3C5OA 1QJ8A 1OPFA 3AA1A 2LHFA 5TISO 4FUVA 3AA6A 4FESA 1PRNA 3UU2A 1MM4A 2W80C 5KAFO 4C4VB 5GV0A 1Q9FA 2WJQA 3AA0A 3DZMA 2KC0A 3POQA 4N74A 3BS0A 3VZTX 4D65A 4AKMA 2R4LA 2R88A 3LK42 3SYSA 2ERVA 2XE2A 2WJRA 4GF4A 5T5FA 3O0EA 3AA7A 3PGSA 4AKRB 3POXA 3VZWX 4C4VA 3SY7A 2XE5A 3JTYA 3LK3B 4BUMX 3DA3A 3AA1B 2M07A 4RJWA 5DL6A 3SY9A 3A0HO 4FT6A 3K19A 3SZDA 3VE2A 1ZHYA 3PORA 3PRNA 1T16A 3BRYA 4KR8A 1S5LO 1THQA 4FQEA 4LSEA 4AKRA 4D5UA 4O4XA 4XNKA 2KXPB 1GFQA 2ODJA 4AYDC 5JDPA 3LK3A 3PQUA 4N58A 2PRNA 4FRTA 3DWOX 2R4PA 4FRXA 2Y7SA 5PRNA 1HXXA 3AA7B 3BRZA 4FSPA 4N75A 4AYNA 2YPVA 6PRNA 5E79O 1BXWA 5ADXL 3KVDD 1PHOA 2KXPA 3QRCA
chains in the Genus database with same CATH topology
2XG6A 4RL9A 5DL8A 4XNLA 5G26A 2PORA 3V8UA 1E54A 5FVNA 3EMNX 4GCPA 3HWBA 4O49A 1GFMA 3SYBA 1QJPA 2JMMA 2N2MA 8PRNA 1GFPA 4AFKA 1Q9GA 4O3ZA 3T24A 2J4UP 2GE4A 1ZHWA 3SZVA 2LFUA 4O3WA 2K0LA 4E1TA 2XTQA 3HOEA 3VZUX 4GCQA 3WI5A 1OSMA 4KR4A 3AAEA 4AYMC 2F1VA 3DA4A 1GFNA 1MPFA 2O4VA 5AFUL 4RLBA 1H6S1 3PQSA 4N59A 3WI4A 2YNKA 3HOLA 4QQ1A 2KZ7B 4G75A 4GHBA 1YS5A 3RBHA 2ZFGA 3QRAA 4O3XB 4AYEC 5DL7A 4FZNA 5AFUK 3AAAB 4LSIA 3HW9A 4GCSA 2XTRA 4AYID 2MHLA 3POUA 2KZ7A 2Y0HA 3LK2B 5ADXK 2Y0LA 1IZNB 1MM5A 2K4TA 2QTKA 3AAEB 4PUXA 3T0SA 5IYUA 2W81C 3AAAA 3VE1A 1ZHTA 1HXUA 5DL5A 2FGRA 2XE3A 4F4BA 2XMXA 4O3YA 1BT9A 4U9CA 3FYXA 3LK2A 3LK41 1GFOA 1IZNA 2FGQX 2Y2XA 4Z3TA 4LSHA 4D64A 3A2SX 4O4UA 2OMFA 1BH3A 4LSFA 4JCHA 2Y0KA 2ZLDA 4FOZA 2XE1A 1HXTA 3G7GA 2KDYA 3UAQA 5EE2A 3VY8X 3T20A 1ZHZA 4AUIA 3UPGA 1ORMA 4KRAA 4C69X 1G90A 2F1TA 2X27X 4G76A 3NSGA 1P4TA 1QJ9A 3TZGA 2J1NA 4RLCA 4RJXA 5D5DA 3AA6B 2M06A 3VY9X 4FZMA 4FZLA 1ZHXA 2MNHA 7PRNA 3AA0B 4FMSA 4FSOA 2N2LA 4JFBA 4AZLA 4B61A 3GP6A 3C5OA 1QJ8A 1OPFA 3AA1A 2LHFA 4FUVA 3AA6A 4FESA 1PRNA 3UU2A 1MM4A 2W80C 5GV0A 1Q9FA 3AA0A 3POQA 3VZTX 2KC0A 4E1SA 4D65A 4AKMA 3LK42 3SYSA 2ERVA 2XE2A 4GF4A 5T5FA 3O0EA 3AA7A 4AKRB 3POXA 3VZWX 3SY7A 2XE5A 3JTYA 3LK3B 4BUMX 3DA3A 3AA1B 2M07A 4RJWA 5DL6A 3SY9A 3VE2A 4FT6A 3K19A 3SZDA 4AYDC 1ZHYA 3PORA 3PRNA 4KR8A 1THQA 4LSEA 4AKRA 4D5UA 4O4XA 4XNKA 2KXPB 1GFQA 2ODJA 5JDPA 3LK3A 3PQUA 4N58A 2PRNA 4FRTA 4FRXA 5PRNA 2Y7SA 1HXXA 3AA7B 4FSPA 4AYNA 2YPVA 6PRNA 1BXWA 5ADXL 3KVDD 1PHOA 2KXPA 3QRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XG6 A;  5DL8 A;  2POR A;  1E54 A;  5FVN A;  3EMN X;  4GCP A;  3HWB A;  1GFM A;  3SYB A;  8PRN A;  1GFP A;  3T24 A;  2J4U P;  3SZV A;  3VZU X;  4GCQ A;  3WI5 A;  1OSM A;  4KR4 A;  1GFN A;  1MPF A;  2O4V A;  1H6S 1;  3WI4 A;  2ZFG A;  5DL7 A;  4LSI A;  3HW9 A;  4GCS A;  3POU A;  2Y0H A;  2Y0L A;  2QTK A;  2K4T A;  3T0S A;  1HXU A;  5DL5 A;  2FGR A;  2XE3 A;  1BT9 A;  3FYX A;  1GFO A;  2FGQ X;  2Y2X A;  4LSH A;  4D64 A;  3A2S X;  2OMF A;  1BH3 A;  4LSF A;  4FOZ A;  2Y0K A;  2ZLD A;  2XE1 A;  1HXT A;  3T20 A;  3VY8 X;  4AUI A;  3UPG A;  4KRA A;  3NSG A;  2J1N A;  4RJX A;  3VY9 X;  7PRN A;  4FMS A;  4FSO A;  4JFB A;  1OPF A;  1PRN A;  3UU2 A;  3VZT X;  3POQ A;  4D65 A;  3SYS A;  2XE2 A;  3O0E A;  3POX A;  3VZW X;  3SY7 A;  2XE5 A;  3JTY A;  4BUM X;  4RJW A;  3SY9 A;  5DL6 A;  4FT6 A;  3K19 A;  3SZD A;  3PRN A;  3POR A;  4KR8 A;  4LSE A;  4D5U A;  1GFQ A;  2ODJ A;  5JDP A;  2PRN A;  4FRT A;  4FRX A;  5PRN A;  1HXX A;  4FSP A;  6PRN A;  4C69 X;  1PHO A; 
#chains in the Genus database with same CATH topology
 2XG6 A;  3NJT A;  4RL9 A;  5DL8 A;  4XNL A;  5G26 A;  2POR A;  3V8U A;  3KZI O;  1E54 A;  5FVN A;  5GTH O;  5G38 A;  3EMN X;  4GCP A;  3HWB A;  4O49 A;  4E1S A;  1GFM A;  3SYB A;  1QJP A;  2JMM A;  2N2M A;  3DWN A;  8PRN A;  1GFP A;  2IWV A;  4AFK A;  1Q9G A;  4O3Z A;  3T24 A;  5H2F O;  2J4U P;  2GE4 A;  1ZHW A;  3SZV A;  3PGU A;  2LFU A;  4O3W A;  2K0L A;  4E1T A;  5B66 O;  2XTQ A;  2R4O A;  3HOE A;  3VZU X;  4GCQ A;  3WI5 A;  1OSM A;  4C00 A;  4KR4 A;  5G39 A;  3AAE A;  4AYM C;  2F1V A;  2X9K A;  1GFN A;  1MPF A;  2O4V A;  3DA4 A;  5AFU L;  4RLB A;  1H6S 1;  4PR7 A;  3PQS A;  4N59 A;  3WI4 A;  2YNK A;  3HOL A;  4QQ1 A;  2KZ7 B;  4G75 A;  3JCU O;  2R89 A;  4GHB A;  1YS5 A;  4K3C A;  3RBH A;  2ZFG A;  3QRA A;  4O3X B;  3PGR A;  4AYE C;  5DL7 A;  4FZN A;  5AFU K;  3AAA B;  2IWW A;  4LSI A;  3HW9 A;  4GCS A;  2WVP A;  2XTR A;  5G3A A;  4AYI D;  2MHL A;  4K3B A;  4IL6 O;  5GTI O;  3POU A;  2KZ7 A;  2Y0H A;  3LK2 B;  5ADX K;  2Y0L A;  1IZN B;  1MM5 A;  2K4T A;  2QTK A;  3AAE B;  4UB6 O;  4PUX A;  4UB8 O;  3T0S A;  5IYU A;  2W81 C;  3AAA A;  3VE1 A;  1ZHT A;  1HXU A;  3A0B O;  2FGR A;  2XE3 A;  5DL5 A;  4F4B A;  2XMX A;  4O3Y A;  1BT9 A;  4U9C A;  3FYX A;  3LK2 A;  3LK4 1;  1GFO A;  1IZN A;  2FGQ X;  2Y2X A;  4Z3T A;  4LSH A;  4D64 A;  5B5E O;  3A2S X;  4O4U A;  2OMF A;  1BH3 A;  4LSF A;  4JCH A;  2Y0K A;  2ZLD A;  4FOZ A;  1HXT A;  2XE1 A;  3G7G A;  2KDY A;  3UAQ A;  5EE2 A;  2F1C X;  3VY8 X;  3T20 A;  1ZHZ A;  2AXT O;  4AUI A;  2R4N A;  3UPG A;  1T1L A;  1ORM A;  4KRA A;  4C69 X;  1G90 A;  3WU2 O;  2F1T A;  2X27 X;  4G76 A;  3NSG A;  1P4T A;  1QJ9 A;  2R8A A;  3PF1 A;  2J1N A;  4RLC A;  4RJX A;  5D5D A;  3AA6 B;  3TZG A;  4CTD A;  2JQY A;  2M06 A;  4PJ0 O;  3VY9 X;  4FZM A;  4FZL A;  1ZHX A;  2MNH A;  7PRN A;  5KAI O;  3AA0 B;  4FMS A;  4FSO A;  2N2L A;  4JFB A;  4AZL A;  4B61 A;  3GP6 A;  3C5O A;  1QJ8 A;  1OPF A;  3AA1 A;  2LHF A;  5TIS O;  4FUV A;  3AA6 A;  4FES A;  1PRN A;  3UU2 A;  1MM4 A;  2W80 C;  5KAF O;  4C4V B;  5GV0 A;  1Q9F A;  2WJQ A;  3AA0 A;  3DZM A;  2KC0 A;  3POQ A;  4N74 A;  3BS0 A;  3VZT X;  4D65 A;  4AKM A;  2R4L A;  2R88 A;  3LK4 2;  3SYS A;  2ERV A;  2XE2 A;  2WJR A;  4GF4 A;  5T5F A;  3O0E A;  3AA7 A;  3PGS A;  4AKR B;  3POX A;  3VZW X;  4C4V A;  3SY7 A;  2XE5 A;  3JTY A;  3LK3 B;  4BUM X;  3DA3 A;  3AA1 B;  2M07 A;  4RJW A;  5DL6 A;  3SY9 A;  3A0H O;  4FT6 A;  3K19 A;  3SZD A;  3VE2 A;  1ZHY A;  3POR A;  3PRN A;  1T16 A;  3BRY A;  4KR8 A;  1S5L O;  1THQ A;  4FQE A;  4LSE A;  4AKR A;  4D5U A;  4O4X A;  4XNK A;  2KXP B;  1GFQ A;  2ODJ A;  4AYD C;  5JDP A;  3LK3 A;  3PQU A;  4N58 A;  2PRN A;  4FRT A;  3DWO X;  2R4P A;  4FRX A;  2Y7S A;  5PRN A;  1HXX A;  3AA7 B;  3BRZ A;  4FSP A;  4N75 A;  4AYN A;  2YPV A;  6PRN A;  5E79 O;  1BXW A;  5ADX L;  3KVD D;  1PHO A;  2KXP A;  3QRC A; 
#chains in the Genus database with same CATH homology
 2XG6 A;  4RL9 A;  5DL8 A;  4XNL A;  5G26 A;  2POR A;  3V8U A;  1E54 A;  5FVN A;  3EMN X;  4GCP A;  3HWB A;  4O49 A;  1GFM A;  3SYB A;  1QJP A;  2JMM A;  2N2M A;  8PRN A;  1GFP A;  4AFK A;  1Q9G A;  4O3Z A;  3T24 A;  2J4U P;  2GE4 A;  1ZHW A;  3SZV A;  2LFU A;  4O3W A;  2K0L A;  4E1T A;  2XTQ A;  3HOE A;  3VZU X;  4GCQ A;  3WI5 A;  1OSM A;  4KR4 A;  3AAE A;  4AYM C;  2F1V A;  3DA4 A;  1GFN A;  1MPF A;  2O4V A;  5AFU L;  4RLB A;  1H6S 1;  3PQS A;  4N59 A;  3WI4 A;  2YNK A;  3HOL A;  4QQ1 A;  2KZ7 B;  4G75 A;  4GHB A;  1YS5 A;  3RBH A;  2ZFG A;  3QRA A;  4O3X B;  4AYE C;  5DL7 A;  4FZN A;  5AFU K;  3AAA B;  4LSI A;  3HW9 A;  4GCS A;  2XTR A;  4AYI D;  2MHL A;  3POU A;  2KZ7 A;  2Y0H A;  3LK2 B;  5ADX K;  2Y0L A;  1IZN B;  1MM5 A;  2K4T A;  2QTK A;  3AAE B;  4PUX A;  3T0S A;  5IYU A;  2W81 C;  3AAA A;  3VE1 A;  1ZHT A;  1HXU A;  5DL5 A;  2FGR A;  2XE3 A;  4F4B A;  2XMX A;  4O3Y A;  1BT9 A;  4U9C A;  3FYX A;  3LK2 A;  3LK4 1;  1GFO A;  1IZN A;  2FGQ X;  2Y2X A;  4Z3T A;  4LSH A;  4D64 A;  3A2S X;  4O4U A;  2OMF A;  1BH3 A;  4LSF A;  4JCH A;  2Y0K A;  2ZLD A;  4FOZ A;  2XE1 A;  1HXT A;  3G7G A;  2KDY A;  3UAQ A;  5EE2 A;  3VY8 X;  3T20 A;  1ZHZ A;  4AUI A;  3UPG A;  1ORM A;  4KRA A;  4C69 X;  1G90 A;  2F1T A;  2X27 X;  4G76 A;  3NSG A;  1P4T A;  1QJ9 A;  3TZG A;  2J1N A;  4RLC A;  4RJX A;  5D5D A;  3AA6 B;  2M06 A;  3VY9 X;  4FZM A;  4FZL A;  1ZHX A;  2MNH A;  7PRN A;  3AA0 B;  4FMS A;  4FSO A;  2N2L A;  4JFB A;  4AZL A;  4B61 A;  3GP6 A;  3C5O A;  1QJ8 A;  1OPF A;  3AA1 A;  2LHF A;  4FUV A;  3AA6 A;  4FES A;  1PRN A;  3UU2 A;  1MM4 A;  2W80 C;  5GV0 A;  1Q9F A;  3AA0 A;  3POQ A;  3VZT X;  2KC0 A;  4E1S A;  4D65 A;  4AKM A;  3LK4 2;  3SYS A;  2ERV A;  2XE2 A;  4GF4 A;  5T5F A;  3O0E A;  3AA7 A;  4AKR B;  3POX A;  3VZW X;  3SY7 A;  2XE5 A;  3JTY A;  3LK3 B;  4BUM X;  3DA3 A;  3AA1 B;  2M07 A;  4RJW A;  5DL6 A;  3SY9 A;  3VE2 A;  4FT6 A;  3K19 A;  3SZD A;  4AYD C;  1ZHY A;  3POR A;  3PRN A;  4KR8 A;  1THQ A;  4LSE A;  4AKR A;  4D5U A;  4O4X A;  4XNK A;  2KXP B;  1GFQ A;  2ODJ A;  5JDP A;  3LK3 A;  3PQU A;  4N58 A;  2PRN A;  4FRT A;  4FRX A;  5PRN A;  2Y7S A;  1HXX A;  3AA7 B;  4FSP A;  4AYN A;  2YPV A;  6PRN A;  1BXW A;  5ADX L;  3KVD D;  1PHO A;  2KXP A;  3QRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...