2J1SA

Structure of a streptococcus pneumoniae fucose binding module in complex with fucose
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
141
structure length
141
Chain Sequence
b'KFNDGNLNIAYAKPTTQSSVDYNGDPNRAVDGNRNGNFNSGSVTHTRADNPSWWEVDLKKMDKVGLVKIYNRTDAETQRLSNFDVILYDNNRNEVAKKHVNNLSGESVSLDFKEKGARYIKVKLLTSGVPLSLAEVEVFRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Blood Group Antigen Recognition by a Streptococcus Pneumoniae Virulence Factor
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Carbohydrate-binding protein
total genus 37
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2j1sA00
3LPGA 3CDZB 4ZXEA 5B4XA 1K3IA 3U37A 3VDCA 3HNMA 3OEAA 4QAWA 1H6XA 2J1EA 2ZXQA 3K4AA 2VZSA 3WF4A 4KI5M 4MOAA 3K4ZA 2WO2A 4OZOA 3OEBA 4DUWA 2C26A 3CZJA 1UY3A 3T0AA 3WNPA 3K46A 3T2PA 4BJ0A 4QX1A 2VMFA 4A4AA 1LNSA 4CU7A 2DCJA 3VD5A 1GOGA 1UWWA 5IFTA 3NRUA 2YC4A 4ZY9A 3JXSA 2WO3A 2WUHA 2J22A 4D0QA 2W1WA 3CKHA 3WF0A 1RYYA 1NUKA 2EICA 3OGVA 4ARYA 2W1SA 4FI9A 2QQOA 4MADA 3A23A 2W95A 4Z2AA 2W9XA 4JKKA 4ET7A 3ACFA 2W1QA 1JU3A 3I2IA 2E26A 2B4KA 3T09A 2VZPA 4GZ9A 3ETPA 4CVUA 2J1AA 4JKMA 2EIDA 3ECQA 4LKSA 3C7FA 5HXMA 4M4RA 1UY1A 2R7EB 3NJVA 2YG0A 3I2GA 2WYSA 4XUOA 2VQTA 2W1UA 5F7UA 4A44A 2Y6KA 4A3ZA 5LA0A 3D3AA 2VZTA 3MV11 2HLEA 3CMGA 1DLCA 2VMDA 3E1F1 3IDAA 5IHRA 3WNNA 1WCQA 3C7HA 4QDSA 2W3JA 3GGLA 4YPJA 4ZZ8A 2VJXA 3EYPA 3IAPA 3WF1A 1US2A 1GU3A 3SEPA 1OF3A 2W92A 3CQOA 2JKXA 4W4ZA 1GOFA 1PMJX 5J1XA 2VZ1A 1K12A 3A7QA 5B4NA 2ZEXA 5JXHA 4KWUA 3UETA 3WNKA 2JD9A 4XURA 3LEIA 3I97A 4RN5A 4CUCA 2QQNA 4A42A 3SKJE 5HPOA 3T0BA 2W94A 4OYUA 2VO5A 5DMYA 3FL7A 4XVHA 3T2OA 4BK5A 3CIHA 1O59A 2W91A 3LQCA 3VD9A 2WAOA 2CDPA 2X05A 3C7OA 2VZVA 3MO4A 1EUUA 1NKGA 1J83A 2BBAA 3W5MA 4CUBA 2W87A 3LE0A 1JZ6A 1H6YA 3HEIA 4MO3M 1CZVA 1UX7A 2J1TA 2VMEA 2XONA 2YFZA 2W5FA 1F4AA 1UYYA 2Y6GA 1JU4A 3IB3A 4MGSA 4DXTA 3WF3A 3FHAA 2BERA 3VD4A 3BN6A 2WN2A 3VD3A 4CU9A 1UYXA 4QX3A 4ZZ5A 3OBAA 5G05L 4M4PA 1CZTA 4GWIA 4TXWA 2QBXA 3ABZA 3DYOA 4BDVB 4A41A 4LPLA 5LA1A 2RJ2A 2WZEA 2QQMA 3OGSA 3IIIA 1GMMA 1JI6A 3MUZ1 2YFUA 4LHSA 1IQDC 2VOTA 3T0DA 3EB7A 1NX9A 3F2ZA 4ARXA 2VZRA 5G04L 4QB6A 1OF4A 2J1VA 3UNPA 2C9KA 2LW8A 2EIEA 1JZ7A 1D7PM 1UYZA 2VC9A 4LQRA 3WNLA 1JYXA 1UZ0A 2XHNA 4L0PA 4PT6A 2QQIA 2VMCA 4P00B 4W8JA 4P5YA 3UESA 2ZEYA 4IUGA 1XPWA 1GNYA 2Y64A 3PUIA 1OT5A 2E32A 3K4DA 5JXJA 1UY2A 4JHZA 3C7EA 5CZKA 1JYNA 3T2QA 1JYWA 3FHQA 2J1UA 2VR4A 4JX0A 3I3DA 2DDUA 1SDDB 1EUTA 3AC0A 4UI9L 3OG2A 2WO1A 3HNBM 4HG6B 2V4VA 2WAAA 3K77A 1W8NA 2X10A 1JHJA 3I3BA 4MGQA 3MUY1 1ULPA 1UXXX 3ACGA 1JZ3A 1JZ5A 4QDRA 2BGPA 2J1RA 2WQ8A 2ZEZA 1P8JA 4QB2A 3WQBA 1TVGA 2X09A 5CYYA 1JYVA 4DXRA 1O8PA 4GWJA 2VM9A 3A22A 1CZSA 2JE8A 1JZ2A 3LEKA 4OMDA 2WZ8A 2BZDA 4BK4A 4DUVA 2DCKA 3P6BA 1WKYA 4DUXA 5IFPA 5LA2A 1UXZA 4QDQA 1W0NA 4AAXA 5JR2A 1L7RA 2VCBA 5IJRA 5JXIA 2VZQA 4UAPA 3W5NA 3BGAA 1PX3A 1R64A 2WN3A 4OMCA 5EJ1B 2VCAA 2Y6JA 1T2XA 2B9VA 4XUTA 1W9WA 3NQHA 2ZEWA 3K75B 4DXSA 4XUQA 4CU6A 1L7QA 4QB1A 1K42A 2VL4A 5I0DA 3GM8A 2LS6A 2WDBA 2E31A 2QQLA 3VDAA 4PF1A 1YQ2A 3WF2A 1SHWB 2EIBA 2QQJA 1PMHX 1XNTA 4DEQA 3P1IA 4E8DA 3DECA 4XUNA 3SKVA 4PQQA 1JZ4A 4TTGA 2OKXA 2XOMA 5IYYA 4P08A 4QPWA 3J7HA 5C70A 4D8MA 2QQKA 2WBKA 3I2KA 4XZUG 4OUEA 1CIYA 1SG3A 3FN9A 1XC6A 3C8XA 2VTFA 4DEVA 1W99A 1NAEA 1GUIA 2HYXA 3NNGA 3MBWA 1J84A 2ORZA 2J1SA 4XUPA 3GDBA 4P02B 1UMHA 1K45A 1JZ8A 3VD7A 2Y6LA 4E8CA 1DP0A 3WNOA 3I3EA 1W9TA 1I5PA 2W47A 1W9SA 5DN2A 3HNYM 2E33A 3ACHA 2VQUA 3IAQA 2V5DA 2PQSA 3LPFA 4A45A 1DYOA 3OGRA 4BXSV 5JUVA 2VZOA 3C7GA 3I2JA 2XQXA 2L9LA 4QX0A 1UY4A 3MV01 3T08A 1US3A 4UOJA 1BHGA 3SEEA 3GXUA 4JKLA 3I2FA 2VZ3A 3ACIA 2VZUA 2BGOA 3HPNA 4QX2A 1OD3A 5FUIA 2RVAA 3DYMA 2YB7A 4CU8A 2WABA 2JDAA 1GOHA 5C7GA 4A6OA 2Y6HA 1KGYA 5DQ0A 2CDOA 4RYDA 2KD7A 5C71A 5LCWL 4KMQA 3THCA 3PUHA 3WSOA 5DPNA 3I2HA 1GQPA 1F4HA 3WNMA 1O8SA 3A21A 5EIYB 1ULOA 2VCCA 1PX4A 2Z4FA 3HN3A 2V72A 2J7MA 4W50A 2Y8KA 1UMIA 3VDBA 1MPXA 1UY0A 3DYPA 5JXGA 3WEZA 4AG4A 2C4XA 2W46A 1OH4A 1HN1A 2YC2A 1CX1A 3ZM8A 5A1AA 1TG7A 3HJRA 3OB8A 3HOBA 2RV9A 5JMOA 1KEXA 5EJZB 2ID4A 3CZUA 3NJXA 2ORXA 1XNAA 3LEGA 3THDA 1W8OA 4CUAA
chains in the Genus database with same CATH superfamily
5F5IA 5FY8A 5B4XA 5C8CC 4AVSA 4CCMA 2BP6A 4S2GA 2J1EA 4QGNA 2PLV2 1AR73 4XILA 4CDXA 3HQXA 3IIAA 4KWJA 3H8RA 2WO2A 5FLIA 1B35C 1WCDJ 1G9AA 1RUC1 1NY72 2FCUA 3BTXA 5CFDA 2GNBA 3CZJA 1UY3A 5LBBA 1VBA3 1S0GA 3VKMA 4HZFA 2YY1A 2A7AA 4XF4A 4UFLA 1DGRA 2DUQA 4YVSA 2DCJA 1YFUA 4GB31 3VBRA 4CDQA 1BJQA 2YC4A 4R9AA 1DZTA 3ENRA 4V2VA 3VBUC 4FPYA 1ODMA 1W9FA 2VBDA 3FBYA 3OPWA 5E88A 1W2TA 4AI3A 1RUD2 3WNXA 1U5ZA 3B9CA 4HKWA 1U5IA 2HWE2 5IVCA 4K9SA 3U11A 3GYDA 3VKOA 2JDYA 1Q43A 3CKHA 4YVWA 3DXTA 1GBGA 1RYYA 3WF0A 4EE2A 1F2NA 1H8TA 4FPGA 5A7OA 5FP7A 4RD7A 2HWD2 2P1BA 1JXNA 2JICA 4A6SA 3HN1A 4W65A 2Q1ZB 1J59A 3IT8A 3MEPA 1COV2 4RSUA 5FY7A 4ET7A 4M3CF 5BNOA 2OYZA 3PUSA 1EYBA 4E2QA 1GNZA 1V6JA 2W1QA 2WQZC 3VBOA 2PAEA 3I2IA 3BYWA 4B7KA 2E26A 1GZTA 1ND2A 4X6RB 2OW4A 4XJZA 2FMYA 1ULDA 1EY2A 1V6IA 2R061 1XE8A 4IEPA 3RGBA 3POGA 5LWBA 3ECQA 1E5RA 4UWDA 2AR6A 4CXWA 3PDQA 1HXS3 1G9BA 1JOBA 3AM2A 3Q8EA 4PLOA 2XVGA 4XUOA 2XGXA 1SEFA 2YU1A 3MI8A 2Y60A 3ZIXA 1RIRA 1X9TA 3RZKA 2NQYA 4DMIA 5LA0A 3D3AA 2H6BA 4JVAA 3RMYA 3BVCA 1NLQA 4LHKA 3ZO0B 5FMBA 5A7NA 1CJPA 4AFBA 2HYKA 2Y34A 5FY4A 2W2IA 2A3YA 4XMAA 1BCXA 5FR3A 4NAMA 1UZVA 1YLLA 5DAVA 3IDAA 3E1F1 4B3NA 5IHRA 1G9CA 1MQTC 3S7IA 3WNNA 2PHXA 1WCQA 2WFPA 1QOTA 3ON7A 5BXXA 4AQ6A 3RQ0A 2QVSB 1QH7A 2W3JA 2BRTA 5IW0A 2RS53 1FMD1 3GGLA 4XXAA 1PNFA 5A3OA 4YPJA 1GZCA 4QQ2A 4NOTA 4XF0A 5EXOA 3O1MA 1N1YA 5FK7A 1N3OA 2GP3A 5EZWA 4LTAA 1IQAA 3WF1A 5C5UA 5DZEA 2Q8OA 1O3SA 4D7SA 2W92A 4OUMA 5H9RA 5FY0A 2JKXA 2K9ZA 1RUF3 2VOWA 4I3PA 3PTRB 3RZJA 5A6ZA 1W8ZA 4KBBA 3VL8A 3A7QA 2ZEXA 3MDPA 3UETA 3WP6A 2BFUS 2W39A 1DG6A 3D6EA 3MZHA 1FOD2 2AH2A 2ARCA 1XNCA 5CBLA 2XBO1 4UW5A 1JYTA 1R1A1 2E9QA 3AMQA 1SBFA 4GJYA 3RZLA 4IL7A 1WGPA 3ZYRA 1ZBE3 1RUG2 4AHXA 3I8TA 3M3OA 4OHWA 3TEZA 3PIJA 3PVOA 4TYSA 4A7ZA 5B2GB 2QQPA 3VHNA 5BYNA 1DGWA 2XJRA 4XC9A 3VD9A 3WZ1A 4UFKA 4OULA 4IE7A 2RR12 2CDPA 3MIHA 4CCNA 4G3YC 4BLIA 1D2QA 3AK0A 4XJAA 5KC6A 4BWOA 4NUBA 3ZFFB 2PHLA 1FI2A 1EUUA 1NKGA 3VZLA 5FFOC 3SLIA 4LUMA 5E89A 1BYHA 1V6KA 3TBDA 2D3RA 5D21A 1OOPB 1H6YA 4TLGA 4AGRA 3N36A 1DIWA 4MO3M 1CZVA 4UBGA 2R6QA 4O65A 1CAUB 1UX7A 4CE8A 5AC91 3MIFA 3NNFA 1UX6A 3POSA 2YFZA 5FZAA 2VH9A 1E5HA 5FP8A 5I0TA 3WDVA 3FLRA 2R0HA 4OHZA 2Y6GA 4OQ8A 1GKBA 5A7WB 1JU4A 1UL9A 2D6KA 4TWTA 4MGSA 4EN8B 1WD3A 2DUPA 3H42B 4XBQA 1ND3B 5F3EA 5KC5A 1DGLA 2WS92 3I3MA 1ZRFA 2HEVF 4P9LA 4XMIA 2A6XA 3U10A 1TME2 1IS5A 1KJRA 2XUEA 3FHAA 3WF3A 2Q30A 3VBHA 5C4WC 2UYAA 5A70A 2ADEA 2WRAA 4CU9A 1W6NA 1X50A 1ENQA 4R52A 2B5HA 4AOCA 3OBAA 1S0DA 1S2KA 3NV1A 3ZN6B 2V5YA 4M4PA 3V0BB 2ZZQA 5DAXA 5FBZA 4ATFA 1CAVA 4IV1C 5EWSA 2DURA 3FMGA 2N7GA 4PI2A 3LDBA 4N53C 1X33A 3UJOA 2QQMA 5FO8B 2G4IA 4AI9A 3U4XA 1FPN1 1Y7BA 4JRAA 1PZ9A 1CWPA 1JI6A 3MUZ1 2YFUA 2JG8B 4FFHA 3SMHA 5BPXA 1A34A 1SPPA 3HQRA 3AP5A 3V56A 3JB4C 2VD7A 3H3UA 1JUHA 4Q0SA 4QB6A 1GFF2 4IV3C 4HK8A 5CFCA 1VB2A 2D98A 2Q8EA 5I0RA 1QU0A 4I30A 4NIIA 3F95A 2J1VA 3RZZA 1S0JA 4LO4B 5JOYA 3QD6A 2XVKA 5ACA2 4QHZA 5JOXA 1KDMA 1JODA 4LO6B 3MHZA 1UYZA 2VC9A 3WNLA 3ZSJA 4DIQA 1LENA 3WUCA 1ZA4A 4AFCA 5LBCA 5FWEA 3DPRB 3GNEA 4QPIA 2WNUB 2FMDA 4L0PA 4PT6A 5I8TA 2JG9B 1R081 1DU3D 2VAUA 3WG2A 2F4LA 4QU2A 3TNPB 4FSJA 1F35A 4OHXA 3BKZA 1WLCA 4JGZA 3O1VA 1H2NA 2E32A 1PGW2 2HBUA 4AEDB 1ZZBA 3HR9A 4I0WB 1I3HA 5ANQA 3ZXLA 1JH5A 4AI0A 2GH8A 1JYNA 4RR3A 1JYWA 3KGZA 1QQP1 2KM2A 5T5JA 4Q4X1 5FPLA 4TZDA 2VNOA 5CB7A 5FDBA 3RZHA 1EUTA 4GMP1 1PGSA 1TMF3 2JDUA 2WO1A 3HNBM 5ISLA 2DUOA 4FT8A 2FZ1A 4HG6B 4HONA 4R9CA 1RGSA 2V4VA 1VMHA 1W8NA 4Y5TA 3LDRA 5FZHA 2OIIA 2JENA 1NA1C 4QX8A 4HOOA 2Z5WA 3I3BA 5DUWA 3D4KA 4LBQA 5IT6A 1KQRA 2VMHA 4LO5B 4MV2A 2ZMKA 5FRAA 3ACGA 2IXLA 5J48A 1JZ3A 4MX3A 2RDQA 5GM0A 3WP3A 5M0TA 1JZ5A 4QDRA 2BGPA 1T6BX 5T54A 1RVF3 4P9YA 1VMFA 4GAZA 2RMU1 2ZEZA 1P8JA 4ZU7A 3WQBA 1O8PA 5I8YA 4GWJA 5FZ9A 5A7QA 2WNVA 2NMOA 2FDIA 4GH4C 2YUEA 3AJYA 5F39A 2IVIB 5E6HA 2ILMA 2EF6A 2WZ8A 3H0OA 4LUKA 4DUVA 5IK5A 1DQ6A 4UFMA 5DABA 3WLUA 2EA7A 4AAPA 2GU9A 5LA2A 1C8M3 1LGBA 2LROA 1NCRA 5HCHA 1Z7S3 1L7RA 2YYOA 4C8DA 3B5LB 5GLTA 5FWJA 5J98B 4E2SA 2VMGA 4XAEA 2HBTA 3BGAA 4YW3A 4AVAA 2UURA 2WN3A 1POV3 1UZYA 5EJ1B 3N3HA 1K5MB 2HH9A 4HN0A 5DXDA 4WVMB 2X8KA 2PMWB 4RGAA 5CIRA 3AJZA 5FYCA 1SDWA 5CNAA 4CEYC 1W9WA 3THPA 3T4HB 3H50A 2RMU2 2RJKA 3K75B 4XUQA 1L7QA 3RSJA 1K42A 1HIXA 3GM8A 1WW7A 2FCVA 2WDBA 2I45A 1RUJ3 5LRRA 4KBZA 2QQLA 5EP9A 5BUVA 3AYDA 4XDPA 1YQ2A 5GLZA 4WV8A 3WG4A 3WF2A 3AYEA 2HWF3 4LHNA 3CF6E 2XLGA 4ISQA 4NHLA 1OPOA 3N9OA 3A0KA 1XQNA 2QQJA 3NNJA 1PMHX 4BQWA 3I54A 3RZGA 4XFCA 4Q8LA 3BOPA 1CAXA 2D5FA 3E5UA 2HWD3 4Y24A 1HB4A 3MPBA 2A73B 2DYCA 3N7MA 3DKQA 4WVWA 4Q4W2 1RUC3 4EWAA 3KCXA 1W8HA 1QJY2 5IYYA 3M4FA 1VBC1 4FPHA 3KGLA 3I2KA 1QF3A 1NXMA 2LUWA 4OUEA 4QXHA 4CEWA 1IG3A 1VAKA 4HN1A 3RG0A 4GB33 2JX9A 3C8XA 3N35A 3RYPA 2B46X 1W99A 1MS0A 2BJSA 1ZM1A 1NAEA 2CWMA 5LEJA 1YYNA 4YW5A 2HYXA 3NNGA 1O6UA 3ZR5A 1H1AA 1J84A 2YU2A 3IDEA 5D8AC 1H30A 3O1TA 5LASA 2J1SA 3LFIA 3GDBA 1MS8A 3R4DB 1KS5A 3A0NA 1HN0A 2VTXJ 4KU8A 1VBB1 5L7OC 5FLHA 1JZ8A 5FAXA 2E53A 1L7LA 1TEIA 2R041 3ZX7A 1PIV1 1HRV1 2V4AA 2WYFA 3H1WA 3I3EA 3OF1A 4COYA 1BK0A 5DN2A 1S55A 3EBRA 1CAWB 1ZZ7A 4N7IA 5FZOB 1VBC2 1HV0A 3HNYM 3I2OA 3ACHA 4OI1A 3J7LA 1C4RA 2BU9A 4AG4A 3KV9A 4IGQA 2PQSA 5C8CB 2X29A 4LITA 2ZGSA 3NMBA 3LPFA 1URXA 1DHKB 2R063 4WZCA 4PIZA 4HK9A 3WDYA 4BXSV 4A7YA 3UK9A 2JDZA 4Q26A 3TB0A 4QX0A 2WIIB 1CQ9A 3T08A 1US3A 4I3GA 4LXLA 3UV9A 2DVGA 5CISA 1BHGA 3GXUA 3AZYA 4JKLA 2QJVA 4BXFA 1O4ZA 1ST8A 2VNRA 2P2KA 4A7KA 4V2WA 3VHRA 1YEWA 2VZUA 1RMU1 3KQRA 4D94A 1XNDA 4PF5A 4MLOA 2ZACA 4FFIA 4XZPA 3CNAA 4FPKA 5APAA 3ZFFA 3KHBA 5FUIA 3VBUB 1CD3G 2CU5A 1ND3C 2YB7A 4XTPA 3OBRA 1KFXL 1QDCA 1H2KA 2D6MA 1FMD3 2VNVA 5FZDA 3OOXA 4PDWB 2JB8A 1CAUA 3POFA 1GOHA 1BMV1 2ZGLA 4OVEA 5EPAA 5E1RA 2PTMA 3IMNA 1NOVA 3ZFEC 5CKMA 4RYDA 2MEV1 5C71A 2WFF1 2OXBA 5EHDA 5A7WA 4IESA 3PUHA 4L11A 3WSOA 3B94A 5SV8A 1ULEA 2DCYA 1QXRA 3GBWA 4XDQA 1F4HA 3ZXDA 4D7YA 2ZOEB 1HDKA 3MIBA 4GIQA 2D5HA 4LK6A 4M0NA 1ULOA 4XFBA 4MHUA 1PX4A 5F3IA 4NIAA 3W59A 2Z4FA 2FBEA 1LRHA 2XBO3 1ZRDA 1MACA 1IKQA 1R1A3 2F6BA 3HN3A 1UD1A 5IAVA 2PN5A 5A6QA 3RWKX 4EJRA 2WO7A 3VDBA 5I0SA 4AXOA 1S2EA 4COUA 3WVJA 1BBT1 1PO12 1L3JA 2BOIA 3RJRA 2C4XA 4MUVA 3WEZA 2IZWA 2VOXA 4A2UA 3VBFC 4B7EA 5HV4A 3OBTA 2W46A 3BTZA 4IE0A 2WR9A 3N7JA 3L2HA 3R6SA 3NO8A 3MFAA 4N43A 4YG0A 5H9SA 1V9U1 2JG8A 1RUE1 3H7YA 5TSWA 5DDJ2 3DPRC 4FPJA 1D4VB 1LULA 2RV9A 1AXYA 3HOBA 3TWIA 2JG9C 1XE7A 2MEV2 4FPLA 3K3OA 1MQTB 1PO22 5KHKA 3PIGA 4AZZA 4M01A 3K3NA 5BNPA 2DVBA 3LPGA 3CDZB 1UQXA 3CO2A 4ZXEA 1LEDA 1OSGA 5AC93 2G9FA 1XRUA 2R0FA 1K3IA 4IETA 1W0OA 2ZGUA 3EQEA 3HNMA 4JTOA 4QAWA 5LBEA 1SLAA 5FPUA 1PK6B 2VZSA 4LE3A 4KI5M 2CAVA 4COZA 1ASJ1 2QUOA 1V6OA 3K4ZA 1PVC1 2GSYA 2Z42A 2WNUA 4OZOA 3OEBA 2O1QA 4MGYE 4G9SB 4BQ3A 3I4IA 4ES9A 1BBT2 3T0AA 3J8F2 4Q5OA 5AFBA 4L97A 3T2TA 1WW4A 3VDDC 4BJ0A 1LGNA 2Y33A 2JD4A 4AEDA 2MHFA 5FJHA 5ABJA 2VMFA 5E16A 4A4AA 4Y20B 4G4FA 1G6NA 5LA9A 4YNIA 4AWDA 1EV12 1GOGA 1XU1A 4CDWC 4PBOA 4QM8A 4ZY9A 3V64A 1NE6A 5A7SA 3ZXEA 2WO3A 4LO8A 1SLBA 5JAXA 1QNWA 2E7TA 1Z0HA 2FHRA 3ZXJA 2DVFA 3AVRA 4I09A 1FPN3 3WQ1A 1VBE2 3NJZA 1X8MA 3I49A 2GC1A 3O7OA 5KXEA 5L36A 5HCBA 4MVTA 1DGRN 4XJWA 3WT3A 2W1SA 4BH9A 1JN2P 3QLQA 3H3LA 5IVVA 5A1FA 4MADA 4XQWA 2DF7A 1ODNA 4UF0B 3USSA 4XFAA 4J1XA 1UMZA 3ACFA 4QD2A 3I2DA 3QCWA 1JS9A 1QKQA 2P5BA 1J3QA 3JU9A 2R072 1N47A 1QJX1 3DL3A 1ZZ8A 3LZZA 3OGJA 4AI2A 1NQDA 2B4KA 2VZPA 4JDOA 3T09A 3OD0A 4E9KA 4CVUA 1REFA 2CWSA 2EIDA 4LKSA 5HXMA 1W6QA 4M4RA 1UY1A 3VKNA 1C8NA 1R083 5JOZA 1E5SA 5FP4A 1YRZA 2VQTA 4X8NA 5JPNB 1YI7A 2NP0A 3OGGA 2Y6KA 4Y22A 1GICA 4XIOA 5C4WB 4E4SA 1MZ6A 5BNNC 1QQP3 1VALA 3MV11 1RXGA 4Q4X3 1NCQC 5K8SA 3ALQA 1Y9QA 4K7JA 1QEXA 1YQ5A 2VMDA 2W0XA 2XMLA 3CJXA 3JD71 1DZRA 3BB6A 4GMP3 4K20A 4L2NA 4WVMA 4QDSA 2JKBA 1AXKA 5GLVA 2WLQA 4N53B 3Q8BA 4LOTA 3E6CC 4HVOA 4ZZ8A 5JZGC 1S0FA 2P4EA 4CZSA 5FOBB 5I91A 5LY2A 3EYPA 3IMMA 3USUB 4Z92B 4UYBA 5J7MA 3KCCA 4YM0A 3AKPA 1O4YA 4JGYA 3CQOA 1HRI1 1YFYA 2GDFA 3SH4A 2IVJA 4IV3B 4XHXA 1AR82 2RMU3 5EFUA 1K12A 1SBDA 5JXHA 1NXD1 5FMOS 4XACA 2JD9A 4XURA 3CJIA 3BUCA 2PLV1 3I97A 1MZ5A 4A42A 5T5PA 2IUWA 1WMEA 4XXPA 2A6VA 3PURA 5HPOA 1C1FA 3T0BA 4XABA 1QY4A 3T2OA 4BK5A 1PM4A 1O59A 1IPKA 3VHOA 3LA7A 2VXJA 5FZ1A 2VECA 4K1ZA 2WSVA 1OA4A 1SZBA 4J25A 4Z82A 2ZX2A 4RA0A 3RMXA 4Q4W3 5FZEA 4BB3A 1FV3A 3GHMA 4YFZA 5AFEA 4XAAA 3GBGA 3S7EA 1OMIA 1NZIA 1HRI2 1Q3EA 1RUD1 2Z69A 1LHVA 2HWE1 2W87A 3LE0A 2GH2A 5K7PA 5JWPA 1QJEA 3HEIA 3MIDA 2ARAA 2VW0A 3VHPA 1G86A 5A3TA 3AL5A 1NA1B 2HWD1 4GKYA 4UT5A 4U36A 4YFWA 1KXGA 4LNVA 3OBZA 2CHHA 4C0BA 1LR5A 1GP4A 1COV1 2UYBA 1GP6A 1MVEA 3CBNA 2XL7A 3WQ0A 4QXKA 4JZRA 4WBBA 2B9UA 4R4XA 3VZKA 3NV2A 4DQAA 3M3EA 2BERA 2PQQA 4H55A 2Q5TA 1UNBA 4NRQA 2PAKA 3D0SA 3BN6A 3HD8B 4W6WA 3T3YA 5CADA 1DYKA 3VBRC 4ZZ5A 2Y6FA 5LRSA 2BUKA 3RDIA 3FHIB 1W6OB 3IN9A 4QX7A 1B35A 1VBC3 2SBAA 2Y26A 1XE0A 4GWIA 4HETA 5A1LA 1H2LA 2EAAA 2H6CA 4S2DA 2QBXA 3N9QA 2WA3A 1UPSA 1JW6A 3BOWA 4IE6A 4PDWC 4A41A 2A3WA 4O9GA 1OH3A 3MIGA 1HJGA 5IVBA 2A1XA 3IIIA 5FZ4A 3FJSA 1EAH2 2VOTA 3N9PA 5I93A 3MW3A 2B7YA 4YGBA 3T0DA 2BPA2 5FP9A 5C33A 4FOQA 2A5ZA 1IG0A 1NX9A 1O3RA 1YFXA 1YWKA 1LESA 3VBUA 3FLPA 2QQVA 1ZBA1 4D6QA 1G9FA 1X9PA 1F31A 2H0VA 3ZN5A 3PNAA 4CEYB 3GJAA 1AZDA 1VBB3 4CRQA 4FOWA 4BOWA 1W2AX 2R043 1PIV3 1HRV3 4Q4Y2 4XF3A 1IHMA 4LQRA 3EO6A 3TN92 1PHMA 1JYXA 1N1VA 4FPEA 4IEOA 1UZ0A 2AYHA 2GC2A 3R05A 1UZZA 2D93A 2RM22 5FYIA 1RUH2 4D6RA 4K1YA 4P00B 4W8JA 2WKKA 4P5HA 3UESA 1CONA 3LFMA 1CX4A 4IXLA 2AEYA 3KVAA 3PLQA 1OT5A 4SLIA 3WQ7A 4DFSA 4KL1A 4MYEA 1AXZA 5JXJA 1FOD1 4EZHA 2CY6A 3ZSEA 4LK7A 5C9AC 5DAQA 3T2QA 3WOGA 3FHQA 2J1UA 3NSTA 3OUJA 2Y0OA 2RS32 3KCYA 4JX0A 3JUUA 1AL22 4XF1A 4J6GA 1RUG1 2XHKA 1IZ3A 1DLLA 2DDUA 4P9GA 1JUIA 3UKVA 2AZ5A 2GMPA 1ZBA2 4YSFA 2D44A 2ZHLA 2IFRA 2XKPA 3LA2A 1LOEA 2RR11 4Q4V2 5IAXA 2WAAA 3K77A 4IGPA 2PHTA 2GNDA 1LTEA 2GAUA 3ORJA 1PK6C 4H3WA 1RMU3 1GZ9A 1OC1A 3GZEA 4ZKTB 4LLFA 1ULPA 2DU1A 2BDRA 3BTAA 1MS5A 4OQ9A 4AI8A 2JDHA 4B29A 4BQ2A 4QHOA 1W6MA 1WD4A 1PO13 1IPJA 2QFEA 2WZR2 5D8AB 1A8DA 1W04A 2J1RA 5GALA 4ASMB 1HQLA 3BTYA 2BEOA 2WQ8A 1Q8VA 1IOAA 3KVBA 1F5JA 4YGDA 4OI2A 5L7OB 3GCWA 2HEWF 2OVUA 4DXRA 3BIEA 4FTBA 1E5IA 3D5OA 3OSDA 2PAMA 2EALA 4IDZA 2VPVA 5HI0A 1CZSA 2MEV3 4FAGA 1HB3A 1LECA 2JE8A 2WFF3 2BNOA 1O5UA 3LEKA 3ZYGA 2BZDA 2OQ6A 2DCKA 4DINB 3P6BA 2ZKLA 4YZ5A 2WS91 4HPKB 1UU4A 2C24A 2ZGRA 5FZLA 1TME1 2ATFA 2IXJA 4EN7B 1W0NA 4AAXA 5DUVA 3E5XA 2ZGQA 4AVCA 2VZQA 4R4ZA 4AEKA 2E63A 4CPBA 5A3NA 4Y20A 2OS2A 3NKGA 3ZSLA 3APBA 3WDUA 2DU0A 2VCAA 4KWKA 1VAVA 1T2XA 2WC2A 2Y6JA 4AQTA 1DF0A 2B9VA 2DCZA 1BBT3 4CP2A 4XBNA 2P37A 3NNMA 3KHCA 5FBJA 3NQHA 2ZEWA 4GJZA 2P3JA 4MZUA 2JEMA 1LCLA 4RS5C 3IPVB 1QGLA 1ZA7A 3NW4A 4WVVA 1V9U3 5FQ0B 1RUE3 5AVAA 3W58A 4BQ4A 3RZMA 3RFRA 5J37A 2HWC2 1W9YA 3ZYBA 2BQPA 3ZPYA 1Y3TA 4MXWB 5FY5A 3LDKA 3WHUA 4FFGA 5FXXA 1DQ5A 1SQ4A 2A6WA 4W6YA 4UF0A 4LBQD 4RGKA 5FYSA 5ACA1 1PZ7A 3B9IA 4IEXA 1OURA 4DOUA 4XHBA 3P1IA 1LU2A 3DECA 3PVNA 4LKFA 3G6JB 1XJAA 3VBHC 1S2BA 3OY8A 4RL7A 1WBLA 5FK8A 5A3PA 1JZ4A 2E7AA 4UW4A 1ONAA 2RJLA 1ASJ3 3ZFEB 3WD5A 1QJU2 1PVC3 1YQ8A 3J4UH 1RHI1 3VBSB 4LO7A 2VXRA 2XOMA 1JOJA 1X36A 5F32A 3WW1A 2MPFA 2VUAA 2D3PA 1PGW1 2LTNA 2ZGPA 3AB0A 3G7DA 1FV2A 3WHTA 3ZFGB 1HQWA 1IKPA 3CHXA 1ALYA 1VB4A 5C3QA 2WT2A 3FN9A 3H1YA 5C4WA 3AKSA 1YO8A 2VTFA 4Q0VA 5DUXA 3LKJA 1LU1A 1HQNA 1VP6A 1BEV2 5BY5A 1GUIA 2Y0IA 1LEMA 1WCKA 2ZX1A 3WX5A 3V65A 1GQGA 3OD4A 2ORZA 3KT7A 4IV1A 1OKOA 4ZONA 3U0ZA 2ZS6B 4XUPA 1EPWA 4AGVA 3ZN4A 4P02B 3VBFB 1UMHA 5J96B 3RRDA 2YC0A 1AYN1 4IEUA 1XXNA 2IXHA 4J1WA 1DP0A 4XJ9A 5F6KA 3WNOA 4TLFA 3KV5A 1I5PA 1YJLA 5DZGA 2W47A 4P9XA 1LOGA 5FPXA 5BV6A 4LIUA 4XW3A 3KT4A 2XXZA 1RHI2 1ULGA 3BIWE 4MGKE 3K2OA 3KWVA 4X6QB 4ZXKA 3SNMA 2VOKA 4IV3A 1LOCA 4COWA 3SQOA 5FOJB 2HWB2 3M70A 3RYRA 1TQ5A 3E6DA 1QJX3 3IAQA 2NM1A 1FAYA 2AC1A 4A45A 4F7ZA 1NG0A 5FYBA 3GCXA 1QIQA 3I2JA 1UIJA 4RQPC 1UY4A 4ATEA 3GALA 3ELNA 2GN3A 2NZ9A 4UOJA 2ZMLA 3SEEA 2RDSA 3M1HA 3C2UA 2ZAAA 3VDDB 5A33B 1AYN2 3VZNA 5IK7A 5EV7A 4YW7A 4DRRA 3ZXFA 5LW9A 4WM7C 1IS3A 5FTTC 3SC7X 4V1PA 4HVRA 4CDWB 4XFIA 1JOPA 5FYUA 3DUIA 4QX2A 2RS11 3JD73 4CCKA 4FP3A 1W2OA 4W6XA 4EWEA 4CU8A 5LATA 4LIVA 4BIOA 1NQJA 2Q0AA 4IEZA 1NA1A 1ULCA 4AQ2A 3UYJA 3AZVA 5FZ8A 2Y6HA 5DQ0A 2CAUA 4EN0A 4M00A 2NYYA 3ILFA 2UWCA 3R4SA 4CCEA 3DKWA 5HV0A 2ZKNA 1GANA 1HRI3 3KB5A 3JQXA 3THCA 1MZFA 3K51A 1R092 3U4SA 3E97A 3PJYA 5DPNA 3FBMA 3I2HA 5DAWA 1GQPA 3A21A 4KNCA 1S0IA 1JYCA 2PLV3 2WJSA 3O0WA 1DYPA 4AVVA 1VLNA 4C0HA 2YBPA 3W21A 5LZ6A 3VUOA 4NPRA 4Q4W1 4DZGA 2V72A 3N9NA 4GWNA 5F5CA 3POEA 2R16A 2YBKA 1QJY1 1UMIA 2CGPA 1UY0A 1W6OA 1AVBA 2RS12 2UWAA 1UAIA 2XUMA 3HT2A 4FO9A 2X5IC 2P3IA 4CP1A 4E4ZA 4RFT0 1OH4A 4NIDA 1WMFA 1TE1B 4P14A 1U12A 1CR7A 4HSJA 4META 1CX1A 1CPMA 5FXVA 5A1AA 5BNNB 2VVFA 4WM8C 3WINE 5KXDA 2HJIA 1NCQB 4Z2WA 1XNBA 5I0UA 1N3QA 1RUD3 4E4DX 3S30A 2ZTNA 2VCMA 2HWE3 2WNEA 2ET1A 2RDRA 3LEGA 2HKXA 5C3OA 1W8OA 5GZFA 5JOWA 4CUAA 5JZGB 2TBVA 2KR2A 1OBNA 3Q8FA 4K3UA 3VDCA 3WP5A 2BWAA 5KBFA 2FCTA 3OEAA 5F9TA 5GZCA 1RUI2 4OZXA 5F2SA 1SFYA 1COV3 5FKBA 4UW6A 3OPZA 2D7FA 4HKOA 3VZJA 4DUWA 4LULA 1ENSA 4CCJA 1VRH2 1Y9GA 2ZAHA 1AUYA 2K46A 1ZX5A 4NO4A 1YFWA 4Y5Z0 3KSCA 3T2PA 1O5LA 4QX1A 5H9QA 1XB9A 4CEWC 3LB9A 3ZSKA 5LK5A 1UWWA 3THTA 2ZPXA 4LKDA 2BGCA 5LBFA 2YDEA 3IKWA 1AX1A 1RUH3 1H0BA 2D3SA 4CDUB 3JXSA 3B02A 1Y4WA 2WUHA 2J22A 4D0QA 5CKQA 4I2OA 5K0UC 1Q8SA 2W1WA 4OHVA 4CCLA 1RTVA 2BTVC 3SCFA 5T50A 1VMJA 3TNQA 2YHJA 1MR5A 1UKRA 4QPGC 4XQ4A 4XFHA 4B1LA 3BPSA 4URAA 3E6BA 1NUKA 5AVPA 5JSPA 2YMZA 3DXUA 4FI9A 1AR72 3MICA 4FAHA 4JDNA 4AR2A 2CGNA 2QQOA 3N9LA 5DAPA 1ZBA3 4CCDA 5D8AA 2W9XA 4JKKA 4L8QA 1W3XA 3PVEA 4B4QA 1AYM1 1NLRA 4BMEA 5CAZA 2FD8A 4NWVA 2GN7A 5L7OA 1OQ1A 4K40A 2RDNA 1W28A 1QH6A 1VBA2 2QDNA 1AX0A 1LHNA 3OPTA 2J1AA 1GWMA 1OA3A 1YC61 3QACA 3C7FA 4Z07A 3KF5A 4CXYA 1GZWB 2KXLA 3NJVA 2YG0A 1S1AA 4GA9A 1POV0 1V00A 2O8OA 2PYTA 2W52A 3ACLA 3I2GA 4ZU4A 3U07A 4B4PA 4DY5A 2W08A 5IATA 4HPKA 4Y1XA 5CFDB 3I59B 1Q8QA 1HB2A 3BODA 5LK7B 1C3HA 3U1XA 1FOD3 4URTA 2XLAA 2P3KA 1KRIA 2VZTA 2PHRA 3BPZA 3VZOA 2C0ZA 4YVSB 3AMPA 2BBVA 2HLEA 3VBRB 1OQDA 1RUG3 1UCXA 1DLCA 1SLLA 3KMHA 1LJ7A 2RHPA 4MGIE 3UGGA 1PO11 3NV4A 3ZPOA 1APNA 2ZGNA 2R30A 1OOPA 3C7HA 4QT6A 5FY9A 3U75A 3WR0A 4AQSA 5F6LB 2RR13 3A4UA 1OLRA 1AYM2 2QQUA 1OHFA 4LA3A 2VJXA 4ORFA 3VLBB 3IAPA 5DDJ1 2XJUA 4XDOA 4IERA 2WWJA 3MLKA 1US2A 1GU3A 3LA3A 3SEPA 1K5JA 1OF3A 3VBSC 3VB9A 1PO21 4MXWA 3EJKA 5JCTA 1W05A 3ZFGC 1HXS2 1ND3A 2B8MA 3VKLA 4E4HA 5J1XA 4QGMA 3M7AA 4CDUA 3PU3A 4AEJA 1ULFA 4KWUA 2YPJA 5FZBA 2DFBA 4Y4YA 3VBOB 3HIFA 1FYUA 5EJ3A 1C28A 2XR4A 3QH7A 4PIYA 1LOFA 1WBFA 1LAJA 1XYPA 1DGWX 1UZWA 4JCKA 2VY0A 3ZFEA 1YCIA 1FX5A 2JDPA 1Z78A 2LALA 3RNSA 3ZN6A 3V0BA 1OLME 3UL2A 4EZ4A 5DMYA 3FL7A 2OUHA 2WS93 3J8F1 4QQHA 1TME3 3CIHA 2W91A 1OVSA 1C5IA 4YW4A 2FZ2A 3O1SA 2XJVA 3LQCA 4PQ9A 2YV8A 5JIUA 1WLTA 3AP7A 1ZZ9A 3FFQA 2C1FA 1CVNA 1EV11 1SBEA 2RS52 5A3WA 3J7MA 1DQ0A 2YGMA 4BISA 5C9AB 2X05A 3C7OA 3AXEA 5FYZA 3MO4A 3RI9A 1ZNPA 1H9WA 3AYAA 3S5QA 1J83A 4LA2A 1R1ZA 2R49A 4CXXA 1MEC1 1GQHA 2CSGA 4IE5A 3U14A 2BVVA 4Y1YA 1QXJA 2VE1A 1VBE1 2E51A 1RUF2 4RFRB 5FY1A 3VBFA 5BNPC 4XEZA 1MS1A 2F17A 3WXPA 3NAPC 4RGGA 3ZIWA 1XYNA 3ZSMA 2XONA 3SCGA 2WL1A 4MG2A 1Y9MA 2W5FA 1LHUA 4O61A 3D8CA 4AFMA 3DPRA 3AL6A 2JG9A 1UOFA 3PMSA 4LBNA 4XFFA 5EQUA 4YM3A 2A70A 3LIHA 1PGL2 3AXDA 2I74A 2GMEA 1ZBE2 5ACA3 2R071 4DXTA 1AR91 1W6PB 4Y33A 1VJ2A 2RE9A 4NN0A 4PLNA 2G1MA 3MYXA 3SCHA 4LLOA 4NJ4A 1WA4A 3VN4A 5CEHA 1A6CA 4ITCA 4LBMA 2XB6C 2WN2A 3AMHA 1UYXA 3T1LA 1JHNA 1ZRRA 2XH6A 1UOGA 2XLFA 4HLTA 1RHI3 4XETA 4EWDA 5IVEA 3B93A 3X29B 4NAOA 2Q1MA 4Y4RA 1CZTA 3FE5A 2DFCA 1JYIA 1MEC2 4DRVA 1AL0G 5FYMA 3DYOA 4BDVB 4AFAA 5LA1A 2QE3A 2A75A 2RJ2A 2FDKA 1D4M1 2D6NA 1H4GA 2DTWA 2DTYA 2TEPA 5A33A 3O0VA 1NT0A 1N1TA 2GZWA 4NHXA 2A6ZA 2ZABA 1IQDC 4LHSA 3D0JA 5GLUA 3WV6A 4YG3A 4Q8KA 2D6LX 4MXVA 4TN7A 3EB7A 4CDWA 2QZ2A 5FZCA 3F2ZA 4EV0A 3ZXKA 4ARXA 5FLJA 3H8UA 5DZFA 2I07B 4GWMA 5FZKA 1D0HA 2IXIA 4HT1T 1AYN3 1AR92 5EYYA 4AEMA 3ZXGA 5JDBA 2C9KA 1PM7A 2ETEA 2LW8A 2EIEA 4RS5B 3MF9A 1D7PM 2VVDA 2H0BA 3J26N 3ME2A 3OYWB 3B00A 3ETQA 3O14A 1CESA 3LSEA 1J3PA 1AX2A 4O7XA 2ERFA 1T6GC 3POBA 4C91A 1D2SA 2VMCA 1AR81 2QTWB 2ZEYA 2V73A 1OI6A 1QDOA 1W0PA 1H8VA 5L73A 1GNYA 3PUIA 3AKTA 4S2HA 3T30A 1D4M2 4DNYA 3Q8AA 1UY2A 4IEYA 3VBHB 1J1TA 1LHWA 4JHZA 1A78A 4KGGA 2YBSA 2JE7A 2PHDA 3PL0A 1KITA 3WDXA 4YZ1A 4DB5A 1O3QA 3NKTA 4C1WA 4Q29A 1ZZ6A 1K5MA 1YI9A 4IEVA 2AENA 1SDDB 3NNLA 4M3CE 5D2AA 4QKDA 1CAVB 4FOYA 1J1LA 1SCRA 3OUHA 2XKOA 5T3NA 1VBD1 5FPVA 3K48A 4HKLA 3UGFA 2IFWA 1BLZA 2UU8A 4NROA 4LJHA 3T1MA 1PVXA 1C57A 5A6XA 3HQUA 3WP4A 3FZ3A 5KR7A 1JHJA 4MGQA 1AR61 3PU8A 1AF9A 1SPPB 2ZGTA 3HBKA 3HWJA 3S0MA 1NCQA 2RS13 4K21A 1NYWA 1GLHA 3ST7A 4N8MA 3N9MA 3EXUA 1GR3A 3HT1A 4NPMA 4QB2A 5GZGA 5FO7B 3H8XA 2X09A 3H3ZA 3HVDA 1AJOA 3CJIC 3MLJA 3OUIA 4MH0E 2B45X 2TNFA 5C6CA 2VM9A 1OFSA 2BWCA 3LEMA 2Q1FA 2JWPA 3FWEA 1TZOA 3DEMA 3IM0A 2CYFA 2JDMA 1KS4A 1JZ2A 3OTFA 4LBJA 4BK4A 4HVQA 1BVVA 2OPWA 1V6MA 1S0EA 3NVCA 4LORA 2GP5A 3TRSB 5IFPA 4RHV1 4QKFA 3Q9OA 1QXPA 1UXZA 4JGZB 4KG8A 1M4WA 1VBD2 2UWBA 4R8HA 3IBMA 1TMF2 5JR2A 3INAA 5JXIA 3AZXA 3LOBA 2A6YA 2VUJA 1RUI3 2EVXA 3ILRA 1PX3A 4RR3B 1PMIA 1R64A 4JDMA 4ASKA 1IS6A 4RQPB 4OMCA 4F8AA 1QJY3 1AR62 3KQ4B 1TNFA 1HV1A 4M3CB 4XUTA 3LWCA 4EN9B 2NN8A 2LRPA 1UIKA 1VRBA 3NV3A 1CPNA 3AKRA 4BQ1A 3ZKUA 4DXSA 4NIGA 1DFQA 1LGCA 1RVF2 2D97A 1EAH1 4SBVA 2BNMA 3ZVXA 4UBHA 4NHYA 5FZFA 5LY1A 4WM7B 4B1MA 5GZDA 2RG4A 4CDXC 1KJLA 4LEJA 1XYOA 1DZQA 4ZS3A 4PF1A 4LBQB 1UOJA 1I5ZA 1G8WA 2K0GA 4B8EA 1CAWA 1W3VA 2PFWA 5FZOA 4FPCA 4AF9A 4KQ7A 3DV8A 5CFDC 3TYJA 4AVBA 1SHWB 4F3JA 4RHV2 1X7NA 1GWKA 1N3PA 3H7JA 1XNTA 5C8CA 4Q4Y1 1C8M2 4XUNA 1FT9A 5J3UA 4PQQA 4N7UA 1FXZA 1Z7S2 2ADDA 4YVSC 4Q0PA 3TN91 1FATA 2WNVB 4CDQC 3KT1A 2RM21 5C3SA 4C90A 1RUH1 1WW6A 2OKXA 4TTGA 5FXZA 1GZWA 5CU1A 2P6HA 4ASLA 3AP4A 1LODA 1V6LA 3LIGA 4P08A 4Y26A 1RC6A 3J7HA 4H2AA 1XU2A 5C70A 4D8MA 4GMP0 2QQKA 2WBKA 3I59A 1S4CA 3W20A 1O3TA 3EMRA 4XZUG 1NCRB 4YVWC 2R1DA 1U5XA 1A3KA 1H8TC 5FPZA 1XC6A 2RS31 5J36A 1AL21 3L2YA 2UY8A 5T52A 3S5AA 3JCIA 3GF6A 4Y1ZA 1RXFA 3E5QA 1HJFA 1RUJ2 1W06A 3MBWA 3B3QE 2P6CA 4CPBD 4N9IA 4NHMA 5BNOC 2HWF2 2X5IB 4Q4V1 1TNRA 2DV9A 5LEKA 3VBOC 4PDWA 4CP9B 1I9RA 1QNYA 1ND2C 2KA3A 1W90A 2VG9A 4EROA 5KHJA 4PHZA 3FUQA 4YGEA 1GSLA 4WM8B 1W9TA 1W8UA 4QXBA 1U0AA 4D3WA 2YGLA 4AVTA 1N1SA 2GC3A 4INDA 3D82A 2WZR1 3O1UA 3P5BA 3TOJA 1STMA 1RUC2 2NMNA 4GD4A 1AYM3 4JV4A 1QMJA 4ZHNA 4GKXA 4YYOA 2FQPA 2Q4SA 2V5DA 4BU2A 5JR7B 1CAXB 2IC1A 5FYTA 1DYOA 2ZX0A 4COVA 2DVDA 5JUVA 3CLPA 1KD7A 3C7GA 1XNKA 2L9LA 4JTNA 4PIXA 5IVJA 4GB32 3MV01 1WCSA 2BNNA 3SISA 2BFUL 2GNTA 2XDVA 4HANA 4GULA 4QQLA 3DGTA 1OLQA 2ZGKA 4N9HA 3PUQA 3ACIA 2CTVA 3M8LA 4CEWB 2VQAA 4QKBA 3UGHA 3ES4A 2YROA 4EN6B 5C9AA 4CUGA 1SACA 3FUOA 2E7QA 3ZDSA 1I6XA 2ZMNA 1DQ2A 4JQTA 1JBCA 1OD3A 1SLCA 2EXJA 1MQTA 2RVAA 2WINB 4HFSA 3DYMA 1HW5A 5K0UB 2TUNA 1BXHA 2CV6A 2OA2A 3S57A 4QPGB 5DDJ3 4EYUA 2PELA 1F15A 5C7GA 1PK6A 2HWC1 4E2GA 3ZYJB 4A6OA 3J7NA 3AYCA 1KGYA 2BV4A 3H9AA 2CDOA 4S2FA 3SITA 2R062 4DXZA 1PO23 1HX6A 1WMXA 4ZPIA 4KMQA 5IVFA 3M2MA 3R4UA 4FPFA 5FZ7A 4P9JA 2X53S 3MGUA 3UJQA 3O12A 5FMDA 4MGZE 1BK1A 1O8SA 5EYXA 4Y5SA 5SV5A 1W6PA 3ZYHA 3AMMA 4XOGA 3HBZA 1WA6X 3S6PA 5EIYB 2QNKA 1QJFA 1ZRCA 4DS0A 4OI4A 1QJU1 5FZIA 1LKNA 3VL9A 4L92A 2P34A 1ACCA 3MPPG 4W50A 1W8WA 1MPXA 1OLMA 3J8F3 2VUCA 4YLZA 3RI8A 3DYPA 3ZXAC 2IWGB 1E57A 1RL3A 2A71A 1SFPA 4BQ5A 2WWUA 5HBAA 2DCTA 5GZEA 3ZOIA 4FPOB 1EV13 1FMD2 2YC2A 1GV9A 2AACA 2BW8A 1BEV1 1Q5OA 1TG7A 1OD5A 5F5QA 3MLLA 5JMOA 1KEXA 5EJZB 2ID4A 2ENRA 3NJXA 3I3QA 1XNAA 1MEC3 3TEWA 5L9VA 1Q56A 4HBNA 2NLRA 4Q0QA 3DN7A 1VBE3 4QPYA 1CGPA 3AP6A 4AK3A 2R32A 1VE0A 3WY6A 5IUQA 4RS5A 3U37A 4FBFA 3OYWA 4LKEA 1H6XA 2ZXQA 1CIWA 1W39A 1RUOA 1LOBA 1V70A 2G9GA 3K4AA 3WF4A 5KWRA 2JJ6A 5GKAC 3AKQA 5J09A 1WMDA 4WZFA 3H8OA 2XBO2 4MOAA 3WG3A 1R1A2 2HWB1 2C26A 3PVBB 4D69A 1YIFA 2R073 3WNPA 1AR93 3POYA 4XIKA 2CGOA 3K46A 5A32B 2FDFA 3B69A 3ZMNA 4QQOA 5FZMA 3V0AB 2AUYA 3URFA 5JIAA 2D6PA 2ZCWA 4LT5A 5DG1A 2NPIA 3MF6A 4FCAA 1H1IA 1LNSA 1WZXA 1GYKA 4JRLA 2P17A 3O0XA 3ROUA 4CU7A 3VD5A 4ES8A 2GC0A 5IFTA 1BVP1 4PBPA 3NRUA 4AFDA 4YGCA 5L9RA 4LHLA 4Y1UA 3POJA 2BOJA 2JDNA 4BIFA 5CFCC 5CKNA 4YARA 4N53A 2ZHMA 3ASIA 1D4M3 2B39A 3JZVA 5JVVA 2VGDA 5DG2A 1UU5A 4AYUA 2CNAA 2ZZJA 5DUUA 3T4VA 2W68A 1G7YA 3USUA 4N43B 3WW4A 5AC92 1C1LA 2EICA 4F83A 3OGVA 2VU9A 5C8WA 5IK4A 3NL1A 2OT7A 3RPQA 4QPIC 4ARYA 2EAKA 3NJYA 3QH6A 4NVPA 4FFFA 1FNZA 4QGLA 1G9DA 4Z2AA 3A23A 2W95A 3ZYPA 1S0BA 5T55A 2C5DA 4FP2A 1OUXA 3LF7A 4JGZC 5FYVA 1RJ8A 4PI0A 5KHGA 1JU3A 5BNPB 3DCQA 3JBG1 2J42A 3NAPB 3PTYA 3AZZA 4I0BA 5A3MA 4BQYA 4GZ9A 2XPJA 4RR3C 1SMVA 3ETPA 1UO9A 2PHFA 2VW2A 4JKMA 5F37A 1WLWA 2R7EB 1R091 4BCUA 3KV4A 1AR83 2XWBB 2WYSA 3L9JT 2BYVE 2W1UA 2Y38A 2YZ4A 1W8FA 4A44A 1H4HA 4OCTA 3TEXA 3ZDVA 4AE2A 5F7UA 4OFGA 2ET7A 4A3ZA 4MGTA 2WA4A 4BM8A 5F5AA 5FZ3A 1FPN2 5ABJB 2D40A 1GP5A 2O0OA 4UFHA 3CMGA 4RQPA 4U2AA 5FKCA 1X82A 3LD8A 5FREA 2OQ7A 5JMCA 5KHHA 4M3CA 1NE4A 3BI3A 5F2WA 1VBD3 5JSRA 1O7FA 1POQA 2ES3A 1AJKA 4JAAA 2FDGA 3JBG2 2JB4A 3SH3A 2WNVC 2DWRA 4WM7A 4JHTA 1AR63 3NWKA 5LB6A 4FVVA 4ONUA 2OZJA 4CCOA 1RB8G 4JQRA 2FDJA 5ERLA 4W4ZA 5C3PA 1CN1A 2FDHA 1UYPA 1B09A 1GOFA 1PMJX 1R082 1X8EA 2VZ1A 1YNAA 1NCRC 1OUSA 4NPLA 5FYYA 5I8SA 3UKTA 5B4NA 1F8VA 3WNKA 1HKDA 3GJBA 1J58A 3LEIA 4RN5A 4CUCA 2QQNA 1RUI1 4GH4B 2ZGMA 3WDTA 3ILNA 4OLLA 4KWLA 3SKJE 1DDLA 3UKNA 2XG3A 4OI0A 1YJKA 3FLTA 1QQP2 1W6QB 2W94A 2VO5A 1EPZA 2VBBA 4OYUA 4Q4X2 4XVHA 3ZKYA 1VRH1 4LMFA 1H9PA 4RHV3 1HLCA 4XCAA 4XQDA 3RWNA 5JPMB 4R9BA 3C3VA 3N4MA 4O9EA 1ZRIA 2WAOA 1XBFA 4CYDA 5KHIA 3ZR6A 5K4LA 4XFGA 5F3GA 4Y22B 1JMUB 2LM3A 4H7LA 2VZVA 4I02A 3AFKA 4D7TA 2ZBJA 5JLVA 5FP3A 4YW6A 4WVZA 2BBAA 2VBPA 4CUBA 5F3CA 3W5MA 3WDWA 1UPIA 2JXAA 4CEYA 4HL0A 2X5IA 4K8FA 1JZ6A 1CJDA 2ZJCA 5FZ0A 3W9AA 1EAH3 1YQCA 4CP9A 1BQPA 2J1TA 2VMEA 3J9SA 4CA9A 5FIXA 5C3RA 2YXSA 3LSDA 5KXCA 4WM8A 1AR71 1F4AA 5IWFA 4QX5A 4ZS2A 4I0AA 2XJQA 1OKQA 1UYYA 4PLMA 1XSQA 2WWSA 3H1MA 2ZHNA 4JGYB 4QM9A 4Q1PA 3IB3A 1OFNA 2DBNA 2Z79A 3AMNA 4Q0UA 3WCSA 4MHRA 2CL2A 4XBLA 4XTMA 4EQVA 5GJ6A 4Q4Y3 1VBA1 2Z2SB 2JECA 1QOSA 2ZX4A 1YHFA 3TN93 2V09A 3CJIB 3ZYIB 2JIJA 5F8PA 3P3PA 4KGQA 3VD3A 3VD4A 5BNQA 2RM23 4QX3A 2DBIA 1IS4A 1SCSA 2BVBA 5G05L 1W2UA 4CSWA 2WT1A 4FXKB 3LAGA 4XCBA 1MVQA 3FFZA 3GBFA 4TXWA 1XSRA 1PNGA 3ABZA 5FCCA 2K2SA 3KM5A 4LPLA 2VULA 5A7PA 2WZEA 2E6VA 3OGSA 1DQ4A 1GMMA 2QZ3A 2RS33 2ZHKA 1AL23 3SH5A 4FTSA 2XJSA 5FO9B 2D43A 4AW7A 4HSLA 1RUNA 3KZ4C 4FXGB 2VZRA 1O4TA 2PXJA 5G04L 4Q4V3 3O1PA 1OF4A 3LCPA 5K0UA 3WUDA 3KF3A 3UNPA 1WW5A 1KDKA 4L9BA 4LBKA 1W2NA 5A3LA 1JZ7A 1YQ6A 4QPGA 1XOYA 2EXIA 3GZUC 2AREA 4CDXB 4H7MA 3O1OA 1H2MA 2WZR3 2XHNA 4IEWA 2O8QA 5FPBA 1UU6A 1Y43B 3RYKA 2QQIA 1HXS1 1UOBA 2ARXA 4P5YA 2WQ4A 1DQ1A 4IUGA 4BHPA 2WSUA 5IK8A 1XPWA 2ZA9A 2Y64A 3BCWA 3MW4A 4JC1A 3THDA 3K4DA 5D1IA 2OX0A 1REDA 4B4RA 2A3XA 3C7EA 5CZKA 4YM1A 5C5TA 3GZAA 2PHWA 4CDQB 4BZ4A 2VR4A 4FQZA 4FQ4A 2XWJB 3I3DA 3ZFFC 4Z1VA 2ARBA 3RVHA 5L9BA 1D0GA 1B35B 3AC0A 4N90A 1MS4A 4UI9L 5CA6A 3OG2A 1OOPC 2XVLA 3KV6A 3POWA 4Q27A 3RS6A 1REEA 2RS51 3IPVA 4YVWB 2X10A 4CP0A 5FQ0A 1SFNA 1VBB2 3U78A 1H8TB 3WG1A 5FYHA 3P3NA 3EHKA 1VIWB 2SLIA 2R042 3BALA 3MUY1 1PIV2 1HRV2 1WLDA 1UXXX 2ZX3A 4NRPA 4YZ3A 4AHYA 4Q1RA 1M06G 5FPAA 1MZEA 1RUF1 5A80A 1GNHA 3ES1A 5BNOB 1LHOA 3JB8A 5HCFA 4CDUC 3O1RA 1RITA 3BU7A 1TVGA 5CYYA 1JYVA 1ND2B 4K8RB 5FUPA 2HWC3 3HAGA 1OPMA 1ENRA 1LOFC 2HEYF 3A22A 1Q8PA 3POIA 4H14A 4PCRA 3VBSA 4XJUA 1JTZX 4OMDA 1PGL1 3B7MA 4M0HA 1ZBE1 5GLWA 1WKYA 4Y1VA 3ZFGA 4BPZA 1U5YA 3FX3A 4DUXA 5F1RA 5A32A 4QDQA 2C6SA 4MSVA 5E8AA 4BQXA 2VCBA 3R0RA 4UFIA 5IJRA 3V0AA 2WNOA 4N43C 4UAPA 3KS7A 1QJU3 3IDCB 2JG8C 3W5NA 1SLTA 4YW2A 2VUDA 3MW2A 1RMU2 1AHSA 4IW3A 4CCCA 2OUJA 4OUSA 4XJ8A 3VV1A 4YM2A 1I1EA 1NZCA 2Q8DA 3PMEA 3SXWA 4GQ7A 1BKZA 1IGOA 1OXCA 2PA7A 3DF0A 1OQEA 4CU6A 4TSVA 3ZMOA 4BLJA 4QB1A 4NR1A 2VL4A 5I0DA 1BEV3 1V0AA 2LS6A 4CTEA 4BYYA 2E31A 1BMV2 4QMAA 1ZVFA 3VDAA 3WW2A 5CG8A 2WNUC 4YWAA 4UXAA 4AHZA 3N7LA 3M3QA 2WFF2 1W6MB 2VQ0A 2XJTA 4XF9A 1HB1A 4UW3A 3TAYA 2EIBA 1VR3A 4XYXA 4OHYA 3AVSA 2QKDA 4KH9A 4DEQA 4AEDC 4E8DA 1V6NA 4P9IA 3NAPA 4YRDA 3SKVA 4NMIA 4D6SA 5ABJC 1RJ7A 4AHWA 4XPVA 4YZ2A 4Q2FA 3MIEA 3PUAA 2P3YA 4QXCA 1O91A 4PJYA 4YG6A 2HWB3 1GWLA 1YUDA 4QPWA 4FTEA 2WLPA 4A3XA 4BA6A 5FUNA 3VDDA 3JQWA 2G9ZA 1RINA 1CIYA 1SG3A 4QHBA 3RJ2X 4DEVA 5CVRA 3SHRA 1V9U2 1RUE2 3AFGA 3LGRA 4YW1A 2VTXA 5T5LA 1OVPA 4FOVA 5HXVA 2DVAA 5FJKA 2VNGA 1W03A 5FXWA 5T5OA 3N7KA 4HXCA 3O5SA 3VGIA 3GHNA 1UN1A 2IXKA 2QDRA 1YIPA 5HCAA 3CEWA 1K45A 4I01A 1WCUA 4IE4A 3WCRA 1SLIA 3VD7A 2Y6LA 4DO0A 4E8CA 5JSOA 3M3CA 5A6YA 2PHUA 4BMBA 2VMIA 1W9SA 4Z8BA 3MFCA 1ASJ2 1NLSA 1PVC2 5H9PA 4NHKA 2C9AA 1QOOA 4ZU5A 3M3IA 2F4PA 2E33A 3CL1A 5FZ6A 2VQUA 2EXHA 3JBG3 4NRMA 1F5FA 4AGGA 1W8TA 1LOAA 3QBQA 1ENXA 4GH4A 5FV3A 1W6NB 3ITQA 3AZWA 3OJBA 3OY8B 3OGRA 2VZOA 5A3UA 2QQWA 2XQXA 3I7DA 3IDBB 4L99A 1WWYA 4KG0A 1R093 5FMOL 5JI9A 2AEZA 1K5MC 2EXKA 3VKFC 4QU1A 4LBLA 1LB2A 2JE9A 4AL9A 1TMF1 1WUVA 3OCPA 2B42B 3ATGA 3UT0A 1DCSA 3I2FA 1ZYBA 2VZ3A 3LOIA 2OZ6A 5BNNA 1PZ8A 1MS9A 3AP9A 5L19A 3PJQA 4R9DA 2BGOA 3HPNA 4JGYC 4DY3A 1MS3A 3TEYA 1J3RA 1FNYA 4AI1A 3VZMA 5CFCB 2ZGOA 4IV1B 4DPNA 2XL9A 2GNMA 2JDKA 5ANNA 2WABA 1RVF1 3PHMA 5IVYA 2JDAA 2JIGA 5JZGA 3ZYFA 3GZTB 4IQPA 1QJX2 2D6OX 3B01A 3IWZA 4Y3OA 3IZOA 1A8MA 2QCSB 2AGSA 4IGOA 1DBNA 3WW3A 4LR4A 5CG9A 4UFJA 4NIHA 3KLSA 3AX4A 3KD4A 4QPIB 1VPHA 2KD7A 1H1MA 1VAMA 4LE4A 5LCWL 4LOSA 1BZWA 1UKGA 1ZREA 1YXWA 2GMMA 4ISRA 4QWNA 3WNMA 5KXBA 1KFUL 5FZGA 1C8M1 2EIGA 2I2SA 3FC0A 4KU7A 1F9KA 1Z7S1 2GALA 2XQRA 2VCCA 2XJPA 3HMYA 4HMZA 2WT0A 4E27A 5JI7A 2VVEA 1IPSA 5K9YA 1POV1 2J7MA 4GXLA 2OPKA 2Q8CA 2Y8KA 1VRH3 4P9WA 2WZPP 4XE9A 1NY71 1UF2C 3ZLIA 5JXGA 2IXCA 2VOVA 3JD72 1EP0A 4K6BA 2VW1A 4NWWA 1C5HA 3Q8CA 3BU0A 4GALA 1OA2A 1HN1A 1Q8OA 3CU7A 4NE9A 3QOPA 3ZM8A 2R1BA 2MNGA 5FMCA 3HJRA 1S0CA 3OB8A 4X8PA 1ZZCA 1RUJ1 2YPDA 1QJZA 4C1XA 4YZ4A 4BE3A 2O14A 1QWRA 1QHDA 3CZUA 4QQPA 4QKNA 2ORXA 2HWF1 4LBOA 1UW8A 2UY9A 2G19A 4IEQA
chains in the Genus database with same CATH topology
3LPGA 3CDZB 4ZXEA 5B4XA 1K3IA 3U37A 3VDCA 3HNMA 3OEAA 4QAWA 1H6XA 2J1EA 2ZXQA 3K4AA 2VZSA 3WF4A 4KI5M 4MOAA 3K4ZA 2WO2A 4OZOA 3OEBA 4DUWA 2C26A 3CZJA 1UY3A 3T0AA 3WNPA 3K46A 3T2PA 4BJ0A 4QX1A 2VMFA 4A4AA 1LNSA 4CU7A 2DCJA 3VD5A 1GOGA 1UWWA 5IFTA 3NRUA 2YC4A 4ZY9A 3JXSA 2WO3A 2WUHA 2J22A 4D0QA 2W1WA 3CKHA 3WF0A 1RYYA 1NUKA 2EICA 3OGVA 4ARYA 2W1SA 4FI9A 2QQOA 4MADA 3A23A 2W95A 4Z2AA 2W9XA 4JKKA 4ET7A 3ACFA 2W1QA 1JU3A 3I2IA 2E26A 2B4KA 3T09A 2VZPA 4GZ9A 3ETPA 4CVUA 2J1AA 4JKMA 2EIDA 3ECQA 4LKSA 3C7FA 5HXMA 4M4RA 1UY1A 2R7EB 3NJVA 2YG0A 3I2GA 2WYSA 4XUOA 2VQTA 2W1UA 5F7UA 4A44A 2Y6KA 4A3ZA 5LA0A 3D3AA 2VZTA 3MV11 2HLEA 3CMGA 1DLCA 2VMDA 3E1F1 3IDAA 5IHRA 3WNNA 1WCQA 3C7HA 4QDSA 2W3JA 3GGLA 4YPJA 4ZZ8A 2VJXA 3EYPA 3IAPA 3WF1A 1US2A 1GU3A 3SEPA 1OF3A 2W92A 3CQOA 2JKXA 4W4ZA 1GOFA 1PMJX 5J1XA 2VZ1A 1K12A 3A7QA 5B4NA 2ZEXA 5JXHA 4KWUA 3UETA 3WNKA 2JD9A 4XURA 3LEIA 3I97A 4RN5A 4CUCA 2QQNA 4A42A 3SKJE 5HPOA 3T0BA 2W94A 4OYUA 2VO5A 5DMYA 3FL7A 4XVHA 3T2OA 4BK5A 3CIHA 1O59A 2W91A 3LQCA 3VD9A 2WAOA 2CDPA 2X05A 3C7OA 2VZVA 3MO4A 1EUUA 1NKGA 1J83A 2BBAA 3W5MA 4CUBA 2W87A 3LE0A 1JZ6A 1H6YA 3HEIA 4MO3M 1CZVA 1UX7A 2J1TA 2VMEA 2XONA 2YFZA 2W5FA 1F4AA 1UYYA 2Y6GA 1JU4A 3IB3A 4MGSA 4DXTA 3WF3A 3FHAA 2BERA 3VD4A 3BN6A 2WN2A 3VD3A 4CU9A 1UYXA 4QX3A 4ZZ5A 3OBAA 5G05L 4M4PA 1CZTA 4GWIA 4TXWA 2QBXA 3ABZA 3DYOA 4BDVB 4A41A 4LPLA 5LA1A 2RJ2A 2WZEA 2QQMA 3OGSA 3IIIA 1GMMA 1JI6A 3MUZ1 2YFUA 4LHSA 1IQDC 2VOTA 3T0DA 3EB7A 1NX9A 3F2ZA 4ARXA 2VZRA 5G04L 4QB6A 1OF4A 2J1VA 3UNPA 2C9KA 2LW8A 2EIEA 1JZ7A 1D7PM 1UYZA 2VC9A 4LQRA 3WNLA 1JYXA 1UZ0A 2XHNA 4L0PA 4PT6A 2QQIA 2VMCA 4P00B 4W8JA 4P5YA 3UESA 2ZEYA 4IUGA 1XPWA 1GNYA 2Y64A 3PUIA 1OT5A 2E32A 3K4DA 5JXJA 1UY2A 4JHZA 3C7EA 5CZKA 1JYNA 3T2QA 1JYWA 3FHQA 2J1UA 2VR4A 4JX0A 3I3DA 2DDUA 1SDDB 1EUTA 3AC0A 4UI9L 3OG2A 2WO1A 3HNBM 4HG6B 2V4VA 2WAAA 3K77A 1W8NA 2X10A 1JHJA 3I3BA 4MGQA 3MUY1 1ULPA 1UXXX 3ACGA 1JZ3A 1JZ5A 4QDRA 2BGPA 2J1RA 2WQ8A 2ZEZA 1P8JA 4QB2A 3WQBA 1TVGA 2X09A 5CYYA 1JYVA 4DXRA 1O8PA 4GWJA 2VM9A 3A22A 1CZSA 2JE8A 1JZ2A 3LEKA 4OMDA 2WZ8A 2BZDA 4BK4A 4DUVA 2DCKA 3P6BA 1WKYA 4DUXA 5IFPA 5LA2A 1UXZA 4QDQA 1W0NA 4AAXA 5JR2A 1L7RA 2VCBA 5IJRA 5JXIA 2VZQA 4UAPA 3W5NA 3BGAA 1PX3A 1R64A 2WN3A 4OMCA 5EJ1B 2VCAA 2Y6JA 1T2XA 2B9VA 4XUTA 1W9WA 3NQHA 2ZEWA 3K75B 4DXSA 4XUQA 4CU6A 1L7QA 4QB1A 1K42A 2VL4A 5I0DA 3GM8A 2LS6A 2WDBA 2E31A 2QQLA 3VDAA 4PF1A 1YQ2A 3WF2A 1SHWB 2EIBA 2QQJA 1PMHX 1XNTA 4DEQA 3P1IA 4E8DA 3DECA 4XUNA 3SKVA 4PQQA 1JZ4A 4TTGA 2OKXA 2XOMA 5IYYA 4P08A 4QPWA 3J7HA 5C70A 4D8MA 2QQKA 2WBKA 3I2KA 4XZUG 4OUEA 1CIYA 1SG3A 3FN9A 1XC6A 3C8XA 2VTFA 4DEVA 1W99A 1NAEA 1GUIA 2HYXA 3NNGA 3MBWA 1J84A 2ORZA 2J1SA 4XUPA 3GDBA 4P02B 1UMHA 1K45A 1JZ8A 3VD7A 2Y6LA 4E8CA 1DP0A 3WNOA 3I3EA 1W9TA 1I5PA 2W47A 1W9SA 5DN2A 3HNYM 2E33A 3ACHA 2VQUA 3IAQA 2V5DA 2PQSA 3LPFA 4A45A 1DYOA 3OGRA 4BXSV 5JUVA 2VZOA 3C7GA 3I2JA 2XQXA 2L9LA 4QX0A 1UY4A 3MV01 3T08A 1US3A 4UOJA 1BHGA 3SEEA 3GXUA 4JKLA 3I2FA 2VZ3A 3ACIA 2VZUA 2BGOA 3HPNA 4QX2A 1OD3A 5FUIA 2RVAA 3DYMA 2YB7A 4CU8A 2WABA 2JDAA 1GOHA 5C7GA 4A6OA 2Y6HA 1KGYA 5DQ0A 2CDOA 4RYDA 2KD7A 5C71A 5LCWL 4KMQA 3THCA 3PUHA 3WSOA 5DPNA 3I2HA 1GQPA 1F4HA 3WNMA 1O8SA 3A21A 5EIYB 1ULOA 2VCCA 1PX4A 2Z4FA 3HN3A 2V72A 2J7MA 4W50A 2Y8KA 1UMIA 3VDBA 1MPXA 1UY0A 3DYPA 5JXGA 3WEZA 4AG4A 2C4XA 2W46A 1OH4A 1HN1A 2YC2A 1CX1A 3ZM8A 5A1AA 1TG7A 3HJRA 3OB8A 3HOBA 2RV9A 5JMOA 1KEXA 5EJZB 2ID4A 3CZUA 3NJXA 2ORXA 1XNAA 3LEGA 3THDA 1W8OA 4CUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LPG A;  3CDZ B;  4ZXE A;  5B4X A;  1K3I A;  3U37 A;  3VDC A;  3HNM A;  3OEA A;  4QAW A;  1H6X A;  2J1E A;  2ZXQ A;  3K4A A;  2VZS A;  3WF4 A;  4KI5 M;  4MOA A;  3K4Z A;  2WO2 A;  4OZO A;  3OEB A;  4DUW A;  2C26 A;  3CZJ A;  1UY3 A;  3T0A A;  3WNP A;  3K46 A;  3T2P A;  4BJ0 A;  4QX1 A;  2VMF A;  4A4A A;  1LNS A;  4CU7 A;  2DCJ A;  3VD5 A;  1GOG A;  1UWW A;  5IFT A;  3NRU A;  2YC4 A;  4ZY9 A;  3JXS A;  2WO3 A;  2WUH A;  2J22 A;  4D0Q A;  2W1W A;  3CKH A;  3WF0 A;  1RYY A;  1NUK A;  2EIC A;  3OGV A;  4ARY A;  2W1S A;  4FI9 A;  2QQO A;  4MAD A;  3A23 A;  2W95 A;  4Z2A A;  2W9X A;  4JKK A;  4ET7 A;  3ACF A;  2W1Q A;  1JU3 A;  3I2I A;  2E26 A;  2B4K A;  3T09 A;  2VZP A;  4GZ9 A;  3ETP A;  4CVU A;  2J1A A;  4JKM A;  2EID A;  3ECQ A;  4LKS A;  3C7F A;  5HXM A;  4M4R A;  1UY1 A;  2R7E B;  3NJV A;  2YG0 A;  3I2G A;  2WYS A;  4XUO A;  2VQT A;  2W1U A;  5F7U A;  4A44 A;  2Y6K A;  4A3Z A;  5LA0 A;  3D3A A;  2VZT A;  3MV1 1;  2HLE A;  3CMG A;  1DLC A;  2VMD A;  3E1F 1;  3IDA A;  5IHR A;  3WNN A;  1WCQ A;  3C7H A;  4QDS A;  2W3J A;  3GGL A;  4YPJ A;  4ZZ8 A;  2VJX A;  3EYP A;  3IAP A;  3WF1 A;  1US2 A;  1GU3 A;  3SEP A;  1OF3 A;  2W92 A;  3CQO A;  2JKX A;  4W4Z A;  1GOF A;  1PMJ X;  5J1X A;  2VZ1 A;  1K12 A;  3A7Q A;  5B4N A;  2ZEX A;  5JXH A;  4KWU A;  3UET A;  3WNK A;  2JD9 A;  4XUR A;  3LEI A;  3I97 A;  4RN5 A;  4CUC A;  2QQN A;  4A42 A;  3SKJ E;  5HPO A;  3T0B A;  2W94 A;  4OYU A;  2VO5 A;  5DMY A;  3FL7 A;  4XVH A;  3T2O A;  4BK5 A;  3CIH A;  1O59 A;  2W91 A;  3LQC A;  3VD9 A;  2WAO A;  2CDP A;  2X05 A;  3C7O A;  2VZV A;  3MO4 A;  1EUU A;  1NKG A;  1J83 A;  2BBA A;  3W5M A;  4CUB A;  2W87 A;  3LE0 A;  1JZ6 A;  1H6Y A;  3HEI A;  4MO3 M;  1CZV A;  1UX7 A;  2J1T A;  2VME A;  2XON A;  2YFZ A;  2W5F A;  1F4A A;  1UYY A;  2Y6G A;  1JU4 A;  3IB3 A;  4MGS A;  4DXT A;  3WF3 A;  3FHA A;  2BER A;  3VD4 A;  3BN6 A;  2WN2 A;  3VD3 A;  4CU9 A;  1UYX A;  4QX3 A;  4ZZ5 A;  3OBA A;  5G05 L;  4M4P A;  1CZT A;  4GWI A;  4TXW A;  2QBX A;  3ABZ A;  3DYO A;  4BDV B;  4A41 A;  4LPL A;  5LA1 A;  2RJ2 A;  2WZE A;  2QQM A;  3OGS A;  3III A;  1GMM A;  1JI6 A;  3MUZ 1;  2YFU A;  4LHS A;  1IQD C;  2VOT A;  3T0D A;  3EB7 A;  1NX9 A;  3F2Z A;  4ARX A;  2VZR A;  5G04 L;  4QB6 A;  1OF4 A;  2J1V A;  3UNP A;  2C9K A;  2LW8 A;  2EIE A;  1JZ7 A;  1D7P M;  1UYZ A;  2VC9 A;  4LQR A;  3WNL A;  1JYX A;  1UZ0 A;  2XHN A;  4L0P A;  4PT6 A;  2QQI A;  2VMC A;  4P00 B;  4W8J A;  4P5Y A;  3UES A;  2ZEY A;  4IUG A;  1XPW A;  1GNY A;  2Y64 A;  3PUI A;  1OT5 A;  2E32 A;  3K4D A;  5JXJ A;  1UY2 A;  4JHZ A;  3C7E A;  5CZK A;  1JYN A;  3T2Q A;  1JYW A;  3FHQ A;  2J1U A;  2VR4 A;  4JX0 A;  3I3D A;  2DDU A;  1SDD B;  1EUT A;  3AC0 A;  4UI9 L;  3OG2 A;  2WO1 A;  3HNB M;  4HG6 B;  2V4V A;  2WAA A;  3K77 A;  1W8N A;  2X10 A;  1JHJ A;  3I3B A;  4MGQ A;  3MUY 1;  1ULP A;  1UXX X;  3ACG A;  1JZ3 A;  1JZ5 A;  4QDR A;  2BGP A;  2J1R A;  2WQ8 A;  2ZEZ A;  1P8J A;  4QB2 A;  3WQB A;  1TVG A;  2X09 A;  5CYY A;  1JYV A;  4DXR A;  1O8P A;  4GWJ A;  2VM9 A;  3A22 A;  1CZS A;  2JE8 A;  1JZ2 A;  3LEK A;  4OMD A;  2WZ8 A;  2BZD A;  4BK4 A;  4DUV A;  2DCK A;  3P6B A;  1WKY A;  4DUX A;  5IFP A;  5LA2 A;  1UXZ A;  4QDQ A;  1W0N A;  4AAX A;  5JR2 A;  1L7R A;  2VCB A;  5IJR A;  5JXI A;  2VZQ A;  4UAP A;  3W5N A;  3BGA A;  1PX3 A;  1R64 A;  2WN3 A;  4OMC A;  5EJ1 B;  2VCA A;  2Y6J A;  1T2X A;  2B9V A;  4XUT A;  1W9W A;  3NQH A;  2ZEW A;  3K75 B;  4DXS A;  4XUQ A;  4CU6 A;  1L7Q A;  4QB1 A;  1K42 A;  2VL4 A;  5I0D A;  3GM8 A;  2LS6 A;  2WDB A;  2E31 A;  2QQL A;  3VDA A;  4PF1 A;  1YQ2 A;  3WF2 A;  1SHW B;  2EIB A;  2QQJ A;  1PMH X;  1XNT A;  4DEQ A;  3P1I A;  4E8D A;  3DEC A;  4XUN A;  3SKV A;  4PQQ A;  1JZ4 A;  4TTG A;  2OKX A;  2XOM A;  5IYY A;  4P08 A;  4QPW A;  3J7H A;  5C70 A;  4D8M A;  2QQK A;  2WBK A;  3I2K A;  4XZU G;  4OUE A;  1CIY A;  1SG3 A;  3FN9 A;  1XC6 A;  3C8X A;  2VTF A;  4DEV A;  1W99 A;  1NAE A;  1GUI A;  2HYX A;  3NNG A;  3MBW A;  1J84 A;  2ORZ A;  2J1S A;  4XUP A;  3GDB A;  4P02 B;  1UMH A;  1K45 A;  1JZ8 A;  3VD7 A;  2Y6L A;  4E8C A;  1DP0 A;  3WNO A;  3I3E A;  1W9T A;  1I5P A;  2W47 A;  1W9S A;  5DN2 A;  3HNY M;  2E33 A;  3ACH A;  2VQU A;  3IAQ A;  2V5D A;  2PQS A;  3LPF A;  4A45 A;  1DYO A;  3OGR A;  4BXS V;  5JUV A;  2VZO A;  3C7G A;  3I2J A;  2XQX A;  2L9L A;  4QX0 A;  1UY4 A;  3MV0 1;  3T08 A;  1US3 A;  4UOJ A;  1BHG A;  3SEE A;  3GXU A;  4JKL A;  3I2F A;  2VZ3 A;  3ACI A;  2VZU A;  2BGO A;  3HPN A;  4QX2 A;  1OD3 A;  5FUI A;  2RVA A;  3DYM A;  2YB7 A;  4CU8 A;  2WAB A;  2JDA A;  1GOH A;  5C7G A;  4A6O A;  2Y6H A;  1KGY A;  5DQ0 A;  2CDO A;  4RYD A;  2KD7 A;  5C71 A;  5LCW L;  4KMQ A;  3THC A;  3PUH A;  3WSO A;  5DPN A;  3I2H A;  1GQP A;  1F4H A;  3WNM A;  1O8S A;  3A21 A;  5EIY B;  1ULO A;  2VCC A;  1PX4 A;  2Z4F A;  3HN3 A;  2V72 A;  2J7M A;  4W50 A;  2Y8K A;  1UMI A;  3VDB A;  1MPX A;  1UY0 A;  3DYP A;  5JXG A;  3WEZ A;  4AG4 A;  2C4X A;  2W46 A;  1OH4 A;  1HN1 A;  2YC2 A;  1CX1 A;  3ZM8 A;  5A1A A;  1TG7 A;  3HJR A;  3OB8 A;  3HOB A;  2RV9 A;  5JMO A;  1KEX A;  5EJZ B;  2ID4 A;  3CZU A;  3NJX A;  2ORX A;  1XNA A;  3LEG A;  3THD A;  1W8O A;  4CUA A; 
#chains in the Genus database with same CATH topology
 5F5I A;  5FY8 A;  5B4X A;  5C8C C;  4AVS A;  4CCM A;  2BP6 A;  4S2G A;  2J1E A;  4QGN A;  2PLV 2;  1AR7 3;  4XIL A;  4CDX A;  3HQX A;  3IIA A;  4KWJ A;  3H8R A;  2WO2 A;  5FLI A;  1B35 C;  1WCD J;  1G9A A;  1RUC 1;  1NY7 2;  2FCU A;  3BTX A;  5CFD A;  2GNB A;  3CZJ A;  1UY3 A;  5LBB A;  1VBA 3;  1S0G A;  3VKM A;  4HZF A;  2YY1 A;  2A7A A;  4XF4 A;  4UFL A;  1DGR A;  2DUQ A;  4YVS A;  2DCJ A;  1YFU A;  4GB3 1;  3VBR A;  4CDQ A;  1BJQ A;  2YC4 A;  4R9A A;  1DZT A;  3ENR A;  4V2V A;  3VBU C;  4FPY A;  1ODM A;  1W9F A;  2VBD A;  3FBY A;  3OPW A;  5E88 A;  1W2T A;  4AI3 A;  1RUD 2;  3WNX A;  1U5Z A;  3B9C A;  4HKW A;  1U5I A;  2HWE 2;  5IVC A;  4K9S A;  3U11 A;  3GYD A;  3VKO A;  2JDY A;  1Q43 A;  3CKH A;  4YVW A;  3DXT A;  1GBG A;  1RYY A;  3WF0 A;  4EE2 A;  1F2N A;  1H8T A;  4FPG A;  5A7O A;  5FP7 A;  4RD7 A;  2HWD 2;  2P1B A;  1JXN A;  2JIC A;  4A6S A;  3HN1 A;  4W65 A;  2Q1Z B;  1J59 A;  3IT8 A;  3MEP A;  1COV 2;  4RSU A;  5FY7 A;  4ET7 A;  4M3C F;  5BNO A;  2OYZ A;  3PUS A;  1EYB A;  4E2Q A;  1GNZ A;  1V6J A;  2W1Q A;  2WQZ C;  3VBO A;  2PAE A;  3I2I A;  3BYW A;  4B7K A;  2E26 A;  1GZT A;  1ND2 A;  4X6R B;  2OW4 A;  4XJZ A;  2FMY A;  1ULD A;  1EY2 A;  1V6I A;  2R06 1;  1XE8 A;  4IEP A;  3RGB A;  3POG A;  5LWB A;  3ECQ A;  1E5R A;  4UWD A;  2AR6 A;  4CXW A;  3PDQ A;  1HXS 3;  1G9B A;  1JOB A;  3AM2 A;  3Q8E A;  4PLO A;  2XVG A;  4XUO A;  2XGX A;  1SEF A;  2YU1 A;  3MI8 A;  2Y60 A;  3ZIX A;  1RIR A;  1X9T A;  3RZK A;  2NQY A;  4DMI A;  5LA0 A;  3D3A A;  2H6B A;  4JVA A;  3RMY A;  3BVC A;  1NLQ A;  4LHK A;  3ZO0 B;  5FMB A;  5A7N A;  1CJP A;  4AFB A;  2HYK A;  2Y34 A;  5FY4 A;  2W2I A;  2A3Y A;  4XMA A;  1BCX A;  5FR3 A;  4NAM A;  1UZV A;  1YLL A;  5DAV A;  3IDA A;  3E1F 1;  4B3N A;  5IHR A;  1G9C A;  1MQT C;  3S7I A;  3WNN A;  2PHX A;  1WCQ A;  2WFP A;  1QOT A;  3ON7 A;  5BXX A;  4AQ6 A;  3RQ0 A;  2QVS B;  1QH7 A;  2W3J A;  2BRT A;  5IW0 A;  2RS5 3;  1FMD 1;  3GGL A;  4XXA A;  1PNF A;  5A3O A;  4YPJ A;  1GZC A;  4QQ2 A;  4NOT A;  4XF0 A;  5EXO A;  3O1M A;  1N1Y A;  5FK7 A;  1N3O A;  2GP3 A;  5EZW A;  4LTA A;  1IQA A;  3WF1 A;  5C5U A;  5DZE A;  2Q8O A;  1O3S A;  4D7S A;  2W92 A;  4OUM A;  5H9R A;  5FY0 A;  2JKX A;  2K9Z A;  1RUF 3;  2VOW A;  4I3P A;  3PTR B;  3RZJ A;  5A6Z A;  1W8Z A;  4KBB A;  3VL8 A;  3A7Q A;  2ZEX A;  3MDP A;  3UET A;  3WP6 A;  2BFU S;  2W39 A;  1DG6 A;  3D6E A;  3MZH A;  1FOD 2;  2AH2 A;  2ARC A;  1XNC A;  5CBL A;  2XBO 1;  4UW5 A;  1JYT A;  1R1A 1;  2E9Q A;  3AMQ A;  1SBF A;  4GJY A;  3RZL A;  4IL7 A;  1WGP A;  3ZYR A;  1ZBE 3;  1RUG 2;  4AHX A;  3I8T A;  3M3O A;  4OHW A;  3TEZ A;  3PIJ A;  3PVO A;  4TYS A;  4A7Z A;  5B2G B;  2QQP A;  3VHN A;  5BYN A;  1DGW A;  2XJR A;  4XC9 A;  3VD9 A;  3WZ1 A;  4UFK A;  4OUL A;  4IE7 A;  2RR1 2;  2CDP A;  3MIH A;  4CCN A;  4G3Y C;  4BLI A;  1D2Q A;  3AK0 A;  4XJA A;  5KC6 A;  4BWO A;  4NUB A;  3ZFF B;  2PHL A;  1FI2 A;  1EUU A;  1NKG A;  3VZL A;  5FFO C;  3SLI A;  4LUM A;  5E89 A;  1BYH A;  1V6K A;  3TBD A;  2D3R A;  5D21 A;  1OOP B;  1H6Y A;  4TLG A;  4AGR A;  3N36 A;  1DIW A;  4MO3 M;  1CZV A;  4UBG A;  2R6Q A;  4O65 A;  1CAU B;  1UX7 A;  4CE8 A;  5AC9 1;  3MIF A;  3NNF A;  1UX6 A;  3POS A;  2YFZ A;  5FZA A;  2VH9 A;  1E5H A;  5FP8 A;  5I0T A;  3WDV A;  3FLR A;  2R0H A;  4OHZ A;  2Y6G A;  4OQ8 A;  1GKB A;  5A7W B;  1JU4 A;  1UL9 A;  2D6K A;  4TWT A;  4MGS A;  4EN8 B;  1WD3 A;  2DUP A;  3H42 B;  4XBQ A;  1ND3 B;  5F3E A;  5KC5 A;  1DGL A;  2WS9 2;  3I3M A;  1ZRF A;  2HEV F;  4P9L A;  4XMI A;  2A6X A;  3U10 A;  1TME 2;  1IS5 A;  1KJR A;  2XUE A;  3FHA A;  3WF3 A;  2Q30 A;  3VBH A;  5C4W C;  2UYA A;  5A70 A;  2ADE A;  2WRA A;  4CU9 A;  1W6N A;  1X50 A;  1ENQ A;  4R52 A;  2B5H A;  4AOC A;  3OBA A;  1S0D A;  1S2K A;  3NV1 A;  3ZN6 B;  2V5Y A;  4M4P A;  3V0B B;  2ZZQ A;  5DAX A;  5FBZ A;  4ATF A;  1CAV A;  4IV1 C;  5EWS A;  2DUR A;  3FMG A;  2N7G A;  4PI2 A;  3LDB A;  4N53 C;  1X33 A;  3UJO A;  2QQM A;  5FO8 B;  2G4I A;  4AI9 A;  3U4X A;  1FPN 1;  1Y7B A;  4JRA A;  1PZ9 A;  1CWP A;  1JI6 A;  3MUZ 1;  2YFU A;  2JG8 B;  4FFH A;  3SMH A;  5BPX A;  1A34 A;  1SPP A;  3HQR A;  3AP5 A;  3V56 A;  3JB4 C;  2VD7 A;  3H3U A;  1JUH A;  4Q0S A;  4QB6 A;  1GFF 2;  4IV3 C;  4HK8 A;  5CFC A;  1VB2 A;  2D98 A;  2Q8E A;  5I0R A;  1QU0 A;  4I30 A;  4NII A;  3F95 A;  2J1V A;  3RZZ A;  1S0J A;  4LO4 B;  5JOY A;  3QD6 A;  2XVK A;  5ACA 2;  4QHZ A;  5JOX A;  1KDM A;  1JOD A;  4LO6 B;  3MHZ A;  1UYZ A;  2VC9 A;  3WNL A;  3ZSJ A;  4DIQ A;  1LEN A;  3WUC A;  1ZA4 A;  4AFC A;  5LBC A;  5FWE A;  3DPR B;  3GNE A;  4QPI A;  2WNU B;  2FMD A;  4L0P A;  4PT6 A;  5I8T A;  2JG9 B;  1R08 1;  1DU3 D;  2VAU A;  3WG2 A;  2F4L A;  4QU2 A;  3TNP B;  4FSJ A;  1F35 A;  4OHX A;  3BKZ A;  1WLC A;  4JGZ A;  3O1V A;  1H2N A;  2E32 A;  1PGW 2;  2HBU A;  4AED B;  1ZZB A;  3HR9 A;  4I0W B;  1I3H A;  5ANQ A;  3ZXL A;  1JH5 A;  4AI0 A;  2GH8 A;  1JYN A;  4RR3 A;  1JYW A;  3KGZ A;  1QQP 1;  2KM2 A;  5T5J A;  4Q4X 1;  5FPL A;  4TZD A;  2VNO A;  5CB7 A;  5FDB A;  3RZH A;  1EUT A;  4GMP 1;  1PGS A;  1TMF 3;  2JDU A;  2WO1 A;  3HNB M;  5ISL A;  2DUO A;  4FT8 A;  2FZ1 A;  4HG6 B;  4HON A;  4R9C A;  1RGS A;  2V4V A;  1VMH A;  1W8N A;  4Y5T A;  3LDR A;  5FZH A;  2OII A;  2JEN A;  1NA1 C;  4QX8 A;  4HOO A;  2Z5W A;  3I3B A;  5DUW A;  3D4K A;  4LBQ A;  5IT6 A;  1KQR A;  2VMH A;  4LO5 B;  4MV2 A;  2ZMK A;  5FRA A;  3ACG A;  2IXL A;  5J48 A;  1JZ3 A;  4MX3 A;  2RDQ A;  5GM0 A;  3WP3 A;  5M0T A;  1JZ5 A;  4QDR A;  2BGP A;  1T6B X;  5T54 A;  1RVF 3;  4P9Y A;  1VMF A;  4GAZ A;  2RMU 1;  2ZEZ A;  1P8J A;  4ZU7 A;  3WQB A;  1O8P A;  5I8Y A;  4GWJ A;  5FZ9 A;  5A7Q A;  2WNV A;  2NMO A;  2FDI A;  4GH4 C;  2YUE A;  3AJY A;  5F39 A;  2IVI B;  5E6H A;  2ILM A;  2EF6 A;  2WZ8 A;  3H0O A;  4LUK A;  4DUV A;  5IK5 A;  1DQ6 A;  4UFM A;  5DAB A;  3WLU A;  2EA7 A;  4AAP A;  2GU9 A;  5LA2 A;  1C8M 3;  1LGB A;  2LRO A;  1NCR A;  5HCH A;  1Z7S 3;  1L7R A;  2YYO A;  4C8D A;  3B5L B;  5GLT A;  5FWJ A;  5J98 B;  4E2S A;  2VMG A;  4XAE A;  2HBT A;  3BGA A;  4YW3 A;  4AVA A;  2UUR A;  2WN3 A;  1POV 3;  1UZY A;  5EJ1 B;  3N3H A;  1K5M B;  2HH9 A;  4HN0 A;  5DXD A;  4WVM B;  2X8K A;  2PMW B;  4RGA A;  5CIR A;  3AJZ A;  5FYC A;  1SDW A;  5CNA A;  4CEY C;  1W9W A;  3THP A;  3T4H B;  3H50 A;  2RMU 2;  2RJK A;  3K75 B;  4XUQ A;  1L7Q A;  3RSJ A;  1K42 A;  1HIX A;  3GM8 A;  1WW7 A;  2FCV A;  2WDB A;  2I45 A;  1RUJ 3;  5LRR A;  4KBZ A;  2QQL A;  5EP9 A;  5BUV A;  3AYD A;  4XDP A;  1YQ2 A;  5GLZ A;  4WV8 A;  3WG4 A;  3WF2 A;  3AYE A;  2HWF 3;  4LHN A;  3CF6 E;  2XLG A;  4ISQ A;  4NHL A;  1OPO A;  3N9O A;  3A0K A;  1XQN A;  2QQJ A;  3NNJ A;  1PMH X;  4BQW A;  3I54 A;  3RZG A;  4XFC A;  4Q8L A;  3BOP A;  1CAX A;  2D5F A;  3E5U A;  2HWD 3;  4Y24 A;  1HB4 A;  3MPB A;  2A73 B;  2DYC A;  3N7M A;  3DKQ A;  4WVW A;  4Q4W 2;  1RUC 3;  4EWA A;  3KCX A;  1W8H A;  1QJY 2;  5IYY A;  3M4F A;  1VBC 1;  4FPH A;  3KGL A;  3I2K A;  1QF3 A;  1NXM A;  2LUW A;  4OUE A;  4QXH A;  4CEW A;  1IG3 A;  1VAK A;  4HN1 A;  3RG0 A;  4GB3 3;  2JX9 A;  3C8X A;  3N35 A;  3RYP A;  2B46 X;  1W99 A;  1MS0 A;  2BJS A;  1ZM1 A;  1NAE A;  2CWM A;  5LEJ A;  1YYN A;  4YW5 A;  2HYX A;  3NNG A;  1O6U A;  3ZR5 A;  1H1A A;  1J84 A;  2YU2 A;  3IDE A;  5D8A C;  1H30 A;  3O1T A;  5LAS A;  2J1S A;  3LFI A;  3GDB A;  1MS8 A;  3R4D B;  1KS5 A;  3A0N A;  1HN0 A;  2VTX J;  4KU8 A;  1VBB 1;  5L7O C;  5FLH A;  1JZ8 A;  5FAX A;  2E53 A;  1L7L A;  1TEI A;  2R04 1;  3ZX7 A;  1PIV 1;  1HRV 1;  2V4A A;  2WYF A;  3H1W A;  3I3E A;  3OF1 A;  4COY A;  1BK0 A;  5DN2 A;  1S55 A;  3EBR A;  1CAW B;  1ZZ7 A;  4N7I A;  5FZO B;  1VBC 2;  1HV0 A;  3HNY M;  3I2O A;  3ACH A;  4OI1 A;  3J7L A;  1C4R A;  2BU9 A;  4AG4 A;  3KV9 A;  4IGQ A;  2PQS A;  5C8C B;  2X29 A;  4LIT A;  2ZGS A;  3NMB A;  3LPF A;  1URX A;  1DHK B;  2R06 3;  4WZC A;  4PIZ A;  4HK9 A;  3WDY A;  4BXS V;  4A7Y A;  3UK9 A;  2JDZ A;  4Q26 A;  3TB0 A;  4QX0 A;  2WII B;  1CQ9 A;  3T08 A;  1US3 A;  4I3G A;  4LXL A;  3UV9 A;  2DVG A;  5CIS A;  1BHG A;  3GXU A;  3AZY A;  4JKL A;  2QJV A;  4BXF A;  1O4Z A;  1ST8 A;  2VNR A;  2P2K A;  4A7K A;  4V2W A;  3VHR A;  1YEW A;  2VZU A;  1RMU 1;  3KQR A;  4D94 A;  1XND A;  4PF5 A;  4MLO A;  2ZAC A;  4FFI A;  4XZP A;  3CNA A;  4FPK A;  5APA A;  3ZFF A;  3KHB A;  5FUI A;  3VBU B;  1CD3 G;  2CU5 A;  1ND3 C;  2YB7 A;  4XTP A;  3OBR A;  1KFX L;  1QDC A;  1H2K A;  2D6M A;  1FMD 3;  2VNV A;  5FZD A;  3OOX A;  4PDW B;  2JB8 A;  1CAU A;  3POF A;  1GOH A;  1BMV 1;  2ZGL A;  4OVE A;  5EPA A;  5E1R A;  2PTM A;  3IMN A;  1NOV A;  3ZFE C;  5CKM A;  4RYD A;  2MEV 1;  5C71 A;  2WFF 1;  2OXB A;  5EHD A;  5A7W A;  4IES A;  3PUH A;  4L11 A;  3WSO A;  3B94 A;  5SV8 A;  1ULE A;  2DCY A;  1QXR A;  3GBW A;  4XDQ A;  1F4H A;  3ZXD A;  4D7Y A;  2ZOE B;  1HDK A;  3MIB A;  4GIQ A;  2D5H A;  4LK6 A;  4M0N A;  1ULO A;  4XFB A;  4MHU A;  1PX4 A;  5F3I A;  4NIA A;  3W59 A;  2Z4F A;  2FBE A;  1LRH A;  2XBO 3;  1ZRD A;  1MAC A;  1IKQ A;  1R1A 3;  2F6B A;  3HN3 A;  1UD1 A;  5IAV A;  2PN5 A;  5A6Q A;  3RWK X;  4EJR A;  2WO7 A;  3VDB A;  5I0S A;  4AXO A;  1S2E A;  4COU A;  3WVJ A;  1BBT 1;  1PO1 2;  1L3J A;  2BOI A;  3RJR A;  2C4X A;  4MUV A;  3WEZ A;  2IZW A;  2VOX A;  4A2U A;  3VBF C;  4B7E A;  5HV4 A;  3OBT A;  2W46 A;  3BTZ A;  4IE0 A;  2WR9 A;  3N7J A;  3L2H A;  3R6S A;  3NO8 A;  3MFA A;  4N43 A;  4YG0 A;  5H9S A;  1V9U 1;  2JG8 A;  1RUE 1;  3H7Y A;  5TSW A;  5DDJ 2;  3DPR C;  4FPJ A;  1D4V B;  1LUL A;  2RV9 A;  1AXY A;  3HOB A;  3TWI A;  2JG9 C;  1XE7 A;  2MEV 2;  4FPL A;  3K3O A;  1MQT B;  1PO2 2;  5KHK A;  3PIG A;  4AZZ A;  4M01 A;  3K3N A;  5BNP A;  2DVB A;  3LPG A;  3CDZ B;  1UQX A;  3CO2 A;  4ZXE A;  1LED A;  1OSG A;  5AC9 3;  2G9F A;  1XRU A;  2R0F A;  1K3I A;  4IET A;  1W0O A;  2ZGU A;  3EQE A;  3HNM A;  4JTO A;  4QAW A;  5LBE A;  1SLA A;  5FPU A;  1PK6 B;  2VZS A;  4LE3 A;  4KI5 M;  2CAV A;  4COZ A;  1ASJ 1;  2QUO A;  1V6O A;  3K4Z A;  1PVC 1;  2GSY A;  2Z42 A;  2WNU A;  4OZO A;  3OEB A;  2O1Q A;  4MGY E;  4G9S B;  4BQ3 A;  3I4I A;  4ES9 A;  1BBT 2;  3T0A A;  3J8F 2;  4Q5O A;  5AFB A;  4L97 A;  3T2T A;  1WW4 A;  3VDD C;  4BJ0 A;  1LGN A;  2Y33 A;  2JD4 A;  4AED A;  2MHF A;  5FJH A;  5ABJ A;  2VMF A;  5E16 A;  4A4A A;  4Y20 B;  4G4F A;  1G6N A;  5LA9 A;  4YNI A;  4AWD A;  1EV1 2;  1GOG A;  1XU1 A;  4CDW C;  4PBO A;  4QM8 A;  4ZY9 A;  3V64 A;  1NE6 A;  5A7S A;  3ZXE A;  2WO3 A;  4LO8 A;  1SLB A;  5JAX A;  1QNW A;  2E7T A;  1Z0H A;  2FHR A;  3ZXJ A;  2DVF A;  3AVR A;  4I09 A;  1FPN 3;  3WQ1 A;  1VBE 2;  3NJZ A;  1X8M A;  3I49 A;  2GC1 A;  3O7O A;  5KXE A;  5L36 A;  5HCB A;  4MVT A;  1DGR N;  4XJW A;  3WT3 A;  2W1S A;  4BH9 A;  1JN2 P;  3QLQ A;  3H3L A;  5IVV A;  5A1F A;  4MAD A;  4XQW A;  2DF7 A;  1ODN A;  4UF0 B;  3USS A;  4XFA A;  4J1X A;  1UMZ A;  3ACF A;  4QD2 A;  3I2D A;  3QCW A;  1JS9 A;  1QKQ A;  2P5B A;  1J3Q A;  3JU9 A;  2R07 2;  1N47 A;  1QJX 1;  3DL3 A;  1ZZ8 A;  3LZZ A;  3OGJ A;  4AI2 A;  1NQD A;  2B4K A;  2VZP A;  4JDO A;  3T09 A;  3OD0 A;  4E9K A;  4CVU A;  1REF A;  2CWS A;  2EID A;  4LKS A;  5HXM A;  1W6Q A;  4M4R A;  1UY1 A;  3VKN A;  1C8N A;  1R08 3;  5JOZ A;  1E5S A;  5FP4 A;  1YRZ A;  2VQT A;  4X8N A;  5JPN B;  1YI7 A;  2NP0 A;  3OGG A;  2Y6K A;  4Y22 A;  1GIC A;  4XIO A;  5C4W B;  4E4S A;  1MZ6 A;  5BNN C;  1QQP 3;  1VAL A;  3MV1 1;  1RXG A;  4Q4X 3;  1NCQ C;  5K8S A;  3ALQ A;  1Y9Q A;  4K7J A;  1QEX A;  1YQ5 A;  2VMD A;  2W0X A;  2XML A;  3CJX A;  3JD7 1;  1DZR A;  3BB6 A;  4GMP 3;  4K20 A;  4L2N A;  4WVM A;  4QDS A;  2JKB A;  1AXK A;  5GLV A;  2WLQ A;  4N53 B;  3Q8B A;  4LOT A;  3E6C C;  4HVO A;  4ZZ8 A;  5JZG C;  1S0F A;  2P4E A;  4CZS A;  5FOB B;  5I91 A;  5LY2 A;  3EYP A;  3IMM A;  3USU B;  4Z92 B;  4UYB A;  5J7M A;  3KCC A;  4YM0 A;  3AKP A;  1O4Y A;  4JGY A;  3CQO A;  1HRI 1;  1YFY A;  2GDF A;  3SH4 A;  2IVJ A;  4IV3 B;  4XHX A;  1AR8 2;  2RMU 3;  5EFU A;  1K12 A;  1SBD A;  5JXH A;  1NXD 1;  5FMO S;  4XAC A;  2JD9 A;  4XUR A;  3CJI A;  3BUC A;  2PLV 1;  3I97 A;  1MZ5 A;  4A42 A;  5T5P A;  2IUW A;  1WME A;  4XXP A;  2A6V A;  3PUR A;  5HPO A;  1C1F A;  3T0B A;  4XAB A;  1QY4 A;  3T2O A;  4BK5 A;  1PM4 A;  1O59 A;  1IPK A;  3VHO A;  3LA7 A;  2VXJ A;  5FZ1 A;  2VEC A;  4K1Z A;  2WSV A;  1OA4 A;  1SZB A;  4J25 A;  4Z82 A;  2ZX2 A;  4RA0 A;  3RMX A;  4Q4W 3;  5FZE A;  4BB3 A;  1FV3 A;  3GHM A;  4YFZ A;  5AFE A;  4XAA A;  3GBG A;  3S7E A;  1OMI A;  1NZI A;  1HRI 2;  1Q3E A;  1RUD 1;  2Z69 A;  1LHV A;  2HWE 1;  2W87 A;  3LE0 A;  2GH2 A;  5K7P A;  5JWP A;  1QJE A;  3HEI A;  3MID A;  2ARA A;  2VW0 A;  3VHP A;  1G86 A;  5A3T A;  3AL5 A;  1NA1 B;  2HWD 1;  4GKY A;  4UT5 A;  4U36 A;  4YFW A;  1KXG A;  4LNV A;  3OBZ A;  2CHH A;  4C0B A;  1LR5 A;  1GP4 A;  1COV 1;  2UYB A;  1GP6 A;  1MVE A;  3CBN A;  2XL7 A;  3WQ0 A;  4QXK A;  4JZR A;  4WBB A;  2B9U A;  4R4X A;  3VZK A;  3NV2 A;  4DQA A;  3M3E A;  2BER A;  2PQQ A;  4H55 A;  2Q5T A;  1UNB A;  4NRQ A;  2PAK A;  3D0S A;  3BN6 A;  3HD8 B;  4W6W A;  3T3Y A;  5CAD A;  1DYK A;  3VBR C;  4ZZ5 A;  2Y6F A;  5LRS A;  2BUK A;  3RDI A;  3FHI B;  1W6O B;  3IN9 A;  4QX7 A;  1B35 A;  1VBC 3;  2SBA A;  2Y26 A;  1XE0 A;  4GWI A;  4HET A;  5A1L A;  1H2L A;  2EAA A;  2H6C A;  4S2D A;  2QBX A;  3N9Q A;  2WA3 A;  1UPS A;  1JW6 A;  3BOW A;  4IE6 A;  4PDW C;  4A41 A;  2A3W A;  4O9G A;  1OH3 A;  3MIG A;  1HJG A;  5IVB A;  2A1X A;  3III A;  5FZ4 A;  3FJS A;  1EAH 2;  2VOT A;  3N9P A;  5I93 A;  3MW3 A;  2B7Y A;  4YGB A;  3T0D A;  2BPA 2;  5FP9 A;  5C33 A;  4FOQ A;  2A5Z A;  1IG0 A;  1NX9 A;  1O3R A;  1YFX A;  1YWK A;  1LES A;  3VBU A;  3FLP A;  2QQV A;  1ZBA 1;  4D6Q A;  1G9F A;  1X9P A;  1F31 A;  2H0V A;  3ZN5 A;  3PNA A;  4CEY B;  3GJA A;  1AZD A;  1VBB 3;  4CRQ A;  4FOW A;  4BOW A;  1W2A X;  2R04 3;  1PIV 3;  1HRV 3;  4Q4Y 2;  4XF3 A;  1IHM A;  4LQR A;  3EO6 A;  3TN9 2;  1PHM A;  1JYX A;  1N1V A;  4FPE A;  4IEO A;  1UZ0 A;  2AYH A;  2GC2 A;  3R05 A;  1UZZ A;  2D93 A;  2RM2 2;  5FYI A;  1RUH 2;  4D6R A;  4K1Y A;  4P00 B;  4W8J A;  2WKK A;  4P5H A;  3UES A;  1CON A;  3LFM A;  1CX4 A;  4IXL A;  2AEY A;  3KVA A;  3PLQ A;  1OT5 A;  4SLI A;  3WQ7 A;  4DFS A;  4KL1 A;  4MYE A;  1AXZ A;  5JXJ A;  1FOD 1;  4EZH A;  2CY6 A;  3ZSE A;  4LK7 A;  5C9A C;  5DAQ A;  3T2Q A;  3WOG A;  3FHQ A;  2J1U A;  3NST A;  3OUJ A;  2Y0O A;  2RS3 2;  3KCY A;  4JX0 A;  3JUU A;  1AL2 2;  4XF1 A;  4J6G A;  1RUG 1;  2XHK A;  1IZ3 A;  1DLL A;  2DDU A;  4P9G A;  1JUI A;  3UKV A;  2AZ5 A;  2GMP A;  1ZBA 2;  4YSF A;  2D44 A;  2ZHL A;  2IFR A;  2XKP A;  3LA2 A;  1LOE A;  2RR1 1;  4Q4V 2;  5IAX A;  2WAA A;  3K77 A;  4IGP A;  2PHT A;  2GND A;  1LTE A;  2GAU A;  3ORJ A;  1PK6 C;  4H3W A;  1RMU 3;  1GZ9 A;  1OC1 A;  3GZE A;  4ZKT B;  4LLF A;  1ULP A;  2DU1 A;  2BDR A;  3BTA A;  1MS5 A;  4OQ9 A;  4AI8 A;  2JDH A;  4B29 A;  4BQ2 A;  4QHO A;  1W6M A;  1WD4 A;  1PO1 3;  1IPJ A;  2QFE A;  2WZR 2;  5D8A B;  1A8D A;  1W04 A;  2J1R A;  5GAL A;  4ASM B;  1HQL A;  3BTY A;  2BEO A;  2WQ8 A;  1Q8V A;  1IOA A;  3KVB A;  1F5J A;  4YGD A;  4OI2 A;  5L7O B;  3GCW A;  2HEW F;  2OVU A;  4DXR A;  3BIE A;  4FTB A;  1E5I A;  3D5O A;  3OSD A;  2PAM A;  2EAL A;  4IDZ A;  2VPV A;  5HI0 A;  1CZS A;  2MEV 3;  4FAG A;  1HB3 A;  1LEC A;  2JE8 A;  2WFF 3;  2BNO A;  1O5U A;  3LEK A;  3ZYG A;  2BZD A;  2OQ6 A;  2DCK A;  4DIN B;  3P6B A;  2ZKL A;  4YZ5 A;  2WS9 1;  4HPK B;  1UU4 A;  2C24 A;  2ZGR A;  5FZL A;  1TME 1;  2ATF A;  2IXJ A;  4EN7 B;  1W0N A;  4AAX A;  5DUV A;  3E5X A;  2ZGQ A;  4AVC A;  2VZQ A;  4R4Z A;  4AEK A;  2E63 A;  4CPB A;  5A3N A;  4Y20 A;  2OS2 A;  3NKG A;  3ZSL A;  3APB A;  3WDU A;  2DU0 A;  2VCA A;  4KWK A;  1VAV A;  1T2X A;  2WC2 A;  2Y6J A;  4AQT A;  1DF0 A;  2B9V A;  2DCZ A;  1BBT 3;  4CP2 A;  4XBN A;  2P37 A;  3NNM A;  3KHC A;  5FBJ A;  3NQH A;  2ZEW A;  4GJZ A;  2P3J A;  4MZU A;  2JEM A;  1LCL A;  4RS5 C;  3IPV B;  1QGL A;  1ZA7 A;  3NW4 A;  4WVV A;  1V9U 3;  5FQ0 B;  1RUE 3;  5AVA A;  3W58 A;  4BQ4 A;  3RZM A;  3RFR A;  5J37 A;  2HWC 2;  1W9Y A;  3ZYB A;  2BQP A;  3ZPY A;  1Y3T A;  4MXW B;  5FY5 A;  3LDK A;  3WHU A;  4FFG A;  5FXX A;  1DQ5 A;  1SQ4 A;  2A6W A;  4W6Y A;  4UF0 A;  4LBQ D;  4RGK A;  5FYS A;  5ACA 1;  1PZ7 A;  3B9I A;  4IEX A;  1OUR A;  4DOU A;  4XHB A;  3P1I A;  1LU2 A;  3DEC A;  3PVN A;  4LKF A;  3G6J B;  1XJA A;  3VBH C;  1S2B A;  3OY8 A;  4RL7 A;  1WBL A;  5FK8 A;  5A3P A;  1JZ4 A;  2E7A A;  4UW4 A;  1ONA A;  2RJL A;  1ASJ 3;  3ZFE B;  3WD5 A;  1QJU 2;  1PVC 3;  1YQ8 A;  3J4U H;  1RHI 1;  3VBS B;  4LO7 A;  2VXR A;  2XOM A;  1JOJ A;  1X36 A;  5F32 A;  3WW1 A;  2MPF A;  2VUA A;  2D3P A;  1PGW 1;  2LTN A;  2ZGP A;  3AB0 A;  3G7D A;  1FV2 A;  3WHT A;  3ZFG B;  1HQW A;  1IKP A;  3CHX A;  1ALY A;  1VB4 A;  5C3Q A;  2WT2 A;  3FN9 A;  3H1Y A;  5C4W A;  3AKS A;  1YO8 A;  2VTF A;  4Q0V A;  5DUX A;  3LKJ A;  1LU1 A;  1HQN A;  1VP6 A;  1BEV 2;  5BY5 A;  1GUI A;  2Y0I A;  1LEM A;  1WCK A;  2ZX1 A;  3WX5 A;  3V65 A;  1GQG A;  3OD4 A;  2ORZ A;  3KT7 A;  4IV1 A;  1OKO A;  4ZON A;  3U0Z A;  2ZS6 B;  4XUP A;  1EPW A;  4AGV A;  3ZN4 A;  4P02 B;  3VBF B;  1UMH A;  5J96 B;  3RRD A;  2YC0 A;  1AYN 1;  4IEU A;  1XXN A;  2IXH A;  4J1W A;  1DP0 A;  4XJ9 A;  5F6K A;  3WNO A;  4TLF A;  3KV5 A;  1I5P A;  1YJL A;  5DZG A;  2W47 A;  4P9X A;  1LOG A;  5FPX A;  5BV6 A;  4LIU A;  4XW3 A;  3KT4 A;  2XXZ A;  1RHI 2;  1ULG A;  3BIW E;  4MGK E;  3K2O A;  3KWV A;  4X6Q B;  4ZXK A;  3SNM A;  2VOK A;  4IV3 A;  1LOC A;  4COW A;  3SQO A;  5FOJ B;  2HWB 2;  3M70 A;  3RYR A;  1TQ5 A;  3E6D A;  1QJX 3;  3IAQ A;  2NM1 A;  1FAY A;  2AC1 A;  4A45 A;  4F7Z A;  1NG0 A;  5FYB A;  3GCX A;  1QIQ A;  3I2J A;  1UIJ A;  4RQP C;  1UY4 A;  4ATE A;  3GAL A;  3ELN A;  2GN3 A;  2NZ9 A;  4UOJ A;  2ZML A;  3SEE A;  2RDS A;  3M1H A;  3C2U A;  2ZAA A;  3VDD B;  5A33 B;  1AYN 2;  3VZN A;  5IK7 A;  5EV7 A;  4YW7 A;  4DRR A;  3ZXF A;  5LW9 A;  4WM7 C;  1IS3 A;  5FTT C;  3SC7 X;  4V1P A;  4HVR A;  4CDW B;  4XFI A;  1JOP A;  5FYU A;  3DUI A;  4QX2 A;  2RS1 1;  3JD7 3;  4CCK A;  4FP3 A;  1W2O A;  4W6X A;  4EWE A;  4CU8 A;  5LAT A;  4LIV A;  4BIO A;  1NQJ A;  2Q0A A;  4IEZ A;  1NA1 A;  1ULC A;  4AQ2 A;  3UYJ A;  3AZV A;  5FZ8 A;  2Y6H A;  5DQ0 A;  2CAU A;  4EN0 A;  4M00 A;  2NYY A;  3ILF A;  2UWC A;  3R4S A;  4CCE A;  3DKW A;  5HV0 A;  2ZKN A;  1GAN A;  1HRI 3;  3KB5 A;  3JQX A;  3THC A;  1MZF A;  3K51 A;  1R09 2;  3U4S A;  3E97 A;  3PJY A;  5DPN A;  3FBM A;  3I2H A;  5DAW A;  1GQP A;  3A21 A;  4KNC A;  1S0I A;  1JYC A;  2PLV 3;  2WJS A;  3O0W A;  1DYP A;  4AVV A;  1VLN A;  4C0H A;  2YBP A;  3W21 A;  5LZ6 A;  3VUO A;  4NPR A;  4Q4W 1;  4DZG A;  2V72 A;  3N9N A;  4GWN A;  5F5C A;  3POE A;  2R16 A;  2YBK A;  1QJY 1;  1UMI A;  2CGP A;  1UY0 A;  1W6O A;  1AVB A;  2RS1 2;  2UWA A;  1UAI A;  2XUM A;  3HT2 A;  4FO9 A;  2X5I C;  2P3I A;  4CP1 A;  4E4Z A;  4RFT 0;  1OH4 A;  4NID A;  1WMF A;  1TE1 B;  4P14 A;  1U12 A;  1CR7 A;  4HSJ A;  4MET A;  1CX1 A;  1CPM A;  5FXV A;  5A1A A;  5BNN B;  2VVF A;  4WM8 C;  3WIN E;  5KXD A;  2HJI A;  1NCQ B;  4Z2W A;  1XNB A;  5I0U A;  1N3Q A;  1RUD 3;  4E4D X;  3S30 A;  2ZTN A;  2VCM A;  2HWE 3;  2WNE A;  2ET1 A;  2RDR A;  3LEG A;  2HKX A;  5C3O A;  1W8O A;  5GZF A;  5JOW A;  4CUA A;  5JZG B;  2TBV A;  2KR2 A;  1OBN A;  3Q8F A;  4K3U A;  3VDC A;  3WP5 A;  2BWA A;  5KBF A;  2FCT A;  3OEA A;  5F9T A;  5GZC A;  1RUI 2;  4OZX A;  5F2S A;  1SFY A;  1COV 3;  5FKB A;  4UW6 A;  3OPZ A;  2D7F A;  4HKO A;  3VZJ A;  4DUW A;  4LUL A;  1ENS A;  4CCJ A;  1VRH 2;  1Y9G A;  2ZAH A;  1AUY A;  2K46 A;  1ZX5 A;  4NO4 A;  1YFW A;  4Y5Z 0;  3KSC A;  3T2P A;  1O5L A;  4QX1 A;  5H9Q A;  1XB9 A;  4CEW C;  3LB9 A;  3ZSK A;  5LK5 A;  1UWW A;  3THT A;  2ZPX A;  4LKD A;  2BGC A;  5LBF A;  2YDE A;  3IKW A;  1AX1 A;  1RUH 3;  1H0B A;  2D3S A;  4CDU B;  3JXS A;  3B02 A;  1Y4W A;  2WUH A;  2J22 A;  4D0Q A;  5CKQ A;  4I2O A;  5K0U C;  1Q8S A;  2W1W A;  4OHV A;  4CCL A;  1RTV A;  2BTV C;  3SCF A;  5T50 A;  1VMJ A;  3TNQ A;  2YHJ A;  1MR5 A;  1UKR A;  4QPG C;  4XQ4 A;  4XFH A;  4B1L A;  3BPS A;  4URA A;  3E6B A;  1NUK A;  5AVP A;  5JSP A;  2YMZ A;  3DXU A;  4FI9 A;  1AR7 2;  3MIC A;  4FAH A;  4JDN A;  4AR2 A;  2CGN A;  2QQO A;  3N9L A;  5DAP A;  1ZBA 3;  4CCD A;  5D8A A;  2W9X A;  4JKK A;  4L8Q A;  1W3X A;  3PVE A;  4B4Q A;  1AYM 1;  1NLR A;  4BME A;  5CAZ A;  2FD8 A;  4NWV A;  2GN7 A;  5L7O A;  1OQ1 A;  4K40 A;  2RDN A;  1W28 A;  1QH6 A;  1VBA 2;  2QDN A;  1AX0 A;  1LHN A;  3OPT A;  2J1A A;  1GWM A;  1OA3 A;  1YC6 1;  3QAC A;  3C7F A;  4Z07 A;  3KF5 A;  4CXY A;  1GZW B;  2KXL A;  3NJV A;  2YG0 A;  1S1A A;  4GA9 A;  1POV 0;  1V00 A;  2O8O A;  2PYT A;  2W52 A;  3ACL A;  3I2G A;  4ZU4 A;  3U07 A;  4B4P A;  4DY5 A;  2W08 A;  5IAT A;  4HPK A;  4Y1X A;  5CFD B;  3I59 B;  1Q8Q A;  1HB2 A;  3BOD A;  5LK7 B;  1C3H A;  3U1X A;  1FOD 3;  4URT A;  2XLA A;  2P3K A;  1KRI A;  2VZT A;  2PHR A;  3BPZ A;  3VZO A;  2C0Z A;  4YVS B;  3AMP A;  2BBV A;  2HLE A;  3VBR B;  1OQD A;  1RUG 3;  1UCX A;  1DLC A;  1SLL A;  3KMH A;  1LJ7 A;  2RHP A;  4MGI E;  3UGG A;  1PO1 1;  3NV4 A;  3ZPO A;  1APN A;  2ZGN A;  2R30 A;  1OOP A;  3C7H A;  4QT6 A;  5FY9 A;  3U75 A;  3WR0 A;  4AQS A;  5F6L B;  2RR1 3;  3A4U A;  1OLR A;  1AYM 2;  2QQU A;  1OHF A;  4LA3 A;  2VJX A;  4ORF A;  3VLB B;  3IAP A;  5DDJ 1;  2XJU A;  4XDO A;  4IER A;  2WWJ A;  3MLK A;  1US2 A;  1GU3 A;  3LA3 A;  3SEP A;  1K5J A;  1OF3 A;  3VBS C;  3VB9 A;  1PO2 1;  4MXW A;  3EJK A;  5JCT A;  1W05 A;  3ZFG C;  1HXS 2;  1ND3 A;  2B8M A;  3VKL A;  4E4H A;  5J1X A;  4QGM A;  3M7A A;  4CDU A;  3PU3 A;  4AEJ A;  1ULF A;  4KWU A;  2YPJ A;  5FZB A;  2DFB A;  4Y4Y A;  3VBO B;  3HIF A;  1FYU A;  5EJ3 A;  1C28 A;  2XR4 A;  3QH7 A;  4PIY A;  1LOF A;  1WBF A;  1LAJ A;  1XYP A;  1DGW X;  1UZW A;  4JCK A;  2VY0 A;  3ZFE A;  1YCI A;  1FX5 A;  2JDP A;  1Z78 A;  2LAL A;  3RNS A;  3ZN6 A;  3V0B A;  1OLM E;  3UL2 A;  4EZ4 A;  5DMY A;  3FL7 A;  2OUH A;  2WS9 3;  3J8F 1;  4QQH A;  1TME 3;  3CIH A;  2W91 A;  1OVS A;  1C5I A;  4YW4 A;  2FZ2 A;  3O1S A;  2XJV A;  3LQC A;  4PQ9 A;  2YV8 A;  5JIU A;  1WLT A;  3AP7 A;  1ZZ9 A;  3FFQ A;  2C1F A;  1CVN A;  1EV1 1;  1SBE A;  2RS5 2;  5A3W A;  3J7M A;  1DQ0 A;  2YGM A;  4BIS A;  5C9A B;  2X05 A;  3C7O A;  3AXE A;  5FYZ A;  3MO4 A;  3RI9 A;  1ZNP A;  1H9W A;  3AYA A;  3S5Q A;  1J83 A;  4LA2 A;  1R1Z A;  2R49 A;  4CXX A;  1MEC 1;  1GQH A;  2CSG A;  4IE5 A;  3U14 A;  2BVV A;  4Y1Y A;  1QXJ A;  2VE1 A;  1VBE 1;  2E51 A;  1RUF 2;  4RFR B;  5FY1 A;  3VBF A;  5BNP C;  4XEZ A;  1MS1 A;  2F17 A;  3WXP A;  3NAP C;  4RGG A;  3ZIW A;  1XYN A;  3ZSM A;  2XON A;  3SCG A;  2WL1 A;  4MG2 A;  1Y9M A;  2W5F A;  1LHU A;  4O61 A;  3D8C A;  4AFM A;  3DPR A;  3AL6 A;  2JG9 A;  1UOF A;  3PMS A;  4LBN A;  4XFF A;  5EQU A;  4YM3 A;  2A70 A;  3LIH A;  1PGL 2;  3AXD A;  2I74 A;  2GME A;  1ZBE 2;  5ACA 3;  2R07 1;  4DXT A;  1AR9 1;  1W6P B;  4Y33 A;  1VJ2 A;  2RE9 A;  4NN0 A;  4PLN A;  2G1M A;  3MYX A;  3SCH A;  4LLO A;  4NJ4 A;  1WA4 A;  3VN4 A;  5CEH A;  1A6C A;  4ITC A;  4LBM A;  2XB6 C;  2WN2 A;  3AMH A;  1UYX A;  3T1L A;  1JHN A;  1ZRR A;  2XH6 A;  1UOG A;  2XLF A;  4HLT A;  1RHI 3;  4XET A;  4EWD A;  5IVE A;  3B93 A;  3X29 B;  4NAO A;  2Q1M A;  4Y4R A;  1CZT A;  3FE5 A;  2DFC A;  1JYI A;  1MEC 2;  4DRV A;  1AL0 G;  5FYM A;  3DYO A;  4BDV B;  4AFA A;  5LA1 A;  2QE3 A;  2A75 A;  2RJ2 A;  2FDK A;  1D4M 1;  2D6N A;  1H4G A;  2DTW A;  2DTY A;  2TEP A;  5A33 A;  3O0V A;  1NT0 A;  1N1T A;  2GZW A;  4NHX A;  2A6Z A;  2ZAB A;  1IQD C;  4LHS A;  3D0J A;  5GLU A;  3WV6 A;  4YG3 A;  4Q8K A;  2D6L X;  4MXV A;  4TN7 A;  3EB7 A;  4CDW A;  2QZ2 A;  5FZC A;  3F2Z A;  4EV0 A;  3ZXK A;  4ARX A;  5FLJ A;  3H8U A;  5DZF A;  2I07 B;  4GWM A;  5FZK A;  1D0H A;  2IXI A;  4HT1 T;  1AYN 3;  1AR9 2;  5EYY A;  4AEM A;  3ZXG A;  5JDB A;  2C9K A;  1PM7 A;  2ETE A;  2LW8 A;  2EIE A;  4RS5 B;  3MF9 A;  1D7P M;  2VVD A;  2H0B A;  3J26 N;  3ME2 A;  3OYW B;  3B00 A;  3ETQ A;  3O14 A;  1CES A;  3LSE A;  1J3P A;  1AX2 A;  4O7X A;  2ERF A;  1T6G C;  3POB A;  4C91 A;  1D2S A;  2VMC A;  1AR8 1;  2QTW B;  2ZEY A;  2V73 A;  1OI6 A;  1QDO A;  1W0P A;  1H8V A;  5L73 A;  1GNY A;  3PUI A;  3AKT A;  4S2H A;  3T30 A;  1D4M 2;  4DNY A;  3Q8A A;  1UY2 A;  4IEY A;  3VBH B;  1J1T A;  1LHW A;  4JHZ A;  1A78 A;  4KGG A;  2YBS A;  2JE7 A;  2PHD A;  3PL0 A;  1KIT A;  3WDX A;  4YZ1 A;  4DB5 A;  1O3Q A;  3NKT A;  4C1W A;  4Q29 A;  1ZZ6 A;  1K5M A;  1YI9 A;  4IEV A;  2AEN A;  1SDD B;  3NNL A;  4M3C E;  5D2A A;  4QKD A;  1CAV B;  4FOY A;  1J1L A;  1SCR A;  3OUH A;  2XKO A;  5T3N A;  1VBD 1;  5FPV A;  3K48 A;  4HKL A;  3UGF A;  2IFW A;  1BLZ A;  2UU8 A;  4NRO A;  4LJH A;  3T1M A;  1PVX A;  1C57 A;  5A6X A;  3HQU A;  3WP4 A;  3FZ3 A;  5KR7 A;  1JHJ A;  4MGQ A;  1AR6 1;  3PU8 A;  1AF9 A;  1SPP B;  2ZGT A;  3HBK A;  3HWJ A;  3S0M A;  1NCQ A;  2RS1 3;  4K21 A;  1NYW A;  1GLH A;  3ST7 A;  4N8M A;  3N9M A;  3EXU A;  1GR3 A;  3HT1 A;  4NPM A;  4QB2 A;  5GZG A;  5FO7 B;  3H8X A;  2X09 A;  3H3Z A;  3HVD A;  1AJO A;  3CJI C;  3MLJ A;  3OUI A;  4MH0 E;  2B45 X;  2TNF A;  5C6C A;  2VM9 A;  1OFS A;  2BWC A;  3LEM A;  2Q1F A;  2JWP A;  3FWE A;  1TZO A;  3DEM A;  3IM0 A;  2CYF A;  2JDM A;  1KS4 A;  1JZ2 A;  3OTF A;  4LBJ A;  4BK4 A;  4HVQ A;  1BVV A;  2OPW A;  1V6M A;  1S0E A;  3NVC A;  4LOR A;  2GP5 A;  3TRS B;  5IFP A;  4RHV 1;  4QKF A;  3Q9O A;  1QXP A;  1UXZ A;  4JGZ B;  4KG8 A;  1M4W A;  1VBD 2;  2UWB A;  4R8H A;  3IBM A;  1TMF 2;  5JR2 A;  3INA A;  5JXI A;  3AZX A;  3LOB A;  2A6Y A;  2VUJ A;  1RUI 3;  2EVX A;  3ILR A;  1PX3 A;  4RR3 B;  1PMI A;  1R64 A;  4JDM A;  4ASK A;  1IS6 A;  4RQP B;  4OMC A;  4F8A A;  1QJY 3;  1AR6 2;  3KQ4 B;  1TNF A;  1HV1 A;  4M3C B;  4XUT A;  3LWC A;  4EN9 B;  2NN8 A;  2LRP A;  1UIK A;  1VRB A;  3NV3 A;  1CPN A;  3AKR A;  4BQ1 A;  3ZKU A;  4DXS A;  4NIG A;  1DFQ A;  1LGC A;  1RVF 2;  2D97 A;  1EAH 1;  4SBV A;  2BNM A;  3ZVX A;  4UBH A;  4NHY A;  5FZF A;  5LY1 A;  4WM7 B;  4B1M A;  5GZD A;  2RG4 A;  4CDX C;  1KJL A;  4LEJ A;  1XYO A;  1DZQ A;  4ZS3 A;  4PF1 A;  4LBQ B;  1UOJ A;  1I5Z A;  1G8W A;  2K0G A;  4B8E A;  1CAW A;  1W3V A;  2PFW A;  5FZO A;  4FPC A;  4AF9 A;  4KQ7 A;  3DV8 A;  5CFD C;  3TYJ A;  4AVB A;  1SHW B;  4F3J A;  4RHV 2;  1X7N A;  1GWK A;  1N3P A;  3H7J A;  1XNT A;  5C8C A;  4Q4Y 1;  1C8M 2;  4XUN A;  1FT9 A;  5J3U A;  4PQQ A;  4N7U A;  1FXZ A;  1Z7S 2;  2ADD A;  4YVS C;  4Q0P A;  3TN9 1;  1FAT A;  2WNV B;  4CDQ C;  3KT1 A;  2RM2 1;  5C3S A;  4C90 A;  1RUH 1;  1WW6 A;  2OKX A;  4TTG A;  5FXZ A;  1GZW A;  5CU1 A;  2P6H A;  4ASL A;  3AP4 A;  1LOD A;  1V6L A;  3LIG A;  4P08 A;  4Y26 A;  1RC6 A;  3J7H A;  4H2A A;  1XU2 A;  5C70 A;  4D8M A;  4GMP 0;  2QQK A;  2WBK A;  3I59 A;  1S4C A;  3W20 A;  1O3T A;  3EMR A;  4XZU G;  1NCR B;  4YVW C;  2R1D A;  1U5X A;  1A3K A;  1H8T C;  5FPZ A;  1XC6 A;  2RS3 1;  5J36 A;  1AL2 1;  3L2Y A;  2UY8 A;  5T52 A;  3S5A A;  3JCI A;  3GF6 A;  4Y1Z A;  1RXF A;  3E5Q A;  1HJF A;  1RUJ 2;  1W06 A;  3MBW A;  3B3Q E;  2P6C A;  4CPB D;  4N9I A;  4NHM A;  5BNO C;  2HWF 2;  2X5I B;  4Q4V 1;  1TNR A;  2DV9 A;  5LEK A;  3VBO C;  4PDW A;  4CP9 B;  1I9R A;  1QNY A;  1ND2 C;  2KA3 A;  1W90 A;  2VG9 A;  4ERO A;  5KHJ A;  4PHZ A;  3FUQ A;  4YGE A;  1GSL A;  4WM8 B;  1W9T A;  1W8U A;  4QXB A;  1U0A A;  4D3W A;  2YGL A;  4AVT A;  1N1S A;  2GC3 A;  4IND A;  3D82 A;  2WZR 1;  3O1U A;  3P5B A;  3TOJ A;  1STM A;  1RUC 2;  2NMN A;  4GD4 A;  1AYM 3;  4JV4 A;  1QMJ A;  4ZHN A;  4GKX A;  4YYO A;  2FQP A;  2Q4S A;  2V5D A;  4BU2 A;  5JR7 B;  1CAX B;  2IC1 A;  5FYT A;  1DYO A;  2ZX0 A;  4COV A;  2DVD A;  5JUV A;  3CLP A;  1KD7 A;  3C7G A;  1XNK A;  2L9L A;  4JTN A;  4PIX A;  5IVJ A;  4GB3 2;  3MV0 1;  1WCS A;  2BNN A;  3SIS A;  2BFU L;  2GNT A;  2XDV A;  4HAN A;  4GUL A;  4QQL A;  3DGT A;  1OLQ A;  2ZGK A;  4N9H A;  3PUQ A;  3ACI A;  2CTV A;  3M8L A;  4CEW B;  2VQA A;  4QKB A;  3UGH A;  3ES4 A;  2YRO A;  4EN6 B;  5C9A A;  4CUG A;  1SAC A;  3FUO A;  2E7Q A;  3ZDS A;  1I6X A;  2ZMN A;  1DQ2 A;  4JQT A;  1JBC A;  1OD3 A;  1SLC A;  2EXJ A;  1MQT A;  2RVA A;  2WIN B;  4HFS A;  3DYM A;  1HW5 A;  5K0U B;  2TUN A;  1BXH A;  2CV6 A;  2OA2 A;  3S57 A;  4QPG B;  5DDJ 3;  4EYU A;  2PEL A;  1F15 A;  5C7G A;  1PK6 A;  2HWC 1;  4E2G A;  3ZYJ B;  4A6O A;  3J7N A;  3AYC A;  1KGY A;  2BV4 A;  3H9A A;  2CDO A;  4S2F A;  3SIT A;  2R06 2;  4DXZ A;  1PO2 3;  1HX6 A;  1WMX A;  4ZPI A;  4KMQ A;  5IVF A;  3M2M A;  3R4U A;  4FPF A;  5FZ7 A;  4P9J A;  2X53 S;  3MGU A;  3UJQ A;  3O12 A;  5FMD A;  4MGZ E;  1BK1 A;  1O8S A;  5EYX A;  4Y5S A;  5SV5 A;  1W6P A;  3ZYH A;  3AMM A;  4XOG A;  3HBZ A;  1WA6 X;  3S6P A;  5EIY B;  2QNK A;  1QJF A;  1ZRC A;  4DS0 A;  4OI4 A;  1QJU 1;  5FZI A;  1LKN A;  3VL9 A;  4L92 A;  2P34 A;  1ACC A;  3MPP G;  4W50 A;  1W8W A;  1MPX A;  1OLM A;  3J8F 3;  2VUC A;  4YLZ A;  3RI8 A;  3DYP A;  3ZXA C;  2IWG B;  1E57 A;  1RL3 A;  2A71 A;  1SFP A;  4BQ5 A;  2WWU A;  5HBA A;  2DCT A;  5GZE A;  3ZOI A;  4FPO B;  1EV1 3;  1FMD 2;  2YC2 A;  1GV9 A;  2AAC A;  2BW8 A;  1BEV 1;  1Q5O A;  1TG7 A;  1OD5 A;  5F5Q A;  3MLL A;  5JMO A;  1KEX A;  5EJZ B;  2ID4 A;  2ENR A;  3NJX A;  3I3Q A;  1XNA A;  1MEC 3;  3TEW A;  5L9V A;  1Q56 A;  4HBN A;  2NLR A;  4Q0Q A;  3DN7 A;  1VBE 3;  4QPY A;  1CGP A;  3AP6 A;  4AK3 A;  2R32 A;  1VE0 A;  3WY6 A;  5IUQ A;  4RS5 A;  3U37 A;  4FBF A;  3OYW A;  4LKE A;  1H6X A;  2ZXQ A;  1CIW A;  1W39 A;  1RUO A;  1LOB A;  1V70 A;  2G9G A;  3K4A A;  3WF4 A;  5KWR A;  2JJ6 A;  5GKA C;  3AKQ A;  5J09 A;  1WMD A;  4WZF A;  3H8O A;  2XBO 2;  4MOA A;  3WG3 A;  1R1A 2;  2HWB 1;  2C26 A;  3PVB B;  4D69 A;  1YIF A;  2R07 3;  3WNP A;  1AR9 3;  3POY A;  4XIK A;  2CGO A;  3K46 A;  5A32 B;  2FDF A;  3B69 A;  3ZMN A;  4QQO A;  5FZM A;  3V0A B;  2AUY A;  3URF A;  5JIA A;  2D6P A;  2ZCW A;  4LT5 A;  5DG1 A;  2NPI A;  3MF6 A;  4FCA A;  1H1I A;  1LNS A;  1WZX A;  1GYK A;  4JRL A;  2P17 A;  3O0X A;  3ROU A;  4CU7 A;  3VD5 A;  4ES8 A;  2GC0 A;  5IFT A;  1BVP 1;  4PBP A;  3NRU A;  4AFD A;  4YGC A;  5L9R A;  4LHL A;  4Y1U A;  3POJ A;  2BOJ A;  2JDN A;  4BIF A;  5CFC C;  5CKN A;  4YAR A;  4N53 A;  2ZHM A;  3ASI A;  1D4M 3;  2B39 A;  3JZV A;  5JVV A;  2VGD A;  5DG2 A;  1UU5 A;  4AYU A;  2CNA A;  2ZZJ A;  5DUU A;  3T4V A;  2W68 A;  1G7Y A;  3USU A;  4N43 B;  3WW4 A;  5AC9 2;  1C1L A;  2EIC A;  4F83 A;  3OGV A;  2VU9 A;  5C8W A;  5IK4 A;  3NL1 A;  2OT7 A;  3RPQ A;  4QPI C;  4ARY A;  2EAK A;  3NJY A;  3QH6 A;  4NVP A;  4FFF A;  1FNZ A;  4QGL A;  1G9D A;  4Z2A A;  3A23 A;  2W95 A;  3ZYP A;  1S0B A;  5T55 A;  2C5D A;  4FP2 A;  1OUX A;  3LF7 A;  4JGZ C;  5FYV A;  1RJ8 A;  4PI0 A;  5KHG A;  1JU3 A;  5BNP B;  3DCQ A;  3JBG 1;  2J42 A;  3NAP B;  3PTY A;  3AZZ A;  4I0B A;  5A3M A;  4BQY A;  4GZ9 A;  2XPJ A;  4RR3 C;  1SMV A;  3ETP A;  1UO9 A;  2PHF A;  2VW2 A;  4JKM A;  5F37 A;  1WLW A;  2R7E B;  1R09 1;  4BCU A;  3KV4 A;  1AR8 3;  2XWB B;  2WYS A;  3L9J T;  2BYV E;  2W1U A;  2Y38 A;  2YZ4 A;  1W8F A;  4A44 A;  1H4H A;  4OCT A;  3TEX A;  3ZDV A;  4AE2 A;  5F7U A;  4OFG A;  2ET7 A;  4A3Z A;  4MGT A;  2WA4 A;  4BM8 A;  5F5A A;  5FZ3 A;  1FPN 2;  5ABJ B;  2D40 A;  1GP5 A;  2O0O A;  4UFH A;  3CMG A;  4RQP A;  4U2A A;  5FKC A;  1X82 A;  3LD8 A;  5FRE A;  2OQ7 A;  5JMC A;  5KHH A;  4M3C A;  1NE4 A;  3BI3 A;  5F2W A;  1VBD 3;  5JSR A;  1O7F A;  1POQ A;  2ES3 A;  1AJK A;  4JAA A;  2FDG A;  3JBG 2;  2JB4 A;  3SH3 A;  2WNV C;  2DWR A;  4WM7 A;  4JHT A;  1AR6 3;  3NWK A;  5LB6 A;  4FVV A;  4ONU A;  2OZJ A;  4CCO A;  1RB8 G;  4JQR A;  2FDJ A;  5ERL A;  4W4Z A;  5C3P A;  1CN1 A;  2FDH A;  1UYP A;  1B09 A;  1GOF A;  1PMJ X;  1R08 2;  1X8E A;  2VZ1 A;  1YNA A;  1NCR C;  1OUS A;  4NPL A;  5FYY A;  5I8S A;  3UKT A;  5B4N A;  1F8V A;  3WNK A;  1HKD A;  3GJB A;  1J58 A;  3LEI A;  4RN5 A;  4CUC A;  2QQN A;  1RUI 1;  4GH4 B;  2ZGM A;  3WDT A;  3ILN A;  4OLL A;  4KWL A;  3SKJ E;  1DDL A;  3UKN A;  2XG3 A;  4OI0 A;  1YJK A;  3FLT A;  1QQP 2;  1W6Q B;  2W94 A;  2VO5 A;  1EPZ A;  2VBB A;  4OYU A;  4Q4X 2;  4XVH A;  3ZKY A;  1VRH 1;  4LMF A;  1H9P A;  4RHV 3;  1HLC A;  4XCA A;  4XQD A;  3RWN A;  5JPM B;  4R9B A;  3C3V A;  3N4M A;  4O9E A;  1ZRI A;  2WAO A;  1XBF A;  4CYD A;  5KHI A;  3ZR6 A;  5K4L A;  4XFG A;  5F3G A;  4Y22 B;  1JMU B;  2LM3 A;  4H7L A;  2VZV A;  4I02 A;  3AFK A;  4D7T A;  2ZBJ A;  5JLV A;  5FP3 A;  4YW6 A;  4WVZ A;  2BBA A;  2VBP A;  4CUB A;  5F3C A;  3W5M A;  3WDW A;  1UPI A;  2JXA A;  4CEY A;  4HL0 A;  2X5I A;  4K8F A;  1JZ6 A;  1CJD A;  2ZJC A;  5FZ0 A;  3W9A A;  1EAH 3;  1YQC A;  4CP9 A;  1BQP A;  2J1T A;  2VME A;  3J9S A;  4CA9 A;  5FIX A;  5C3R A;  2YXS A;  3LSD A;  5KXC A;  4WM8 A;  1AR7 1;  1F4A A;  5IWF A;  4QX5 A;  4ZS2 A;  4I0A A;  2XJQ A;  1OKQ A;  1UYY A;  4PLM A;  1XSQ A;  2WWS A;  3H1M A;  2ZHN A;  4JGY B;  4QM9 A;  4Q1P A;  3IB3 A;  1OFN A;  2DBN A;  2Z79 A;  3AMN A;  4Q0U A;  3WCS A;  4MHR A;  2CL2 A;  4XBL A;  4XTM A;  4EQV A;  5GJ6 A;  4Q4Y 3;  1VBA 1;  2Z2S B;  2JEC A;  1QOS A;  2ZX4 A;  1YHF A;  3TN9 3;  2V09 A;  3CJI B;  3ZYI B;  2JIJ A;  5F8P A;  3P3P A;  4KGQ A;  3VD3 A;  3VD4 A;  5BNQ A;  2RM2 3;  4QX3 A;  2DBI A;  1IS4 A;  1SCS A;  2BVB A;  5G05 L;  1W2U A;  4CSW A;  2WT1 A;  4FXK B;  3LAG A;  4XCB A;  1MVQ A;  3FFZ A;  3GBF A;  4TXW A;  1XSR A;  1PNG A;  3ABZ A;  5FCC A;  2K2S A;  3KM5 A;  4LPL A;  2VUL A;  5A7P A;  2WZE A;  2E6V A;  3OGS A;  1DQ4 A;  1GMM A;  2QZ3 A;  2RS3 3;  2ZHK A;  1AL2 3;  3SH5 A;  4FTS A;  2XJS A;  5FO9 B;  2D43 A;  4AW7 A;  4HSL A;  1RUN A;  3KZ4 C;  4FXG B;  2VZR A;  1O4T A;  2PXJ A;  5G04 L;  4Q4V 3;  3O1P A;  1OF4 A;  3LCP A;  5K0U A;  3WUD A;  3KF3 A;  3UNP A;  1WW5 A;  1KDK A;  4L9B A;  4LBK A;  1W2N A;  5A3L A;  1JZ7 A;  1YQ6 A;  4QPG A;  1XOY A;  2EXI A;  3GZU C;  2ARE A;  4CDX B;  4H7M A;  3O1O A;  1H2M A;  2WZR 3;  2XHN A;  4IEW A;  2O8Q A;  5FPB A;  1UU6 A;  1Y43 B;  3RYK A;  2QQI A;  1HXS 1;  1UOB A;  2ARX A;  4P5Y A;  2WQ4 A;  1DQ1 A;  4IUG A;  4BHP A;  2WSU A;  5IK8 A;  1XPW A;  2ZA9 A;  2Y64 A;  3BCW A;  3MW4 A;  4JC1 A;  3THD A;  3K4D A;  5D1I A;  2OX0 A;  1RED A;  4B4R A;  2A3X A;  3C7E A;  5CZK A;  4YM1 A;  5C5T A;  3GZA A;  2PHW A;  4CDQ B;  4BZ4 A;  2VR4 A;  4FQZ A;  4FQ4 A;  2XWJ B;  3I3D A;  3ZFF C;  4Z1V A;  2ARB A;  3RVH A;  5L9B A;  1D0G A;  1B35 B;  3AC0 A;  4N90 A;  1MS4 A;  4UI9 L;  5CA6 A;  3OG2 A;  1OOP C;  2XVL A;  3KV6 A;  3POW A;  4Q27 A;  3RS6 A;  1REE A;  2RS5 1;  3IPV A;  4YVW B;  2X10 A;  4CP0 A;  5FQ0 A;  1SFN A;  1VBB 2;  3U78 A;  1H8T B;  3WG1 A;  5FYH A;  3P3N A;  3EHK A;  1VIW B;  2SLI A;  2R04 2;  3BAL A;  3MUY 1;  1PIV 2;  1HRV 2;  1WLD A;  1UXX X;  2ZX3 A;  4NRP A;  4YZ3 A;  4AHY A;  4Q1R A;  1M06 G;  5FPA A;  1MZE A;  1RUF 1;  5A80 A;  1GNH A;  3ES1 A;  5BNO B;  1LHO A;  3JB8 A;  5HCF A;  4CDU C;  3O1R A;  1RIT A;  3BU7 A;  1TVG A;  5CYY A;  1JYV A;  1ND2 B;  4K8R B;  5FUP A;  2HWC 3;  3HAG A;  1OPM A;  1ENR A;  1LOF C;  2HEY F;  3A22 A;  1Q8P A;  3POI A;  4H14 A;  4PCR A;  3VBS A;  4XJU A;  1JTZ X;  4OMD A;  1PGL 1;  3B7M A;  4M0H A;  1ZBE 1;  5GLW A;  1WKY A;  4Y1V A;  3ZFG A;  4BPZ A;  1U5Y A;  3FX3 A;  4DUX A;  5F1R A;  5A32 A;  4QDQ A;  2C6S A;  4MSV A;  5E8A A;  4BQX A;  2VCB A;  3R0R A;  4UFI A;  5IJR A;  3V0A A;  2WNO A;  4N43 C;  4UAP A;  3KS7 A;  1QJU 3;  3IDC B;  2JG8 C;  3W5N A;  1SLT A;  4YW2 A;  2VUD A;  3MW2 A;  1RMU 2;  1AHS A;  4IW3 A;  4CCC A;  2OUJ A;  4OUS A;  4XJ8 A;  3VV1 A;  4YM2 A;  1I1E A;  1NZC A;  2Q8D A;  3PME A;  3SXW A;  4GQ7 A;  1BKZ A;  1IGO A;  1OXC A;  2PA7 A;  3DF0 A;  1OQE A;  4CU6 A;  4TSV A;  3ZMO A;  4BLJ A;  4QB1 A;  4NR1 A;  2VL4 A;  5I0D A;  1BEV 3;  1V0A A;  2LS6 A;  4CTE A;  4BYY A;  2E31 A;  1BMV 2;  4QMA A;  1ZVF A;  3VDA A;  3WW2 A;  5CG8 A;  2WNU C;  4YWA A;  4UXA A;  4AHZ A;  3N7L A;  3M3Q A;  2WFF 2;  1W6M B;  2VQ0 A;  2XJT A;  4XF9 A;  1HB1 A;  4UW3 A;  3TAY A;  2EIB A;  1VR3 A;  4XYX A;  4OHY A;  3AVS A;  2QKD A;  4KH9 A;  4DEQ A;  4AED C;  4E8D A;  1V6N A;  4P9I A;  3NAP A;  4YRD A;  3SKV A;  4NMI A;  4D6S A;  5ABJ C;  1RJ7 A;  4AHW A;  4XPV A;  4YZ2 A;  4Q2F A;  3MIE A;  3PUA A;  2P3Y A;  4QXC A;  1O91 A;  4PJY A;  4YG6 A;  2HWB 3;  1GWL A;  1YUD A;  4QPW A;  4FTE A;  2WLP A;  4A3X A;  4BA6 A;  5FUN A;  3VDD A;  3JQW A;  2G9Z A;  1RIN A;  1CIY A;  1SG3 A;  4QHB A;  3RJ2 X;  4DEV A;  5CVR A;  3SHR A;  1V9U 2;  1RUE 2;  3AFG A;  3LGR A;  4YW1 A;  2VTX A;  5T5L A;  1OVP A;  4FOV A;  5HXV A;  2DVA A;  5FJK A;  2VNG A;  1W03 A;  5FXW A;  5T5O A;  3N7K A;  4HXC A;  3O5S A;  3VGI A;  3GHN A;  1UN1 A;  2IXK A;  2QDR A;  1YIP A;  5HCA A;  3CEW A;  1K45 A;  4I01 A;  1WCU A;  4IE4 A;  3WCR A;  1SLI A;  3VD7 A;  2Y6L A;  4DO0 A;  4E8C A;  5JSO A;  3M3C A;  5A6Y A;  2PHU A;  4BMB A;  2VMI A;  1W9S A;  4Z8B A;  3MFC A;  1ASJ 2;  1NLS A;  1PVC 2;  5H9P A;  4NHK A;  2C9A A;  1QOO A;  4ZU5 A;  3M3I A;  2F4P A;  2E33 A;  3CL1 A;  5FZ6 A;  2VQU A;  2EXH A;  3JBG 3;  4NRM A;  1F5F A;  4AGG A;  1W8T A;  1LOA A;  3QBQ A;  1ENX A;  4GH4 A;  5FV3 A;  1W6N B;  3ITQ A;  3AZW A;  3OJB A;  3OY8 B;  3OGR A;  2VZO A;  5A3U A;  2QQW A;  2XQX A;  3I7D A;  3IDB B;  4L99 A;  1WWY A;  4KG0 A;  1R09 3;  5FMO L;  5JI9 A;  2AEZ A;  1K5M C;  2EXK A;  3VKF C;  4QU1 A;  4LBL A;  1LB2 A;  2JE9 A;  4AL9 A;  1TMF 1;  1WUV A;  3OCP A;  2B42 B;  3ATG A;  3UT0 A;  1DCS A;  3I2F A;  1ZYB A;  2VZ3 A;  3LOI A;  2OZ6 A;  5BNN A;  1PZ8 A;  1MS9 A;  3AP9 A;  5L19 A;  3PJQ A;  4R9D A;  2BGO A;  3HPN A;  4JGY C;  4DY3 A;  1MS3 A;  3TEY A;  1J3R A;  1FNY A;  4AI1 A;  3VZM A;  5CFC B;  2ZGO A;  4IV1 B;  4DPN A;  2XL9 A;  2GNM A;  2JDK A;  5ANN A;  2WAB A;  1RVF 1;  3PHM A;  5IVY A;  2JDA A;  2JIG A;  5JZG A;  3ZYF A;  3GZT B;  4IQP A;  1QJX 2;  2D6O X;  3B01 A;  3IWZ A;  4Y3O A;  3IZO A;  1A8M A;  2QCS B;  2AGS A;  4IGO A;  1DBN A;  3WW3 A;  4LR4 A;  5CG9 A;  4UFJ A;  4NIH A;  3KLS A;  3AX4 A;  3KD4 A;  4QPI B;  1VPH A;  2KD7 A;  1H1M A;  1VAM A;  4LE4 A;  5LCW L;  4LOS A;  1BZW A;  1UKG A;  1ZRE A;  1YXW A;  2GMM A;  4ISR A;  4QWN A;  3WNM A;  5KXB A;  1KFU L;  5FZG A;  1C8M 1;  2EIG A;  2I2S A;  3FC0 A;  4KU7 A;  1F9K A;  1Z7S 1;  2GAL A;  2XQR A;  2VCC A;  2XJP A;  3HMY A;  4HMZ A;  2WT0 A;  4E27 A;  5JI7 A;  2VVE A;  1IPS A;  5K9Y A;  1POV 1;  2J7M A;  4GXL A;  2OPK A;  2Q8C A;  2Y8K A;  1VRH 3;  4P9W A;  2WZP P;  4XE9 A;  1NY7 1;  1UF2 C;  3ZLI A;  5JXG A;  2IXC A;  2VOV A;  3JD7 2;  1EP0 A;  4K6B A;  2VW1 A;  4NWW A;  1C5H A;  3Q8C A;  3BU0 A;  4GAL A;  1OA2 A;  1HN1 A;  1Q8O A;  3CU7 A;  4NE9 A;  3QOP A;  3ZM8 A;  2R1B A;  2MNG A;  5FMC A;  3HJR A;  1S0C A;  3OB8 A;  4X8P A;  1ZZC A;  1RUJ 1;  2YPD A;  1QJZ A;  4C1X A;  4YZ4 A;  4BE3 A;  2O14 A;  1QWR A;  1QHD A;  3CZU A;  4QQP A;  4QKN A;  2ORX A;  2HWF 1;  4LBO A;  1UW8 A;  2UY9 A;  2G19 A;  4IEQ A; 
#chains in the Genus database with same CATH homology
 3LPG A;  3CDZ B;  4ZXE A;  5B4X A;  1K3I A;  3U37 A;  3VDC A;  3HNM A;  3OEA A;  4QAW A;  1H6X A;  2J1E A;  2ZXQ A;  3K4A A;  2VZS A;  3WF4 A;  4KI5 M;  4MOA A;  3K4Z A;  2WO2 A;  4OZO A;  3OEB A;  4DUW A;  2C26 A;  3CZJ A;  1UY3 A;  3T0A A;  3WNP A;  3K46 A;  3T2P A;  4BJ0 A;  4QX1 A;  2VMF A;  4A4A A;  1LNS A;  4CU7 A;  2DCJ A;  3VD5 A;  1GOG A;  1UWW A;  5IFT A;  3NRU A;  2YC4 A;  4ZY9 A;  3JXS A;  2WO3 A;  2WUH A;  2J22 A;  4D0Q A;  2W1W A;  3CKH A;  3WF0 A;  1RYY A;  1NUK A;  2EIC A;  3OGV A;  4ARY A;  2W1S A;  4FI9 A;  2QQO A;  4MAD A;  3A23 A;  2W95 A;  4Z2A A;  2W9X A;  4JKK A;  4ET7 A;  3ACF A;  2W1Q A;  1JU3 A;  3I2I A;  2E26 A;  2B4K A;  3T09 A;  2VZP A;  4GZ9 A;  3ETP A;  4CVU A;  2J1A A;  4JKM A;  2EID A;  3ECQ A;  4LKS A;  3C7F A;  5HXM A;  4M4R A;  1UY1 A;  2R7E B;  3NJV A;  2YG0 A;  3I2G A;  2WYS A;  4XUO A;  2VQT A;  2W1U A;  5F7U A;  4A44 A;  2Y6K A;  4A3Z A;  5LA0 A;  3D3A A;  2VZT A;  3MV1 1;  2HLE A;  3CMG A;  1DLC A;  2VMD A;  3E1F 1;  3IDA A;  5IHR A;  3WNN A;  1WCQ A;  3C7H A;  4QDS A;  2W3J A;  3GGL A;  4YPJ A;  4ZZ8 A;  2VJX A;  3EYP A;  3IAP A;  3WF1 A;  1US2 A;  1GU3 A;  3SEP A;  1OF3 A;  2W92 A;  3CQO A;  2JKX A;  4W4Z A;  1GOF A;  1PMJ X;  5J1X A;  2VZ1 A;  1K12 A;  3A7Q A;  5B4N A;  2ZEX A;  5JXH A;  4KWU A;  3UET A;  3WNK A;  2JD9 A;  4XUR A;  3LEI A;  3I97 A;  4RN5 A;  4CUC A;  2QQN A;  4A42 A;  3SKJ E;  5HPO A;  3T0B A;  2W94 A;  4OYU A;  2VO5 A;  5DMY A;  3FL7 A;  4XVH A;  3T2O A;  4BK5 A;  3CIH A;  1O59 A;  2W91 A;  3LQC A;  3VD9 A;  2WAO A;  2CDP A;  2X05 A;  3C7O A;  2VZV A;  3MO4 A;  1EUU A;  1NKG A;  1J83 A;  2BBA A;  3W5M A;  4CUB A;  2W87 A;  3LE0 A;  1JZ6 A;  1H6Y A;  3HEI A;  4MO3 M;  1CZV A;  1UX7 A;  2J1T A;  2VME A;  2XON A;  2YFZ A;  2W5F A;  1F4A A;  1UYY A;  2Y6G A;  1JU4 A;  3IB3 A;  4MGS A;  4DXT A;  3WF3 A;  3FHA A;  2BER A;  3VD4 A;  3BN6 A;  2WN2 A;  3VD3 A;  4CU9 A;  1UYX A;  4QX3 A;  4ZZ5 A;  3OBA A;  5G05 L;  4M4P A;  1CZT A;  4GWI A;  4TXW A;  2QBX A;  3ABZ A;  3DYO A;  4BDV B;  4A41 A;  4LPL A;  5LA1 A;  2RJ2 A;  2WZE A;  2QQM A;  3OGS A;  3III A;  1GMM A;  1JI6 A;  3MUZ 1;  2YFU A;  4LHS A;  1IQD C;  2VOT A;  3T0D A;  3EB7 A;  1NX9 A;  3F2Z A;  4ARX A;  2VZR A;  5G04 L;  4QB6 A;  1OF4 A;  2J1V A;  3UNP A;  2C9K A;  2LW8 A;  2EIE A;  1JZ7 A;  1D7P M;  1UYZ A;  2VC9 A;  4LQR A;  3WNL A;  1JYX A;  1UZ0 A;  2XHN A;  4L0P A;  4PT6 A;  2QQI A;  2VMC A;  4P00 B;  4W8J A;  4P5Y A;  3UES A;  2ZEY A;  4IUG A;  1XPW A;  1GNY A;  2Y64 A;  3PUI A;  1OT5 A;  2E32 A;  3K4D A;  5JXJ A;  1UY2 A;  4JHZ A;  3C7E A;  5CZK A;  1JYN A;  3T2Q A;  1JYW A;  3FHQ A;  2J1U A;  2VR4 A;  4JX0 A;  3I3D A;  2DDU A;  1SDD B;  1EUT A;  3AC0 A;  4UI9 L;  3OG2 A;  2WO1 A;  3HNB M;  4HG6 B;  2V4V A;  2WAA A;  3K77 A;  1W8N A;  2X10 A;  1JHJ A;  3I3B A;  4MGQ A;  3MUY 1;  1ULP A;  1UXX X;  3ACG A;  1JZ3 A;  1JZ5 A;  4QDR A;  2BGP A;  2J1R A;  2WQ8 A;  2ZEZ A;  1P8J A;  4QB2 A;  3WQB A;  1TVG A;  2X09 A;  5CYY A;  1JYV A;  4DXR A;  1O8P A;  4GWJ A;  2VM9 A;  3A22 A;  1CZS A;  2JE8 A;  1JZ2 A;  3LEK A;  4OMD A;  2WZ8 A;  2BZD A;  4BK4 A;  4DUV A;  2DCK A;  3P6B A;  1WKY A;  4DUX A;  5IFP A;  5LA2 A;  1UXZ A;  4QDQ A;  1W0N A;  4AAX A;  5JR2 A;  1L7R A;  2VCB A;  5IJR A;  5JXI A;  2VZQ A;  4UAP A;  3W5N A;  3BGA A;  1PX3 A;  1R64 A;  2WN3 A;  4OMC A;  5EJ1 B;  2VCA A;  2Y6J A;  1T2X A;  2B9V A;  4XUT A;  1W9W A;  3NQH A;  2ZEW A;  3K75 B;  4DXS A;  4XUQ A;  4CU6 A;  1L7Q A;  4QB1 A;  1K42 A;  2VL4 A;  5I0D A;  3GM8 A;  2LS6 A;  2WDB A;  2E31 A;  2QQL A;  3VDA A;  4PF1 A;  1YQ2 A;  3WF2 A;  1SHW B;  2EIB A;  2QQJ A;  1PMH X;  1XNT A;  4DEQ A;  3P1I A;  4E8D A;  3DEC A;  4XUN A;  3SKV A;  4PQQ A;  1JZ4 A;  4TTG A;  2OKX A;  2XOM A;  5IYY A;  4P08 A;  4QPW A;  3J7H A;  5C70 A;  4D8M A;  2QQK A;  2WBK A;  3I2K A;  4XZU G;  4OUE A;  1CIY A;  1SG3 A;  3FN9 A;  1XC6 A;  3C8X A;  2VTF A;  4DEV A;  1W99 A;  1NAE A;  1GUI A;  2HYX A;  3NNG A;  3MBW A;  1J84 A;  2ORZ A;  2J1S A;  4XUP A;  3GDB A;  4P02 B;  1UMH A;  1K45 A;  1JZ8 A;  3VD7 A;  2Y6L A;  4E8C A;  1DP0 A;  3WNO A;  3I3E A;  1W9T A;  1I5P A;  2W47 A;  1W9S A;  5DN2 A;  3HNY M;  2E33 A;  3ACH A;  2VQU A;  3IAQ A;  2V5D A;  2PQS A;  3LPF A;  4A45 A;  1DYO A;  3OGR A;  4BXS V;  5JUV A;  2VZO A;  3C7G A;  3I2J A;  2XQX A;  2L9L A;  4QX0 A;  1UY4 A;  3MV0 1;  3T08 A;  1US3 A;  4UOJ A;  1BHG A;  3SEE A;  3GXU A;  4JKL A;  3I2F A;  2VZ3 A;  3ACI A;  2VZU A;  2BGO A;  3HPN A;  4QX2 A;  1OD3 A;  5FUI A;  2RVA A;  3DYM A;  2YB7 A;  4CU8 A;  2WAB A;  2JDA A;  1GOH A;  5C7G A;  4A6O A;  2Y6H A;  1KGY A;  5DQ0 A;  2CDO A;  4RYD A;  2KD7 A;  5C71 A;  5LCW L;  4KMQ A;  3THC A;  3PUH A;  3WSO A;  5DPN A;  3I2H A;  1GQP A;  1F4H A;  3WNM A;  1O8S A;  3A21 A;  5EIY B;  1ULO A;  2VCC A;  1PX4 A;  2Z4F A;  3HN3 A;  2V72 A;  2J7M A;  4W50 A;  2Y8K A;  1UMI A;  3VDB A;  1MPX A;  1UY0 A;  3DYP A;  5JXG A;  3WEZ A;  4AG4 A;  2C4X A;  2W46 A;  1OH4 A;  1HN1 A;  2YC2 A;  1CX1 A;  3ZM8 A;  5A1A A;  1TG7 A;  3HJR A;  3OB8 A;  3HOB A;  2RV9 A;  5JMO A;  1KEX A;  5EJZ B;  2ID4 A;  3CZU A;  3NJX A;  2ORX A;  1XNA A;  3LEG A;  3THD A;  1W8O A;  4CUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...