2J1SA

Structure of a streptococcus pneumoniae fucose binding module in complex with fucose
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
141
structure length
141
Chain Sequence
KFNDGNLNIAYAKPTTQSSVDYNGDPNRAVDGNRNGNFNSGSVTHTRADNPSWWEVDLKKMDKVGLVKIYNRTDAETQRLSNFDVILYDNNRNEVAKKHVNNLSGESVSLDFKEKGARYIKVKLLTSGVPLSLAEVEVFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Blood Group Antigen Recognition by a Streptococcus Pneumoniae Virulence Factor
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Carbohydrate-binding protein
total genus 37
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2j1sA00
4DXSA 3NQHA 5DN2A 3WNLA 1GMMA 1W9WA 3I2KA 2QQOA 3IAQA 1KEXA 2W47A 3FHQA 2Y64A 3OGVA 4A4AA 4XUTA 2WZ8A 3HJRA 4PQQA 5EJ1B 4P08A 2YC2A 3MBWA 5EJZB 1UY0A 1W9SA 1OF3A 2L9LA 2W46A 3K4ZA 1JZ8A 3OEAA 1GNYA 1UYZA 1JZ5A 1UY2A 2CDOA 5LA2A 2EICA 4M4RA 3CQOA 1XNTA 2W91A 2RVAA 2YC4A 2DCJA 4QX3A 3MUZ1 1D7PM 5JR2A 2X09A 4PT6A 3P1IA 2W1WA 1JU4A 5CZKA 3WSOA 3NNGA 2J22A 4A41A 4LHSA 4QPWA 4W4ZA 4A3ZA 1RYYA 4UI9L 2WYSA 3A22A 3LEGA 1GOFA 3I3EA 3OEBA 4OYUA 2E26A 4M4PA 1DLCA 3MUY1 3UETA 1CZSA 3HEIA 3GGLA 2QQNA 2V4VA 3WNOA 4CU8A 3SEPA 1T2XA 4ZZ8A 3THCA 2W1QA 4W8JA 3CIHA 5HXMA 4HG6B 2WO1A 4DUWA 3WF0A 4JKKA 1O59A 3HNBM 4QB2A 3LQCA 5FUIA 4TTGA 4QDSA 3I3BA 2QQMA 2CDPA 1GUIA 2Y6HA 3BGAA 5CYYA 3UNPA 3PUIA 2VO5A 4CVUA 3DYMA 2VMDA 3NJXA 2VMEA 2Y6KA 3VDBA 2R7EB 1JZ2A 3ACFA 3LE0A 3WF2A 2W9XA 3C8XA 4QX0A 3THDA 4MGQA 2VZVA 5IFPA 3VD3A 1UMIA 2J7MA 4CU6A 1NAEA 4OMCA 3LPFA 3NRUA 2ORXA 2XOMA 4QB6A 2X10A 4YPJA 2W94A 2QQLA 4JX0A 3T08A 2ZXQA 4UOJA 5LA1A 1JYNA 3VDCA 2ZEYA 4KWUA 2WN3A 3MV11 3ZM8A 4P5YA 4CUAA 4W50A 2BERA 1XNAA 1UXXX 5EIYB 3ACGA 1F4HA 3T0BA 3ABZA 4KI5M 3HOBA 3CKHA 5J1XA 1EUTA 1UZ0A 3CDZB 4FI9A 4CUBA 4JKMA 4QDQA 1I5PA 2J1TA 2YG0A 2Z4FA 2Y8KA 5IHRA 2VZ3A 3IAPA 3SEEA 3OB8A 1H6YA 3E1F1 4DXRA 4ZZ5A 2JKXA 3DYOA 4DUVA 1H6XA 1CZVA 2VTFA 2VZRA 3OGRA 2EIEA 4BK4A 1WKYA 4XUQA 2V5DA 4MGSA 2VZUA 4QX2A 3CMGA 3DYPA 1W9TA 2VZPA 4XUNA 4OMDA 3W5NA 2VMCA 4XUPA 3SKVA 1JZ6A 3D3AA 2W1SA 2YFUA 3C7OA 3WNPA 3OGSA 4BXSV 2VMFA 2BGOA 3A23A 2QQIA 2WO3A 1ULOA 2E32A 1NUKA 2VCBA 3GXUA 2OKXA 1NKGA 4KMQA 4XZUG 2W1UA 3OG2A 4AG4A 4ARXA 4D8MA 5G04L 5JUVA 3FHAA 1XPWA 2Y6JA 4L0PA 3SKJE 2JE8A 3MO4A 4LQRA 3HNMA 2QQKA 2JD9A 1UY1A 1UMHA 2VZSA 1W0NA 3DECA 3K4DA 4UAPA 2RJ2A 4PF1A 1DYOA 4RYDA 1BHGA 4DUXA 2XQXA 2E31A 3IIIA 5DMYA 2Y6LA 1PMHX 1K42A 2HLEA 1GOHA 1YQ2A 2VZTA 2WAOA 1PMJX 2VCAA 3EYPA 4LKSA 5A1AA 2W95A 3LEIA 2X05A 3J7HA 3K75B 3VD5A 1GOGA 1OD3A 2C9KA 2LS6A 3BN6A 5C7GA 3T0DA 2WAAA 3I2GA 2JDAA 5JXHA 3HNYM 2XONA 3VD4A 3LPGA 4AAXA 2WO2A 4MOAA 3WEZA 1JI6A 4QB1A 5IJRA 1MPXA 4OUEA 1SG3A 1UWWA 3I2IA 3P6BA 1UY3A 2VM9A 2VZ1A 3I2HA 3I2FA 2ZEXA 1UXZA 2WABA 3FL7A 1K45A 5DPNA 1GQPA 1JU3A 5F7UA 3C7EA 2J1AA 3WNNA 1KGYA 1JYWA 4Z2AA 3C7GA 2BGPA 4A42A 1OT5A 2W87A 2BZDA 4CUCA 3HPNA 2VQTA 5IYYA 3WNMA 3WNKA 4P02B 3VD7A 1JYXA 1O8SA 1ULPA 2VJXA 1SHWB 4ZXEA 3NJVA 5C71A 1K12A 1NX9A 2J1RA 1JZ3A 1L7QA 4QAWA 4JKLA 2J1EA 1UYYA 3WF3A 1K3IA 4E8CA 3WQBA 2W92A 3VDAA 5DQ0A 4GWJA 2VQUA 5G05L 1UYXA 4MADA 3EB7A 3U37A 5IFTA 2VC9A 3CZJA 1US3A 1J83A 2WBKA 2J1VA 2XHNA 2ORZA 2KD7A 1UX7A 1R64A 3ETPA 1OF4A 4LPLA 4ZY9A 5JMOA 2HYXA 5JXIA 4D0QA 3C7FA 3K4AA 3C7HA 4RN5A 2J1SA 1HN1A 2E33A 3PUHA 4QDRA 2EIDA 3K46A 2ID4A 1TG7A 3W5MA 5B4NA 5JXJA 2VZQA 1DP0A 5C70A 1J84A 4GZ9A 2BBAA 1CX1A 2Y6GA 1PX4A 3OBAA 3I2JA 3CZUA 4DEVA 2C4XA 3T09A 1GU3A 4XVHA 1CZTA 3WF1A 4JHZA 3T2PA 1JZ7A 1W8OA 3I3DA 3ACHA 5I0DA 1JZ4A 1US2A 4BJ0A 4P00B 1L7RA 4A44A 3ECQA 2C26A 3AC0A 4MO3M 3HN3A 4E8DA 2V72A 3LEKA 1XC6A 3GDBA 4A45A 4A6OA 5JXGA 2VOTA 3IB3A 2YFZA 4OZOA 4ARYA 2RV9A 2LW8A 1JYVA 4TXWA 3IDAA 3A7QA 1P8JA 2VZOA 2WZEA 2W5FA 3T2QA 2DDUA 2YB7A 3F2ZA 4ET7A 5HPOA 2PQSA 3VD9A 5LA0A 3GM8A 4XUOA 3FN9A 2WN2A 5LCWL 1IQDC 1WCQA 3WF4A 2WUHA 2WQ8A 2DCKA 2VL4A 2B9VA 4XURA 4QX1A 1OH4A 1JHJA 1W8NA 2WDBA 1PX3A 1F4AA 1UY4A 2QQJA 3ACIA 1TVGA 2VCCA 1CIYA 4CU9A 4IUGA 3JXSA 4DEQA 4CU7A 2EIBA 2ZEZA 1O8PA 2B4KA 2W3JA 3A21A 4GWIA 3T2OA 3T0AA 4DXTA 3K77A 5B4XA 4BDVB 1EUUA 2J1UA 2QBXA 2ZEWA 1SDDB 3I97A 3MV01 4BK5A 1W99A 2VR4A 3UESA 1LNSA
chains in the Genus database with same CATH superfamily
1COV2 2B7YA 2YV8A 4Y22B 3WNLA 4NROA 3I2KA 5E1RA 1B35B 1O4ZA 1K5MA 2D44A 3GZUC 4QKFA 4EV0A 4FP3A 4M0HA 5BNOB 5BNPB 2VD7A 3KCXA 3JBG1 5C6CA 3NO8A 4JGZA 5CADA 4NIHA 4LKDA 1AR91 1W39A 5EXOA 3WUCA 1BXHA 3OGVA 4A4AA 4J25A 2WKKA 2R0HA 4QQOA 4Q0UA 4Y26A 3WXPA 1ZA7A 4I02A 1AR63 4N8MA 2JDUA 1VBE2 4OHVA 2R16A 3D4KA 5IVEA 1GZWA 4COZA 2WA3A 2CWSA 1OF3A 3K4ZA 4HETA 4OHWA 5A6XA 3DL3A 4CDQB 1GNYA 1DIWA 3WUDA 4XJAA 5D8AA 5BNQA 1SLIA 5J3UA 1AR61 1ODNA 2R062 1UZYA 1W6OB 4IV1B 2YBPA 4Q1RA 5K7PA 4UW5A 2BYVE 4NJ4A 1FAYA 1ZZCA 2W1WA 1Q43A 2ZHNA 5C5UA 3NNGA 1PIV2 1NQDA 1S2KA 2IXHA 4FPLA 5KXBA 3WVJA 1X33A 4QPWA 5LA9A 1W2TA 5FUNA 3THTA 1LAJA 1DBNA 3O12A 2EAKA 4QT6A 2VXJA 4UI9L 1UF2C 2X5IB 3ZN5A 2JDPA 1GOFA 3I3EA 1W0OA 1CJPA 2YGLA 3N7MA 4IE7A 1WCUA 3UV9A 2WO7A 4KBBA 1YFWA 3CJIC 1MZ5A 1X9TA 1CZSA 2AREA 3GGLA 1ZVFA 4XHXA 3ST7A 5DZGA 5A7OA 1U12A 1YWKA 3WNOA 1S2BA 3AXEA 2BEOA 5FYTA 4J6GA 3IDBB 4NPMA 4OUSA 3H8OA 1JYTA 2ZAHA 3THCA 1I9RA 4QQLA 5APAA 1K5JA 1OLRA 1GYKA 3V56A 2FDHA 3M3EA 1RTVA 3WG3A 3VBRC 3JZVA 3FZ3A 5FDBA 2X5IC 4BISA 1E5RA 3HNBM 4QB2A 3MFAA 4MLOA 4LLOA 3S30A 3NSTA 5A3OA 4AFAA 4I0AA 3I3BA 3R4DB 2PHWA 2NMOA 2Y38A 5DAWA 5F5CA 1YI9A 1FNYA 4NMIA 4D6RA 1LOBA 1M4WA 3A0NA 3ILFA 4NHMA 5GLVA 4BA6A 1G9AA 4RGAA 2NQYA 1H8VA 4KWKA 3HQRA 1W8FA 1VPHA 3K3OA 4KGQA 4WVMB 3V0BB 3WX5A 1IPJA 1DYKA 3TB0A 2MPFA 4P9IA 5FZEA 3RG0A 3VDBA 2ZMKA 1C5IA 4N9HA 3ZYBA 4QX5A 4OQ8A 1DZTA 2I45A 5FZFA 4HZFA 5DDJ2 3WDXA 2W9XA 3O1PA 2NN8A 1REEA 3QH6A 5F3CA 3NNJA 4W6XA 3ZXDA 1V9U2 2ZA9A 2XUMA 5IFPA 2XLGA 1W6PB 1W8HA 3QACA 4IQPA 5FZMA 4D7YA 1PGL2 4A7YA 1VP6A 5FLIA 4GMP3 1N3OA 1FV3A 4OMCA 3RWKX 2A3XA 5JWPA 2WZPP 1FV2A 2XOMA 4QB6A 1IKQA 1OLMA 4COVA 5FZLA 3OCPA 4O65A 1W6QB 1UIKA 4ASMB 2XBO2 3WZ1A 2WZR2 2YU1A 4GMP1 3RNSA 3ZDSA 3NKGA 5LA1A 1YFYA 3LZZA 1VLNA 2PLV3 4CRQA 4O61A 3AMQA 4I3GA 4KWUA 2YXSA 2FZ2A 1ZRDA 4K6BA 3WP6A 3OY8B 1EYBA 4FFIA 2PTMA 4DRRA 2JDNA 1AYN3 4HKLA 4P5YA 2BNOA 3B9IA 4W50A 1OD5A 4GAZA 3MLLA 1XNAA 1CN1A 3GBFA 4DIQA 4COUA 3O1TA 1OOPB 1FT9A 2K0GA 2PLV1 1H1MA 3M3IA 5KXCA 3ZYIB 1ULDA 5LWBA 1MVEA 1AYN1 1OPMA 2QJVA 4EYUA 5BXXA 4Y5TA 4Z8BA 1QU0A 1H9WA 4XAEA 2WLQA 4PIZA 5KXDA 3VN4A 1V0AA 4JKMA 2HWB3 4QDQA 2J1TA 4URTA 1S0CA 5L7OB 4KU7A 1W6OA 5LY1A 4MYEA 3O0WA 3CF6E 4N53B 4PIXA 5FK8A 1IPKA 5FAXA 2ZGQA 3OUIA 4UFJA 3OB8A 1H6YA 3I2OA 4MX3A 3EO6A 5IT6A 4R9BA 3VBRA 1AR72 3DYOA 4YM3A 5H9QA 1SCRA 3NV3A 4EWEA 2X5IA 1H1IA 3OGRA 2EIEA 5H9SA 4BK4A 1J58A 5LW9A 3RZHA 1NCQB 3VZKA 1HKDA 1YJKA 2Y0OA 2ZGMA 5F3IA 4EJRA 3KB5A 5A32B 1I1EA 1VJ2A 2CGPA 2VZUA 4MXWB 4Q4Y3 5LBCA 4XXPA 1NQJA 2BOIA 1U5ZA 2JENA 1Y9GA 4FPFA 4XUNA 4CUGA 5KR7A 3MDPA 5FY4A 2QZ2A 5FY5A 5FFOC 2RMU2 3H7YA 3I59B 3J8F1 3QCWA 1JZ6A 3D3AA 4TLGA 1EPZA 1IS6A 2PFWA 3KV9A 2YFUA 2AH2A 2VMFA 1J3PA 1VBC2 2BGOA 3ZIXA 2TEPA 5ABJB 3GHMA 2YU2A 2PHLA 4Q4V2 2DU0A 1PGSA 2QQIA 1C8NA 1QJY3 1WUVA 3KV4A 3VBHB 5L9VA 2RDQA 4FQZA 4S2DA 2VCBA 3E6BA 1O3SA 2DV9A 4XOGA 1URXA 2GP3A 1G9DA 4G3YC 4IEQA 4AG4A 4Y1YA 5JZGB 1JOPA 2AGSA 4FQ4A 4GB33 3D5OA 4IEPA 1C8M3 1LULA 1I3HA 4AHXA 4XF1A 5FY8A 1FOD2 1YQ5A 4QU2A 2OW4A 3J8F2 3C3VA 4KWLA 2Y6JA 2ZHMA 1H2LA 1CVNA 4IE6A 4Q0VA 5IW0A 2GP5A 4WVMA 2Y60A 3V0BA 1HB2A 2Y6FA 4IGPA 2CHHA 2JD9A 2YUEA 3N9MA 4GB31 3ZXKA 2ZABA 1C8M1 1UY1A 3K2OA 2VZSA 4UAPA 1SLAA 3DECA 3VBHC 2VPVA 2FDIA 1AL22 2RJ2A 3B93A 2ILMA 1DYOA 4FPCA 4RYDA 4Q5OA 5LEJA 3ORJA 1GP6A 5M0TA 2E31A 4C8DA 1W6PA 4CSWA 3IM0A 5JZGC 5C8CC 4ZU7A 3N9LA 5ACA2 1K42A 4RGGA 3PUAA 2MEV3 2HLEA 3WW1A 3UYJA 2BFUS 3NNFA 3KT7A 2OUHA 4IETA 4D7TA 1PMJX 4YW6A 2A1XA 2WSUA 3N3HA 1RUD2 1JOBA 3ZOIA 1ZZ7A 1GR3A 4LKFA 5FZOB 1ULFA 4LBMA 5EYYA 1GOGA 2LS6A 3FFZA 4QXHA 2MEV1 3WHTA 5I8YA 2GMMA 2WAAA 1DG6A 1XOYA 2RS53 3M3OA 3DF0A 1N1YA 4H2AA 2BJSA 2HWE2 5JXHA 1AXYA 4N7UA 5LK5A 4N43C 5FYVA 2WFF1 1UQXA 4UFKA 3OY8A 4NN0A 3U75A 4CCOA 4LOSA 5FPZA 4C91A 5GJ6A 1ACCA 4QB1A 2K9ZA 1POV0 5IJRA 5FOJB 1W8UA 1MPXA 2D6LX 2RS51 4HK8A 3PIJA 3ZR6A 4FFGA 5KC6A 1SG3A 3I2IA 5KHIA 1NZCA 5DAVA 4NAMA 1N1SA 2VQAA 5IVBA 2JIJA 1HJFA 3LIGA 4ATEA 4CEYC 4Z2WA 3PVBB 3WDYA 1ZREA 3POFA 2D6MA 1AVBA 1YIFA 2WABA 3EJKA 3FL7A 4LMFA 5CAZA 2E9QA 4A7KA 3ILRA 3RYKA 1JU3A 4Y3OA 1YXWA 4RA0A 3WNNA 4N53A 5J36A 1EAH3 1JYWA 3QH7A 1FI2A 2WFF2 4CP9B 4Z2AA 1J3QA 1JMUB 5F5IA 2A6ZA 4P9JA 2W87A 3ZXFA 5FP8A 2BZDA 3KZ4C 2P5BA 4QHOA 4IV3C 2QTWB 3BU7A 3H9AA 4LA2A 3ZSEA 5IYYA 1D2SA 1YNAA 1NCQA 5A7PA 5T54A 3VD7A 2VW2A 3QLQA 1W9FA 3ZFFB 1ZBA2 4EWAA 4L8QA 5A32A 2YMZA 2WNEA 2A3YA 3AMPA 2EXKA 3L2HA 4MXWA 5FBZA 1K12A 5EFUA 4BZ4A 5C71A 5IK7A 1L7QA 4WM8C 1SPPB 5JPNB 5L9BA 4WZCA 5FQ0B 3I59A 1HQLA 3AFGA 3H3LA 4YGCA 1IS5A 3NAPC 1EY2A 1PMIA 2D40A 4HVOA 5FZAA 1Y7BA 2DVDA 2W92A 3VDAA 3V0AA 4C0BA 2FZ1A 1U0AA 1ND3C 2VQUA 2ZMNA 3GJAA 1UYXA 3WQ1A 2R073 3EB7A 4IEWA 5IFTA 5FXZA 3UT0A 4OCTA 4CDXC 3VBHA 2PXJA 3ENRA 1US3A 5A3UA 2HWF1 1CAWB 4HMZA 5GLZA 1XYPA 1AR83 2KD7A 1JYCA 1R64A 1UX7A 1OF4A 1LOEA 5E16A 3BOWA 5L73A 4NIGA 4QMAA 5JZGA 1KXGA 2R071 2G9FA 2VU9A 1CONA 1LECA 1HN1A 2J1SA 4IL7A 3AMMA 4RHV3 5BY5A 1PVC3 3S7IA 1PVXA 4YW7A 1AR81 1MEC3 1PZ9A 1ZBE2 2ET1A 2AENA 4HT1T 4O7XA 2B9UA 1TG7A 5KHGA 5CKNA 1F5FA 3OPZA 1YFXA 4S2FA 4W6WA 3ETQA 3VKLA 4RHV1 1OA2A 3J7LA 1PVC1 4OI4A 1CX1A 1H2MA 2VOXA 2QQUA 4AGGA 1PX4A 1OURA 4QD2A 4COWA 1LODA 3IZOA 1LESA 3CZUA 4DEVA 4CEWB 5GZEA 1GLHA 1RINA 4JHZA 1G6NA 3VL9A 1ZRRA 4EQVA 4K1ZA 4AGVA 3MW2A 4A3XA 5CISA 1GZ9A 4XEZA 4BYYA 1RUF3 4CE8A 1JZ4A 2P6HA 5K0UB 2VECA 4XFCA 1SEFA 3LA3A 1Q8OA 3SXWA 4BQXA 1EV13 2WWSA 4LIVA 4AEKA 5JOZA 5EP9A 3IWZA 4KWJA 5CBLA 2ZX1A 3BIEA 2CWMA 4AVVA 1POQA 1JH5A 1RUF1 3GZAA 4LNVA 2IXKA 4P5HA 1XU2A 3HN3A 5I0SA 2PELA 2H0VA 5B2GB 2JG9B 1EV11 5I8SA 5F3GA 4A6OA 1KITA 5JXGA 1PO13 2WL1A 5A3NA 2I2SA 4DY3A 2YPDA 2RV9A 2DYCA 4CEWC 1ENRA 1EPWA 1SLTA 2NPIA 2UU8A 2VMIA 5FP9A 1DGWX 1T6GC 2RM22 5A80A 3RRDA 3WDVA 5I8TA 1VBD2 4FAHA 4HOOA 1UOFA 3O0VA 3A7QA 5LRRA 5K0UC 4UT5A 3U4XA 1PO11 5EHDA 3T2QA 3AP9A 2VVFA 1QJX3 5BPXA 3W59A 4ET7A 4WM8A 4H7MA 2ZGTA 2ZACA 1NG0A 4AEMA 2XHKA 2GC1A 3OBRA 1AYM3 3FN9A 4CA9A 1O4YA 1RJ7A 4UYBA 4CCEA 3VHPA 2OYZA 1RUG2 2CAUA 4XDOA 1V00A 4FT8A 1WCQA 1RUOA 5FP4A 2GMPA 2JG9C 2H6CA 2IWGB 1BLZA 1ND3A 2VL4A 4IEVA 4RR3C 4YG3A 1WMXA 1VAKA 4CP9A 4QX1A 4AVAA 2JB8A 1OH4A 4HSJA 3POEA 5FMCA 4CDXA 1AYM1 2WDBA 2BVVA 1G9FA 5F5QA 5J98B 3ZKUA 4ZHNA 3D82A 1W2OA 3RPQA 3ZFFA 1AJKA 5FMBA 3U78A 1J3RA 3HBKA 1CIYA 4DEQA 4CU7A 3ZN4A 4BQWA 2D97A 3VKNA 2D3PA 1RGSA 5D2AA 1RUJ2 5TSWA 1SPPA 3BIWE 4QX7A 3H3ZA 1CR7A 4XBQA 5FQ0A 2AEZA 4KGGA 5E89A 5C3SA 3H1WA 3KCCA 3K77A 1EUUA 2J1UA 2JXAA 2OQ6A 4PJYA 4XACA 2IZWA 1LTEA 4B1MA 4QGNA 2JE7A 2XUEA 3BTAA 5A7SA 3VBUC 2UY9A 1SDDB 2ATFA 3HMYA 1OKOA 3RZKA 3MV01 5K8SA 3BYWA 2Q4SA 2XR4A 4OQ9A 3MIDA 3ZR5A 2WT0A 1UU6A 3ON7A 3NV1A 1XNCA 4DXSA 5FZKA 1BCXA 1PNGA 3VBOB 1VALA 1RUE2 5LBFA 2QQOA 3U11A 4EWDA 2W47A 1GFF2 1W0PA 2JDMA 4D6QA 4META 3EBRA 3FHQA 4ATFA 5IK8A 4DQAA 3KF5A 3UJQA 5A3TA 4XUTA 2WZ8A 3C2UA 5DAQA 2VTXA 3FE5A 1R093 4P08A 1YQCA 5C3PA 1V6JA 1ZA4A 1OC1A 1UY0A 1W9SA 4N7IA 3D6EA 3CHXA 3ZYRA 2JG8C 2L9LA 3M8LA 4YVWC 5FP3A 4AFBA 1DQ6A 4BQ4A 1S1AA 2HWC1 5LZ6A 3ZSLA 1R091 4M3CB 1ENSA 1WGPA 4DNYA 2YHJA 4OULA 1TEIA 1S55A 2RJLA 4CEWA 3VBOC 3CQOA 2NMNA 4UF0B 4UFHA 3WG4A 1BMV2 3KQ4B 2YC4A 2ZGNA 4Y1ZA 4IESA 4R9CA 3FLRA 1F5JA 3D0SA 5K0UA 3WSOA 1HW5A 2J22A 3T30A 1J1TA 4MV2A 4U36A 5A7QA 3TNQA 4W4ZA 3AJYA 1OUSA 4JCKA 1SFYA 3DEMA 3OYWA 3A22A 1D4M2 5FTTC 2N7GA 3RS6A 1YCIA 4NIDA 4LO6B 3P5BA 1UYPA 1ZZBA 4JTOA 2VUJA 1D4VB 1KS5A 2F4LA 1OFNA 1RXFA 1X9PA 2EXHA 5CA6A 4QQ2A 2HEYF 3UETA 4W6YA 4OHYA 1TME3 2JG9A 3HEIA 3Q8BA 4JGZC 4X6RB 1CD3G 2XJQA 1ZZ8A 4C90A 4F7ZA 2AZ5A 4PHZA 4DOUA 2BFUL 5A3WA 1CPNA 1LEDA 3ZYPA 1T2XA 3T1MA 5FO8B 1JBCA 3FWEA 4B4RA 2W1QA 2HBTA 4W8JA 4BE3A 1BVP1 1TME1 1XE0A 2WQZC 2PHFA 1D0GA 1UU5A 1ONAA 1Y43B 3CIHA 3EXUA 3OBZA 4G4FA 4NHXA 4XDPA 3UL2A 5JMCA 4HG6B 1S0FA 2WO1A 4FTBA 5F1RA 5FPVA 4FOWA 2VOWA 1NLRA 1U5IA 3WF0A 3LKJA 4JKKA 1W28A 4MUVA 4XMAA 3SNMA 4ORFA 5J96B 3PJYA 4EROA 3VBUA 1AZDA 2AYHA 2Y6HA 2WT2A 1Z78A 4C1XA 4FO9A 4CP2A 4QPIB 3B69A 4LLFA 5CYYA 5DUXA 1NXD1 5A6QA 3UNPA 2WNUC 1ULGA 2VO5A 5FYMA 2ZGLA 1XQNA 4FPJA 3DYMA 1YQ6A 2NM1A 4QXKA 3POWA 3MLJA 5FZ9A 3RSJA 4AHYA 1NZIA 1ZX5A 3ZFGC 2VMEA 1COV3 1CGPA 5CG8A 2D3RA 3DV8A 4OUMA 3MW3A 3ES4A 1JZ2A 3LE0A 1LOFC 3K51A 2Y26A 3C8XA 4QX0A 5FXWA 2ZX0A 4XTMA 5D21A 5AC91 1PM4A 2VZVA 2JEMA 3I7DA 3AP6A 1COV1 3KLSA 2JDZA 2WS92 3TN93 4KNCA 2YZ4A 3KT4A 4CU6A 1NAEA 3LPFA 3N4MA 4XYXA 2JG8A 1OQDA 1ND2B 1VBE3 3OSDA 5L36A 2D98A 1GP4A 1GICA 2W94A 1HRI2 2JDKA 2QQLA 3T08A 1HLCA 3VBOA 2VW1A 3E6DA 4ASKA 1LOCA 4Q0PA 5FZ3A 3TYJA 2XJPA 5GLWA 2R063 1RUC2 2R32A 1DQ0A 1QJEA 1VBE1 4XILA 1Q8PA 5HV4A 3RZGA 4Q4W2 1AX2A 4I01A 3Q9OA 2ZBJA 1X8EA 4D7SA 5BUVA 1PIV3 2ADEA 1R1A2 3IKWA 1AR93 1V6LA 3FC0A 3N9OA 2W52A 5T3NA 5EIYB 3MIEA 3MGUA 2CNAA 5KWRA 2RJKA 5CFDC 2R061 3RFRA 3H1MA 4LA3A 3PIGA 3ZVXA 1S0GA 3S0MA 5FPXA 2WR9A 3AZZA 2WNOA 3HOBA 5IVYA 3ZN6B 3PUQA 2BGCA 5FLHA 1PIV1 1EUTA 1UZ0A 3CDZB 2Q30A 4FI9A 2FCVA 4M3CA 5FZIA 5EJ3A 4I2OA 4ZS2A 2GALA 3FUOA 2XL9A 4YSFA 2CU5A 3H1YA 4P9XA 4UF0A 2O8OA 4QXBA 2AC1A 1W6MB 5I93A 2YG0A 1ENQA 2Z4FA 3ASIA 1UNBA 2Y8KA 3MPBA 5T5PA 2C6SA 5IHRA 3TAYA 1MACA 1RUNA 1GQGA 3AZVA 3SEEA 5J7MA 2I74A 2HWD2 1TMF2 2VUCA 4NRMA 1RHI2 2XKOA 4HKWA 4DUVA 1H6XA 1CZVA 4DINB 1F2NA 2VZRA 5GZGA 1KJLA 3KQRA 4XUQA 2V5DA 4LR4A 5C33A 1WMEA 4LBNA 5F2WA 4ASLA 1RC6A 3NMBA 1XYOA 4GULA 1B35C 1ULCA 3H50A 4QX2A 1Q8QA 5A33A 3DYPA 1W9TA 5BNOC 5BNPC 4K20A 3LDKA 5JAXA 4OMDA 1DGRN 1Q8VA 2DCZA 4NVPA 3W5NA 3USUB 3BODA 2FQPA 2OZJA 4CYDA 3TEXA 2OA2A 2W1SA 2WNUA 3C7OA 4LBQD 3T4HB 4BXSV 3E97A 3LSEA 3O5SA 3Q8AA 3S5AA 3ZFGA 5LK7B 1W6NB 3WOGA 1C1FA 4HL0A 3JB8A 4NWWA 4M01A 1LOFA 1QXRA 4I30A 4CDQC 3CEWA 2GC0A 1HDKA 1QH6A 1UL9A 5DDJ3 2UURA 5F5AA 2ZCWA 1NKGA 4A7ZA 4NRQA 2W1UA 4ARXA 4MVTA 4IV1C 3CO2A 1VE0A 2F6BA 1PGW2 1V9U3 1YJLA 2HEWF 2NLRA 1O4TA 4E27A 1OXCA 5JUVA 5C5TA 4JDOA 4OZXA 5DDJ1 1SZBA 5FMOS 1XPWA 3VB9A 4Y1VA 2KXLA 4ZU5A 2VUAA 3HNMA 2QQKA 3WP5A 1V9U1 1GSLA 1R082 1RXGA 2XBO3 2Y34A 1C3HA 4E4ZA 1XYNA 1D0HA 1PGL1 3ZIWA 1UMHA 5F2SA 3ZYJB 2OZ6A 4D94A 2Q8OA 4QPYA 5FOBB 2YC0A 3DXUA 2QZ3A 1UOGA 1W05A 4K9SA 1RVF2 4K40A 2VH9A 2XBO1 2ZGUA 3RZJA 1FMD2 2WZR1 2Y6LA 4M0NA 1IKPA 2GZWA 5CFDA 5FYZA 1GOHA 1YQ2A 1W3XA 3MZHA 2WAOA 4YM2A 5FYCA 1NA1B 3CNAA 2W95A 1XNDA 3LEIA 2WFPA 4NUBA 4QM8A 3IT8A 1SFPA 5T5OA 3AZYA 5IVVA 2Z5WA 4LULA 2VG9A 5A3PA 3K75B 1Q5OA 2C9KA 1OQEA 2R042 4K8FA 4KU8A 3T0DA 3I2GA 1JUHA 1KRIA 1A3KA 4AW7A 3BU0A 2PQQA 4Q8KA 2B46X 5A3LA 3T2TA 3WEZA 3I49A 4JGYB 3ZYGA 3N7LA 1RMU2 5IVFA 1MZFA 2DBNA 3N7KA 4Y22A 4CCNA 3MIHA 5A1FA 1SLLA 5FCCA 4GKXA 4BH9A 1B35A 1FXZA 3P6BA 3ZN6A 1LGCA 5BNOA 3HD8B 5BNPA 2QKDA 5A7WB 1NA1C 1QKQA 2JECA 4OLLA 3I2HA 4ZU4A 3I2FA 5FRAA 2ZEXA 4AI2A 2CGOA 1V6OA 2YYOA 2VNGA 4AI0A 3PVEA 1AR71 1K45A 1QNYA 2WRAA 4R9DA 4BIFA 5JIUA 1W6MA 2RMU3 3C7EA 4QHBA 3ZYHA 2PHTA 4MG2A 2JDHA 3HVDA 1LHOA 1VBC3 4GH4B 2ZGSA 2BGPA 4FTEA 2YBKA 2RR12 4Q4V3 2HEVF 4CDQA 4JGYC 3BALA 2IUWA 1OLQA 3HPNA 3OBTA 3QD6A 4WBBA 1OBNA 1RUI2 4IGQA 5FP7A 4XF9A 2RMU1 5FZ4A 5CFCB 2GAUA 2VY0A 1UOJA 2A75A 4P02B 5DABA 4YW5A 3VBFB 3WNKA 1JYXA 1O8SA 2VJXA 1CAXB 2OS2A 1SHWB 4IV1A 1VBC1 4W65A 3NJVA 4B4PA 1UO9A 1W06A 4Q4V1 1CESA 1GBGA 3FFQA 1JZ3A 2ZKNA 3PDQA 4JKLA 3USUA 4LHLA 4D6SA 3AP5A 5D1IA 5JI9A 3N36A 1FOD3 3U14A 2C9AA 4BXFA 1OOPC 3J8F3 3WQBA 4PLMA 2WLPA 4MSVA 4Q26A 4GWJA 1YQ8A 2ARAA 1MR5A 2GDFA 4IDZA 5FJHA 5G05L 1O3RA 1QH7A 1GQHA 4MADA 1LEMA 1L3JA 4K3UA 5FK7A 3K3NA 4FTSA 1VIWB 2VC9A 4MGIE 4UFIA 1FOD1 2ZHLA 3OD4A 4YW1A 3RMYA 1AL23 2RS12 2VBPA 4IXLA 4LPLA 3URFA 1BVVA 1DGWA 2HYXA 5L7OC 4YGBA 4N53C 2ZAAA 2P3JA 3K4AA 3O1VA 2EA7A 4RN5A 1IG0A 2E6VA 4QDRA 3AX4A 5ACA3 3UGHA 2QDNA 1F8VA 3TNPB 1AL21 2HKXA 3HWJA 5I0TA 1QNWA 4C1WA 4XF0A 3W5MA 1QJU2 5CB7A 4JV4A 2VZQA 1NCQC 2ET7A 2W0XA 4WVVA 1W9YA 3ZXJA 4ISRA 3PNAA 1DP0A 4PDWB 2BBAA 2OT7A 5ACA1 1YC61 2P3KA 2GU9A 3SHRA 3OBAA 5A3MA 3WY6A 1TZOA 2HWE3 4OI1A 3ME2A 2C4XA 3TRSB 2ZGKA 5E6HA 4P14A 1RUD1 2UWAA 1UCXA 4HPKB 1W8OA 1OLME 2D6OX 4LO5B 1Q56A 2LUWA 2WNVB 2FDGA 5ABJC 4GXLA 3MW4A 5T52A 2EALA 4R4XA 1XNKA 2YROA 2HWE1 4DB5A 4QM9A 1NA1A 1ENXA 5ANQA 3FLTA 4XBLA 3RMXA 1UZVA 1WW6A 1Q8SA 3AL6A 5CIRA 3B3QE 1NOVA 2ZMLA 4PDWC 3GDBA 4Y1XA 1W8ZA 2A6XA 1IHMA 3OF1A 4AOCA 1RB8G 4Q8LA 2Q8CA 3ZXGA 4Q4Y2 4C0HA 5GLUA 1JYVA 2WFF3 4JGYA 4KQ7A 1W6QA 2ZZJA 4NE9A 4L9BA 4M00A 5AVPA 1W8TA 3SH5A 3GALA 1FPN2 3GYDA 5K4LA 1LJ7A 3RQ0A 2VZOA 5DXDA 1LU1A 1N1VA 1PO22 3ALQA 4Z92B 1QDOA 1ZBA3 4NWVA 4CDWB 5A7WA 2VBDA 4X8PA 1Z7S2 3FMGA 2B5HA 2PQSA 2XVKA 4EN6B 3VD9A 5LA0A 1QJY2 2BVBA 4XUOA 4DPNA 4YZ2A 4FOQA 1UZWA 3AVSA 1WLWA 1OOPA 5CVRA 4BMBA 4EN8B 1QOTA 3WF4A 2WQ8A 2DCKA 1ZBA1 2D7FA 2Z2SB 3IMNA 1JHJA 5JSRA 4NIAA 5JDBA 4PIYA 1PX3A 1F4AA 4XFBA 1UY4A 2QQJA 2WT1A 1FX5A 3I3QA 5A1LA 3VUOA 3VBFA 3VLBB 5L7OA 3JXSA 1CAXA 1G86A 1LCLA 1UU4A 3E5QA 3VGIA 2CTVA 1A6CA 3LCPA 2BBVA 1N47A 1PHMA 3VKOA 2BUKA 1QIQA 3A21A 3T2OA 2Q5TA 1T6BX 4DXTA 5B4XA 2EXJA 3MPPG 5IK4A 1RUH2 1ZBE3 4LITA 5J09A 5FYIA 1MQTB 1N3QA 4XC9A 5HV0A 3RI8A 2B8MA 3M7AA 5JSPA 2W2IA 2VR4A 1KDKA 2BP6A 3UESA 2BNNA 4GJYA 4L11A 4CXXA 5FZBA 3O1UA 1VBB2 1PM7A 5EWSA 1S0EA 4B7EA 5BV6A 3BTZA 2P34A 3NQHA 4MGKE 5DN2A 4DRVA 3RZZA 1GMMA 1ZBE1 3IBMA 1S2EA 4KG0A 1W9WA 2HWF3 2XKPA 1VBA2 4YNIA 1DU3D 1ASJ2 3IAQA 1KEXA 5A6YA 3ACLA 3H8UA 4K21A 5ABJA 2H0BA 2ZGOA 3BPSA 5F6LB 3DCQA 2IVIB 1XBFA 2F17A 4IEXA 5C9AB 1O3TA 2NP0A 3JCIA 2YC2A 3M3CA 5EJZB 4JDMA 3ZFFC 1PK6B 4UFLA 4WVZA 4V1PA 4QKBA 4PDWA 3I3MA 4P9LA 1JZ8A 3OEAA 1NCRB 4NAOA 4YVSB 2R0FA 1JZ5A 1UY2A 4QKNA 2CDOA 4QGLA 2JB4A 3AYAA 5LA2A 4CUCA 3KWVA 3B00A 4UW6A 4CXYA 2W91A 4XW3A 2IC1A 1DQ2A 4HPKA 4AQSA 2DCJA 5FMOL 4O9GA 3LFIA 1D7PM 4CP1A 2JDYA 5JR2A 5AVAA 3P1IA 4YM0A 2XDVA 5CZKA 5EPAA 2Z79A 4Q29A 2W68A 5EYXA 1VBD3 3ZDVA 3ROUA 4BIOA 3M3QA 4XFAA 5FY0A 4XMIA 4FAGA 4BLJA 4A3ZA 3AZWA 1EAH2 2WYSA 2UYBA 1ALYA 3J7MA 3LEGA 5E8AA 5JIAA 1JW6A 4YYOA 5AC93 2QQPA 5FY7A 2OQ7A 2XLFA 3OEBA 4OYUA 1X82A 2E26A 3AMNA 3H0OA 4M4PA 2DBIA 2GC2A 5FYHA 5AFBA 2RM21 5FXVA 3BPZA 2G9GA 1VBD1 3MUY1 1FATA 2IXLA 4YVSC 1NCRC 1RUG3 2E7AA 2QQNA 1CQ9A 3ATGA 4MXVA 1GANA 3AKSA 4R8HA 4PQ9A 4KL1A 3DPRB 5J37A 1JYIA 4CU8A 4FPOB 2XG3A 3FX3A 3VZMA 1H8TB 2QCSB 5FZOA 1KFXL 3PTRB 1VRH2 3MFCA 2X8KA 1RUG1 3R05A 2EIGA 3OUJA 3RI9A 2KM2A 2FBEA 1OUXA 1UOBA 2FMDA 3KV5A 2PHXA 2ZGRA 3RWNA 1H2NA 3JB4C 3WG1A 3VDDB 1UKGA 4CDWA 3RGBA 2V73A 3B02A 1HB4A 3R4SA 4LO4B 3MI8A 1O59A 1F35A 2R49A 1RUJ3 1LRHA 3HN1A 3LQCA 3SCGA 3VZOA 1ZRIA 3KCYA 1PNFA 5FO9B 4TTGA 4K1YA 4M3CF 2QQMA 2K46A 1GUIA 2G9ZA 2FCTA 1OMIA 3M70A 4MZUA 1RUJ1 2RS32 4P9YA 3PUIA 1HN0A 4CVUA 3GZTB 2DUPA 1H8TC 4CPBA 4BQYA 3JD72 1BYHA 1MEC2 4NO4A 5HCBA 4JRAA 4WVWA 5DG2A 4KH9A 3VDDC 3I8TA 4GWNA 1HRV2 2IFRA 2ETEA 3THDA 1AJOA 2BTVC 5C3RA 5L9RA 4HANA 4V2VA 1IG3A 1UMIA 2RG4A 1RUE1 1NE4A 3N9NA 5CKQA 3WQ7A 3WCRA 4S2GA 3M1HA 5FY9A 2A73B 4L97A 2Q1MA 5FZ1A 2VVEA 1DYPA 1YRZA 5GKAC 3WDUA 2VW0A 1L7LA 3IPVB 5F6KA 2FMYA 4JX0A 2ZXQA 3BTYA 4AFMA 4BQ3A 2QVSB 3VDCA 1BEV2 1LU2A 2VULA 2ZEYA 4I3PA 1MS9A 4ZKTB 5DUUA 1H4GA 2WN3A 3MV11 3LD8A 2P2KA 2LM3A 2JD4A 3D0JA 3ZM8A 2J42A 4XF4A 4LBQB 4LT5A 3D8CA 2WQ4A 5C9AA 1G9CA 1CAWA 2FDFA 5FKBA 3OTFA 4HN1A 1TNRA 1BMV1 1D4M3 3ABZA 4KI5M 4PI0A 3CKHA 4FVVA 1AX1A 5C4WB 4RGKA 3BCWA 4XAAA 1HXS2 1NCRA 2XQRA 2EVXA 4YVSA 5IUQA 1BBT2 5J1XA 4R4ZA 3BVCA 3T4VA 5HBAA 2HWC3 3I54A 1MS3A 1ZRCA 1I5PA 1D4M1 4AQTA 2DWRA 4FFHA 3LIHA 4HVRA 4CDUB 2VZ3A 4DZGA 3IAPA 1LOGA 3LA7A 4YZ5A 4DXRA 1YYNA 3E1F1 4XIOA 5FPUA 1CAUB 4YW2A 5C3OA 4DXZA 1POV3 2PN5A 5FR3A 3TEWA 4P9GA 1CWPA 2VTFA 3OUHA 4Y4YA 4AVCA 4N90A 1WKYA 3O0XA 1UW8A 3W21A 4AQ2A 4MGSA 1EP0A 2VUDA 2WC2A 4RFRB 2PHDA 2DCYA 3PTYA 3UGGA 2EXIA 3VHRA 4PBPA 1UX6A 4BLIA 4LBLA 1MS4A 1POV1 4NHYA 1UKRA 2BWAA 2VMCA 2WA4A 3SKVA 1NY72 4AVTA 3DPRA 4EE2A 5F8PA 4JC1A 4XFGA 3ZPYA 1K5MB 3OGSA 1YIPA 1H8TA 2PAEA 3HR9A 5A6ZA 1X50A 2IFWA 2CL2A 1HB3A 3QBQA 4UFMA 3S6PA 3POYA 4ZZ8A 3AZXA 2OXBA 2F4PA 3KM5A 4PF5A 5ERLA 4CTEA 3VDDA 2E32A 2VMGA 4LUKA 3Q8FA 1QOSA 5DUVA 2OKXA 4P9WA 1V6MA 3UKVA 4QKDA 4XZUG 2P4EA 3ZFEB 3V65A 4D8MA 2HJIA 4MHUA 4PCRA 5EZWA 4B29A 5KBFA 3DUIA 1ZYBA 5G04L 5D8AB 3EMRA 4IE4A 3LWCA 4NOTA 4OI2A 4L0PA 3SKJE 3E6CC 4YLZA 4EN7B 1S0BA 2E7TA 2VNOA 4LQRA 2QQWA 1JN2P 1APNA 4Q0QA 2ADDA 2XMLA 3N9QA 4I09A 2Q1ZB 1HRI3 5KHHA 1W3VA 5T5LA 4Y33A 2WS91 3KSCA 1RJ8A 2AACA 2GH2A 2IXIA 1RUC3 2IVJA 2XQXA 3NV4A 4FPEA 4Q4W3 2XPJA 5GALA 1FNZA 4NR1A 5JPMB 2A5ZA 1VRBA 1HRI1 1Q3EA 2VMHA 3ZFEC 1WLDA 4OHXA 1R1A3 2CYFA 2VVDA 2XL7A 2LROA 4XE9A 2YDEA 3MEPA 5F32A 2C0ZA 4WM7B 1TQ5A 2VCAA 3JU9A 3POBA 3EYPA 1RUC1 3HQXA 4H3WA 4LKSA 2BRTA 3H7JA 3O14A 2G4IA 3J7HA 1ZZ6A 2P37A 4Q4W1 2TNFA 4SBVA 3VBSB 4BQ5A 3IPVA 5J48A 1UIJA 4YFWA 2E51A 4F3JA 3VZJA 1OD3A 1LGBA 1R1A1 1G7YA 1DF0A 2JDAA 5BNNB 3DGTA 4BHPA 3HNYM 2XONA 1I6XA 5H9PA 4KG8A 3SQOA 4NRPA 4XETA 3WW2A 2TBVA 4MOAA 4QPIC 1SLCA 4LBQA 3BKZA 1SACA 1JI6A 1XNBA 1TMF3 1RHI3 4OUEA 4Q4X2 1WLTA 5I0UA 4ZONA 4AAPA 3HT2A 3VHNA 1UWWA 2Z42A 4HKOA 5LBEA 1SBEA 4FXGB 4WM7C 2WWJA 2QDRA 5C4WA 4E4SA 1XRUA 5HCAA 3O1RA 4JRLA 5JR7B 2AR6A 2HWD1 1A8DA 1TMF1 1G8WA 3PVOA 1RHI1 3VBSC 3ZYFA 5DZEA 1WD3A 3GJBA 5DPNA 3JQWA 2P17A 3N7JA 1UZZA 3CLPA 3ILNA 3VKMA 5F7UA 4LEJA 3AB0A 2V5YA 5BNNC 1H30A 2ZX2A 1AF9A 4AK3A 2KR2A 2ZX4A 4CDUA 4FOYA 1UPSA 3C7GA 3NVCA 3LGRA 3PU3A 4LE4A 1V6NA 4A42A 1ND2C 2HBUA 2OIIA 1MS5A 1BQPA 2VQTA 2RDNA 1Y9MA 1J1LA 3U4SA 5I0RA 5FZ6A 3WNMA 3RVHA 2V4AA 4JVAA 3WHUA 4ZXEA 1X8MA 2NYYA 1NX9A 2K2SA 2RHPA 2J1RA 3L2YA 4Y24A 1YEWA 5JLVA 4QAWA 1YI7A 5K9YA 1UD1A 1YLLA 3LFMA 2BOJA 5KC5A 2J1EA 5CKMA 4AYUA 4BCUA 2DURA 1QQP2 4Y1UA 4CCLA 1K3IA 1CX4A 4OHZA 4IEYA 2G19A 5LB6A 1WW7A 3U37A 1IQAA 1OFSA 1PGW1 2CV6A 4YW3A 1R083 1DQ5A 3TN92 1J59A 3CZJA 1J83A 1X36A 2WBKA 3FLPA 4YRDA 2XHNA 1WW4A 2QUOA 2ORZA 4YGEA 3AYDA 4JQTA 3ETPA 4XFHA 3AP7A 1WMDA 2WJSA 3CJIB 4UXAA 5JMOA 5JXIA 1WBLA 3LDRA 3ZFEA 2YGMA 1QY4A 1RVF3 1WCSA 4NIIA 3GNEA 1O7FA 1R081 2PYTA 1MS0A 3C7FA 1FMD3 1JS9A 3PUHA 3B01A 2QQVA 1D2QA 2PHUA 3R0RA 1S0JA 4MGZE 2EIDA 3K46A 4XQ4A 5IAXA 5FO7B 2YPJA 3LA2A 4XHBA 5KHKA 3PLQA 5JXJA 1RVF1 1DHKB 3JBG2 3USSA 4AFCA 1AR92 1FMD1 1J84A 3POGA 4GZ9A 5T50A 2Y6GA 3VBRB 1QGLA 1F31A 2R043 4IEOA 4E9KA 1HB1A 5DAPA 4QPIA 4MH0E 4XVHA 1B09A 1CZTA 3T2PA 4BB3A 1BZWA 3I3DA 2DFCA 2BV4A 4Q0SA 5I0DA 2QNKA 1GZTA 2GNBA 4QWNA 4AEDC 1RMU3 3LF7A 2R041 3AL5A 3LSDA 2WZR3 3QOPA 4WM7A 3ZMOA 3WD5A 5DZFA 1ODMA 1AR62 3N35A 1BK1A 4EN0A 2E7QA 2GN7A 4TSVA 3R4UA 1CIWA 1MZEA 5ISLA 3VBSA 4H14A 4A44A 3U10A 1UN1A 1RMU1 2R1BA 3AC0A 3ZSJA 1OA4A 2V72A 3LEKA 4TN7A 5BNNA 4BOWA 4A45A 1E5SA 2D3SA 4XJZA 4Y5SA 3OOXA 2JE9A 4MHRA 5CEHA 2JICA 2H6BA 4PBOA 1E5HA 3IB3A 5SV8A 4AFDA 1GNHA 5FYBA 1ND2A 2LW8A 3IN9A 2GC3A 1W8WA 3LOBA 4FPKA 2RR13 3MF9A 4YGDA 4LOTA 4B4QA 3MIBA 2C24A 3J4UH 5FV3A 4AQ6A 2WSVA 1P8JA 1QEXA 4COYA 1RUI3 2D43A 4GKYA 1Y9QA 2WZEA 4JDNA 4M3CE 1C4RA 4ZPIA 2JX9A 4IEZA 2DVAA 2DDUA 3UJOA 4YZ1A 3F2ZA 5KHJA 4LIUA 3ZMNA 3AYCA 3VKFC 4RFT0 3RYPA 2YBSA 4YG0A 4E2SA 2RR11 5JCTA 4GWMA 3W9AA 1O3QA 1HV0A 5GM0A 1RUI1 3J9SA 1KDMA 4A2UA 1AR73 2WUHA 5CG9A 1O91A 4AI3A 2ERFA 1SBFA 4AHWA 2B9VA 1AUYA 1OPOA 3PJQA 4AGRA 2DVBA 4HONA 3BI3A 4BQ2A 2ARCA 2FCUA 3NW4A 3ACIA 4OI0A 1OKQA 2VCCA 4O9EA 3WV6A 1KJRA 1GWMA 2XB6C 4CU9A 1REFA 2ENRA 4LE3A 3VZLA 1KQRA 3FHIB 4GD4A 2RS13 1DGLA 4WZFA 1H0BA 2EIBA 1GP5A 2B4KA 4Q1PA 2W3JA 1VAVA 2OX0A 4GWIA 3ZKYA 3APBA 1A34A 4QGMA 3NJYA 3T0AA 4AI9A 4XJ8A 4BDVB 4XABA 2QBXA 1BKZA 1AXKA 1KS4A 1S0IA 2RS11 2ZEWA 1IGOA 3I4IA 3I97A 4Q27A 2DUQA 1SLBA 4BK5A 5LEKA 1QJU3 1W99A 2RE9A 3IMMA 1OVSA 5SV5A 4F83A 4UW4A 3TOJA 3SH3A 1O5UA 3VL8A 4D69A 2UY8A 4FPHA 1C57A 2OPKA 3CJIA 3KMHA 3P3PA 3THPA 5JOWA 1QJU1 4FP2A 4INDA 4E2GA 1A78A 1CPMA 4XCBA 3T1LA 2LTNA 5F39A 1W6NA 2DUOA 4XXAA 2Y64A 4GH4C 2WINB 3GF6A 4XPVA 1LHWA 1DGRA 1OQ1A 3HJRA 4XFIA 4PQQA 4Z82A 4H7LA 1E57A 5EJ1B 1DZRA 1WCKA 2CGNA 3MBWA 5ANNA 3CL1A 1LENA 1RIRA 3VBFC 4LBKA 3GZEA 2W46A 4DO0A 1RITA 4IE5A 4QX8A 1UYZA 1A8MA 3KV6A 2IXCA 2SLIA 1VR3A 2HWB1 5EV7A 3S57A 2AEYA 1SDWA 2PLV2 1CAVB 2EICA 3P3NA 1WZXA 3POJA 4M4RA 4AEDB 1XNTA 2BQPA 2XLAA 2RVAA 4QX3A 2ZS6B 1O5LA 4AE2A 3MUZ1 1OSGA 1AYN2 2X09A 4PT6A 1GKBA 4YW4A 3V64A 1JU4A 1RUD3 2Q1FA 3JQXA 4YZ3A 5FLJA 3WG2A 4A41A 3AFKA 2D6NA 1LR5A 4LHSA 3B7MA 4IERA 1FPN3 2TUNA 1JTZX 1RYYA 5EQUA 1Y4WA 1UAIA 3RJRA 1PO23 2UWCA 2B39A 1MVQA 4Q4Y1 3S7EA 4E2QA 2QFEA 5C8WA 3V0AB 3MLKA 1Z7S3 4FPGA 1DLCA 1FPN1 3AKTA 1OVPA 3GCXA 2HWB2 2BW8A 2PAMA 4LTAA 2IXJA 2V4VA 3OPWA 1PO21 3SC7X 3OPTA 3WW4A 1GWKA 2PHRA 2RDSA 1UPIA 3SEPA 1V6IA 3PU8A 1CJDA 2VXRA 2AUYA 2YY1A 1Z7S1 3AXDA 3OD0A 4ONUA 4XCAA 4YZ4A 4AWDA 2ZJCA 3M2MA 5C8CB 1QJY1 4BQ1A 3KHCA 5DUWA 2R6QA 2FDJA 3ZLIA 4RD7A 4D3WA 3JUUA 3FUQA 5T5JA 5HXMA 1NLQA 2I07B 4Y20B 4QU1A 3NWKA 4DUWA 4K7JA 1W03A 1ST8A 4RS5B 1WA6X 1AXZA 1QXPA 2GN3A 5FKCA 1YO8A 2E53A 5FUIA 1HX6A 1QOOA 1QJZA 3PVNA 2G1MA 4QDSA 4NPRA 4N43B 2CDPA 2WNVC 3AKQA 3BGAA 3SH4A 1RUH3 5A7NA 3PMSA 3UGFA 1HQNA 2VNVA 4AVBA 3FJSA 2Q8DA 4AF9A 4CCCA 1W2NA 2GMEA 1H4HA 5LRSA 2VMDA 1C5HA 4BPZA 1VBB3 3MICA 3NJXA 3ZX7A 2Y6KA 4IE0A 3HBZA 3ZSKA 2R7EB 3AK0A 1DDLA 1SQ4A 2VE1A 1RUH1 4CEYB 4TLFA 5FY1A 3ACFA 4J1WA 3RYRA 3WF2A 1VBA3 5L19A 1ASJ3 1IS4A 2RDRA 4GH4A 2LRPA 4RS5C 2VNRA 5JSOA 4MGQA 4GB32 1VBB1 4GIQA 1C8M2 3TWIA 4IW3A 3VD3A 1XU1A 2J7MA 4QQHA 3VHOA 4TZDA 5FYUA 3LOIA 3X29B 1VBA1 1SBDA 3NRUA 2ORXA 1QHDA 1ASJ1 2VOKA 2X10A 4XFFA 4YPJA 3NNMA 3SMHA 3N9PA 2C1FA 4IV3B 3LDBA 5IAVA 4CDWC 1H1AA 3KVBA 1AX0A 4UOJA 1JYNA 3F95A 5FIXA 4IGOA 3RZMA 2O0OA 2GNTA 4DFSA 4HN0A 3CBNA 4AHZA 3BOPA 4WM8B 3NL1A 3ZSMA 3LAGA 2XJSA 3AVRA 1O6UA 4CUAA 2BERA 1U5XA 4TWTA 2JWPA 3NAPB 4LHNA 1UXXX 4BM8A 2MEV2 3ACGA 3WQ0A 5GZFA 3J26N 1F4HA 3UKTA 1ND3B 3T0BA 3ZXLA 1GV9A 4HBNA 5FWEA 5FXXA 3AMHA 2XJVA 5IVCA 2HH9A 2ES3A 4CDXB 3NKTA 5LBBA 1V70A 1XJAA 3INAA 1Y3TA 2RS52 4J1XA 4YM1A 1CAVA 3VV1A 4CUBA 1IPSA 1EAH1 2EAAA 3KGLA 4AEDA 5AFEA 1SCSA 3EHKA 4GJZA 1OA3A 1OHFA 1MQTC 1W2UA 3O7OA 5DG1A 3R6SA 5IWFA 4F8AA 1SMVA 1JHNA 3KHBA 2D5FA 1VRH3 2GSYA 4ITCA 1DQ4A 1X7NA 2JKXA 3E5XA 4ZZ5A 1C28A 2FD8A 2MHFA 4CCMA 2A6WA 2XJRA 1FYUA 1DZQA 2Y33A 3AKRA 2A71A 4ZXKA 4LHKA 4RQPB 3NNLA 4LUMA 3NV2A 5FREA 5FZGA 4DS0A 1S0DA 5JOYA 3CMGA 1VRH1 2VZPA 2WNVA 3RZLA 2RM23 1ZRFA 4Y5Z0 4Q2FA 4XUPA 5HXVA 5HCHA 1JXNA 3PL0A 1NT0A 3OGGA 1G9BA 1H2KA 3WNPA 5C9AC 4RL7A 5C8CA 3ES1A 2RS33 1W2AX 3A23A 2GH8A 1NXMA 1PK6C 2WIIB 3SCFA 2WO3A 2DVFA 3JD73 4UBHA 2D6PA 4LK7A 3KD4A 4Y20A 1ULOA 2BNMA 4K8RB 1XE7A 4DMIA 1NUKA 4HLTA 4QPGB 4LKEA 2SBAA 4RS5A 3GXUA 2Y0IA 4PLOA 2RS31 4FFFA 4JTNA 4KMQA 4PI2A 4URAA 5IVJA 1HRV3 3A4UA 3OG2A 1HV1A 2C5DA 4RQPC 5BYNA 3GBWA 4HFSA 1QWRA 1KD7A 4N43A 1MS1A 1MEC1 3JD71 2GNMA 2HWF2 3IIAA 3A0KA 3FHAA 4LXLA 2A7AA 1F15A 2CSGA 1VMHA 4AZZA 2JE8A 4CZSA 3O1SA 1HRV1 4G9SB 2BWCA 1Z0HA 2PMWB 2R072 3ITQA 3LB9A 2WWUA 3MO4A 1YFUA 2OUJA 1QJFA 4BWOA 3H42B 4FCAA 4CEYA 1AR82 4NHKA 1W0NA 2JKBA 2O1QA 3K4DA 3S5QA 3OYWB 1BEV3 4BU2A 4PF1A 5HI0A 1BHGA 3AM2A 4FPYA 4QPGC 1WWYA 4EZHA 1WA4A 2UYAA 4DUXA 3DPRC 3FBMA 1TE1B 3PMEA 3BB6A 4XZPA 4A6SA 1IZ3A 1NYWA 3GHNA 5IK5A 3IIIA 4L92A 5DMYA 4RHV2 1PMHX 1PVC2 2ARBA 3G7DA 5CNAA 5FMDA 1WBFA 1WD4A 4RR3B 2LALA 1H9PA 1BEV1 1N3PA 2VZTA 2XGXA 4XJWA 3ZPOA 1DCSA 1RUE3 2P6CA 5I91A 1JOJA 5A1AA 3LEMA 1SFNA 2O8QA 2X05A 2QE3A 4IV3A 1TNFA 1WCDJ 3DN7A 3Q8EA 4B7KA 1HXS3 3CU7A 3VD5A 2X53S 1BBT3 2XH6A 2XJUA 3BN6A 5C7GA 4DY5A 4XTPA 2XXZA 4V2WA 3MF6A 3AJZA 1UMZA 2NZ9A 1RL3A 2B42B 3VD4A 3U0ZA 1ZNPA 2ZOEB 1MQTA 3LPGA 4JQRA 5FUPA 3WR0A 4FSJA 4AAXA 3ZO0B 2WO2A 3ZXEA 3IDCB 2OPWA 1HXS1 3I2DA 3M4FA 1BK0A 1RUF2 4QXCA 1BBT1 3NAPA 4XF3A 3T3YA 3WINE 2DFBA 2DF7A 4FOVA 3VBUB 3TBDA 5GZDA 2A70A 1EV12 1QJX1 4H55A 2DCTA 3U07A 5GZCA 1ZM1A 3WP4A 3OJBA 2XJTA 1UY3A 1XB9A 2DU1A 2XVLA 5FYSA 2CY6A 3DKWA 3KVAA 4RSUA 4QHZA 2VM9A 3B9CA 3W20A 3WT3A 1VMJA 2VZ1A 3BTXA 3WW3A 1UXZA 5F37A 4MGTA 4YG6A 2E63A 1VMFA 1C1LA 2DVGA 3ELNA 1JUIA 4X8NA 4CCJA 1GQPA 5E88A 1YHFA 4IEUA 3FBYA 1PO12 2J1AA 3WDTA 2PAKA 3WP3A 1LOAA 1KGYA 5H9RA 3TEYA 1M06G 5T55A 4OFGA 1PK6A 2FHRA 4U2AA 4L99A 4FXKB 3U1XA 3POSA 3MYXA 1HQWA 2W08A 1OT5A 1GWLA 2Z69A 5CFCC 1AL0G 1WMFA 2VGDA 3HT1A 2A6YA 3MIFA 3WDWA 1NY71 3DXTA 1OI6A 2D93A 1QJX2 4BMEA 2ZHKA 1ULPA 2JG8B 4RQPA 4YVWB 3H3UA 2ARXA 4B8EA 1REDA 3G6JB 2ZZQA 4XIKA 1AYM2 1I5ZA 2VBBA 3NJZA 3HAGA 4LBJA 4CCDA 1UYYA 3WF3A 3MIGA 4XQDA 4E8CA 1HJGA 4LORA 4OVEA 1N1TA 5DQ0A 3O1MA 1LGNA 5FJKA 5FZCA 3SITA 3E5UA 3GBGA 3K48A 2R1DA 5HCFA 5C4WC 5A70A 2O14A 2J1VA 4GA9A 4LO7A 1MS8A 3J7NA 4QQPA 5IATA 4XBNA 4QPGA 3O1OA 4FBFA 1E5IA 1S4CA 1IOAA 4JZRA 5FBJA 4CPBD 2VOVA 1YUDA 4ZY9A 1LKNA 4AEJA 3HIFA 4D0QA 3KS7A 4JGZB 5CU1A 4E4HA 4AXOA 5F3EA 3C7HA 2OVUA 3AKPA 4XDQA 2X29A 4CDUC 2E33A 4CCKA 4I0BA 3AP4A 3WLUA 2VCMA 3CJXA 4S2HA 1VB2A 4KBZA 3TEZA 5FZ8A 2ID4A 2GNDA 3L9JT 2BPA2 5B4NA 1R1ZA 4I0WB 1NE6A 2UWBA 2XWJB 4LJHA 1GZWB 5JI7A 3KT1A 4CXWA 5C70A 1LB2A 2VTXJ 4R52A 5FPLA 4GMP0 4AR2A 4MGYE 3I2JA 2WS93 1QMJA 1KFUL 2A6VA 2EF6A 5F9TA 3T09A 1GU3A 3WF1A 3ZXAC 1JZ7A 5FPAA 2R30A 1ULEA 1DQ1A 3ACHA 1K5MC 1QF3A 4UBGA 3SLIA 4ES8A 5A33B 3H8XA 4EN9B 2HWC2 5KXEA 2ZGPA 4RR3A 2ZPXA 2P3YA 4Q4X3 4UWDA 1R092 5LY2A 3DKQA 3GCWA 1US2A 4HSLA 2BU9A 3SISA 4BJ0A 5FZDA 2ZKLA 2WNUB 4LK6A 3UKNA 4P00B 1L7RA 3ECQA 2C26A 2XVGA 3ZFGB 2JJ6A 4UW3A 3IDEA 1VB4A 4MO3M 1XE8A 4Q4X1 4E8DA 4PLNA 2A3WA 3MHZA 1ZZ9A 1XC6A 1W90A 5FPBA 2VOTA 1LHUA 2MNGA 2YFZA 5D8AC 4OZOA 4ARYA 1NLSA 1QXJA 5DAXA 5C3QA 5CFCA 4NPLA 4TXWA 4XJUA 1PZ8A 3HQUA 3IDAA 3UK9A 1STMA 1WW5A 2DTWA 4X6QB 5FZ0A 4YFZA 3POIA 1V6KA 1DLLA 2W5FA 1W04A 4CP0A 2YB7A 1HIXA 1MZ6A 4LBOA 3EQEA 3OGJA 3RJ2X 2ZX3A 4AI8A 4GQ7A 2W39A 5HPOA 1XSQA 2BDRA 3GM8A 3Q8CA 1TME2 2CAVA 2WN2A 5FYYA 2P3IA 4ZS3A 2HWD3 3PUSA 5LASA 4AI1A 1U5YA 5LCWL 1JODA 1IQDC 4XQWA 1QQP3 2V09A 4Z07A 1DFQA 4YWAA 5JOXA 2HYKA 3B94A 2D5HA 4XURA 4B3NA 3H8RA 5LATA 1W8NA 1XSRA 4NHLA 2FDKA 4HXCA 4JHTA 3PURA 4ISQA 4WV8A 4Z1VA 5JVVA 5CFDB 1TVGA 2XWBB 4LO8A 5FZHA 1XXNA 1VAMA 2B45X 4GALA 1QQP1 3KGZA 2D6KA 2VQ0A 4Y4RA 3WNXA 2DTYA 4IUGA 1PZ7A 3AYEA 4YVWA 4ES9A 3W58A 4N9IA 3PHMA 3RDIA 1QDCA 1F9KA 4SLIA 4R9AA 1GNZA 4AL9A 4E4DX 2ZEZA 1O8PA 4EZ4A 2ZTNA 3SCHA 4XJ9A 5GLTA 2Q8EA 2VAUA 4AVSA 2P1BA 4B1LA 1CAUA 1WLCA 2JIGA 4TYSA 3TN91 1OH3A 1IS3A 5FZ7A 3KF3A 1GZCA 4L2NA 4YARA 1LHVA 3VZNA 4HVQA 1LHNA 4JAAA 3BUCA 3B5LB 2KA3A 4HK9A 5FWJA 2PA7A 2Q0AA 3JBG3 5AC92 2WYFA 1LNSA 1BJQA 1AHSA 3WCSA
chains in the Genus database with same CATH topology
4DXSA 3NQHA 5DN2A 3WNLA 1GMMA 1W9WA 3I2KA 2QQOA 3IAQA 1KEXA 2W47A 3FHQA 2Y64A 3OGVA 4A4AA 4XUTA 2WZ8A 3HJRA 4PQQA 5EJ1B 4P08A 2YC2A 3MBWA 5EJZB 1UY0A 1W9SA 1OF3A 2L9LA 2W46A 3K4ZA 1JZ8A 3OEAA 1GNYA 1UYZA 1JZ5A 1UY2A 2CDOA 5LA2A 2EICA 4M4RA 3CQOA 1XNTA 2W91A 2RVAA 2YC4A 2DCJA 4QX3A 3MUZ1 1D7PM 5JR2A 2X09A 4PT6A 3P1IA 2W1WA 1JU4A 5CZKA 3WSOA 3NNGA 2J22A 4A41A 4LHSA 4QPWA 4W4ZA 4A3ZA 1RYYA 4UI9L 2WYSA 3A22A 3LEGA 1GOFA 3I3EA 3OEBA 4OYUA 2E26A 4M4PA 1DLCA 3MUY1 3UETA 1CZSA 3HEIA 3GGLA 2QQNA 2V4VA 3WNOA 4CU8A 3SEPA 1T2XA 4ZZ8A 3THCA 2W1QA 4W8JA 3CIHA 5HXMA 4HG6B 2WO1A 4DUWA 3WF0A 4JKKA 1O59A 3HNBM 4QB2A 3LQCA 5FUIA 4TTGA 4QDSA 3I3BA 2QQMA 2CDPA 1GUIA 2Y6HA 3BGAA 5CYYA 3UNPA 3PUIA 2VO5A 4CVUA 3DYMA 2VMDA 3NJXA 2VMEA 2Y6KA 3VDBA 2R7EB 1JZ2A 3ACFA 3LE0A 3WF2A 2W9XA 3C8XA 4QX0A 3THDA 4MGQA 2VZVA 5IFPA 3VD3A 1UMIA 2J7MA 4CU6A 1NAEA 4OMCA 3LPFA 3NRUA 2ORXA 2XOMA 4QB6A 2X10A 4YPJA 2W94A 2QQLA 4JX0A 3T08A 2ZXQA 4UOJA 5LA1A 1JYNA 3VDCA 2ZEYA 4KWUA 2WN3A 3MV11 3ZM8A 4P5YA 4CUAA 4W50A 2BERA 1XNAA 1UXXX 5EIYB 3ACGA 1F4HA 3T0BA 3ABZA 4KI5M 3HOBA 3CKHA 5J1XA 1EUTA 1UZ0A 3CDZB 4FI9A 4CUBA 4JKMA 4QDQA 1I5PA 2J1TA 2YG0A 2Z4FA 2Y8KA 5IHRA 2VZ3A 3IAPA 3SEEA 3OB8A 1H6YA 3E1F1 4DXRA 4ZZ5A 2JKXA 3DYOA 4DUVA 1H6XA 1CZVA 2VTFA 2VZRA 3OGRA 2EIEA 4BK4A 1WKYA 4XUQA 2V5DA 4MGSA 2VZUA 4QX2A 3CMGA 3DYPA 1W9TA 2VZPA 4XUNA 4OMDA 3W5NA 2VMCA 4XUPA 3SKVA 1JZ6A 3D3AA 2W1SA 2YFUA 3C7OA 3WNPA 3OGSA 4BXSV 2VMFA 2BGOA 3A23A 2QQIA 2WO3A 1ULOA 2E32A 1NUKA 2VCBA 3GXUA 2OKXA 1NKGA 4KMQA 4XZUG 2W1UA 3OG2A 4AG4A 4ARXA 4D8MA 5G04L 5JUVA 3FHAA 1XPWA 2Y6JA 4L0PA 3SKJE 2JE8A 3MO4A 4LQRA 3HNMA 2QQKA 2JD9A 1UY1A 1UMHA 2VZSA 1W0NA 3DECA 3K4DA 4UAPA 2RJ2A 4PF1A 1DYOA 4RYDA 1BHGA 4DUXA 2XQXA 2E31A 3IIIA 5DMYA 2Y6LA 1PMHX 1K42A 2HLEA 1GOHA 1YQ2A 2VZTA 2WAOA 1PMJX 2VCAA 3EYPA 4LKSA 5A1AA 2W95A 3LEIA 2X05A 3J7HA 3K75B 3VD5A 1GOGA 1OD3A 2C9KA 2LS6A 3BN6A 5C7GA 3T0DA 2WAAA 3I2GA 2JDAA 5JXHA 3HNYM 2XONA 3VD4A 3LPGA 4AAXA 2WO2A 4MOAA 3WEZA 1JI6A 4QB1A 5IJRA 1MPXA 4OUEA 1SG3A 1UWWA 3I2IA 3P6BA 1UY3A 2VM9A 2VZ1A 3I2HA 3I2FA 2ZEXA 1UXZA 2WABA 3FL7A 1K45A 5DPNA 1GQPA 1JU3A 5F7UA 3C7EA 2J1AA 3WNNA 1KGYA 1JYWA 4Z2AA 3C7GA 2BGPA 4A42A 1OT5A 2W87A 2BZDA 4CUCA 3HPNA 2VQTA 5IYYA 3WNMA 3WNKA 4P02B 3VD7A 1JYXA 1O8SA 1ULPA 2VJXA 1SHWB 4ZXEA 3NJVA 5C71A 1K12A 1NX9A 2J1RA 1JZ3A 1L7QA 4QAWA 4JKLA 2J1EA 1UYYA 3WF3A 1K3IA 4E8CA 3WQBA 2W92A 3VDAA 5DQ0A 4GWJA 2VQUA 5G05L 1UYXA 4MADA 3EB7A 3U37A 5IFTA 2VC9A 3CZJA 1US3A 1J83A 2WBKA 2J1VA 2XHNA 2ORZA 2KD7A 1UX7A 1R64A 3ETPA 1OF4A 4LPLA 4ZY9A 5JMOA 2HYXA 5JXIA 4D0QA 3C7FA 3K4AA 3C7HA 4RN5A 2J1SA 1HN1A 2E33A 3PUHA 4QDRA 2EIDA 3K46A 2ID4A 1TG7A 3W5MA 5B4NA 5JXJA 2VZQA 1DP0A 5C70A 1J84A 4GZ9A 2BBAA 1CX1A 2Y6GA 1PX4A 3OBAA 3I2JA 3CZUA 4DEVA 2C4XA 3T09A 1GU3A 4XVHA 1CZTA 3WF1A 4JHZA 3T2PA 1JZ7A 1W8OA 3I3DA 3ACHA 5I0DA 1JZ4A 1US2A 4BJ0A 4P00B 1L7RA 4A44A 3ECQA 2C26A 3AC0A 4MO3M 3HN3A 4E8DA 2V72A 3LEKA 1XC6A 3GDBA 4A45A 4A6OA 5JXGA 2VOTA 3IB3A 2YFZA 4OZOA 4ARYA 2RV9A 2LW8A 1JYVA 4TXWA 3IDAA 3A7QA 1P8JA 2VZOA 2WZEA 2W5FA 3T2QA 2DDUA 2YB7A 3F2ZA 4ET7A 5HPOA 2PQSA 3VD9A 5LA0A 3GM8A 4XUOA 3FN9A 2WN2A 5LCWL 1IQDC 1WCQA 3WF4A 2WUHA 2WQ8A 2DCKA 2VL4A 2B9VA 4XURA 4QX1A 1OH4A 1JHJA 1W8NA 2WDBA 1PX3A 1F4AA 1UY4A 2QQJA 3ACIA 1TVGA 2VCCA 1CIYA 4CU9A 4IUGA 3JXSA 4DEQA 4CU7A 2EIBA 2ZEZA 1O8PA 2B4KA 2W3JA 3A21A 4GWIA 3T2OA 3T0AA 4DXTA 3K77A 5B4XA 4BDVB 1EUUA 2J1UA 2QBXA 2ZEWA 1SDDB 3I97A 3MV01 4BK5A 1W99A 2VR4A 3UESA 1LNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DXS A;  3NQH A;  5DN2 A;  3WNL A;  1GMM A;  1W9W A;  3I2K A;  2QQO A;  3IAQ A;  1KEX A;  2W47 A;  3FHQ A;  2Y64 A;  3OGV A;  4A4A A;  4XUT A;  2WZ8 A;  3HJR A;  4PQQ A;  5EJ1 B;  4P08 A;  2YC2 A;  3MBW A;  5EJZ B;  1UY0 A;  1W9S A;  1OF3 A;  2L9L A;  2W46 A;  3K4Z A;  1JZ8 A;  3OEA A;  1GNY A;  1UYZ A;  1JZ5 A;  1UY2 A;  2CDO A;  5LA2 A;  2EIC A;  4M4R A;  3CQO A;  1XNT A;  2W91 A;  2RVA A;  2YC4 A;  2DCJ A;  4QX3 A;  3MUZ 1;  1D7P M;  5JR2 A;  2X09 A;  4PT6 A;  3P1I A;  2W1W A;  1JU4 A;  5CZK A;  3WSO A;  3NNG A;  2J22 A;  4A41 A;  4LHS A;  4QPW A;  4W4Z A;  4A3Z A;  1RYY A;  4UI9 L;  2WYS A;  3A22 A;  3LEG A;  1GOF A;  3I3E A;  3OEB A;  4OYU A;  2E26 A;  4M4P A;  1DLC A;  3MUY 1;  3UET A;  1CZS A;  3HEI A;  3GGL A;  2QQN A;  2V4V A;  3WNO A;  4CU8 A;  3SEP A;  1T2X A;  4ZZ8 A;  3THC A;  2W1Q A;  4W8J A;  3CIH A;  5HXM A;  4HG6 B;  2WO1 A;  4DUW A;  3WF0 A;  4JKK A;  1O59 A;  3HNB M;  4QB2 A;  3LQC A;  5FUI A;  4TTG A;  4QDS A;  3I3B A;  2QQM A;  2CDP A;  1GUI A;  2Y6H A;  3BGA A;  5CYY A;  3UNP A;  3PUI A;  2VO5 A;  4CVU A;  3DYM A;  2VMD A;  3NJX A;  2VME A;  2Y6K A;  3VDB A;  2R7E B;  1JZ2 A;  3ACF A;  3LE0 A;  3WF2 A;  2W9X A;  3C8X A;  4QX0 A;  3THD A;  4MGQ A;  2VZV A;  5IFP A;  3VD3 A;  1UMI A;  2J7M A;  4CU6 A;  1NAE A;  4OMC A;  3LPF A;  3NRU A;  2ORX A;  2XOM A;  4QB6 A;  2X10 A;  4YPJ A;  2W94 A;  2QQL A;  4JX0 A;  3T08 A;  2ZXQ A;  4UOJ A;  5LA1 A;  1JYN A;  3VDC A;  2ZEY A;  4KWU A;  2WN3 A;  3MV1 1;  3ZM8 A;  4P5Y A;  4CUA A;  4W50 A;  2BER A;  1XNA A;  1UXX X;  5EIY B;  3ACG A;  1F4H A;  3T0B A;  3ABZ A;  4KI5 M;  3HOB A;  3CKH A;  5J1X A;  1EUT A;  1UZ0 A;  3CDZ B;  4FI9 A;  4CUB A;  4JKM A;  4QDQ A;  1I5P A;  2J1T A;  2YG0 A;  2Z4F A;  2Y8K A;  5IHR A;  2VZ3 A;  3IAP A;  3SEE A;  3OB8 A;  1H6Y A;  3E1F 1;  4DXR A;  4ZZ5 A;  2JKX A;  3DYO A;  4DUV A;  1H6X A;  1CZV A;  2VTF A;  2VZR A;  3OGR A;  2EIE A;  4BK4 A;  1WKY A;  4XUQ A;  2V5D A;  4MGS A;  2VZU A;  4QX2 A;  3CMG A;  3DYP A;  1W9T A;  2VZP A;  4XUN A;  4OMD A;  3W5N A;  2VMC A;  4XUP A;  3SKV A;  1JZ6 A;  3D3A A;  2W1S A;  2YFU A;  3C7O A;  3WNP A;  3OGS A;  4BXS V;  2VMF A;  2BGO A;  3A23 A;  2QQI A;  2WO3 A;  1ULO A;  2E32 A;  1NUK A;  2VCB A;  3GXU A;  2OKX A;  1NKG A;  4KMQ A;  4XZU G;  2W1U A;  3OG2 A;  4AG4 A;  4ARX A;  4D8M A;  5G04 L;  5JUV A;  3FHA A;  1XPW A;  2Y6J A;  4L0P A;  3SKJ E;  2JE8 A;  3MO4 A;  4LQR A;  3HNM A;  2QQK A;  2JD9 A;  1UY1 A;  1UMH A;  2VZS A;  1W0N A;  3DEC A;  3K4D A;  4UAP A;  2RJ2 A;  4PF1 A;  1DYO A;  4RYD A;  1BHG A;  4DUX A;  2XQX A;  2E31 A;  3III A;  5DMY A;  2Y6L A;  1PMH X;  1K42 A;  2HLE A;  1GOH A;  1YQ2 A;  2VZT A;  2WAO A;  1PMJ X;  2VCA A;  3EYP A;  4LKS A;  5A1A A;  2W95 A;  3LEI A;  2X05 A;  3J7H A;  3K75 B;  3VD5 A;  1GOG A;  1OD3 A;  2C9K A;  2LS6 A;  3BN6 A;  5C7G A;  3T0D A;  2WAA A;  3I2G A;  2JDA A;  5JXH A;  3HNY M;  2XON A;  3VD4 A;  3LPG A;  4AAX A;  2WO2 A;  4MOA A;  3WEZ A;  1JI6 A;  4QB1 A;  5IJR A;  1MPX A;  4OUE A;  1SG3 A;  1UWW A;  3I2I A;  3P6B A;  1UY3 A;  2VM9 A;  2VZ1 A;  3I2H A;  3I2F A;  2ZEX A;  1UXZ A;  2WAB A;  3FL7 A;  1K45 A;  5DPN A;  1GQP A;  1JU3 A;  5F7U A;  3C7E A;  2J1A A;  3WNN A;  1KGY A;  1JYW A;  4Z2A A;  3C7G A;  2BGP A;  4A42 A;  1OT5 A;  2W87 A;  2BZD A;  4CUC A;  3HPN A;  2VQT A;  5IYY A;  3WNM A;  3WNK A;  4P02 B;  3VD7 A;  1JYX A;  1O8S A;  1ULP A;  2VJX A;  1SHW B;  4ZXE A;  3NJV A;  5C71 A;  1K12 A;  1NX9 A;  2J1R A;  1JZ3 A;  1L7Q A;  4QAW A;  4JKL A;  2J1E A;  1UYY A;  3WF3 A;  1K3I A;  4E8C A;  3WQB A;  2W92 A;  3VDA A;  5DQ0 A;  4GWJ A;  2VQU A;  5G05 L;  1UYX A;  4MAD A;  3EB7 A;  3U37 A;  5IFT A;  2VC9 A;  3CZJ A;  1US3 A;  1J83 A;  2WBK A;  2J1V A;  2XHN A;  2ORZ A;  2KD7 A;  1UX7 A;  1R64 A;  3ETP A;  1OF4 A;  4LPL A;  4ZY9 A;  5JMO A;  2HYX A;  5JXI A;  4D0Q A;  3C7F A;  3K4A A;  3C7H A;  4RN5 A;  2J1S A;  1HN1 A;  2E33 A;  3PUH A;  4QDR A;  2EID A;  3K46 A;  2ID4 A;  1TG7 A;  3W5M A;  5B4N A;  5JXJ A;  2VZQ A;  1DP0 A;  5C70 A;  1J84 A;  4GZ9 A;  2BBA A;  1CX1 A;  2Y6G A;  1PX4 A;  3OBA A;  3I2J A;  3CZU A;  4DEV A;  2C4X A;  3T09 A;  1GU3 A;  4XVH A;  1CZT A;  3WF1 A;  4JHZ A;  3T2P A;  1JZ7 A;  1W8O A;  3I3D A;  3ACH A;  5I0D A;  1JZ4 A;  1US2 A;  4BJ0 A;  4P00 B;  1L7R A;  4A44 A;  3ECQ A;  2C26 A;  3AC0 A;  4MO3 M;  3HN3 A;  4E8D A;  2V72 A;  3LEK A;  1XC6 A;  3GDB A;  4A45 A;  4A6O A;  5JXG A;  2VOT A;  3IB3 A;  2YFZ A;  4OZO A;  4ARY A;  2RV9 A;  2LW8 A;  1JYV A;  4TXW A;  3IDA A;  3A7Q A;  1P8J A;  2VZO A;  2WZE A;  2W5F A;  3T2Q A;  2DDU A;  2YB7 A;  3F2Z A;  4ET7 A;  5HPO A;  2PQS A;  3VD9 A;  5LA0 A;  3GM8 A;  4XUO A;  3FN9 A;  2WN2 A;  5LCW L;  1IQD C;  1WCQ A;  3WF4 A;  2WUH A;  2WQ8 A;  2DCK A;  2VL4 A;  2B9V A;  4XUR A;  4QX1 A;  1OH4 A;  1JHJ A;  1W8N A;  2WDB A;  1PX3 A;  1F4A A;  1UY4 A;  2QQJ A;  3ACI A;  1TVG A;  2VCC A;  1CIY A;  4CU9 A;  4IUG A;  3JXS A;  4DEQ A;  4CU7 A;  2EIB A;  2ZEZ A;  1O8P A;  2B4K A;  2W3J A;  3A21 A;  4GWI A;  3T2O A;  3T0A A;  4DXT A;  3K77 A;  5B4X A;  4BDV B;  1EUU A;  2J1U A;  2QBX A;  2ZEW A;  1SDD B;  3I97 A;  3MV0 1;  4BK5 A;  1W99 A;  2VR4 A;  3UES A;  1LNS A; 
#chains in the Genus database with same CATH topology
 1COV 2;  2B7Y A;  2YV8 A;  4Y22 B;  3WNL A;  4NRO A;  3I2K A;  5E1R A;  1B35 B;  1O4Z A;  1K5M A;  2D44 A;  3GZU C;  4QKF A;  4EV0 A;  4FP3 A;  4M0H A;  5BNO B;  5BNP B;  2VD7 A;  3KCX A;  3JBG 1;  5C6C A;  3NO8 A;  4JGZ A;  5CAD A;  4NIH A;  4LKD A;  1AR9 1;  1W39 A;  5EXO A;  3WUC A;  1BXH A;  3OGV A;  4A4A A;  4J25 A;  2WKK A;  2R0H A;  4QQO A;  4Q0U A;  4Y26 A;  3WXP A;  1ZA7 A;  4I02 A;  1AR6 3;  4N8M A;  2JDU A;  1VBE 2;  4OHV A;  2R16 A;  3D4K A;  5IVE A;  1GZW A;  4COZ A;  2WA3 A;  2CWS A;  1OF3 A;  3K4Z A;  4HET A;  4OHW A;  5A6X A;  3DL3 A;  4CDQ B;  1GNY A;  1DIW A;  3WUD A;  4XJA A;  5D8A A;  5BNQ A;  1SLI A;  5J3U A;  1AR6 1;  1ODN A;  2R06 2;  1UZY A;  1W6O B;  4IV1 B;  2YBP A;  4Q1R A;  5K7P A;  4UW5 A;  2BYV E;  4NJ4 A;  1FAY A;  1ZZC A;  2W1W A;  1Q43 A;  2ZHN A;  5C5U A;  3NNG A;  1PIV 2;  1NQD A;  1S2K A;  2IXH A;  4FPL A;  5KXB A;  3WVJ A;  1X33 A;  4QPW A;  5LA9 A;  1W2T A;  5FUN A;  3THT A;  1LAJ A;  1DBN A;  3O12 A;  2EAK A;  4QT6 A;  2VXJ A;  4UI9 L;  1UF2 C;  2X5I B;  3ZN5 A;  2JDP A;  1GOF A;  3I3E A;  1W0O A;  1CJP A;  2YGL A;  3N7M A;  4IE7 A;  1WCU A;  3UV9 A;  2WO7 A;  4KBB A;  1YFW A;  3CJI C;  1MZ5 A;  1X9T A;  1CZS A;  2ARE A;  3GGL A;  1ZVF A;  4XHX A;  3ST7 A;  5DZG A;  5A7O A;  1U12 A;  1YWK A;  3WNO A;  1S2B A;  3AXE A;  2BEO A;  5FYT A;  4J6G A;  3IDB B;  4NPM A;  4OUS A;  3H8O A;  1JYT A;  2ZAH A;  3THC A;  1I9R A;  4QQL A;  5APA A;  1K5J A;  1OLR A;  1GYK A;  3V56 A;  2FDH A;  3M3E A;  1RTV A;  3WG3 A;  3VBR C;  3JZV A;  3FZ3 A;  5FDB A;  2X5I C;  4BIS A;  1E5R A;  3HNB M;  4QB2 A;  3MFA A;  4MLO A;  4LLO A;  3S30 A;  3NST A;  5A3O A;  4AFA A;  4I0A A;  3I3B A;  3R4D B;  2PHW A;  2NMO A;  2Y38 A;  5DAW A;  5F5C A;  1YI9 A;  1FNY A;  4NMI A;  4D6R A;  1LOB A;  1M4W A;  3A0N A;  3ILF A;  4NHM A;  5GLV A;  4BA6 A;  1G9A A;  4RGA A;  2NQY A;  1H8V A;  4KWK A;  3HQR A;  1W8F A;  1VPH A;  3K3O A;  4KGQ A;  4WVM B;  3V0B B;  3WX5 A;  1IPJ A;  1DYK A;  3TB0 A;  2MPF A;  4P9I A;  5FZE A;  3RG0 A;  3VDB A;  2ZMK A;  1C5I A;  4N9H A;  3ZYB A;  4QX5 A;  4OQ8 A;  1DZT A;  2I45 A;  5FZF A;  4HZF A;  5DDJ 2;  3WDX A;  2W9X A;  3O1P A;  2NN8 A;  1REE A;  3QH6 A;  5F3C A;  3NNJ A;  4W6X A;  3ZXD A;  1V9U 2;  2ZA9 A;  2XUM A;  5IFP A;  2XLG A;  1W6P B;  1W8H A;  3QAC A;  4IQP A;  5FZM A;  4D7Y A;  1PGL 2;  4A7Y A;  1VP6 A;  5FLI A;  4GMP 3;  1N3O A;  1FV3 A;  4OMC A;  3RWK X;  2A3X A;  5JWP A;  2WZP P;  1FV2 A;  2XOM A;  4QB6 A;  1IKQ A;  1OLM A;  4COV A;  5FZL A;  3OCP A;  4O65 A;  1W6Q B;  1UIK A;  4ASM B;  2XBO 2;  3WZ1 A;  2WZR 2;  2YU1 A;  4GMP 1;  3RNS A;  3ZDS A;  3NKG A;  5LA1 A;  1YFY A;  3LZZ A;  1VLN A;  2PLV 3;  4CRQ A;  4O61 A;  3AMQ A;  4I3G A;  4KWU A;  2YXS A;  2FZ2 A;  1ZRD A;  4K6B A;  3WP6 A;  3OY8 B;  1EYB A;  4FFI A;  2PTM A;  4DRR A;  2JDN A;  1AYN 3;  4HKL A;  4P5Y A;  2BNO A;  3B9I A;  4W50 A;  1OD5 A;  4GAZ A;  3MLL A;  1XNA A;  1CN1 A;  3GBF A;  4DIQ A;  4COU A;  3O1T A;  1OOP B;  1FT9 A;  2K0G A;  2PLV 1;  1H1M A;  3M3I A;  5KXC A;  3ZYI B;  1ULD A;  5LWB A;  1MVE A;  1AYN 1;  1OPM A;  2QJV A;  4EYU A;  5BXX A;  4Y5T A;  4Z8B A;  1QU0 A;  1H9W A;  4XAE A;  2WLQ A;  4PIZ A;  5KXD A;  3VN4 A;  1V0A A;  4JKM A;  2HWB 3;  4QDQ A;  2J1T A;  4URT A;  1S0C A;  5L7O B;  4KU7 A;  1W6O A;  5LY1 A;  4MYE A;  3O0W A;  3CF6 E;  4N53 B;  4PIX A;  5FK8 A;  1IPK A;  5FAX A;  2ZGQ A;  3OUI A;  4UFJ A;  3OB8 A;  1H6Y A;  3I2O A;  4MX3 A;  3EO6 A;  5IT6 A;  4R9B A;  3VBR A;  1AR7 2;  3DYO A;  4YM3 A;  5H9Q A;  1SCR A;  3NV3 A;  4EWE A;  2X5I A;  1H1I A;  3OGR A;  2EIE A;  5H9S A;  4BK4 A;  1J58 A;  5LW9 A;  3RZH A;  1NCQ B;  3VZK A;  1HKD A;  1YJK A;  2Y0O A;  2ZGM A;  5F3I A;  4EJR A;  3KB5 A;  5A32 B;  1I1E A;  1VJ2 A;  2CGP A;  2VZU A;  4MXW B;  4Q4Y 3;  5LBC A;  4XXP A;  1NQJ A;  2BOI A;  1U5Z A;  2JEN A;  1Y9G A;  4FPF A;  4XUN A;  4CUG A;  5KR7 A;  3MDP A;  5FY4 A;  2QZ2 A;  5FY5 A;  5FFO C;  2RMU 2;  3H7Y A;  3I59 B;  3J8F 1;  3QCW A;  1JZ6 A;  3D3A A;  4TLG A;  1EPZ A;  1IS6 A;  2PFW A;  3KV9 A;  2YFU A;  2AH2 A;  2VMF A;  1J3P A;  1VBC 2;  2BGO A;  3ZIX A;  2TEP A;  5ABJ B;  3GHM A;  2YU2 A;  2PHL A;  4Q4V 2;  2DU0 A;  1PGS A;  2QQI A;  1C8N A;  1QJY 3;  1WUV A;  3KV4 A;  3VBH B;  5L9V A;  2RDQ A;  4FQZ A;  4S2D A;  2VCB A;  3E6B A;  1O3S A;  2DV9 A;  4XOG A;  1URX A;  2GP3 A;  1G9D A;  4G3Y C;  4IEQ A;  4AG4 A;  4Y1Y A;  5JZG B;  1JOP A;  2AGS A;  4FQ4 A;  4GB3 3;  3D5O A;  4IEP A;  1C8M 3;  1LUL A;  1I3H A;  4AHX A;  4XF1 A;  5FY8 A;  1FOD 2;  1YQ5 A;  4QU2 A;  2OW4 A;  3J8F 2;  3C3V A;  4KWL A;  2Y6J A;  2ZHM A;  1H2L A;  1CVN A;  4IE6 A;  4Q0V A;  5IW0 A;  2GP5 A;  4WVM A;  2Y60 A;  3V0B A;  1HB2 A;  2Y6F A;  4IGP A;  2CHH A;  2JD9 A;  2YUE A;  3N9M A;  4GB3 1;  3ZXK A;  2ZAB A;  1C8M 1;  1UY1 A;  3K2O A;  2VZS A;  4UAP A;  1SLA A;  3DEC A;  3VBH C;  2VPV A;  2FDI A;  1AL2 2;  2RJ2 A;  3B93 A;  2ILM A;  1DYO A;  4FPC A;  4RYD A;  4Q5O A;  5LEJ A;  3ORJ A;  1GP6 A;  5M0T A;  2E31 A;  4C8D A;  1W6P A;  4CSW A;  3IM0 A;  5JZG C;  5C8C C;  4ZU7 A;  3N9L A;  5ACA 2;  1K42 A;  4RGG A;  3PUA A;  2MEV 3;  2HLE A;  3WW1 A;  3UYJ A;  2BFU S;  3NNF A;  3KT7 A;  2OUH A;  4IET A;  4D7T A;  1PMJ X;  4YW6 A;  2A1X A;  2WSU A;  3N3H A;  1RUD 2;  1JOB A;  3ZOI A;  1ZZ7 A;  1GR3 A;  4LKF A;  5FZO B;  1ULF A;  4LBM A;  5EYY A;  1GOG A;  2LS6 A;  3FFZ A;  4QXH A;  2MEV 1;  3WHT A;  5I8Y A;  2GMM A;  2WAA A;  1DG6 A;  1XOY A;  2RS5 3;  3M3O A;  3DF0 A;  1N1Y A;  4H2A A;  2BJS A;  2HWE 2;  5JXH A;  1AXY A;  4N7U A;  5LK5 A;  4N43 C;  5FYV A;  2WFF 1;  1UQX A;  4UFK A;  3OY8 A;  4NN0 A;  3U75 A;  4CCO A;  4LOS A;  5FPZ A;  4C91 A;  5GJ6 A;  1ACC A;  4QB1 A;  2K9Z A;  1POV 0;  5IJR A;  5FOJ B;  1W8U A;  1MPX A;  2D6L X;  2RS5 1;  4HK8 A;  3PIJ A;  3ZR6 A;  4FFG A;  5KC6 A;  1SG3 A;  3I2I A;  5KHI A;  1NZC A;  5DAV A;  4NAM A;  1N1S A;  2VQA A;  5IVB A;  2JIJ A;  1HJF A;  3LIG A;  4ATE A;  4CEY C;  4Z2W A;  3PVB B;  3WDY A;  1ZRE A;  3POF A;  2D6M A;  1AVB A;  1YIF A;  2WAB A;  3EJK A;  3FL7 A;  4LMF A;  5CAZ A;  2E9Q A;  4A7K A;  3ILR A;  3RYK A;  1JU3 A;  4Y3O A;  1YXW A;  4RA0 A;  3WNN A;  4N53 A;  5J36 A;  1EAH 3;  1JYW A;  3QH7 A;  1FI2 A;  2WFF 2;  4CP9 B;  4Z2A A;  1J3Q A;  1JMU B;  5F5I A;  2A6Z A;  4P9J A;  2W87 A;  3ZXF A;  5FP8 A;  2BZD A;  3KZ4 C;  2P5B A;  4QHO A;  4IV3 C;  2QTW B;  3BU7 A;  3H9A A;  4LA2 A;  3ZSE A;  5IYY A;  1D2S A;  1YNA A;  1NCQ A;  5A7P A;  5T54 A;  3VD7 A;  2VW2 A;  3QLQ A;  1W9F A;  3ZFF B;  1ZBA 2;  4EWA A;  4L8Q A;  5A32 A;  2YMZ A;  2WNE A;  2A3Y A;  3AMP A;  2EXK A;  3L2H A;  4MXW A;  5FBZ A;  1K12 A;  5EFU A;  4BZ4 A;  5C71 A;  5IK7 A;  1L7Q A;  4WM8 C;  1SPP B;  5JPN B;  5L9B A;  4WZC A;  5FQ0 B;  3I59 A;  1HQL A;  3AFG A;  3H3L A;  4YGC A;  1IS5 A;  3NAP C;  1EY2 A;  1PMI A;  2D40 A;  4HVO A;  5FZA A;  1Y7B A;  2DVD A;  2W92 A;  3VDA A;  3V0A A;  4C0B A;  2FZ1 A;  1U0A A;  1ND3 C;  2VQU A;  2ZMN A;  3GJA A;  1UYX A;  3WQ1 A;  2R07 3;  3EB7 A;  4IEW A;  5IFT A;  5FXZ A;  3UT0 A;  4OCT A;  4CDX C;  3VBH A;  2PXJ A;  3ENR A;  1US3 A;  5A3U A;  2HWF 1;  1CAW B;  4HMZ A;  5GLZ A;  1XYP A;  1AR8 3;  2KD7 A;  1JYC A;  1R64 A;  1UX7 A;  1OF4 A;  1LOE A;  5E16 A;  3BOW A;  5L73 A;  4NIG A;  4QMA A;  5JZG A;  1KXG A;  2R07 1;  2G9F A;  2VU9 A;  1CON A;  1LEC A;  1HN1 A;  2J1S A;  4IL7 A;  3AMM A;  4RHV 3;  5BY5 A;  1PVC 3;  3S7I A;  1PVX A;  4YW7 A;  1AR8 1;  1MEC 3;  1PZ9 A;  1ZBE 2;  2ET1 A;  2AEN A;  4HT1 T;  4O7X A;  2B9U A;  1TG7 A;  5KHG A;  5CKN A;  1F5F A;  3OPZ A;  1YFX A;  4S2F A;  4W6W A;  3ETQ A;  3VKL A;  4RHV 1;  1OA2 A;  3J7L A;  1PVC 1;  4OI4 A;  1CX1 A;  1H2M A;  2VOX A;  2QQU A;  4AGG A;  1PX4 A;  1OUR A;  4QD2 A;  4COW A;  1LOD A;  3IZO A;  1LES A;  3CZU A;  4DEV A;  4CEW B;  5GZE A;  1GLH A;  1RIN A;  4JHZ A;  1G6N A;  3VL9 A;  1ZRR A;  4EQV A;  4K1Z A;  4AGV A;  3MW2 A;  4A3X A;  5CIS A;  1GZ9 A;  4XEZ A;  4BYY A;  1RUF 3;  4CE8 A;  1JZ4 A;  2P6H A;  5K0U B;  2VEC A;  4XFC A;  1SEF A;  3LA3 A;  1Q8O A;  3SXW A;  4BQX A;  1EV1 3;  2WWS A;  4LIV A;  4AEK A;  5JOZ A;  5EP9 A;  3IWZ A;  4KWJ A;  5CBL A;  2ZX1 A;  3BIE A;  2CWM A;  4AVV A;  1POQ A;  1JH5 A;  1RUF 1;  3GZA A;  4LNV A;  2IXK A;  4P5H A;  1XU2 A;  3HN3 A;  5I0S A;  2PEL A;  2H0V A;  5B2G B;  2JG9 B;  1EV1 1;  5I8S A;  5F3G A;  4A6O A;  1KIT A;  5JXG A;  1PO1 3;  2WL1 A;  5A3N A;  2I2S A;  4DY3 A;  2YPD A;  2RV9 A;  2DYC A;  4CEW C;  1ENR A;  1EPW A;  1SLT A;  2NPI A;  2UU8 A;  2VMI A;  5FP9 A;  1DGW X;  1T6G C;  2RM2 2;  5A80 A;  3RRD A;  3WDV A;  5I8T A;  1VBD 2;  4FAH A;  4HOO A;  1UOF A;  3O0V A;  3A7Q A;  5LRR A;  5K0U C;  4UT5 A;  3U4X A;  1PO1 1;  5EHD A;  3T2Q A;  3AP9 A;  2VVF A;  1QJX 3;  5BPX A;  3W59 A;  4ET7 A;  4WM8 A;  4H7M A;  2ZGT A;  2ZAC A;  1NG0 A;  4AEM A;  2XHK A;  2GC1 A;  3OBR A;  1AYM 3;  3FN9 A;  4CA9 A;  1O4Y A;  1RJ7 A;  4UYB A;  4CCE A;  3VHP A;  2OYZ A;  1RUG 2;  2CAU A;  4XDO A;  1V00 A;  4FT8 A;  1WCQ A;  1RUO A;  5FP4 A;  2GMP A;  2JG9 C;  2H6C A;  2IWG B;  1BLZ A;  1ND3 A;  2VL4 A;  4IEV A;  4RR3 C;  4YG3 A;  1WMX A;  1VAK A;  4CP9 A;  4QX1 A;  4AVA A;  2JB8 A;  1OH4 A;  4HSJ A;  3POE A;  5FMC A;  4CDX A;  1AYM 1;  2WDB A;  2BVV A;  1G9F A;  5F5Q A;  5J98 B;  3ZKU A;  4ZHN A;  3D82 A;  1W2O A;  3RPQ A;  3ZFF A;  1AJK A;  5FMB A;  3U78 A;  1J3R A;  3HBK A;  1CIY A;  4DEQ A;  4CU7 A;  3ZN4 A;  4BQW A;  2D97 A;  3VKN A;  2D3P A;  1RGS A;  5D2A A;  1RUJ 2;  5TSW A;  1SPP A;  3BIW E;  4QX7 A;  3H3Z A;  1CR7 A;  4XBQ A;  5FQ0 A;  2AEZ A;  4KGG A;  5E89 A;  5C3S A;  3H1W A;  3KCC A;  3K77 A;  1EUU A;  2J1U A;  2JXA A;  2OQ6 A;  4PJY A;  4XAC A;  2IZW A;  1LTE A;  4B1M A;  4QGN A;  2JE7 A;  2XUE A;  3BTA A;  5A7S A;  3VBU C;  2UY9 A;  1SDD B;  2ATF A;  3HMY A;  1OKO A;  3RZK A;  3MV0 1;  5K8S A;  3BYW A;  2Q4S A;  2XR4 A;  4OQ9 A;  3MID A;  3ZR5 A;  2WT0 A;  1UU6 A;  3ON7 A;  3NV1 A;  1XNC A;  4DXS A;  5FZK A;  1BCX A;  1PNG A;  3VBO B;  1VAL A;  1RUE 2;  5LBF A;  2QQO A;  3U11 A;  4EWD A;  2W47 A;  1GFF 2;  1W0P A;  2JDM A;  4D6Q A;  4MET A;  3EBR A;  3FHQ A;  4ATF A;  5IK8 A;  4DQA A;  3KF5 A;  3UJQ A;  5A3T A;  4XUT A;  2WZ8 A;  3C2U A;  5DAQ A;  2VTX A;  3FE5 A;  1R09 3;  4P08 A;  1YQC A;  5C3P A;  1V6J A;  1ZA4 A;  1OC1 A;  1UY0 A;  1W9S A;  4N7I A;  3D6E A;  3CHX A;  3ZYR A;  2JG8 C;  2L9L A;  3M8L A;  4YVW C;  5FP3 A;  4AFB A;  1DQ6 A;  4BQ4 A;  1S1A A;  2HWC 1;  5LZ6 A;  3ZSL A;  1R09 1;  4M3C B;  1ENS A;  1WGP A;  4DNY A;  2YHJ A;  4OUL A;  1TEI A;  1S55 A;  2RJL A;  4CEW A;  3VBO C;  3CQO A;  2NMN A;  4UF0 B;  4UFH A;  3WG4 A;  1BMV 2;  3KQ4 B;  2YC4 A;  2ZGN A;  4Y1Z A;  4IES A;  4R9C A;  3FLR A;  1F5J A;  3D0S A;  5K0U A;  3WSO A;  1HW5 A;  2J22 A;  3T30 A;  1J1T A;  4MV2 A;  4U36 A;  5A7Q A;  3TNQ A;  4W4Z A;  3AJY A;  1OUS A;  4JCK A;  1SFY A;  3DEM A;  3OYW A;  3A22 A;  1D4M 2;  5FTT C;  2N7G A;  3RS6 A;  1YCI A;  4NID A;  4LO6 B;  3P5B A;  1UYP A;  1ZZB A;  4JTO A;  2VUJ A;  1D4V B;  1KS5 A;  2F4L A;  1OFN A;  1RXF A;  1X9P A;  2EXH A;  5CA6 A;  4QQ2 A;  2HEY F;  3UET A;  4W6Y A;  4OHY A;  1TME 3;  2JG9 A;  3HEI A;  3Q8B A;  4JGZ C;  4X6R B;  1CD3 G;  2XJQ A;  1ZZ8 A;  4C90 A;  4F7Z A;  2AZ5 A;  4PHZ A;  4DOU A;  2BFU L;  5A3W A;  1CPN A;  1LED A;  3ZYP A;  1T2X A;  3T1M A;  5FO8 B;  1JBC A;  3FWE A;  4B4R A;  2W1Q A;  2HBT A;  4W8J A;  4BE3 A;  1BVP 1;  1TME 1;  1XE0 A;  2WQZ C;  2PHF A;  1D0G A;  1UU5 A;  1ONA A;  1Y43 B;  3CIH A;  3EXU A;  3OBZ A;  4G4F A;  4NHX A;  4XDP A;  3UL2 A;  5JMC A;  4HG6 B;  1S0F A;  2WO1 A;  4FTB A;  5F1R A;  5FPV A;  4FOW A;  2VOW A;  1NLR A;  1U5I A;  3WF0 A;  3LKJ A;  4JKK A;  1W28 A;  4MUV A;  4XMA A;  3SNM A;  4ORF A;  5J96 B;  3PJY A;  4ERO A;  3VBU A;  1AZD A;  2AYH A;  2Y6H A;  2WT2 A;  1Z78 A;  4C1X A;  4FO9 A;  4CP2 A;  4QPI B;  3B69 A;  4LLF A;  5CYY A;  5DUX A;  1NXD 1;  5A6Q A;  3UNP A;  2WNU C;  1ULG A;  2VO5 A;  5FYM A;  2ZGL A;  1XQN A;  4FPJ A;  3DYM A;  1YQ6 A;  2NM1 A;  4QXK A;  3POW A;  3MLJ A;  5FZ9 A;  3RSJ A;  4AHY A;  1NZI A;  1ZX5 A;  3ZFG C;  2VME A;  1COV 3;  1CGP A;  5CG8 A;  2D3R A;  3DV8 A;  4OUM A;  3MW3 A;  3ES4 A;  1JZ2 A;  3LE0 A;  1LOF C;  3K51 A;  2Y26 A;  3C8X A;  4QX0 A;  5FXW A;  2ZX0 A;  4XTM A;  5D21 A;  5AC9 1;  1PM4 A;  2VZV A;  2JEM A;  3I7D A;  3AP6 A;  1COV 1;  3KLS A;  2JDZ A;  2WS9 2;  3TN9 3;  4KNC A;  2YZ4 A;  3KT4 A;  4CU6 A;  1NAE A;  3LPF A;  3N4M A;  4XYX A;  2JG8 A;  1OQD A;  1ND2 B;  1VBE 3;  3OSD A;  5L36 A;  2D98 A;  1GP4 A;  1GIC A;  2W94 A;  1HRI 2;  2JDK A;  2QQL A;  3T08 A;  1HLC A;  3VBO A;  2VW1 A;  3E6D A;  4ASK A;  1LOC A;  4Q0P A;  5FZ3 A;  3TYJ A;  2XJP A;  5GLW A;  2R06 3;  1RUC 2;  2R32 A;  1DQ0 A;  1QJE A;  1VBE 1;  4XIL A;  1Q8P A;  5HV4 A;  3RZG A;  4Q4W 2;  1AX2 A;  4I01 A;  3Q9O A;  2ZBJ A;  1X8E A;  4D7S A;  5BUV A;  1PIV 3;  2ADE A;  1R1A 2;  3IKW A;  1AR9 3;  1V6L A;  3FC0 A;  3N9O A;  2W52 A;  5T3N A;  5EIY B;  3MIE A;  3MGU A;  2CNA A;  5KWR A;  2RJK A;  5CFD C;  2R06 1;  3RFR A;  3H1M A;  4LA3 A;  3PIG A;  3ZVX A;  1S0G A;  3S0M A;  5FPX A;  2WR9 A;  3AZZ A;  2WNO A;  3HOB A;  5IVY A;  3ZN6 B;  3PUQ A;  2BGC A;  5FLH A;  1PIV 1;  1EUT A;  1UZ0 A;  3CDZ B;  2Q30 A;  4FI9 A;  2FCV A;  4M3C A;  5FZI A;  5EJ3 A;  4I2O A;  4ZS2 A;  2GAL A;  3FUO A;  2XL9 A;  4YSF A;  2CU5 A;  3H1Y A;  4P9X A;  4UF0 A;  2O8O A;  4QXB A;  2AC1 A;  1W6M B;  5I93 A;  2YG0 A;  1ENQ A;  2Z4F A;  3ASI A;  1UNB A;  2Y8K A;  3MPB A;  5T5P A;  2C6S A;  5IHR A;  3TAY A;  1MAC A;  1RUN A;  1GQG A;  3AZV A;  3SEE A;  5J7M A;  2I74 A;  2HWD 2;  1TMF 2;  2VUC A;  4NRM A;  1RHI 2;  2XKO A;  4HKW A;  4DUV A;  1H6X A;  1CZV A;  4DIN B;  1F2N A;  2VZR A;  5GZG A;  1KJL A;  3KQR A;  4XUQ A;  2V5D A;  4LR4 A;  5C33 A;  1WME A;  4LBN A;  5F2W A;  4ASL A;  1RC6 A;  3NMB A;  1XYO A;  4GUL A;  1B35 C;  1ULC A;  3H50 A;  4QX2 A;  1Q8Q A;  5A33 A;  3DYP A;  1W9T A;  5BNO C;  5BNP C;  4K20 A;  3LDK A;  5JAX A;  4OMD A;  1DGR N;  1Q8V A;  2DCZ A;  4NVP A;  3W5N A;  3USU B;  3BOD A;  2FQP A;  2OZJ A;  4CYD A;  3TEX A;  2OA2 A;  2W1S A;  2WNU A;  3C7O A;  4LBQ D;  3T4H B;  4BXS V;  3E97 A;  3LSE A;  3O5S A;  3Q8A A;  3S5A A;  3ZFG A;  5LK7 B;  1W6N B;  3WOG A;  1C1F A;  4HL0 A;  3JB8 A;  4NWW A;  4M01 A;  1LOF A;  1QXR A;  4I30 A;  4CDQ C;  3CEW A;  2GC0 A;  1HDK A;  1QH6 A;  1UL9 A;  5DDJ 3;  2UUR A;  5F5A A;  2ZCW A;  1NKG A;  4A7Z A;  4NRQ A;  2W1U A;  4ARX A;  4MVT A;  4IV1 C;  3CO2 A;  1VE0 A;  2F6B A;  1PGW 2;  1V9U 3;  1YJL A;  2HEW F;  2NLR A;  1O4T A;  4E27 A;  1OXC A;  5JUV A;  5C5T A;  4JDO A;  4OZX A;  5DDJ 1;  1SZB A;  5FMO S;  1XPW A;  3VB9 A;  4Y1V A;  2KXL A;  4ZU5 A;  2VUA A;  3HNM A;  2QQK A;  3WP5 A;  1V9U 1;  1GSL A;  1R08 2;  1RXG A;  2XBO 3;  2Y34 A;  1C3H A;  4E4Z A;  1XYN A;  1D0H A;  1PGL 1;  3ZIW A;  1UMH A;  5F2S A;  3ZYJ B;  2OZ6 A;  4D94 A;  2Q8O A;  4QPY A;  5FOB B;  2YC0 A;  3DXU A;  2QZ3 A;  1UOG A;  1W05 A;  4K9S A;  1RVF 2;  4K40 A;  2VH9 A;  2XBO 1;  2ZGU A;  3RZJ A;  1FMD 2;  2WZR 1;  2Y6L A;  4M0N A;  1IKP A;  2GZW A;  5CFD A;  5FYZ A;  1GOH A;  1YQ2 A;  1W3X A;  3MZH A;  2WAO A;  4YM2 A;  5FYC A;  1NA1 B;  3CNA A;  2W95 A;  1XND A;  3LEI A;  2WFP A;  4NUB A;  4QM8 A;  3IT8 A;  1SFP A;  5T5O A;  3AZY A;  5IVV A;  2Z5W A;  4LUL A;  2VG9 A;  5A3P A;  3K75 B;  1Q5O A;  2C9K A;  1OQE A;  2R04 2;  4K8F A;  4KU8 A;  3T0D A;  3I2G A;  1JUH A;  1KRI A;  1A3K A;  4AW7 A;  3BU0 A;  2PQQ A;  4Q8K A;  2B46 X;  5A3L A;  3T2T A;  3WEZ A;  3I49 A;  4JGY B;  3ZYG A;  3N7L A;  1RMU 2;  5IVF A;  1MZF A;  2DBN A;  3N7K A;  4Y22 A;  4CCN A;  3MIH A;  5A1F A;  1SLL A;  5FCC A;  4GKX A;  4BH9 A;  1B35 A;  1FXZ A;  3P6B A;  3ZN6 A;  1LGC A;  5BNO A;  3HD8 B;  5BNP A;  2QKD A;  5A7W B;  1NA1 C;  1QKQ A;  2JEC A;  4OLL A;  3I2H A;  4ZU4 A;  3I2F A;  5FRA A;  2ZEX A;  4AI2 A;  2CGO A;  1V6O A;  2YYO A;  2VNG A;  4AI0 A;  3PVE A;  1AR7 1;  1K45 A;  1QNY A;  2WRA A;  4R9D A;  4BIF A;  5JIU A;  1W6M A;  2RMU 3;  3C7E A;  4QHB A;  3ZYH A;  2PHT A;  4MG2 A;  2JDH A;  3HVD A;  1LHO A;  1VBC 3;  4GH4 B;  2ZGS A;  2BGP A;  4FTE A;  2YBK A;  2RR1 2;  4Q4V 3;  2HEV F;  4CDQ A;  4JGY C;  3BAL A;  2IUW A;  1OLQ A;  3HPN A;  3OBT A;  3QD6 A;  4WBB A;  1OBN A;  1RUI 2;  4IGQ A;  5FP7 A;  4XF9 A;  2RMU 1;  5FZ4 A;  5CFC B;  2GAU A;  2VY0 A;  1UOJ A;  2A75 A;  4P02 B;  5DAB A;  4YW5 A;  3VBF B;  3WNK A;  1JYX A;  1O8S A;  2VJX A;  1CAX B;  2OS2 A;  1SHW B;  4IV1 A;  1VBC 1;  4W65 A;  3NJV A;  4B4P A;  1UO9 A;  1W06 A;  4Q4V 1;  1CES A;  1GBG A;  3FFQ A;  1JZ3 A;  2ZKN A;  3PDQ A;  4JKL A;  3USU A;  4LHL A;  4D6S A;  3AP5 A;  5D1I A;  5JI9 A;  3N36 A;  1FOD 3;  3U14 A;  2C9A A;  4BXF A;  1OOP C;  3J8F 3;  3WQB A;  4PLM A;  2WLP A;  4MSV A;  4Q26 A;  4GWJ A;  1YQ8 A;  2ARA A;  1MR5 A;  2GDF A;  4IDZ A;  5FJH A;  5G05 L;  1O3R A;  1QH7 A;  1GQH A;  4MAD A;  1LEM A;  1L3J A;  4K3U A;  5FK7 A;  3K3N A;  4FTS A;  1VIW B;  2VC9 A;  4MGI E;  4UFI A;  1FOD 1;  2ZHL A;  3OD4 A;  4YW1 A;  3RMY A;  1AL2 3;  2RS1 2;  2VBP A;  4IXL A;  4LPL A;  3URF A;  1BVV A;  1DGW A;  2HYX A;  5L7O C;  4YGB A;  4N53 C;  2ZAA A;  2P3J A;  3K4A A;  3O1V A;  2EA7 A;  4RN5 A;  1IG0 A;  2E6V A;  4QDR A;  3AX4 A;  5ACA 3;  3UGH A;  2QDN A;  1F8V A;  3TNP B;  1AL2 1;  2HKX A;  3HWJ A;  5I0T A;  1QNW A;  4C1W A;  4XF0 A;  3W5M A;  1QJU 2;  5CB7 A;  4JV4 A;  2VZQ A;  1NCQ C;  2ET7 A;  2W0X A;  4WVV A;  1W9Y A;  3ZXJ A;  4ISR A;  3PNA A;  1DP0 A;  4PDW B;  2BBA A;  2OT7 A;  5ACA 1;  1YC6 1;  2P3K A;  2GU9 A;  3SHR A;  3OBA A;  5A3M A;  3WY6 A;  1TZO A;  2HWE 3;  4OI1 A;  3ME2 A;  2C4X A;  3TRS B;  2ZGK A;  5E6H A;  4P14 A;  1RUD 1;  2UWA A;  1UCX A;  4HPK B;  1W8O A;  1OLM E;  2D6O X;  4LO5 B;  1Q56 A;  2LUW A;  2WNV B;  2FDG A;  5ABJ C;  4GXL A;  3MW4 A;  5T52 A;  2EAL A;  4R4X A;  1XNK A;  2YRO A;  2HWE 1;  4DB5 A;  4QM9 A;  1NA1 A;  1ENX A;  5ANQ A;  3FLT A;  4XBL A;  3RMX A;  1UZV A;  1WW6 A;  1Q8S A;  3AL6 A;  5CIR A;  3B3Q E;  1NOV A;  2ZML A;  4PDW C;  3GDB A;  4Y1X A;  1W8Z A;  2A6X A;  1IHM A;  3OF1 A;  4AOC A;  1RB8 G;  4Q8L A;  2Q8C A;  3ZXG A;  4Q4Y 2;  4C0H A;  5GLU A;  1JYV A;  2WFF 3;  4JGY A;  4KQ7 A;  1W6Q A;  2ZZJ A;  4NE9 A;  4L9B A;  4M00 A;  5AVP A;  1W8T A;  3SH5 A;  3GAL A;  1FPN 2;  3GYD A;  5K4L A;  1LJ7 A;  3RQ0 A;  2VZO A;  5DXD A;  1LU1 A;  1N1V A;  1PO2 2;  3ALQ A;  4Z92 B;  1QDO A;  1ZBA 3;  4NWV A;  4CDW B;  5A7W A;  2VBD A;  4X8P A;  1Z7S 2;  3FMG A;  2B5H A;  2PQS A;  2XVK A;  4EN6 B;  3VD9 A;  5LA0 A;  1QJY 2;  2BVB A;  4XUO A;  4DPN A;  4YZ2 A;  4FOQ A;  1UZW A;  3AVS A;  1WLW A;  1OOP A;  5CVR A;  4BMB A;  4EN8 B;  1QOT A;  3WF4 A;  2WQ8 A;  2DCK A;  1ZBA 1;  2D7F A;  2Z2S B;  3IMN A;  1JHJ A;  5JSR A;  4NIA A;  5JDB A;  4PIY A;  1PX3 A;  1F4A A;  4XFB A;  1UY4 A;  2QQJ A;  2WT1 A;  1FX5 A;  3I3Q A;  5A1L A;  3VUO A;  3VBF A;  3VLB B;  5L7O A;  3JXS A;  1CAX A;  1G86 A;  1LCL A;  1UU4 A;  3E5Q A;  3VGI A;  2CTV A;  1A6C A;  3LCP A;  2BBV A;  1N47 A;  1PHM A;  3VKO A;  2BUK A;  1QIQ A;  3A21 A;  3T2O A;  2Q5T A;  1T6B X;  4DXT A;  5B4X A;  2EXJ A;  3MPP G;  5IK4 A;  1RUH 2;  1ZBE 3;  4LIT A;  5J09 A;  5FYI A;  1MQT B;  1N3Q A;  4XC9 A;  5HV0 A;  3RI8 A;  2B8M A;  3M7A A;  5JSP A;  2W2I A;  2VR4 A;  1KDK A;  2BP6 A;  3UES A;  2BNN A;  4GJY A;  4L11 A;  4CXX A;  5FZB A;  3O1U A;  1VBB 2;  1PM7 A;  5EWS A;  1S0E A;  4B7E A;  5BV6 A;  3BTZ A;  2P34 A;  3NQH A;  4MGK E;  5DN2 A;  4DRV A;  3RZZ A;  1GMM A;  1ZBE 1;  3IBM A;  1S2E A;  4KG0 A;  1W9W A;  2HWF 3;  2XKP A;  1VBA 2;  4YNI A;  1DU3 D;  1ASJ 2;  3IAQ A;  1KEX A;  5A6Y A;  3ACL A;  3H8U A;  4K21 A;  5ABJ A;  2H0B A;  2ZGO A;  3BPS A;  5F6L B;  3DCQ A;  2IVI B;  1XBF A;  2F17 A;  4IEX A;  5C9A B;  1O3T A;  2NP0 A;  3JCI A;  2YC2 A;  3M3C A;  5EJZ B;  4JDM A;  3ZFF C;  1PK6 B;  4UFL A;  4WVZ A;  4V1P A;  4QKB A;  4PDW A;  3I3M A;  4P9L A;  1JZ8 A;  3OEA A;  1NCR B;  4NAO A;  4YVS B;  2R0F A;  1JZ5 A;  1UY2 A;  4QKN A;  2CDO A;  4QGL A;  2JB4 A;  3AYA A;  5LA2 A;  4CUC A;  3KWV A;  3B00 A;  4UW6 A;  4CXY A;  2W91 A;  4XW3 A;  2IC1 A;  1DQ2 A;  4HPK A;  4AQS A;  2DCJ A;  5FMO L;  4O9G A;  3LFI A;  1D7P M;  4CP1 A;  2JDY A;  5JR2 A;  5AVA A;  3P1I A;  4YM0 A;  2XDV A;  5CZK A;  5EPA A;  2Z79 A;  4Q29 A;  2W68 A;  5EYX A;  1VBD 3;  3ZDV A;  3ROU A;  4BIO A;  3M3Q A;  4XFA A;  5FY0 A;  4XMI A;  4FAG A;  4BLJ A;  4A3Z A;  3AZW A;  1EAH 2;  2WYS A;  2UYB A;  1ALY A;  3J7M A;  3LEG A;  5E8A A;  5JIA A;  1JW6 A;  4YYO A;  5AC9 3;  2QQP A;  5FY7 A;  2OQ7 A;  2XLF A;  3OEB A;  4OYU A;  1X82 A;  2E26 A;  3AMN A;  3H0O A;  4M4P A;  2DBI A;  2GC2 A;  5FYH A;  5AFB A;  2RM2 1;  5FXV A;  3BPZ A;  2G9G A;  1VBD 1;  3MUY 1;  1FAT A;  2IXL A;  4YVS C;  1NCR C;  1RUG 3;  2E7A A;  2QQN A;  1CQ9 A;  3ATG A;  4MXV A;  1GAN A;  3AKS A;  4R8H A;  4PQ9 A;  4KL1 A;  3DPR B;  5J37 A;  1JYI A;  4CU8 A;  4FPO B;  2XG3 A;  3FX3 A;  3VZM A;  1H8T B;  2QCS B;  5FZO A;  1KFX L;  3PTR B;  1VRH 2;  3MFC A;  2X8K A;  1RUG 1;  3R05 A;  2EIG A;  3OUJ A;  3RI9 A;  2KM2 A;  2FBE A;  1OUX A;  1UOB A;  2FMD A;  3KV5 A;  2PHX A;  2ZGR A;  3RWN A;  1H2N A;  3JB4 C;  3WG1 A;  3VDD B;  1UKG A;  4CDW A;  3RGB A;  2V73 A;  3B02 A;  1HB4 A;  3R4S A;  4LO4 B;  3MI8 A;  1O59 A;  1F35 A;  2R49 A;  1RUJ 3;  1LRH A;  3HN1 A;  3LQC A;  3SCG A;  3VZO A;  1ZRI A;  3KCY A;  1PNF A;  5FO9 B;  4TTG A;  4K1Y A;  4M3C F;  2QQM A;  2K46 A;  1GUI A;  2G9Z A;  2FCT A;  1OMI A;  3M70 A;  4MZU A;  1RUJ 1;  2RS3 2;  4P9Y A;  3PUI A;  1HN0 A;  4CVU A;  3GZT B;  2DUP A;  1H8T C;  4CPB A;  4BQY A;  3JD7 2;  1BYH A;  1MEC 2;  4NO4 A;  5HCB A;  4JRA A;  4WVW A;  5DG2 A;  4KH9 A;  3VDD C;  3I8T A;  4GWN A;  1HRV 2;  2IFR A;  2ETE A;  3THD A;  1AJO A;  2BTV C;  5C3R A;  5L9R A;  4HAN A;  4V2V A;  1IG3 A;  1UMI A;  2RG4 A;  1RUE 1;  1NE4 A;  3N9N A;  5CKQ A;  3WQ7 A;  3WCR A;  4S2G A;  3M1H A;  5FY9 A;  2A73 B;  4L97 A;  2Q1M A;  5FZ1 A;  2VVE A;  1DYP A;  1YRZ A;  5GKA C;  3WDU A;  2VW0 A;  1L7L A;  3IPV B;  5F6K A;  2FMY A;  4JX0 A;  2ZXQ A;  3BTY A;  4AFM A;  4BQ3 A;  2QVS B;  3VDC A;  1BEV 2;  1LU2 A;  2VUL A;  2ZEY A;  4I3P A;  1MS9 A;  4ZKT B;  5DUU A;  1H4G A;  2WN3 A;  3MV1 1;  3LD8 A;  2P2K A;  2LM3 A;  2JD4 A;  3D0J A;  3ZM8 A;  2J42 A;  4XF4 A;  4LBQ B;  4LT5 A;  3D8C A;  2WQ4 A;  5C9A A;  1G9C A;  1CAW A;  2FDF A;  5FKB A;  3OTF A;  4HN1 A;  1TNR A;  1BMV 1;  1D4M 3;  3ABZ A;  4KI5 M;  4PI0 A;  3CKH A;  4FVV A;  1AX1 A;  5C4W B;  4RGK A;  3BCW A;  4XAA A;  1HXS 2;  1NCR A;  2XQR A;  2EVX A;  4YVS A;  5IUQ A;  1BBT 2;  5J1X A;  4R4Z A;  3BVC A;  3T4V A;  5HBA A;  2HWC 3;  3I54 A;  1MS3 A;  1ZRC A;  1I5P A;  1D4M 1;  4AQT A;  2DWR A;  4FFH A;  3LIH A;  4HVR A;  4CDU B;  2VZ3 A;  4DZG A;  3IAP A;  1LOG A;  3LA7 A;  4YZ5 A;  4DXR A;  1YYN A;  3E1F 1;  4XIO A;  5FPU A;  1CAU B;  4YW2 A;  5C3O A;  4DXZ A;  1POV 3;  2PN5 A;  5FR3 A;  3TEW A;  4P9G A;  1CWP A;  2VTF A;  3OUH A;  4Y4Y A;  4AVC A;  4N90 A;  1WKY A;  3O0X A;  1UW8 A;  3W21 A;  4AQ2 A;  4MGS A;  1EP0 A;  2VUD A;  2WC2 A;  4RFR B;  2PHD A;  2DCY A;  3PTY A;  3UGG A;  2EXI A;  3VHR A;  4PBP A;  1UX6 A;  4BLI A;  4LBL A;  1MS4 A;  1POV 1;  4NHY A;  1UKR A;  2BWA A;  2VMC A;  2WA4 A;  3SKV A;  1NY7 2;  4AVT A;  3DPR A;  4EE2 A;  5F8P A;  4JC1 A;  4XFG A;  3ZPY A;  1K5M B;  3OGS A;  1YIP A;  1H8T A;  2PAE A;  3HR9 A;  5A6Z A;  1X50 A;  2IFW A;  2CL2 A;  1HB3 A;  3QBQ A;  4UFM A;  3S6P A;  3POY A;  4ZZ8 A;  3AZX A;  2OXB A;  2F4P A;  3KM5 A;  4PF5 A;  5ERL A;  4CTE A;  3VDD A;  2E32 A;  2VMG A;  4LUK A;  3Q8F A;  1QOS A;  5DUV A;  2OKX A;  4P9W A;  1V6M A;  3UKV A;  4QKD A;  4XZU G;  2P4E A;  3ZFE B;  3V65 A;  4D8M A;  2HJI A;  4MHU A;  4PCR A;  5EZW A;  4B29 A;  5KBF A;  3DUI A;  1ZYB A;  5G04 L;  5D8A B;  3EMR A;  4IE4 A;  3LWC A;  4NOT A;  4OI2 A;  4L0P A;  3SKJ E;  3E6C C;  4YLZ A;  4EN7 B;  1S0B A;  2E7T A;  2VNO A;  4LQR A;  2QQW A;  1JN2 P;  1APN A;  4Q0Q A;  2ADD A;  2XML A;  3N9Q A;  4I09 A;  2Q1Z B;  1HRI 3;  5KHH A;  1W3V A;  5T5L A;  4Y33 A;  2WS9 1;  3KSC A;  1RJ8 A;  2AAC A;  2GH2 A;  2IXI A;  1RUC 3;  2IVJ A;  2XQX A;  3NV4 A;  4FPE A;  4Q4W 3;  2XPJ A;  5GAL A;  1FNZ A;  4NR1 A;  5JPM B;  2A5Z A;  1VRB A;  1HRI 1;  1Q3E A;  2VMH A;  3ZFE C;  1WLD A;  4OHX A;  1R1A 3;  2CYF A;  2VVD A;  2XL7 A;  2LRO A;  4XE9 A;  2YDE A;  3MEP A;  5F32 A;  2C0Z A;  4WM7 B;  1TQ5 A;  2VCA A;  3JU9 A;  3POB A;  3EYP A;  1RUC 1;  3HQX A;  4H3W A;  4LKS A;  2BRT A;  3H7J A;  3O14 A;  2G4I A;  3J7H A;  1ZZ6 A;  2P37 A;  4Q4W 1;  2TNF A;  4SBV A;  3VBS B;  4BQ5 A;  3IPV A;  5J48 A;  1UIJ A;  4YFW A;  2E51 A;  4F3J A;  3VZJ A;  1OD3 A;  1LGB A;  1R1A 1;  1G7Y A;  1DF0 A;  2JDA A;  5BNN B;  3DGT A;  4BHP A;  3HNY M;  2XON A;  1I6X A;  5H9P A;  4KG8 A;  3SQO A;  4NRP A;  4XET A;  3WW2 A;  2TBV A;  4MOA A;  4QPI C;  1SLC A;  4LBQ A;  3BKZ A;  1SAC A;  1JI6 A;  1XNB A;  1TMF 3;  1RHI 3;  4OUE A;  4Q4X 2;  1WLT A;  5I0U A;  4ZON A;  4AAP A;  3HT2 A;  3VHN A;  1UWW A;  2Z42 A;  4HKO A;  5LBE A;  1SBE A;  4FXG B;  4WM7 C;  2WWJ A;  2QDR A;  5C4W A;  4E4S A;  1XRU A;  5HCA A;  3O1R A;  4JRL A;  5JR7 B;  2AR6 A;  2HWD 1;  1A8D A;  1TMF 1;  1G8W A;  3PVO A;  1RHI 1;  3VBS C;  3ZYF A;  5DZE A;  1WD3 A;  3GJB A;  5DPN A;  3JQW A;  2P17 A;  3N7J A;  1UZZ A;  3CLP A;  3ILN A;  3VKM A;  5F7U A;  4LEJ A;  3AB0 A;  2V5Y A;  5BNN C;  1H30 A;  2ZX2 A;  1AF9 A;  4AK3 A;  2KR2 A;  2ZX4 A;  4CDU A;  4FOY A;  1UPS A;  3C7G A;  3NVC A;  3LGR A;  3PU3 A;  4LE4 A;  1V6N A;  4A42 A;  1ND2 C;  2HBU A;  2OII A;  1MS5 A;  1BQP A;  2VQT A;  2RDN A;  1Y9M A;  1J1L A;  3U4S A;  5I0R A;  5FZ6 A;  3WNM A;  3RVH A;  2V4A A;  4JVA A;  3WHU A;  4ZXE A;  1X8M A;  2NYY A;  1NX9 A;  2K2S A;  2RHP A;  2J1R A;  3L2Y A;  4Y24 A;  1YEW A;  5JLV A;  4QAW A;  1YI7 A;  5K9Y A;  1UD1 A;  1YLL A;  3LFM A;  2BOJ A;  5KC5 A;  2J1E A;  5CKM A;  4AYU A;  4BCU A;  2DUR A;  1QQP 2;  4Y1U A;  4CCL A;  1K3I A;  1CX4 A;  4OHZ A;  4IEY A;  2G19 A;  5LB6 A;  1WW7 A;  3U37 A;  1IQA A;  1OFS A;  1PGW 1;  2CV6 A;  4YW3 A;  1R08 3;  1DQ5 A;  3TN9 2;  1J59 A;  3CZJ A;  1J83 A;  1X36 A;  2WBK A;  3FLP A;  4YRD A;  2XHN A;  1WW4 A;  2QUO A;  2ORZ A;  4YGE A;  3AYD A;  4JQT A;  3ETP A;  4XFH A;  3AP7 A;  1WMD A;  2WJS A;  3CJI B;  4UXA A;  5JMO A;  5JXI A;  1WBL A;  3LDR A;  3ZFE A;  2YGM A;  1QY4 A;  1RVF 3;  1WCS A;  4NII A;  3GNE A;  1O7F A;  1R08 1;  2PYT A;  1MS0 A;  3C7F A;  1FMD 3;  1JS9 A;  3PUH A;  3B01 A;  2QQV A;  1D2Q A;  2PHU A;  3R0R A;  1S0J A;  4MGZ E;  2EID A;  3K46 A;  4XQ4 A;  5IAX A;  5FO7 B;  2YPJ A;  3LA2 A;  4XHB A;  5KHK A;  3PLQ A;  5JXJ A;  1RVF 1;  1DHK B;  3JBG 2;  3USS A;  4AFC A;  1AR9 2;  1FMD 1;  1J84 A;  3POG A;  4GZ9 A;  5T50 A;  2Y6G A;  3VBR B;  1QGL A;  1F31 A;  2R04 3;  4IEO A;  4E9K A;  1HB1 A;  5DAP A;  4QPI A;  4MH0 E;  4XVH A;  1B09 A;  1CZT A;  3T2P A;  4BB3 A;  1BZW A;  3I3D A;  2DFC A;  2BV4 A;  4Q0S A;  5I0D A;  2QNK A;  1GZT A;  2GNB A;  4QWN A;  4AED C;  1RMU 3;  3LF7 A;  2R04 1;  3AL5 A;  3LSD A;  2WZR 3;  3QOP A;  4WM7 A;  3ZMO A;  3WD5 A;  5DZF A;  1ODM A;  1AR6 2;  3N35 A;  1BK1 A;  4EN0 A;  2E7Q A;  2GN7 A;  4TSV A;  3R4U A;  1CIW A;  1MZE A;  5ISL A;  3VBS A;  4H14 A;  4A44 A;  3U10 A;  1UN1 A;  1RMU 1;  2R1B A;  3AC0 A;  3ZSJ A;  1OA4 A;  2V72 A;  3LEK A;  4TN7 A;  5BNN A;  4BOW A;  4A45 A;  1E5S A;  2D3S A;  4XJZ A;  4Y5S A;  3OOX A;  2JE9 A;  4MHR A;  5CEH A;  2JIC A;  2H6B A;  4PBO A;  1E5H A;  3IB3 A;  5SV8 A;  4AFD A;  1GNH A;  5FYB A;  1ND2 A;  2LW8 A;  3IN9 A;  2GC3 A;  1W8W A;  3LOB A;  4FPK A;  2RR1 3;  3MF9 A;  4YGD A;  4LOT A;  4B4Q A;  3MIB A;  2C24 A;  3J4U H;  5FV3 A;  4AQ6 A;  2WSV A;  1P8J A;  1QEX A;  4COY A;  1RUI 3;  2D43 A;  4GKY A;  1Y9Q A;  2WZE A;  4JDN A;  4M3C E;  1C4R A;  4ZPI A;  2JX9 A;  4IEZ A;  2DVA A;  2DDU A;  3UJO A;  4YZ1 A;  3F2Z A;  5KHJ A;  4LIU A;  3ZMN A;  3AYC A;  3VKF C;  4RFT 0;  3RYP A;  2YBS A;  4YG0 A;  4E2S A;  2RR1 1;  5JCT A;  4GWM A;  3W9A A;  1O3Q A;  1HV0 A;  5GM0 A;  1RUI 1;  3J9S A;  1KDM A;  4A2U A;  1AR7 3;  2WUH A;  5CG9 A;  1O91 A;  4AI3 A;  2ERF A;  1SBF A;  4AHW A;  2B9V A;  1AUY A;  1OPO A;  3PJQ A;  4AGR A;  2DVB A;  4HON A;  3BI3 A;  4BQ2 A;  2ARC A;  2FCU A;  3NW4 A;  3ACI A;  4OI0 A;  1OKQ A;  2VCC A;  4O9E A;  3WV6 A;  1KJR A;  1GWM A;  2XB6 C;  4CU9 A;  1REF A;  2ENR A;  4LE3 A;  3VZL A;  1KQR A;  3FHI B;  4GD4 A;  2RS1 3;  1DGL A;  4WZF A;  1H0B A;  2EIB A;  1GP5 A;  2B4K A;  4Q1P A;  2W3J A;  1VAV A;  2OX0 A;  4GWI A;  3ZKY A;  3APB A;  1A34 A;  4QGM A;  3NJY A;  3T0A A;  4AI9 A;  4XJ8 A;  4BDV B;  4XAB A;  2QBX A;  1BKZ A;  1AXK A;  1KS4 A;  1S0I A;  2RS1 1;  2ZEW A;  1IGO A;  3I4I A;  3I97 A;  4Q27 A;  2DUQ A;  1SLB A;  4BK5 A;  5LEK A;  1QJU 3;  1W99 A;  2RE9 A;  3IMM A;  1OVS A;  5SV5 A;  4F83 A;  4UW4 A;  3TOJ A;  3SH3 A;  1O5U A;  3VL8 A;  4D69 A;  2UY8 A;  4FPH A;  1C57 A;  2OPK A;  3CJI A;  3KMH A;  3P3P A;  3THP A;  5JOW A;  1QJU 1;  4FP2 A;  4IND A;  4E2G A;  1A78 A;  1CPM A;  4XCB A;  3T1L A;  2LTN A;  5F39 A;  1W6N A;  2DUO A;  4XXA A;  2Y64 A;  4GH4 C;  2WIN B;  3GF6 A;  4XPV A;  1LHW A;  1DGR A;  1OQ1 A;  3HJR A;  4XFI A;  4PQQ A;  4Z82 A;  4H7L A;  1E57 A;  5EJ1 B;  1DZR A;  1WCK A;  2CGN A;  3MBW A;  5ANN A;  3CL1 A;  1LEN A;  1RIR A;  3VBF C;  4LBK A;  3GZE A;  2W46 A;  4DO0 A;  1RIT A;  4IE5 A;  4QX8 A;  1UYZ A;  1A8M A;  3KV6 A;  2IXC A;  2SLI A;  1VR3 A;  2HWB 1;  5EV7 A;  3S57 A;  2AEY A;  1SDW A;  2PLV 2;  1CAV B;  2EIC A;  3P3N A;  1WZX A;  3POJ A;  4M4R A;  4AED B;  1XNT A;  2BQP A;  2XLA A;  2RVA A;  4QX3 A;  2ZS6 B;  1O5L A;  4AE2 A;  3MUZ 1;  1OSG A;  1AYN 2;  2X09 A;  4PT6 A;  1GKB A;  4YW4 A;  3V64 A;  1JU4 A;  1RUD 3;  2Q1F A;  3JQX A;  4YZ3 A;  5FLJ A;  3WG2 A;  4A41 A;  3AFK A;  2D6N A;  1LR5 A;  4LHS A;  3B7M A;  4IER A;  1FPN 3;  2TUN A;  1JTZ X;  1RYY A;  5EQU A;  1Y4W A;  1UAI A;  3RJR A;  1PO2 3;  2UWC A;  2B39 A;  1MVQ A;  4Q4Y 1;  3S7E A;  4E2Q A;  2QFE A;  5C8W A;  3V0A B;  3MLK A;  1Z7S 3;  4FPG A;  1DLC A;  1FPN 1;  3AKT A;  1OVP A;  3GCX A;  2HWB 2;  2BW8 A;  2PAM A;  4LTA A;  2IXJ A;  2V4V A;  3OPW A;  1PO2 1;  3SC7 X;  3OPT A;  3WW4 A;  1GWK A;  2PHR A;  2RDS A;  1UPI A;  3SEP A;  1V6I A;  3PU8 A;  1CJD A;  2VXR A;  2AUY A;  2YY1 A;  1Z7S 1;  3AXD A;  3OD0 A;  4ONU A;  4XCA A;  4YZ4 A;  4AWD A;  2ZJC A;  3M2M A;  5C8C B;  1QJY 1;  4BQ1 A;  3KHC A;  5DUW A;  2R6Q A;  2FDJ A;  3ZLI A;  4RD7 A;  4D3W A;  3JUU A;  3FUQ A;  5T5J A;  5HXM A;  1NLQ A;  2I07 B;  4Y20 B;  4QU1 A;  3NWK A;  4DUW A;  4K7J A;  1W03 A;  1ST8 A;  4RS5 B;  1WA6 X;  1AXZ A;  1QXP A;  2GN3 A;  5FKC A;  1YO8 A;  2E53 A;  5FUI A;  1HX6 A;  1QOO A;  1QJZ A;  3PVN A;  2G1M A;  4QDS A;  4NPR A;  4N43 B;  2CDP A;  2WNV C;  3AKQ A;  3BGA A;  3SH4 A;  1RUH 3;  5A7N A;  3PMS A;  3UGF A;  1HQN A;  2VNV A;  4AVB A;  3FJS A;  2Q8D A;  4AF9 A;  4CCC A;  1W2N A;  2GME A;  1H4H A;  5LRS A;  2VMD A;  1C5H A;  4BPZ A;  1VBB 3;  3MIC A;  3NJX A;  3ZX7 A;  2Y6K A;  4IE0 A;  3HBZ A;  3ZSK A;  2R7E B;  3AK0 A;  1DDL A;  1SQ4 A;  2VE1 A;  1RUH 1;  4CEY B;  4TLF A;  5FY1 A;  3ACF A;  4J1W A;  3RYR A;  3WF2 A;  1VBA 3;  5L19 A;  1ASJ 3;  1IS4 A;  2RDR A;  4GH4 A;  2LRP A;  4RS5 C;  2VNR A;  5JSO A;  4MGQ A;  4GB3 2;  1VBB 1;  4GIQ A;  1C8M 2;  3TWI A;  4IW3 A;  3VD3 A;  1XU1 A;  2J7M A;  4QQH A;  3VHO A;  4TZD A;  5FYU A;  3LOI A;  3X29 B;  1VBA 1;  1SBD A;  3NRU A;  2ORX A;  1QHD A;  1ASJ 1;  2VOK A;  2X10 A;  4XFF A;  4YPJ A;  3NNM A;  3SMH A;  3N9P A;  2C1F A;  4IV3 B;  3LDB A;  5IAV A;  4CDW C;  1H1A A;  3KVB A;  1AX0 A;  4UOJ A;  1JYN A;  3F95 A;  5FIX A;  4IGO A;  3RZM A;  2O0O A;  2GNT A;  4DFS A;  4HN0 A;  3CBN A;  4AHZ A;  3BOP A;  4WM8 B;  3NL1 A;  3ZSM A;  3LAG A;  2XJS A;  3AVR A;  1O6U A;  4CUA A;  2BER A;  1U5X A;  4TWT A;  2JWP A;  3NAP B;  4LHN A;  1UXX X;  4BM8 A;  2MEV 2;  3ACG A;  3WQ0 A;  5GZF A;  3J26 N;  1F4H A;  3UKT A;  1ND3 B;  3T0B A;  3ZXL A;  1GV9 A;  4HBN A;  5FWE A;  5FXX A;  3AMH A;  2XJV A;  5IVC A;  2HH9 A;  2ES3 A;  4CDX B;  3NKT A;  5LBB A;  1V70 A;  1XJA A;  3INA A;  1Y3T A;  2RS5 2;  4J1X A;  4YM1 A;  1CAV A;  3VV1 A;  4CUB A;  1IPS A;  1EAH 1;  2EAA A;  3KGL A;  4AED A;  5AFE A;  1SCS A;  3EHK A;  4GJZ A;  1OA3 A;  1OHF A;  1MQT C;  1W2U A;  3O7O A;  5DG1 A;  3R6S A;  5IWF A;  4F8A A;  1SMV A;  1JHN A;  3KHB A;  2D5F A;  1VRH 3;  2GSY A;  4ITC A;  1DQ4 A;  1X7N A;  2JKX A;  3E5X A;  4ZZ5 A;  1C28 A;  2FD8 A;  2MHF A;  4CCM A;  2A6W A;  2XJR A;  1FYU A;  1DZQ A;  2Y33 A;  3AKR A;  2A71 A;  4ZXK A;  4LHK A;  4RQP B;  3NNL A;  4LUM A;  3NV2 A;  5FRE A;  5FZG A;  4DS0 A;  1S0D A;  5JOY A;  3CMG A;  1VRH 1;  2VZP A;  2WNV A;  3RZL A;  2RM2 3;  1ZRF A;  4Y5Z 0;  4Q2F A;  4XUP A;  5HXV A;  5HCH A;  1JXN A;  3PL0 A;  1NT0 A;  3OGG A;  1G9B A;  1H2K A;  3WNP A;  5C9A C;  4RL7 A;  5C8C A;  3ES1 A;  2RS3 3;  1W2A X;  3A23 A;  2GH8 A;  1NXM A;  1PK6 C;  2WII B;  3SCF A;  2WO3 A;  2DVF A;  3JD7 3;  4UBH A;  2D6P A;  4LK7 A;  3KD4 A;  4Y20 A;  1ULO A;  2BNM A;  4K8R B;  1XE7 A;  4DMI A;  1NUK A;  4HLT A;  4QPG B;  4LKE A;  2SBA A;  4RS5 A;  3GXU A;  2Y0I A;  4PLO A;  2RS3 1;  4FFF A;  4JTN A;  4KMQ A;  4PI2 A;  4URA A;  5IVJ A;  1HRV 3;  3A4U A;  3OG2 A;  1HV1 A;  2C5D A;  4RQP C;  5BYN A;  3GBW A;  4HFS A;  1QWR A;  1KD7 A;  4N43 A;  1MS1 A;  1MEC 1;  3JD7 1;  2GNM A;  2HWF 2;  3IIA A;  3A0K A;  3FHA A;  4LXL A;  2A7A A;  1F15 A;  2CSG A;  1VMH A;  4AZZ A;  2JE8 A;  4CZS A;  3O1S A;  1HRV 1;  4G9S B;  2BWC A;  1Z0H A;  2PMW B;  2R07 2;  3ITQ A;  3LB9 A;  2WWU A;  3MO4 A;  1YFU A;  2OUJ A;  1QJF A;  4BWO A;  3H42 B;  4FCA A;  4CEY A;  1AR8 2;  4NHK A;  1W0N A;  2JKB A;  2O1Q A;  3K4D A;  3S5Q A;  3OYW B;  1BEV 3;  4BU2 A;  4PF1 A;  5HI0 A;  1BHG A;  3AM2 A;  4FPY A;  4QPG C;  1WWY A;  4EZH A;  1WA4 A;  2UYA A;  4DUX A;  3DPR C;  3FBM A;  1TE1 B;  3PME A;  3BB6 A;  4XZP A;  4A6S A;  1IZ3 A;  1NYW A;  3GHN A;  5IK5 A;  3III A;  4L92 A;  5DMY A;  4RHV 2;  1PMH X;  1PVC 2;  2ARB A;  3G7D A;  5CNA A;  5FMD A;  1WBF A;  1WD4 A;  4RR3 B;  2LAL A;  1H9P A;  1BEV 1;  1N3P A;  2VZT A;  2XGX A;  4XJW A;  3ZPO A;  1DCS A;  1RUE 3;  2P6C A;  5I91 A;  1JOJ A;  5A1A A;  3LEM A;  1SFN A;  2O8Q A;  2X05 A;  2QE3 A;  4IV3 A;  1TNF A;  1WCD J;  3DN7 A;  3Q8E A;  4B7K A;  1HXS 3;  3CU7 A;  3VD5 A;  2X53 S;  1BBT 3;  2XH6 A;  2XJU A;  3BN6 A;  5C7G A;  4DY5 A;  4XTP A;  2XXZ A;  4V2W A;  3MF6 A;  3AJZ A;  1UMZ A;  2NZ9 A;  1RL3 A;  2B42 B;  3VD4 A;  3U0Z A;  1ZNP A;  2ZOE B;  1MQT A;  3LPG A;  4JQR A;  5FUP A;  3WR0 A;  4FSJ A;  4AAX A;  3ZO0 B;  2WO2 A;  3ZXE A;  3IDC B;  2OPW A;  1HXS 1;  3I2D A;  3M4F A;  1BK0 A;  1RUF 2;  4QXC A;  1BBT 1;  3NAP A;  4XF3 A;  3T3Y A;  3WIN E;  2DFB A;  2DF7 A;  4FOV A;  3VBU B;  3TBD A;  5GZD A;  2A70 A;  1EV1 2;  1QJX 1;  4H55 A;  2DCT A;  3U07 A;  5GZC A;  1ZM1 A;  3WP4 A;  3OJB A;  2XJT A;  1UY3 A;  1XB9 A;  2DU1 A;  2XVL A;  5FYS A;  2CY6 A;  3DKW A;  3KVA A;  4RSU A;  4QHZ A;  2VM9 A;  3B9C A;  3W20 A;  3WT3 A;  1VMJ A;  2VZ1 A;  3BTX A;  3WW3 A;  1UXZ A;  5F37 A;  4MGT A;  4YG6 A;  2E63 A;  1VMF A;  1C1L A;  2DVG A;  3ELN A;  1JUI A;  4X8N A;  4CCJ A;  1GQP A;  5E88 A;  1YHF A;  4IEU A;  3FBY A;  1PO1 2;  2J1A A;  3WDT A;  2PAK A;  3WP3 A;  1LOA A;  1KGY A;  5H9R A;  3TEY A;  1M06 G;  5T55 A;  4OFG A;  1PK6 A;  2FHR A;  4U2A A;  4L99 A;  4FXK B;  3U1X A;  3POS A;  3MYX A;  1HQW A;  2W08 A;  1OT5 A;  1GWL A;  2Z69 A;  5CFC C;  1AL0 G;  1WMF A;  2VGD A;  3HT1 A;  2A6Y A;  3MIF A;  3WDW A;  1NY7 1;  3DXT A;  1OI6 A;  2D93 A;  1QJX 2;  4BME A;  2ZHK A;  1ULP A;  2JG8 B;  4RQP A;  4YVW B;  3H3U A;  2ARX A;  4B8E A;  1RED A;  3G6J B;  2ZZQ A;  4XIK A;  1AYM 2;  1I5Z A;  2VBB A;  3NJZ A;  3HAG A;  4LBJ A;  4CCD A;  1UYY A;  3WF3 A;  3MIG A;  4XQD A;  4E8C A;  1HJG A;  4LOR A;  4OVE A;  1N1T A;  5DQ0 A;  3O1M A;  1LGN A;  5FJK A;  5FZC A;  3SIT A;  3E5U A;  3GBG A;  3K48 A;  2R1D A;  5HCF A;  5C4W C;  5A70 A;  2O14 A;  2J1V A;  4GA9 A;  4LO7 A;  1MS8 A;  3J7N A;  4QQP A;  5IAT A;  4XBN A;  4QPG A;  3O1O A;  4FBF A;  1E5I A;  1S4C A;  1IOA A;  4JZR A;  5FBJ A;  4CPB D;  2VOV A;  1YUD A;  4ZY9 A;  1LKN A;  4AEJ A;  3HIF A;  4D0Q A;  3KS7 A;  4JGZ B;  5CU1 A;  4E4H A;  4AXO A;  5F3E A;  3C7H A;  2OVU A;  3AKP A;  4XDQ A;  2X29 A;  4CDU C;  2E33 A;  4CCK A;  4I0B A;  3AP4 A;  3WLU A;  2VCM A;  3CJX A;  4S2H A;  1VB2 A;  4KBZ A;  3TEZ A;  5FZ8 A;  2ID4 A;  2GND A;  3L9J T;  2BPA 2;  5B4N A;  1R1Z A;  4I0W B;  1NE6 A;  2UWB A;  2XWJ B;  4LJH A;  1GZW B;  5JI7 A;  3KT1 A;  4CXW A;  5C70 A;  1LB2 A;  2VTX J;  4R52 A;  5FPL A;  4GMP 0;  4AR2 A;  4MGY E;  3I2J A;  2WS9 3;  1QMJ A;  1KFU L;  2A6V A;  2EF6 A;  5F9T A;  3T09 A;  1GU3 A;  3WF1 A;  3ZXA C;  1JZ7 A;  5FPA A;  2R30 A;  1ULE A;  1DQ1 A;  3ACH A;  1K5M C;  1QF3 A;  4UBG A;  3SLI A;  4ES8 A;  5A33 B;  3H8X A;  4EN9 B;  2HWC 2;  5KXE A;  2ZGP A;  4RR3 A;  2ZPX A;  2P3Y A;  4Q4X 3;  4UWD A;  1R09 2;  5LY2 A;  3DKQ A;  3GCW A;  1US2 A;  4HSL A;  2BU9 A;  3SIS A;  4BJ0 A;  5FZD A;  2ZKL A;  2WNU B;  4LK6 A;  3UKN A;  4P00 B;  1L7R A;  3ECQ A;  2C26 A;  2XVG A;  3ZFG B;  2JJ6 A;  4UW3 A;  3IDE A;  1VB4 A;  4MO3 M;  1XE8 A;  4Q4X 1;  4E8D A;  4PLN A;  2A3W A;  3MHZ A;  1ZZ9 A;  1XC6 A;  1W90 A;  5FPB A;  2VOT A;  1LHU A;  2MNG A;  2YFZ A;  5D8A C;  4OZO A;  4ARY A;  1NLS A;  1QXJ A;  5DAX A;  5C3Q A;  5CFC A;  4NPL A;  4TXW A;  4XJU A;  1PZ8 A;  3HQU A;  3IDA A;  3UK9 A;  1STM A;  1WW5 A;  2DTW A;  4X6Q B;  5FZ0 A;  4YFZ A;  3POI A;  1V6K A;  1DLL A;  2W5F A;  1W04 A;  4CP0 A;  2YB7 A;  1HIX A;  1MZ6 A;  4LBO A;  3EQE A;  3OGJ A;  3RJ2 X;  2ZX3 A;  4AI8 A;  4GQ7 A;  2W39 A;  5HPO A;  1XSQ A;  2BDR A;  3GM8 A;  3Q8C A;  1TME 2;  2CAV A;  2WN2 A;  5FYY A;  2P3I A;  4ZS3 A;  2HWD 3;  3PUS A;  5LAS A;  4AI1 A;  1U5Y A;  5LCW L;  1JOD A;  1IQD C;  4XQW A;  1QQP 3;  2V09 A;  4Z07 A;  1DFQ A;  4YWA A;  5JOX A;  2HYK A;  3B94 A;  2D5H A;  4XUR A;  4B3N A;  3H8R A;  5LAT A;  1W8N A;  1XSR A;  4NHL A;  2FDK A;  4HXC A;  4JHT A;  3PUR A;  4ISQ A;  4WV8 A;  4Z1V A;  5JVV A;  5CFD B;  1TVG A;  2XWB B;  4LO8 A;  5FZH A;  1XXN A;  1VAM A;  2B45 X;  4GAL A;  1QQP 1;  3KGZ A;  2D6K A;  2VQ0 A;  4Y4R A;  3WNX A;  2DTY A;  4IUG A;  1PZ7 A;  3AYE A;  4YVW A;  4ES9 A;  3W58 A;  4N9I A;  3PHM A;  3RDI A;  1QDC A;  1F9K A;  4SLI A;  4R9A A;  1GNZ A;  4AL9 A;  4E4D X;  2ZEZ A;  1O8P A;  4EZ4 A;  2ZTN A;  3SCH A;  4XJ9 A;  5GLT A;  2Q8E A;  2VAU A;  4AVS A;  2P1B A;  4B1L A;  1CAU A;  1WLC A;  2JIG A;  4TYS A;  3TN9 1;  1OH3 A;  1IS3 A;  5FZ7 A;  3KF3 A;  1GZC A;  4L2N A;  4YAR A;  1LHV A;  3VZN A;  4HVQ A;  1LHN A;  4JAA A;  3BUC A;  3B5L B;  2KA3 A;  4HK9 A;  5FWJ A;  2PA7 A;  2Q0A A;  3JBG 3;  5AC9 2;  2WYF A;  1LNS A;  1BJQ A;  1AHS A;  3WCS A; 
#chains in the Genus database with same CATH homology
 4DXS A;  3NQH A;  5DN2 A;  3WNL A;  1GMM A;  1W9W A;  3I2K A;  2QQO A;  3IAQ A;  1KEX A;  2W47 A;  3FHQ A;  2Y64 A;  3OGV A;  4A4A A;  4XUT A;  2WZ8 A;  3HJR A;  4PQQ A;  5EJ1 B;  4P08 A;  2YC2 A;  3MBW A;  5EJZ B;  1UY0 A;  1W9S A;  1OF3 A;  2L9L A;  2W46 A;  3K4Z A;  1JZ8 A;  3OEA A;  1GNY A;  1UYZ A;  1JZ5 A;  1UY2 A;  2CDO A;  5LA2 A;  2EIC A;  4M4R A;  3CQO A;  1XNT A;  2W91 A;  2RVA A;  2YC4 A;  2DCJ A;  4QX3 A;  3MUZ 1;  1D7P M;  5JR2 A;  2X09 A;  4PT6 A;  3P1I A;  2W1W A;  1JU4 A;  5CZK A;  3WSO A;  3NNG A;  2J22 A;  4A41 A;  4LHS A;  4QPW A;  4W4Z A;  4A3Z A;  1RYY A;  4UI9 L;  2WYS A;  3A22 A;  3LEG A;  1GOF A;  3I3E A;  3OEB A;  4OYU A;  2E26 A;  4M4P A;  1DLC A;  3MUY 1;  3UET A;  1CZS A;  3HEI A;  3GGL A;  2QQN A;  2V4V A;  3WNO A;  4CU8 A;  3SEP A;  1T2X A;  4ZZ8 A;  3THC A;  2W1Q A;  4W8J A;  3CIH A;  5HXM A;  4HG6 B;  2WO1 A;  4DUW A;  3WF0 A;  4JKK A;  1O59 A;  3HNB M;  4QB2 A;  3LQC A;  5FUI A;  4TTG A;  4QDS A;  3I3B A;  2QQM A;  2CDP A;  1GUI A;  2Y6H A;  3BGA A;  5CYY A;  3UNP A;  3PUI A;  2VO5 A;  4CVU A;  3DYM A;  2VMD A;  3NJX A;  2VME A;  2Y6K A;  3VDB A;  2R7E B;  1JZ2 A;  3ACF A;  3LE0 A;  3WF2 A;  2W9X A;  3C8X A;  4QX0 A;  3THD A;  4MGQ A;  2VZV A;  5IFP A;  3VD3 A;  1UMI A;  2J7M A;  4CU6 A;  1NAE A;  4OMC A;  3LPF A;  3NRU A;  2ORX A;  2XOM A;  4QB6 A;  2X10 A;  4YPJ A;  2W94 A;  2QQL A;  4JX0 A;  3T08 A;  2ZXQ A;  4UOJ A;  5LA1 A;  1JYN A;  3VDC A;  2ZEY A;  4KWU A;  2WN3 A;  3MV1 1;  3ZM8 A;  4P5Y A;  4CUA A;  4W50 A;  2BER A;  1XNA A;  1UXX X;  5EIY B;  3ACG A;  1F4H A;  3T0B A;  3ABZ A;  4KI5 M;  3HOB A;  3CKH A;  5J1X A;  1EUT A;  1UZ0 A;  3CDZ B;  4FI9 A;  4CUB A;  4JKM A;  4QDQ A;  1I5P A;  2J1T A;  2YG0 A;  2Z4F A;  2Y8K A;  5IHR A;  2VZ3 A;  3IAP A;  3SEE A;  3OB8 A;  1H6Y A;  3E1F 1;  4DXR A;  4ZZ5 A;  2JKX A;  3DYO A;  4DUV A;  1H6X A;  1CZV A;  2VTF A;  2VZR A;  3OGR A;  2EIE A;  4BK4 A;  1WKY A;  4XUQ A;  2V5D A;  4MGS A;  2VZU A;  4QX2 A;  3CMG A;  3DYP A;  1W9T A;  2VZP A;  4XUN A;  4OMD A;  3W5N A;  2VMC A;  4XUP A;  3SKV A;  1JZ6 A;  3D3A A;  2W1S A;  2YFU A;  3C7O A;  3WNP A;  3OGS A;  4BXS V;  2VMF A;  2BGO A;  3A23 A;  2QQI A;  2WO3 A;  1ULO A;  2E32 A;  1NUK A;  2VCB A;  3GXU A;  2OKX A;  1NKG A;  4KMQ A;  4XZU G;  2W1U A;  3OG2 A;  4AG4 A;  4ARX A;  4D8M A;  5G04 L;  5JUV A;  3FHA A;  1XPW A;  2Y6J A;  4L0P A;  3SKJ E;  2JE8 A;  3MO4 A;  4LQR A;  3HNM A;  2QQK A;  2JD9 A;  1UY1 A;  1UMH A;  2VZS A;  1W0N A;  3DEC A;  3K4D A;  4UAP A;  2RJ2 A;  4PF1 A;  1DYO A;  4RYD A;  1BHG A;  4DUX A;  2XQX A;  2E31 A;  3III A;  5DMY A;  2Y6L A;  1PMH X;  1K42 A;  2HLE A;  1GOH A;  1YQ2 A;  2VZT A;  2WAO A;  1PMJ X;  2VCA A;  3EYP A;  4LKS A;  5A1A A;  2W95 A;  3LEI A;  2X05 A;  3J7H A;  3K75 B;  3VD5 A;  1GOG A;  1OD3 A;  2C9K A;  2LS6 A;  3BN6 A;  5C7G A;  3T0D A;  2WAA A;  3I2G A;  2JDA A;  5JXH A;  3HNY M;  2XON A;  3VD4 A;  3LPG A;  4AAX A;  2WO2 A;  4MOA A;  3WEZ A;  1JI6 A;  4QB1 A;  5IJR A;  1MPX A;  4OUE A;  1SG3 A;  1UWW A;  3I2I A;  3P6B A;  1UY3 A;  2VM9 A;  2VZ1 A;  3I2H A;  3I2F A;  2ZEX A;  1UXZ A;  2WAB A;  3FL7 A;  1K45 A;  5DPN A;  1GQP A;  1JU3 A;  5F7U A;  3C7E A;  2J1A A;  3WNN A;  1KGY A;  1JYW A;  4Z2A A;  3C7G A;  2BGP A;  4A42 A;  1OT5 A;  2W87 A;  2BZD A;  4CUC A;  3HPN A;  2VQT A;  5IYY A;  3WNM A;  3WNK A;  4P02 B;  3VD7 A;  1JYX A;  1O8S A;  1ULP A;  2VJX A;  1SHW B;  4ZXE A;  3NJV A;  5C71 A;  1K12 A;  1NX9 A;  2J1R A;  1JZ3 A;  1L7Q A;  4QAW A;  4JKL A;  2J1E A;  1UYY A;  3WF3 A;  1K3I A;  4E8C A;  3WQB A;  2W92 A;  3VDA A;  5DQ0 A;  4GWJ A;  2VQU A;  5G05 L;  1UYX A;  4MAD A;  3EB7 A;  3U37 A;  5IFT A;  2VC9 A;  3CZJ A;  1US3 A;  1J83 A;  2WBK A;  2J1V A;  2XHN A;  2ORZ A;  2KD7 A;  1UX7 A;  1R64 A;  3ETP A;  1OF4 A;  4LPL A;  4ZY9 A;  5JMO A;  2HYX A;  5JXI A;  4D0Q A;  3C7F A;  3K4A A;  3C7H A;  4RN5 A;  2J1S A;  1HN1 A;  2E33 A;  3PUH A;  4QDR A;  2EID A;  3K46 A;  2ID4 A;  1TG7 A;  3W5M A;  5B4N A;  5JXJ A;  2VZQ A;  1DP0 A;  5C70 A;  1J84 A;  4GZ9 A;  2BBA A;  1CX1 A;  2Y6G A;  1PX4 A;  3OBA A;  3I2J A;  3CZU A;  4DEV A;  2C4X A;  3T09 A;  1GU3 A;  4XVH A;  1CZT A;  3WF1 A;  4JHZ A;  3T2P A;  1JZ7 A;  1W8O A;  3I3D A;  3ACH A;  5I0D A;  1JZ4 A;  1US2 A;  4BJ0 A;  4P00 B;  1L7R A;  4A44 A;  3ECQ A;  2C26 A;  3AC0 A;  4MO3 M;  3HN3 A;  4E8D A;  2V72 A;  3LEK A;  1XC6 A;  3GDB A;  4A45 A;  4A6O A;  5JXG A;  2VOT A;  3IB3 A;  2YFZ A;  4OZO A;  4ARY A;  2RV9 A;  2LW8 A;  1JYV A;  4TXW A;  3IDA A;  3A7Q A;  1P8J A;  2VZO A;  2WZE A;  2W5F A;  3T2Q A;  2DDU A;  2YB7 A;  3F2Z A;  4ET7 A;  5HPO A;  2PQS A;  3VD9 A;  5LA0 A;  3GM8 A;  4XUO A;  3FN9 A;  2WN2 A;  5LCW L;  1IQD C;  1WCQ A;  3WF4 A;  2WUH A;  2WQ8 A;  2DCK A;  2VL4 A;  2B9V A;  4XUR A;  4QX1 A;  1OH4 A;  1JHJ A;  1W8N A;  2WDB A;  1PX3 A;  1F4A A;  1UY4 A;  2QQJ A;  3ACI A;  1TVG A;  2VCC A;  1CIY A;  4CU9 A;  4IUG A;  3JXS A;  4DEQ A;  4CU7 A;  2EIB A;  2ZEZ A;  1O8P A;  2B4K A;  2W3J A;  3A21 A;  4GWI A;  3T2O A;  3T0A A;  4DXT A;  3K77 A;  5B4X A;  4BDV B;  1EUU A;  2J1U A;  2QBX A;  2ZEW A;  1SDD B;  3I97 A;  3MV0 1;  4BK5 A;  1W99 A;  2VR4 A;  3UES A;  1LNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...