2J1XA

Human p53 core domain mutant m133l-v203a-y220c-n239y-n268d
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Structural Basis for Understanding Oncogenic P53 Mutations and Designing Rescue Drugs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 49
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2j1xA00
3KMDA 4IBVA 2J1ZA 4L0YA 2RMNA 3US1A 3EXLA 4AGOA 2IOMA 3WTVA 1GZHA 2ATAA 3D08A 2X0WA 1H9DA 4GUQA 5AOLA 4AGNA 4G82A 1UOLA 3D0AA 3VD1A 3QYMA 1E50A 3EXJA 2X0UA 5AOMA 2J21A 2J1YA 5BUAA 2X0VA 3QYNA 4A63A 3D09A 4G83A 2P52A 4LO9A 3WU1A 1HJCA 3D06A 3Q06A 1T4WA 1CO1A 3IGLA 5ABAA 2ADYA 5AOIA 3D07A 1HU8A 2BIQA 5AB9A 2AHIA 2MEJB 2XWCA 2GEQA 4LOEA 1YCSA 3Q05A 1GZHC 3WTYA 4IBZA 4MZIA 5AOJA 2IOIA 2VUKA 4LOFA 3WTUA 1CMOA 2OCJA 2BIOA 3US0A 2IOOA 3Q01A 2BIPA 1EAOA 5ECGA 2YBGA 4AGQA 3TS8A 1IO4C 5AOKA 3D05A 4IBUA 1KZYA 2J1XA 5A7BA 4KVPA 1EAQA 4HJEA 4AGMA 2H1LM 2J20A 1EANA 5G4OA 3KZ8A 4IBWA 4AGLA 2AC0A 1TUPA 2J6WA 5KBDA 4IJTA 5G4MA 2WGXA 3ZMEA 1HJBC 5LGYA 3IGKA 2FEJA 3VD2A 4IBSA 4IBTA 4QO1B 4IBYA 4XR8C 2BIMA 3WTSA 5G4NA 3VD0A 3WTTA 3WTWA 4L18A 2BINA 4IBQA 2J1WA 2PCXA 4MZRA 1LJMA 4L0ZA 5LAPA 3WTXA 1TSRA 4AGPA 4GUOA 2XWRA
chains in the Genus database with same CATH superfamily
3KPRA 1NAMA 4QNPF 1DVFD 4X7FC 5A2LH 2WO2B 2MOQA 4P2OA 3VMOA 4OKVA 4XI5C 2X1OA 1S7SB 2JJSC 3LZNA 1NOFA 4LDEB 4MXQC 1UH4A 5F0PB 3F5WA 3NCMA 4JFDD 4Y4KD 3LDBB 2B15A 3KLSA 4OCRL 5KN5A 1RULH 3RIFK 4XO3A 5JW5B 2JIXD 5LCVA 4WW2B 1M7UA 4V1DE 1SM3L 4TSBH 1AOZA 2FO1A 3RVTC 3EFOA 1TETH 3T0VA 2EZ0D 3FFCD 3VXNA 4OW6A 1ASOA 4BK4A 4DGUA 5TDOA 5A2FA 4I0CC 4M6NL 4YSEA 2D7PA 4OLVH 1BQUA 5I71C 4WJ5B 3KLHC 1BVNP 1MAML 4PV1C 3QDMD 4JFPA 4XNMB 1XIWD 3LN5A 1UKSA 1XCXA 3G6JB 2F0CA 2F7RA 4HPOL 3IGAB 3MV9E 3AQXA 5D55A 1SJHB 2WPGA 1MW1A 4GAAA 4GSQA 4XPFL 4BKLA 2IFFL 4POZC 3AFLA 2XWCA 2BJMH 1S7TA 3ESOA 3NCCB 3UYRL 4X6DB 1GJWA 2DQFB 1I8LC 3FO1A 2QSQA 5J5EA 1CIDA 5LAXB 1XCQA 1TITA 2FX7H 1EHLH 1U95B 5DLLA 2KYIA 2W0PA 2YEZA 2J8UB 3MRGB 3Q01A 4IU2A 1N3NB 5AG9A 3FTGB 5DJXB 3GZKA 4XP5H 4J12A 2XWJA 3FN0H 3PXJA 4CRPA 1T7ZA 5EU6E 1ES0A 4IEFB 1EZSA 4L1HA 1ZTXL 2BP0A 4NBZB 3AT8A 1GGIH 4Z3GA 1AO7D 3QEHA 1KTLA 4KK6D 3KPPA 4FNLL 1WA0X 3T2NH 3MV7E 2PUQT 5IBTL 2FJUB 5AVVB 4AQZA 4HU8A 1TJXA 1UD4A 1RSFA 1NGZB 2E5EA 3S8WA 4NEHB 5MEPB 1F4WH 3HRZA 4MLSA 1IM3D 3WIHL 1YSOA 1P5VB 1JV2A 2JQAA 2A4EA 3CDFA 1OVZA 3ELQA 2NNFA 3C6SB 1P6WA 4PB9H 4ZFOB 2UZXB 3KWTA 3KGUA 4K23L 3EGSB 2XN9B 1FCCA 3A6BH 3NCJH 1MREH 2GBUA 4POUB 2ESVD 5G55A 2X2YA 4NC2B 2G4GA 1FNLA 1CE6A 3MLSL 5JA8B 1FL3A 2MIZA 1VIWA 4PRDB 3QS3A 3QFDB 4JFWA 4DCQB 4AH2A 2CKBB 5CFAA 5TE7L 3LKRB 4HUXA 2P8LA 3HE7D 2XNAA 1JZJA 4U6HA 5LBSL 1LK3L 3FFDB 4MJJA 4Q8BA 5T3XE 1JSYA 5FYLE 5I1EL 2GTWB 3QAZC 5GIRA 5JOFB 4V1DB 1Q94A 4XNZC 4YHPB 3WEAA 4X6BB 2QVKA 4Y2DA 5IBUG 1HIMH 1JZDC 2A0LD 1CGWA 3BKYH 3FU7A 4UMGA 4JGNA 1CG9A 3FUKA 4H8QA 3BXNB 1MHEB 3IXAA 4P06A 2XFXB 5I8CB 1AY1L 1UJ3C 4PJ9B 3MLRH 4AG4L 4FMKA 4XCNB 4KNQA 5LBGA 4DUWA 1AR1B 5K69A 3BWZA 3MV9B 5FHBH 2PXYA 4PRNB 3ELAT 1KZQA 3MLPA 4KX9A 5CEYA 5FXCH 2DQHH 4B9IA 4CU8A 3WLWD 1L6PA 4HGMA 5GGVL 1T6BX 5J13C 3U0PA 4N0YH 2VW4A 3ILEA 1WZLA 4TPRH 1HYRC 3W57A 1CFSA 4W93A 4Y5VC 2ZSWA 2YD7A 2ZX7A 2WWNA 4N2NA 4ZFOL 5A3ID 1N4XH 3IDYB 5EU4A 3BRDA 4XVTL 1OO2A 4X0NA 2NTFA 4PD4J 3IMRA 4YK4B 2YA0A 5EU6B 4UTAH 1ED3A 2QPSA 4AIEA 1YYML 1E2ZA 4GQZA 1L6ZA 4TUKH 5IK3A 5CGMA 2P8PA 4HZLB 5CJOL 4LOUC 1FFPA 3MCLH 3PHSA 3MV7B 2CKBL 3NA4A 1FHNA 4X5RA 2ZQKA 1DBML 3VFTA 3C6EA 2MCMA 4GUCA 4PR5A 4ZOCA 4G5AA 4CW1B 1ZA3B 5CINL 4JBSA 4R8WL 3L3KB 2OMWB 1Q0XL 1RUMH 3QFJD 1R3JB 1OCWH 3LPWA 2PWFA 4C83A 3Q8AA 3QUYB 1K8DB 3KPLA 1XH3A 4QXUH 2CGRL 3RY5A 1T21A 1XCTB 3FB8A 4YC2B 3BZ4B 1NTDA 4TNVF 1Q9KA 1ECZA 2P80D 3F3HA 3DUHA 2BCKB 4EDXA 1A8JH 3L5XL 3CZFA 5BRZB 3QAQA 3ZPDA 3AUWB 3RU8L 1H0DA 2AEQL 2PMZA 3WUWA 2O6EA 3HC4L 4GP5B 1KLFB 4UDTB 2KQNA 3NN8A 4R96B 4Q0XH 2EUVA 5B3NA 5DRNA 1EK3A 3FTVA 2WTPA 1L9OA 2C26A 1BYPA 4BZ2L 3RAJH 5I1JL 2V8LA 3RUGF 4QOKA 2QTVA 4ZW8A 2XWZA 4PCKA 7PAZA 4PN6A 3X17A 2YD9A 4XPBH 2WUCH 2ZCLL 3HNVL 5CZVL 3BYTA 1KJ3H 2IV9A 1CR9H 5LNEA 2MCPH 1NCJA 1OANA 3FTYA 2N3JA 4CSSA 3CV5A 6PAZA 5SWSD 2KLSA 4LGPB 1N2RB 2SODB 3QQDA 4J6RH 1ZHLB 3MV7D 1A14L 4ONOA 5E7FA 2WNGA 2P28B 1I8LA 3D08A 2VDKH 3BFWA 2QV4A 2W9DH 2QQLL 2PO6C 1O7DE 4HLZH 4G8EA 4J8QA 3TBVA 2BVOB 5KTEL 2XY1A 3KCPB 3ZRFC 3VD4A 3VD1A 1YAZA 5MEOB 1NFDA 4P57B 2LOEA 2XUWA 1OSYA 2Y25A 1VFBA 5HDBF 4R4NC 3EFFA 3E6FA 3QUYD 3TIDB 1HE8A 1WS7A 3BISA 2ZXAA 2Y72A 1FFOA 1XTMA 2VITA 1FYHB 2VC2H 4NRXA 2HLAB 4AOFA 5AW6B 3S37X 2F15A 5A43C 4KQ3L 4A67A 2WLZA 3J2PA 5BRZD 3C08H 1KJVB 4P2QB 4A6YL 5B39A 4ZW5A 2R9HC 3UZQB 5F8QC 5T3XL 3RI5K 4XPAL 1JYVA 2EO1A 5FYLL 1HI6A 1Z9OA 3DOIA 4LSSL 1AOHA 2ADFH 1F11B 4XPGL 1QLFB 2W60B 5FA3B 3AW5A 2R0KH 3IDNB 4NM4H 4L8BB 1A3RL 1U9KA 3BVXA 3FQNA 4WDIA 2F58L 5AVQB 4HK3J 2Z93B 3ZW3A 1QI3A 2GSMB 5C09E 2V2WA 3FU3A 1TQUA 4KZEH 3BRFA 5C8JA 2HT2D 2QSCL 2UWEF 3P77A 3D3VD 4JHWL 4D0DB 1OP5K 5IIEB 5MEQB 4XHJC 4CMHC 4OD2A 2LVCA 3MODH 3GXTA 4OD1H 3ZTJH 5HD8C 1CGXA 2FTAA 1HXMB 4U31A 5IB4B 4L3CB 4XO9A 2Q7AA 1YJDH 2JV6A 2FNBA 2YAEA 5CSBA 2OI9C 1GHFH 3O4OC 5SWZA 4CKVX 3K46A 4BWUA 3LZLA 2ORBH 4YO0A 3CSGA 2X4TA 1BAFL 4QF1B 4ZX6A 2X1QA 4HX1B 1UJ3A 3P3YA 4LL1A 3GZQA 4X9HA 1FZMB 3SKNA 4J3TA 2KZ1B 3EYSH 2R27A 3BKCH 2MPAL 4FEMA 5K93A 1DDTA 4CILA 1A9VA 4DVBA 3BQUB 4FE9A 2RR3A 3KJ6L 5DS8B 1KTJA 4TSAH 4MS6A 4P2QD 1XF5A 2G3ZA 4I9WE 4QWWD 3GSOA 1DVUA 3GMRB 3U6RB 3TZVC 3ATFA 1NAMB 1SEQH 3SOTA 1TFHA 1YEIL 5JUEH 5I19L 2XQYA 3EJSA 4KJPC 4KRPB 5HHXH 4OKVB 4D0CA 1U58A 2A83B 5EBGA 3S36X 4QHKI 3VI4A 3QORB 4FLRA 4W68A 3EBHA 4XBPB 1UZ8A 5AVWB 1GJUA 2HT4C 3UP1A 3JWOC 3GBEA 4G8AC 4NT6B 5CD5C 1BQ5A 1I1AD 3L3OA 4PJHA 4OCWH 3W5MA 2FT6A 1JPGB 1IGJB 3VXNB 1I3VA 5TDOB 4WENB 2D3NA 2H3NB 4LPCA 4XCCL 5D96B 4HZ1A 2LU3A 3OAYH 2ZUUA 1S7QA 3RFRA 3TV3L 3NABH 5DFWH 2PETA 3LN5B 2P52A 5E4EC 5GRJL 1QP1A 1I1RA 1KTBA 3R7QA 1KT2A 1T2XA 3NFNB 3NJIA 5C09B 4FN0A 3LZFH 3MLWL 1MF2H 2VDOH 1HCZA 1IRAY 1A6VH 4Q9BA 1LMKA 3LXCA 3IJSA 2LAAA 4XO8A 4GKOA 4UZSA 5I6KA 3MRKA 1PZAA 5DJ6A 2A6IB 2VUKA 2ZYIA 4LSTL 2NX5D 3ZN6A 1FAKT 4KKCC 2XLLA 3NCFB 2X2HA 5IB3B 2XWJB 1YMMA 3WD5L 1DP0A 4LAJH 2Y7OA 1KTRL 3NUKA 5TFSL 3RWGA 4BDVB 1WAAE 1XF3A 2BP0B 3G5ZA 2CU9A 1ICTA 3X1GA 1KZYA 2R2EA 2IPKB 1NAML 3ECQA 4YGVB 4P49A 1AC0A 1EH9A 2A9DA 1TCRB 5KYYB 1DBBL 1OL0A 3MYJA 4N25A 4MCMA 5E8DH 3HRZB 1Y18A 3HC2A 1MNNA 4GMTL 1JV2B 4GKZB 3FH8A 1QZ1A 5GRWA 4DKFH 5LCVL 5JQ6H 1AP2B 1ZLSH 5C6TL 2D9CA 3V6FA 1DBKH 2UVEA 2WD0A 1VGEH 3FRUB 1W8OA 3M1OA 1MCEA 3PIQA 1RU9L 1DO6A 4FS0A 4ZW6A 2QDVA 1BECA 2DEXX 4R7XA 4B6ZA 1CLYL 3G6AA 1KELL 1FL3B 1G5AA 1UWEH 3ILPA 4CSZA 2WMPB 4OLXL 4OUUA 4HUXB 3K2IA 3UG5A 4ABUA 2P8LB 2K1MA 3JWNG 4U6HB 4X9IA 3UDWC 3BAEH 3HNSL 2OSYA 5CGYC 3BUBA 3GS7A 1FG2A 3PV6B 5C09D 2Y06H 5HYQA 4DO6A 1YNLL 2Y1AA 4XNUH 5GIRB 2J8HA 3JT2A 3MRIA 4AUUA 2XRAH 1U8HA 4PW3A 4Y2DB 3VG0H 1W6LA 5I76A 4L4JA 3QZNA 2EC9U 2G75A 3ATDA 3H9HB 4IBVA 3TL5A 3GI8L 1GTFA 3N41B 1PVHA 3U7YH 4EDWH 3QIUC 4QOKE 3UBXI 4X5LA 3GSNA 5IMOA 1QBBA 2WHVA 3OAYK 5J12B 2FBRA 3L3JA 1RSYA 1JOIA 2VGLM 1IFRA 3ENEA 2YGNA 4KZCA 4ONHA 4U3SB 2CJSA 1KBBA 2WNXA 4KK5D 2F2HA 4UT6H 4JO2L 1XB3A 5BJTA 1DL7H 4EI6B 3WFZA 1H8LA 5I1IL 2C3GA 2XU9A 3DGCR 4A63A 4FKHA 5CZRA 3C8KA 1SXAA 4WTZG 1W15A 5T5FH 3HTLX 3MRHA 2CO6A 1NFDE 4QEGA 5GS0D 2PR9A 2JK5A 1UACH 2GUYA 1ANUA 3GIZH 3MRMA 1OP3K 2DWYA 3ZE2E 1ED3B 2IV8A 4G7YL 4PFEA 3L95A 4JY4B 3DYPA 4OAWA 4AZ8B 3E3QE 5IK3B 1FFPB 4YDVB 1T0PB 1BFOA 1BMWA 1QHQA 3C5SA 1ZVYA 5HYSG 2MOVA 4MB5A 4PR5B 4LDOB 4HWEL 5AAMC 5GRXG 4NJ9H 3I6SA 4AIZB 2N56A 4QXWA 3RIAF 2E7CA 5GS1C 4Z77B 5CEXB 2BSCA 1T1ZB 4IBUA 1YRKA 4ICXA 3ZDXF 1NBYA 5J0BA 4A7VA 1GKEA 3N44B 2CD0A 1S9WB 4NKOA 1UOWA 3QS2A 1XH3B 4P5RA 3FB8B 3TZVA 4MD0B 4YR6A 1Q9KB 3TN0C 2VYRE 2G5BA 3N06B 1AS7A 4M5ZH 4DKDC 4EDXB 2GPZA 2EYRA 4UAOC 1GAFL 4QRAA 4TLSA 1XSJA 3RZCB 5IHUL 1UGNA 3WUWB 1XMEB 1ZE3C 5D2LF 4DP6X 5HI5D 1HDMA 4ACPA 3T04D 3LXBA 1IU1A 4Q2ZB 3D2UA 4JZJA 5B1KA 1BXXA 2WQXA 4MYPA 1OK8A 4IRJD 2MQGA 4FQCH 3QI9C 3MBEC 4FXGA 3A47A 4NJAL 1NGXB 2ZP8A 3ILQD 4Y89A 3MLZH 5JHAA 3D0VB 4QOKB 2VMCA 3SDXF 2H0JA 3JWDH 5IVZA 1I31A 4PJ8D 1KGYE 2QQKH 4R97C 2BHFA 3CCHB 3L48A 3MA9H 3UTPE 5DJ0A 3C6LC 2QMKA 2GJPA 1V54B 4K5OA 4YVNA 4JDEA 1T5WB 4FKEA 1CFVL 2JKSA 3EJZC 1BVOA 2ZXBA 3QZWG 4YPGA 2YBRA 3ML8A 4YZFE 4ZX4A 2NY6B 1NFDB 4KK9C 5KS9A 1Z1WA 3IDUA 3LXAA 1X9LA 4TNVK 4OJFH 1Z9LA 4LOVA 3ZE2B 4NHUA 4FP8H 1SHSA 4JN1H 3T6ZA 2WXJA 3UPRB 4NRXB 4HDIB 1JTOA 4FQQB 3FYIB 4UIKH 2A38A 3VRLE 3ULUF 4YWGL 4PJHE 4W6WB 1J05B 4XODA 5IWLA 5AB0A 3MNVB 1V3JA 4IJ3C 4Y2OB 1JGIA 3FN3A 1DVFC 2BS9A 2B7DT 4HAKA 4TUUA 4G6ML 1VAHA 3Q8FA 5HYFA 4JKPL 2WLMA 4ISVB 4N90E 5E1GA 1H15A 1P7HL 4Y4KC 4WNSA 2ZWZA 3LZRA 3KE0A 3FQNB 3NZSA 1FN4A 3T6QC 4WU5B 4JX0A 4IHOA 5I5MA 1E65A 5E2VL 5GZOA 5IFAH 2V2WB 2EZ0C 3AABA 1BFTA 1NBCA 4HOWA 1B4TA 3W1ZA 5I6XC 4QAWA 4LL4A 1KBKA 1NC2A 3FUIA 2P7TA 4BUQA 3PFQA 1XL4A 1B9KA 2OA9A 1XIWC 2ZWSA 4HKXA 4LSVL 1E4XI 2E6QA 2Z8VC 4NO0D 1JRHI 1PSKH 3VB9A 1JHKL 3SO3B 3WXVH 4YGAB 4M7ZB 3G04A 5I66A 2BM3A 1NCBH 4YO0B 1INQB 5EIVA 2VR5A 3ZKND 2JJWA 1YC8A 4WUUD 5EZIL 1AFVH 5F97E 1NBVH 2DZEA 2R0WL 4JRWA 3D34A 3U7WH 4ORZC 4F1SA 1RLWA 1M1SA 1UZ6F 5T1KD 1UADC 4LXFA 2QZ5A 5CILL 4L5FH 3AS1A 2O1AA 4JPVH 3FQWA 5BS0E 5DJZA 1V27A 3X3FL 4KK6C 1XF5B 3KYNA 4XP6L 2BINA 2OKMA 4UTBA 2H32H 1E9QB 1RPQA 3ARGA 1RUKL 1TG8A 5K9KA 2QTEA 4D0CB 1DLHA 2XN0A 1GGCL 5AL0A 4FG6D 5GSVB 1HHKB 3I3EA 4HHAA 2CJ3A 4M7LL 3CVDA 1UZ8B 4FQHB 2IWKA 2B8OT 4KH9A 3VFWA 2AJUL 5FV1L 4PJHB 5FS5A 2BNRD 1LTXA 2UY6B 3F6LA 1OY3B 5AAMA 4Q9RL 3F58H 3CFJB 3V0DA 4DEPB 2VR9A 1YEEL 3B2VH 4HCFA 1GCYA 5GS1A 3HE7C 3OXSA 1E9OB 5FCUL 2BZ7A 1O5PA 1MLCB 3VAEA 1KIUA 3II3A 3WXWL 3D09A 1JCVA 1HNFA 3QUMA 4GQRA 4DP7X 2FE0A 3CN0A 1KT2B 1Q0YL 5I16B 3CBKB 2JI3A 1TU2A 1F4WL 3FQTB 2CALA 2EIEA 4IRZH 1V55B 4ZS7H 1KDIA 1RHFA 1NMAL 1TPXB 2A0LC 3TN0A 3TESA 1N18A 3HNTL 4UOQA 1FVEB 1AKJB 5JR1L 1PW3A 1BD2D 1PEZA 1WRFA 3V4PA 3UTPD 3IMTA 4IK7A 5C0CA 1DR9A 4W9HC 5FK9A 1DJSA 3FSOA 4YAQB 1AZBA 1NKOA 2IPUK 3WFHA 1S7RB 1LEIA 4RGOH 1CGSL 1XTLA 1YEGL 3WLWC 2OFQA 4R4FH 4IIQC 2R2EB 1FZKA 1IFHL 2JXMB 4EMZA 2EUZA 3D05A 3ROOA 3BH9B 5ITBL 4YSUA 2AZUA 1MDTA 2NY4B 4KTYA 4FQXB 3U30B 5CP3H 3WJMA 3HZVB 4LSRL 5A3IC 1N5YH 4H2CA 2F7IA 2A9NL 3MYJB 1AE6H 1AGEA 1EUTA 1M3IA 3C6LA 3TU6A 4KMTH 5IMLA 3MCKB 1JF1A 3GM0A 5BS0B 4TUJB 1AZRA 2JKRM 4M56A 4FJZA 4ZW3A 1U21A 4JM2B 4ELKA 5F72S 3L7EA 1KIPA 4KZDH 1RXLA 1FHGA 4YH6A 3HZYB 4GS7C 3SZKC 3B9KB 1YPZA 4RFNB 3DX7B 3D2TA 4OJDH 1YLBB 4YBQD 5D4HA 1HL5A 2FO4B 3MCYA 3S36H 2YUZA 5IQ7H 2EE9A 1TOXA 3EG9A 3SZ6A 3L08A 1FG2B 2OPCA 1A7NL 3FO2A 1SMAA 5I5RA 5D6CA 4WU7B 4N2AA 3MRIB 2NDFA 3HHRB 2E7LC 4PIRF 4Q56A 2Y5EA 2G75B 1AKJD 3WELA 1NCAL 4B5ZA 1DVFA 1YC7A 2UXVA 3V4UL 5CBEA 5I1HH 1IGYB 3QUZA 4BH7A 3F84A 3DURB 4CVXB 4FZ8H 1PZUB 2FQGA 3ZYJA 4ALAL 4B60A 3FQXB 1P6FA 4NWUL 4E42A 1PNDA 4OU3A 2ZSVA 4FMVA 2JIXA 3VJ6A 1ND0B 5DMIL 4H1LB 4TTGA 5I30L 3FFCA 5H37A 3UTSB 1W72H 2GIMA 5D7LA 3U4BH 3RYMA 2Z7ZA 3CLEH 1NBQA 1HXYA 1RUML 1UG9A 4G6FB 4NLAA 4I3SH 3C8KB 4LFHG 2DLEA 5KYXA 3SCMA 1IGIL 1XIWA 3BUIA 4LVNC 2XTJE 1LK2B 5KVDH 2E59A 3MRRB 5DSCB 2JK5B 2KUTA 5KAQF 3BN9D 2VZUA 3RL1B 3S3CB 5BOZG 5ESVA 2DJ4A 4W9GC 1IAOA 2WKOF 4JM2D 4OAWB 5JO5A 1MQKH 3BPCB 4MQ7A 4PSRA 4XN5A 2GEQA 1KIQB 5CIPA 3TVMA 2QR0B 4X6EB 4Y4FD 3SE4C 3T2PA 1HZHH 2J2ZB 5E6ID 1R5WA 4RMWA 5JIDA 3MV11 4UT7L 5LVEA 1L7IL 1MWAA 5FYJD 3LQAC 3O3AB 43CAA 5HDQL 4LLUA 2ITCA 1V05A 2VMJA 2WWOA 3DI2B 3IU3A 2R56H 5DDHB 3QUYC 1P0SE 1R0AH 1K9TA 4HFWB 2V3EA 3KWWA 4L4VD 2G60L 3TLRA 4PLNC 4Y4HD 1EDHA 5EHFA 1PTZA 4R83A 5E00B 5TPWH 2FSDA 4OF3A 4NKOB 4XPBL 5CXPA 2DJMA 1N26A 5JHBA 2Q9OA 3EGDB 3L7FB 4JHZA 5MERB 5TDNB 3EFDL 1KYFA 2CXKA 5G4OA 1IM3A 3DIDA 1SN2A 5I6MA 4XMZA 1TTGA 4Z7UE 3UJJL 4DTGH 1QUPA 4OZGF 2F5AL 1FVDA 3QZBA 1HDMB 1FC2D 5E4IA 3LKNA 4W9EC 4GMSL 2ESVA 4Z3JA 4RQQB 4LGRB 5K5YA 4GAGL 4JZJB 1J5IA 3HUJE 3THML 1U8NB 3FHQA 1URIA 2PW1B 4WTQA 2HT2C 3DX6B 3KL5A 4FX5A 3BGFB 4G5ZH 4ZO7A 3DPDA 1WZ1H 2K8MA 3NFSL 4Y16D 1U2HA 2J6EH 1QW8A 3D4ZA 2MNWA 5IVZB 2R1YB 4HD5A 2KH2B 1JGUL 1F1GA 3TIEB 4NXSA 3NSDA 2FZ3A 3KLLA 2AEPL 1TTFA 2ZIDA 3RIAK 4FABH 4CVWA 5LNGA 3U6XA 4OKDA 3SKMA 5IV2B 3VQLA 3SKJH 5F1KC 3DHJA 3MNZB 4IRSB 5FO8A 2P8MA 3VXRD 2ADFL 4YPGB 5EO9A 5IKCB 2R0KL 2YBRB 2AZAA 5BMFL 4UINL 1PL3A 5INDB 2HN7A 2XTJB 1JXDA 3H2PA 4WHYH 2LFGA 4F7MB 4ERSH 2I27N 5H4YA 3U9UB 4XPHL 4Y7MA 4CADB 3CH1B 2WYZA 2VM3A 1A4CA 4XE0A 3IFLL 4UOZA 1D9KD 1UOVA 4M5YL 3LN4A 3MODL 1FVCB 3QB7C 4XXDA 2YPKB 4QWWC 4L8CA 5I6PA 5D71L 3WU1A 4GLRH 3V0VA 2WXPA 4ZOAA 3D07A 4QRUA 3CDZA 3VG9C 2XVLA 2YUXA 3SYCA 4ZZFA 1UFUA 2PLTA 3MGAA 4H8WC 3N43B 1FN4B 4Q4IA 1KFAL 1BQLH 3EBAA 4IHOB 1I1AC 3N1MC 2VLKE 3LS4L 5HI4D 1DJYA 1T0NA 4O4YH 5JW4N 5E6SB 4M4RA 2V8MA 2WOBA 1J0HA 5IVXA 4G1MA 4Z7UB 4RA0C 4F24A 2KZBA 5HHQA 4JVPA 4PI2A 5GSRA 3X1FA 5C7XH 4NWTL 4TSAL 2Q7YA 1ROWA 2AJVL 3OR6B 4O5LH 4WI9A 3D4YA 1FFNB 1HEZA 1QBML 1PDKA 4AQEA 1EX0A 2BVPA 3HUJB 1TEYA 5JUEL 2P80A 2P5PA 4Y1SA 5AZUA 3RNQB 3UBXA 4PGBA 3BUTA 3VCLA 3O6FB 1UT9A 1Z2KA 3KEHA 4K94C 2JCCE 4Y5YC 3QH3B 3UO1H 2QKIC 1NC4B 4G6JL 4LVEA 3UAJC 1ZCRA 4RDQG 3H9SA 3DETD 4OVVA 3PGDA 2EUXA 1UA6H 2WWMD 4F7KA 2FVNA 1HILB 3EYOA 5SWQB 3FQWB 5DJZB 3QWRD 4U2YA 2Y36H 3QFGA 3EOAB 4N22A 3KYNB 2VXTH 2EP6A 1DQLL 1OAYL 2GIXA 2DYSB 5EV7A 3WSQH 4C4KO 1KXTA 4Q58C 1FQ9C 1YPZE 3ARGB 1NDGA 5K9KB 3ALPA 1A47A 1O9WA 4C55A 1OLZA 2WXOA 1RV6X 3NGBB 1DLHB 4JDVA 4PS7A 5SWSA 3X11A 1I3GL 4DPAX 4F2EA 5CSGA 1E6OL 3WKMH 1IL1A 2WWKT 1MWOA 1A6PA 2EIMB 1A6VL 4MA1B 3UTZA 4TM9A 5GJTL 4P5TB 3PXLA 4F8PA 4CKQA 4JR9H 3VFWB 3N9GL 5DVOA 4QMEA 1M6OA 1RIHH 4JFYA 5DS1A 4AJWA 5EEZA 4LCWE 1QW9A 2APXA 2B1AL 3O6MH 1DQIA 4LCVA 4UUJA 3WY4A 1M9SA 1R34A 2GKIA 2EVHA 4XMWA 1BQHB 3V7AE 4LLMA 1MJUL 3OG6B 2WINA 5EF2A 3AC0A 2YFOA 2RQ8A 3O0RH 3GMOB 1MH5A 1F1DA 2EE0A 4WFGD 2NY7L 1Z0NA 3I02B 3QUMB 4X50A 1QO3A 4O58H 1H6EA 2VLKB 3AZUA 3GHBH 1TU2B 1KGCE 2E8YA 4NFCA 4LKCB 4I13B 4X7TA 5D7LE 5TQ0H 4E36A 4U0QB 2MNJB 4B3EA 4DKFL 1NC4D 4Q9CA 5IMKB 5JQ6L 1ZLSL 2P48B 1E6JH 4N8VA 2ZCHL 4MXWH 1RK0A 1SDDA 3V4PB 4AYGA 2VN5A 4EOWH 1HOCA 4KK5C 4LVOB 4JFSA 3IB4A 1LEIB 2P5WD 3W11D 5LGHH 4JRXB 1IKFH 3ECWA 3L1FA 3P4NA 4X6CE 4GQQA 1FZKB 5F7WC 3V55A 2HJLA 4Z7AA 3BLPX 3ROOB 3ZZQA 3DC0A 2CRYA 4WWKB 1LDPH 1WBXB 2I9LA 5EU5A 5AOKA 2UUDH 2F53D 2JCCB 2K45A 4WFHE 1A65A 5T1JA 2CXGA 3Q6FA 4PBWD 4X98A 5C0FA 2BSRB 4WUKH 4MFHA 2EDFA 3N5AA 4MLIA 5C0RL 5DUJA 3OHXA 2X3AA 4OVUA 4PJ7A 4EDWL 4M7JH 4XO4A 1KTDA 4WHCA 1LP9F 4ELKB 3L7EB 3L13A 2E75C 1MELA 1QNIA 1YPZB 2YD0A 1ZHKA 5G4MA 1QR4A 3JZYA 4NQCA 5EOQH 3QUML 1DL7L 1AZCA 2WUBL 3DYOA 4F57H 4ZXBA 3DARA 3WDHA 1S7VB 1DSFL 3FXIC 3BKJH 4F58L 5B7MA 4FJ6A 1F90L 4LCWB 4J4PA 1QG3A 3BVWA 1XGPB 4BELD 1HK6A 2EQDA 1R47A 3FSVA 4PB0L 4DN3L 3GIZL 3QUZB 4XVSH 3TEYA 1TSRA 1A6ZA 3V4PL 1SRDA 2YZ8A 4LQ1A 1UYWH 4JPKL 3BLBA 4HK0A 1JPTL 3K72A 1P4UA 2IANB 3NIFF 2ZSVB 3NJHA 4L5FE 5HI5C 3BJ91 1MCOH 4TV3A 4JRXD 1DN0B 2DQCH 1BM7A 1E5AA 1I1AA 1O6SA 3VJ6B 4XMTA 3TJHD 4E9YA 4FA8A 1A1NB 1WVZA 3A4FA 4IRJC 2H1PH 5ACZA 5D7LB 3LQMA 5E6RB 4X5WA 1N70A 3ILQC 3CQFA 4EEEA 3EYQD 3INUH 2QT6A 2DAVA 3LSOB 1JHLL 1UA7A 4R7NA 3SCMB 5KYXB 4G9FA 3ESVF 5M94B 4OFKA 5E8EA 4PJ8C 4FAAB 1E0OB 4Z7WA 1ETZB 1EAPA 3TH3T 3VGAC 5ESVB 2WCPA 2LQRA 4NN5C 2WXQA 1EZVX 4X6CB 4HFUL 2R51A 1ORSA 2CLZA 4DKEL 3PWVA 1VFOA 3BWAA 3HG1D 2X6MA 5FW6A 1GZHC 4Z95L 2BOBA 2UUDK 3NMEA 4AQ1A 4MB3A 2X6CA 3UAJA 3L3GB 4L48A 2BWQA 3US0A 2ITCB 3QR1A 3ZTCC 5FUCE 2K8QA 1J48A 2VM4A 3FB7B 4ESKA 2AQQA 3KWWB 5F6IB 1L4IA 2W9EH 3L2MA 5ECGA 4N68A 2G0KA 3AJ7A 3BVUA 2YUVA 3PHQA 1ZV2A 4OZIF 3E9TA 4UILH 3OX8A 1ZGLA 1EGJH 2WXRA 5CHNA 1F4AA 4PQXA 2I7OA 3FUMA 2NXZB 2FEDD 2VE6A 4A68A 2EDDA 2Q3AA 2QQKL 1JZ4A 5AVTB 2IAND 1GTNA 2JLLA 3E1F1 5I1CH 3KZ8A 1NIFA 3MAWA 4NS0A 1RFDH 5ES4B 1N6QH 4JM0A 2YEVB 1D5BA 4GQPH 1IBFA 3VXTA 3JTSB 3QEQD 1EO7A 5BQ7A 3L9EA 3TEXA 2VZTA 5IROD 4Z0XB 3QZOA 5DWUL 1VGKA 2L0DA 1OZTG 1ZY9A 1MRFL 3N1FC 4Y5XC 3E80A 1NKRA 3LPFA 1AG0A 4P2RD 4JFZH 3VYNA 2BSSB 4FP8L 4LSPH 4DUVA 3J27A 2DLGA 3S4SA 5JHLA 2EYSA 3H1ZA 1MJ7H 3B4NA 2B5IB 3BIBX 3WTSA 1G7MB 3VXSE 5CJXA 2ZNXA 4KXZH 2FZ3B 1MVFA 3DTXA 5CLYA 1MCPL 2XG4A 4DP0X 1J86A 3VQ1C 1M42A 1KNOB 3MJWA 5IQ9A 5I0XA 2DDQL 5C0ND 2H32B 3ZKNC 4X5XA 32C2A 4QDGA 3AREB 1YEHH 3L45A 4MNHB 3MVSA 4L4TD 4JDTL 4FOMA 3WY1A 4W81A 1DVSA 2W94A 1M9WA 1N0XL 5D1XE 3VE0B 1G87A 4JLRA 5EULV 4MWFB 5SX4I 1MVUA 3U4AA 1PY4A 1KOAA 4OZFA 4AQ8C 4YHLH 4W9JC 1E90A 2BOCA 3GKWH 3L4ZA 4KO5A 1OCCB 2XX0A 3VXMB 4UTCA 3BZ5A 5ID0B 1XF2A 4WI2A 1D5ZB 4GIPD 3OR7A 1PSKL 4RAVA 1F8TL 3EF4A 3KYOA 2GAZA 3TBWA 3D39A 3H8NA 3V0VB 1QKZL 5I8KH 4P5MB 4XZ4A 1E5ZA 5CZKA 4QRUB 1RZJC 1CD8A 1NCBL 2UXGA 2YO3A 3QARA 4FG6C 4NQEA 4HGKC 3DO4A 1G1YA 3AG1B 7FABL 5D7JB 3VYOA 4YXHL 3CFDA 1B0GA 3PWJA 1F4XH 1T0NB 2VQTA 1YA5A 5HHVH 4M62H 4R90L 3DO7A 4M4RB 4HJ1A 5IT2H 2AJ3B 3L5IA 2H1XA 1QFOA 1NDMA 2PP7A 2ZXWB 5B3SB 4L5FL 4G1MB 1FGVH 3WS6C 3GUTA 4PJBA 3VFSB 3T3ME 5HHQB 5BQDA 5GSRB 1IC7H 3OWRA 1U93A 5DRXA 5J6SA 4PY8J 3G7TA 2WY3B 4X7CC 4KQ4H 3VD7A 4JJHA 3EH5B 3FB5B 3X1EA 2NY5H 2YK1L 1PDKB 4BGDA 3F64A 3VRIA 1G9EA 5DURB 5IGXH 1P53A 2R2CA 5FOJA 4L23A 4PJIE 2CO3A 4XMVA 1WZKA 4R0LB 3I3DA 4XMLH 1J0IA 1QNZH 3VCLB 1T7VA 3BC9A 4MMZC 4IHBA 4NUMA 4QHMB 3CVIH 2R0ZL 3S37L 1BOYA 5I0YA 3K2UL 2H26A 3FZUD 3VXSB 3MLXL 4MBRA 3NK4A 3O9WA 3PGDB 5LQBH 5E9DE 3QRLA 1A9BA 3UTSE 1RQ5A 3VXMD 3F58L 3LHPH 4IRJA 3EYOB 4TQHA 2AV7B 1EZLA 4PJ7E 5E6ZA 2A9MH 3LD8B 3GINA 3GLEA 3ZDZF 1OE2A 4GIAA 4G80B 3B1TA 1BX2B 3HMXH 2CO7B 1I1FA 3LEVL 1BVNT 2QGDA 4ONFH 3S3DB 3ZKSD 2G3NA 5D1XB 4JDVB 2G3MA 4NQCE 2OMTB 3SGDI 3B3IA 5D7JD 5JORA 1IL1B 1F2XK 3SKOA 4FI7A 1H8NA 2Q0ZX 4JM4H 4YL4A 3V9FA 5GGRB 3IFOA 2F54E 3NSCA 3K0WA 4KO9A 1ZA6A 3Q2WA 2WKLA 4M5TA 1GZHA 2WIMA 4GO6B 1FNGA 4PMFA 5D7HA 2HVBA 4UUJB 1UCBH 5AOLA 2MFNA 4YBQC 1I75A 4YHIA 4R26L 4XMUA 1G6RB 3VXQA 2WINB 4RMRA 3OKLA 4JB9H 1K3ZA 1FF5A 4S0HA 1ZPUA 2D9QB 3HBPA 1PG7W 1QO3B 3QYNA 1M05A 3GLAA 1RZPA 4ZTPH 3OC5A 3HZMB 1RZGA 3GBML 4KOCA 1RHHA 1AE6L 4CVUA 1OIOA 3BOVA 4YSAA 5EEXA 2EH8L 5B4MD 2ZAHA 4CSTA 3VXSD 1CFQA 3T3MB 5F89A 5CU9A 3IYLW 2VDRH 2FHFA 3OV6A 4OLUH 2C3WA 2VMFA 2H0PA 2PTUA 4H26A 4RFOL 4CJ1A 4W9ZA 2EDBA 3WCYA 5KVFH 1HOCB 2PCFA 4LLYA 5IFJA 1MVYA 4KXDA 3ZO9A 5H4ZA 1ZT7A 4G1EA 4NQSA 2AK1H 1MIEH 1BYOA 4PJIB 3MU3A 3P4NB 4FZEH 4G59C 4H88H 5IQ7L 3RWFA 2HX8A 4B0MB 4JRYE 2I9LB 4NUQA 5EU5B 1D5XA 4HMDA 3VDCA 3MTRA 5D1XD 3BPOC 4BA0A 1MDAA 2XZCL 3MFFB 4OGAD 1IILE 5GGTA 3QCUH 4GG6A 1BZ7B 2J73A 3DBSA 3I50H 3QXUA 4NO0A 3Q6FB 4X4MA 1UB5B 4WEBL 3M17B 3BN9C 4KI5E 1Y0LB 3CH8A 5E9DB 3RQ3A 4Y19A 1UXSA 3NZHH 3OHXB 1CBJA 5C07A 3BZEB 5I1HL 3DBXA 4PJ7B 1TQCB 5AW9B 4M8QB 3D4GA 5DT1H 4ZFGL 4CVZB 1BAGA 1DUYA 2EO7A 4J3OH 4Y4FC 2WTOA 1QEWA 2YGPA 5E6IC 4I3RH 1SOSA 1G6RL 2VW7A 5F0LB 3ZQ9A 2NQCA 4LEXH 1IGTA 3DX1A 3D9AH 4V33A 2BXYA 4KHTL 1QRND 1F0LA 1ZHKB 1KXVC 4NQCB 4D9LL 4ZXBB 4L29A 4OFQA 4AQ8A 5IEHA 4XNXH 4Y4HC 2YRPA 2ZWYA 3CLEL 5K9OA 2F54B 3HG4A 5F7FA 4WIQA 3HIZA 3TO2B 1RI8A 5CN3A 5E2TH 1X7QA 1CXHA 3MOQA 4ZQKA 4R2GD 1AHMA 1NUFA 1MFAH 1VRSA 2VDMH 2AAVA 3M7OA 4ZFFA 1A6ZB 2OR7A 1T7YA 5F88B 5DJDB 5B21A 1BFSA 2ED9A 3GO1L 4HK0B 2K6WA 3QUXA 1MQKL 4WTWA 1NEPA 3WIAA 1WA1X 2J1ZA 3KYMB 4C54A 1AAJA 3BP7B 3FBKA 3O4LE 4ODVH 4UQBA 5D1QD 1U8KA 2IMNA 1Q9OA 1O6SB 1H19A 3CXDH 4QXVA 2BNRA 2NW2A 1PLGH 5IB1B 3PNWA 4FYSA 4B9GA 4N3TA 3FQUA 3LRGA 1U3HA 2X10A 3F7LA 4WWID 3MQIA 3RG1C 1V7ML 2NY0B 2AANA 1FBIH 3WS6A 4NN6B 4Y9BA 4S1QH 4Y16C 5TPWL 4U49A 1Q38A 2IBGA 5CNHA 4QJ4B 1S5IL 4G7VH 4WFFE 4O2FA 3QG7H 1YEKH 2IC2A 4NRZB 4U1KA 2EUWA 2JKTM 2AI0H 2KKQA 1U8LB 2BZDA 4KVNH 5E94A 1SHXA 2P1YA 1TTAA 5DK2B 1KPUA 3VD5A 5L2JA 3PWVB 3ARUA 3CVHH 4JRYB 2JI1A 2FEEI 4HQQH 4HUMB 4MMZA 1ZLUH 5GJSH 2DICA 2BOBB 1B4JH 3WYRA 3ZSTA 3OJ2C 2FLMA 4AQ1B 3NSFA 3V8OA 3IF1A 1WG3A 3D39E 3WTYA 2ICEA 4YVUA 3ZKMD 2LU7A 1PG7H 3II1A 3O2DL 4NQEE 1F3RB 3C5XA 2E7HA 4BE5A 4DOHE 3UO8B 3NCEB 3QQ3A 4OGQC 2D31A 1D9KC 2AFNA 1J0KA 4X2UA 5HHME 1WZ1L 3PHQB 2J6EL 3MUUA 1CDBA 1JMXA 2VZOA 1TZGL 3MROA 4U6XB 5CHNB 1NFKA 3P02A 4OLYL 4LF3A 2PYEE 1T04B 4V11A 1GYUA 3OJMB 4MCYB 3AY4C 3DGGA 4N2FA 1PFCA 1GY2A 4PP1C 3VGBA 3N0AA 3KNBA 4P59L 1HS6A 3ET9F 2Z92B 1LE5A 1D5BB 1SGKA 2OZ4A 5AQ0A 4RZKA 1MJ8L 3P9LB 1VFAA 3QUHA 5F9OH 1DZ0A 4XCYB 4HKZA 5CKGA 3D25A 1U3NA 3AMLA 3MLUH 5EN2A 5HI4C 4E9VA 1LO4H 3GMQA 1VGKB 3R0MA 4HWBA 5JMOC 4F5CA 3RTQA 1JRHL 1Q9WB 5DUBA 4ZBJA 3CK0H 3N04A 2J8OA 2J44A 2XZZA 3O4LB 3DTXB 5GRUH 4NSKA 2XG4B 1K6QH 5DHVB 2BVUA 2BX5A 2ZUVA 3MXWL 3NYKA 3ZRCC 1XF1A 5CO1A 5CD3B 5H94B 3WBDA 4K94L 4X5XB 2ITEA 2H7WA 5HYJD 1QA9B 3I9PA 4AL8L 3O8XD 1S6NA 1MLBA 3BQVA 4BSVA 2YD8A 1XF4A 3T4YA 3T6VA 4YDIH 4JCMA 3MC0A 3NSJA 4JFEE 3DETC 4E5XA 4YHML 3OAUH 3ARPA 4JLRB 1LE9B 2WWMC 3VM5A 1DTUA 5AW3B 4XMKL 4U0RC 4X8CA 1E4KC 1QYGL 1EZUA 2VSMB 3UJIL 5L88H 3GXMA 5L6YH 3O0LA 3K1KC 4A55A 3PFUA 1HTYA 4AKPA 1L9SA 1AVAA 3F65A 3FT1A 3OR7B 3NIDB 1ZLUK 3WLBA 3TBWB 2GAZB 2XA3A 2AVGA 3D39B 4MSWA 2ZKYA 4PRPD 4I1NB 1AGBB 5ETUA 4YLQT 3BAXA 3HW7A 4NQEB 2QL1A 4DOHB 3GEFA 3MRJA 3DGDA 4NNXA 2O5XL 2WXFA 5HHMB 2BO0A 3T08A 4GSRA 1B0GB 2EXWD 2F74B 1UZGA 5E6IA 1OF0A 2A6KA 2IO5A 3D85B 2QPUA 3LX9A 2CO1A 3G9VA 15C8H 2BMKB 1SUHA 1V7NH 2PYEB 3QWOB 5ALCH 4AY0A 1MOEA 3RA7H 5KANG 2YRZA 5CLWA 5E8NA 2PTTA 1OT4A 2DBLH 3S5LG 5DRXB 3S34H 2ILLA 3MJ8B 3PL6B 1QFUH 3JUZA 4CGUB 2D4DA 2VXTL 3WSQL 3OGOE 4WY7H 4KJYB 3IWUA 1CU4H 3ES6A 4PJCF 2EDLA 2HWZH 1XSIA 3WFEL 1GYWA 4ZT1A 2CUAA 1C5BL 4CN1A 1MI5E 4P23A 3RX9A 3IJYA 2HX9A 1NUDA 2CBTA 2HJKB 4P46A 4BQ6A 4HOXA 4ZMWA 1MNUL 4GUPA 3K6NA 4CBZA 4GG6E 2I7SA 2NYKA 2ATKB 4PG9A 3H3KA 5A1AA 5CP7B 1EZVY 2ENSA 2J88H 2APBA 3DROB 4Y19E 4U1JB 3CFTA 2UYLA 5C07E 3SPCA 3W11C 1GKOA 1OOAA 1NL0L 4R7DB 1FZJB 1U8IA 2JQZA 3IETA 4P99A 3K6SB 3QR2A 5JXED 5INCA 3VVVA 5EBLA 2HUEA 2BIMA 4MMXC 4RX4D 1ZMYA 1YNTF 3HHSA 4JFEB 4UNUA 3DX3A 1N64H 1T22A 2W81C 4HUUB 5LKNA 2DN7A 5KOMC 3SKOB 1DDHA 3IFOB 2F9BT 3UC0H 1FGNH 4WWPA 4ES8A 1E6JL 1YZZA 2PYED 1MFNA 2RALA 4P3WA 4EZKA 3OKDB 4MHHG 1FNGB 2XZQL 2DLFH 2DB8A 2Y24A 2YPVH 5C3TA 4BFBD 5DD0H 3BZDA 5D70H 1LYQA 3ABLB 2EDYA 1SLXA 1UWXH 2DM2A 3QPXH 1GL4B 4XMPH 4JHBA 5CCJA 2BHUA 4TQEH 5EU3A 4MS8C 2GG1A 5TDPB 1D9KA 1G9NH 5FEBA 3IS1X 3QUKB 4I89A 1M05B 3GEWB 4GRLB 1SN5A 5F3FA 1RZGB 2BP5M 1GZQA 1RHHB 4XNYL 2H4EA 3CHXA 2D0GA 1RIVH 1U8QA 5DC2A 1E8ZA 3UG3A 1FI8C 4KDVA 3X12A 1EHXA 1CDGA 1XGRB 3RX7A 5F89B 2GJJA 1A2YA 3DA0A 3BEWB 3CZKA 5DVNA 2DIJA 4H26B 3PWNB 4LAQL 4LLYB 3TBSA 2P3YA 3TJHC 2E27H 4K07A 5E2UL 3CU1A 2Z7UA 1N6UA 5B7EA 4ZI8A 1QBLL 2BIOA 4UT9A 4YJZL 1G7PA 2HKHH 1MI5B 3EYQC 1D5XB 1TMCB 4KTEH 3K91A 4JJ5A 1MKFA 2FJHA 1CICB 1HOEA 5F2FA 3V5HA 3N42F 3WIIH 3BFOA 1NEZB 4TLKA 3DVGB 2CWRA 1D3CA 4OM0H 1EAQA 1OHQA 3MRNB 1UFGA 2AJYH 1ZK5A 5C07B 3DHMA 3KYKL 3GXFA 2CSPA 3QDJA 5JLZA 1DUYB 2CUIA 1I9JH 5T33L 3ZL4H 1W0YT 1KCSH 4P4RB 3T8XA 4OT1H 4G7QB 1MCOL 1EFXD 4U3CA 1JPST 1FIGH 4D3CL 5ICXA 1G0YR 1IBYA 2CK0H 1A6AA 5ADPL 1E4KA 2HG5B 5E51A 2ZXEB 4GRLD 4YQXH 5K9OB 3DOSB 4PWKA 4BBWA 1UVQA 1IZKA 3INUL 2RB8A 4U1SA 4I7ZC 1WBZA 2PF6A 5ICYA 1WCBA 4PJEE 4ZQKB 3VUAA 2FEDC 3ZHKA 4F5CE 4I0PA 4JO4H 3T0ED 5AZ2H 4JFFD 3UTTA 1UWXK 1HKLH 2VH5H 2ZF9A 3F7VA 4RISH 4U6YA 4XGZA 2Z65C 5LAPA 4BH8B 2E9GA 5IB2A 1IIIA 1WDAA 4P4KD 3RPIB 3GK8H 3T3PE 3HEIB 3KDMA 4QHLA 5KVGH 1LEGB 4O9HH 5C7ZA 3FTWA 4JAMB 1MPAH 3FMGL 3KWVA 3ZTDC 1NIBA 2QQNL 1MEXH 5IROC 4B9FA 4GSXA 4AYFB 3HMWH 3FNKA 5AYQA 1MI5D 4POYA 3PNWB 3GMMB 3V4VA 5J6GA 1CL7I 4H13C 3S96A 1U8MB 3FQUB 4D7PA 1U3HB 4NNYA 3WHXA 5GGTL 4ZJ9A 1I7TB 4NQVA 1QLRA 4HGWA 2XFGB 3DI3B 5EWIH 3QYMA 4IQHA 4A2HA 1A7PL 2B3RA 4MBOA 1K85A 4TS6A 1SXNA 3UZVA 1GA2A 1KN2H 3AS3A 4U4IA 3GJEB 4QGTA 3SE8H 4CC4C 1FIEA 4UZGA 5J7CC 3MJ9H 4YDMA 4B7IA 2C3XA 4XN2A 2N01B 4MA8H 1KPUB 2DI7A 5C0NC 2WW8A 3TBYB 2WQ8A 1TZOA 2Z35B 3OLGA 5KZCB 1N19A 1HCVA 2EE2A 2B4CH 2VISA 5JYMA 4TLUA 2J5LB 4IKIA 3IF1B 2DMBA 4GW1A 5F9AC 2ICEB 5CS7A 1L9RA 5FUZH 1U8CA 4Z7NE 3WTUA 4YEFA 2WANA 4LRIC 3QQ3B 4WI8A 1TNNA 2XPGA 1H6TA 1YMHA 2K7QA 4FFZH 5DJ2A 1AQDB 3MBXH 1JGVH 4JDZA 4IGBD 3V2AR 4I77H 4MMXA 2J1XA 3VFVA 1RK1A 4YSOA 1N5AA 3OMZA 1IUZA 5EUOF 4LLQA 4RVBA 2Y7NA 2NNRA 5FFOA 5KVFE 4J5VA 2BFGA 1RVFL 5EFIA 3PUUA 4X5QA 2CK2A 4HETA 3FKUS 4I2XE 1VFAB 1MXDA 5DEFA 2DYRB 3RNKA 5AOZA 3NCWA 3FSAA 1EAJA 4B9YA 4IBWA 1E8XA 2JJTC 1IC4L 1R46A 2WAQA 4PJEB 1VADB 2JKJA 2JKXA 1NUNB 2QFRA 2FD6H 5AD0A 1ORQA 1R19A 3RTQB 1KJMA 4OD3H 4UZUA 1ZXQA 4K5MA 1U42A 5J57B 2YKLH 2KHAA 4JG0H 3T3PB 3HE6D 1UKTA 4M93B 1I8IA 2ZWKA 5HPOA 4JCWA 1H5BB 1X5FA 5T5FA 4Z5RB 1PFOA 2W9LA 1OAKH 3KGTA 2LTQC 4K8RH 3PJLA 2Q86A 4APXA 3GIVA 1YYLL 4YDKL 2GABA 1M6UA 1UB6B 4HC1L 4TVPE 3DRTB 3WFBH 1XF4B 2WLKA 1ZT4A 4JS7A 3RZWA 1WYJA 4YX2L 1X5IA 1LD9A 2QADB 4GY4A 4RGMC 4UOW0 3UZEC 5AW0B 4OFYA 1QVOA 1M7XA 2IQ9H 4JGMA 4P05A 1IAIH 3B6SB 4UAHA 1OGAD 4YHYB 5HHVL 4M62L 1IQDB 4YNYB 3QIWD 4OB5L 5IT2L 4K9EH 1BFVL 1R3KB 1G9ML 4MDIA 3RUGA 4DHLA 1AIFB 4OI9A 4LPWA 4WO0A 3ZZLA 2HAZA 4JANA 4G3YL 2V5RA 4PMEA 1U6AH 4UQ3B 3PDOB 4XP1L 1X4YA 2NY5L 2FRGP 4HVBA 5DMJB 5IGXL 1EMTH 4Z7NB 3ESPA 2OZ4L 5IJVB 1YHPA 2O4EA 2OJ1A 4ZPVB 2VXQH 4MQXD 2Q8BH 1J1OH 1T2QH 2X4SA 4NNXB 1CT8A 4H1LG 2Z8SA 3W2DL 1DUZB 4HLZG 4HWBL 5TF1H 3DXAD 1KIRB 4QRSA 3RLSA 3AY2A 3C09C 2A6KB 3QA3B 3JT0A 4JHAH 3MKKA 2VDRB 4U2ZA 1YECL 4MDJB 3RHWK 1JYXA 5IREA 2GTZA 3LOWA 3W0WD 1KY6A 2OMUB 4NNPL 3TT3L 5KYNA 5E8NB 3LHPL 4XN9A 3VM7A 1SBSH 1VPOH 4DIXA 2G2PA 2IOOA 1LO2H 2HKAA 2OJZL 2OM5A 2B59B 2HT3D 2V0AA 2P5ED 4I2XB 4R0LC 3O2WH 3MTXA 5BOJA 5F7UA 3FUNA 4ONFL 4YHZL 2GC7C 3ES6B 4QRPD 3GSQB 5I75C 4F20A 1YG9A 1TKWB 5B4MC 3KPTA 4NQXA 1MY7A 4QYOA 2HFGH 2DQTL 3KPSA 4P23B 3IJYB 2QADD 2YC1A 4P46B 2WZ5A 4JM4L 4M3HA 1MCHA 2IH1A 5E08H 5DI8B 4RDQF 1RZFH 4PIBA 4JPWH 3V5KB 1HSAA 3QEQA 1OSPH 2X7LA 2HTLC 1F3DH 1EXUB 3D69A 4Z7IA 3TF4A 4WKZB 4BK5A 5C6WH 2UWEA 2XACC 5L7XL 1I9IL 4K2UH 3IETB 3QDJE 1ACYH 3MSPA 1SYSB 4JB9L 4OZ4A 5ITFB 3ZTJG 1ZHBB 3BEVA 4U6TA 5A6LA 1D7BA 1JDDA 4OGAC 1KCKA 4QHUB 4FQ2H 3MV01 4QGYA 4XXWC 5EOCL 3K80A 5AW8B 3VI3A 2APSA 3HHSB 2HXAA 3QPQD 3RP1A 5KJRL 4KJQD 5E5MA 1BSIA 1T22B 2PWEA 3D51A 1PNCA 2FR4A 1WK0A 5GHWH 3O3EB 2Y6TE 3QDGD 4Q74A 4X8XA 4MMYA 3BE1H 1WITA 2VDRL 2VDMB 2FATH 2O6DA 3EGXB 3S88H 2Z91B 1VF5C 3IFPA 5ADOH 5KVFL 1PBYA 1QAWA 1DJGA 3EOYG 3GKZA 5DC9B 1CXIA 3UTTE 4C47A 1RPKA 1SYVA 2AK1L 4KFMA 4HAGA 1OGTB 3KVDD 3NZ8A 4F93B 4LRIA 3NFPB 2Z8RA 4NDMB 5BO1L 4OF6A 4HCRA 1GY1A 3LS5H 1ZT1A 4XNDA 4HD9A 1EO8L 2V9RA 2RGSA 5CEZH 5IR1B 1QPXA 1E50A 3QEGH 1OSZA 1ODAA 2RHEA 3CLFL 5HDRA 3LKPB 3I50L 4JVWA 1GZQB 5BUAA 1RCYA 2DV6A 4TNWF 4R2GC 3QVAA 2D7TH 1OF2A 4UYPA 3U0WL 4JRFA 1U8QB 4OQTH 5EDXA 1DQMH 4Q6KA 5BOPA 3ZTNH 3X12B 3ZL1A 2BDNH 2RA1A 4MJ2A 4OY9A 4UI2A 1NCDL 2ZUQC 2DY2A 2VQ4A 2CDFA 4X4XA 5BV7B 2LE9A 3CPLB 4NKDA 4HK3N 4J3OD 2YPLD 5D1QC 1OP9A 3HI1B 4I3RL 3TBSB 5CUSL 2JJTA 3D48R 1E4WH 5PAZA 1KYDA 5F7EH 4TVPL 1HHIA 5AUMB 3CTTA 2Y07H 2I60H 3GRGA 2VIRA 2F7OA 2OCJA 4HIHA 4XNXL 4MJ5B 3L9RB 3BAKA 2C7UB 4JJ5B 2H5UA 2Y2YA 3V5HB 5CJQL 5IJKA 2OL3H 1GS8A 2Q3XA 3WOVA 5CCGE 1JN6B 2GCYA 5HHPA 2HJFA 3V5DB 3I6LD 5HDWA 2AQ2A 4WGKA 1KB5H 4JFHD 2ZKMX 4PU2A 1KDJA 2V9TA 1KMGA 5HI3D 4R7LA 1R75A 5HDLA 3QDJB 3I9AA 1T66D 1XBDA 4N1CA 5D1ZD 1J8HB 3EUUA 1IZJA 4ELME 3T8XB 4TTDD 1FA4A 4HXBL 2UZIL 1TF4A 2J43A 3T4AC 1KG0A 1BZOA 1KLUB 2CBMA 3UZEA 3ZKMC 5ICXB 2KT6A 3HBGA 3HLKA 1BM3L 3LY6A 3TBTB 3S2CA 5FW7A 1F86A 1UVQB 2NLJA 1A0QL 1UH2A 2G9HB 4TUOA 4ZO8A 5IHHA 1WBZB 2DYPA 5JIIA 5ICYB 3KLDA 4UM9A 1WCBB 4GEIA 4PGDB 5HGGS 1YEKL 2FK9A 4AUYA 4I0PB 3SPVA 4BE6A 4ZX3A 4Z76B 2AI0L 5E2WL 2LR4A 3S98A 3UTTB 5BV7L 3F7YB 3LZPA 4IRZA 4KVNL 1KENL 2B1OA 2VN7A 1U0QA 4L0ZA 2DTML 2Z4QA 2BXZA 4QHLB 4HQQL 3A6CL 4AK2A 1P1ZA 3DJ9A 2CRIA 3T6XA 1IEHA 4UT9L 3B2PA 3FF8A 5KSVA 5A6MA 2L7QA 2X12A 5H2BA 3ARXA 5DEGA 1J1XH 2JELL 2WVVA 4MVBD 1BQRA 4YEEA 3GMLB 4H5SA 1DE4B 4JQIA 4WEEA 4UB0L 4PJXA 1NSNH 4P3DA 2X2JA 3QCTH 4K7FA 3SJVB 4RMTA 2G2RA 4WW2F 1HE7A 4FHKA 2JB5H 3TYFB 2ED7A 5F93C 3VGDA 5K9QI 4JK0D 1J8HD 5JIMA 3RFZA 3O2VH 5AVYB 3RUGE 1OCZB 4NZJA 3JSSA 4BQCA 1ZHNB 3PRZA 5F7DB 4LSUH 3O8XC 2FIKB 5EPMA 3BN3B 1BQHG 1RZKH 3HB3D 3MV8A 5FLVA 5F9OL 5JXAL 4RNRA 3G6JF 2YN3A 2BVTA 1BJ1H 3PE9A 4BFJA 4HBQA 4MJ6A 4AV5A 1SLUA 3G5VB 1KCUL 4YE4H 1KJ2A 1M7IA 1NJ9A 1E5YA 1XAUA 4LOFA 4MRBA 2WBJB 3UACA 1YMHB 4X6DF 4L2LA 5L9DH 1P7QA 1P2CA 4ELMB 3LAFA 3QJZA 1IV8A 1ETJA 1NIAA 3CMOL 4I9XA 1YEJL 2DH3A 4LHUB 2VDNH 4Q6IA 2J8UF 4TF4A 3VFVB 2ED6A 1DSWA 3GGWA 4PTUB 1N5AB 3GBNL 1KN4H 4H25B 3P73B 4GQ9H 5FHAH 3BIKA 5EFIB 5ECJE 1FWXA 1SOQA 3BAJA 4PRHA 3EOBA 5T3ZH 1AQHA 5DZVA 5C0BB 5JQIB 1KXQE 5BRQA 2EXWC 5E23A 5K39A 4HWNA 5D5ME 1BG1A 1PF3A 4FQLL 3QPKA 4KKPA 2IGFH 3BFQG 1ORQB 2C9XA 3OKOA 4U1GC 3FHEA 1KJMB 2H6OA 2VDLB 3NQIA 4EVNB 3KPSE 2ITDA 1OTTC 5KW9H 1YUKB 1WD8A 3EF7A 5L6YL 2JF1A 3SJVD 2DQIH 4XVUD 2GJRA 3CFIC 1AD0A 4XOCA 1I8IB 1E28A 3IJEA 4AQAA 3N85L 5I1GH 2ZX6A 5JPNB 2VUOA 1XGYH 3ZGHA 3GSUA 4M6OL 4B9ZA 3P54A 4QO1A 3E6HA 5AVSB 4ODXA 3TCXA 3ZMRA 2FL5B 1CLZH 1N7MH 1HESA 2C9AA 2Q86B 4APXB 3B2MA 3JYCA 3VFOA 2ZPKH 4LASL 2R69A 3GRBA 5D2LA 4FFYA 4M48H 4Y88A 3VI3E 1LD9B 4E9QA 4PRIA 2BC4A 2CNZA 4KV5F 4IDJL 3MLYL 2WBJD 2A3TA 1J0ZA 3GM8A 15C8L 4JJOA 2YAPA 3LYRA 2Y23A 3RUGB 3HA0A 1NM4A 5DMGD 2F61A 1UUSA 2DBLL 1FLTX 3BPLB 3SDXA 4LHUD 4GAFB 4MNGE 3U9PH 1QFUL 4JANB 3V7AG 2A9BA 5CGTA 3ZBMA 4XN4A 2ICWB 2PW2B 2QLYA 4U7SA 4WY7L 1A02N 5DU7A 3CVBA 1I7UB 4NM8L 1CU4L 5KVGE 3C60A 5C0BD 4LBEA 4P8QA 4X4KA 3D50A 4F92B 5IOPB 1J5OH 1Z3GL 3NJNA 1CC3A 4KTDH 3BAYA 1CT8B 5TK2A 2VN3A 3VTAA 3LRSA 1D2OA 5AKTA 5LB1A 1KACB 5JW4Q 3VSUA 4ZFQA 2VDLL 3QJVB 2AK4A 2J88L 1FSKC 3T4AA 3CJJA 4OJAA 5C08D 4MQTB 1T20A 1KCVL 4HISA 2K4WA 5CBAB 2XZAH 4E2OA 1LO5A 2B2XH 1MRCH 3P11L 4HUVA 2V3DA 4H0LC 4N2EA 4FFTA 3NA9H 2E86A 5C6PB 2DQEL 1JNJA 1OT2A 4FNUA 5D5MB 1JUFA 1YN7A 4KUZH 1TJIH 3O41A 4XMXA 1N64L 2BVYA 3IJHB 4M3KB 4QYOB 3UMTA 5JQHC 3KPSB 1S8DA 2XWTA 1JPFB 2YC1B 4CA4A 3AXLB 2CRMA 1A4AA 3V0GA 5BVPH 3GBDA 1PLAA 5I74C 4AE1A 3FT2B 4WFEE 2PPDA 4PPTA 3NSYA 2YHGA 4X8GA 1QUNA 2WN2A 1BGXL 2EIBA 4J2XA 3MGOB 1IC5H 2R1WB 3LKOA 3EJUA 2GJ6A 2Q8AL 1GJIA 1AQKH 3IDJA 4HPYH 1URZA 1K4CA 2OTUB 4BZ1L 1ZS8A 1XFPA 4ZK8A 3IFNL 3ARDD 3DVFA 2EYTA 5DR5L 1OE3A 2BSTB 3VI3B 3WAKA 1IGFL 3MA7A 3MUY1 3I6KA 1TIUA 3AS2A 4MJID 2D3VA 4WI0A 5E5MB 4LCCC 5MP6L 1ZVNA 2QHRL 2WLLA 3RBSA 1NCTA 2D3JA 3H42H 2X4QA 4LESA 1S7UA 5C0GA 1INEH 3FU6A 4MNGB 2CHDA 3Q2NA 4QKTA 1IAIM 5L4IA 3TURA 3MLVH 1XZ0A 2NDGA 3V7MA 2CA4A 1FFRA 2EICA 3FRPA 3AMKA 4FQ1L 1JXGA 1U92A 4PG2C 1B0IA 2X0WA 2AF2A 3NZ8B 4U1HA 5ESAA 4B95C 1TMQA 3PJSB 4JHUA 1ZT1B 2W0LA 3WY2A 2V7NA 1BZ9A 4G6KL 2WZ6A 2WJ7A 5ANMA 7CGTA 3AADB 4UU9B 4FLHA 3KHQA 4GKNA 1CS6A 3GXDA 4OCRH 4PRPA 3T0EC 3JV4A 3FTUA 2EDRA 5JHDD 2JNZA 2HFTA 1QOKA 4P4KC 3GSXA 4MAZA 5D93B 1HHJB 1PQZB 4PJXE 1SVCP 2V17L 3JV0A 3BCDA 4LE8A 3HS8A 4M6NH 3ZL4L 2Y2WA 3BGAA 4F8OA 3JV5A 2ZD0A 1MAMH 4PRAB 1FIGL 1YCSA 4HKBA 3SD5A 4HPOH 2VIRB 1QEXA 4HIHB 4BSWB 4WQOA 4XPFH 2J7LA 3W9DA 4YQXL 2IFFH 1ADQA 2VQ1A 4XHQA 3UYRH 4XRCB 4I87A 3MV8E 5ESQB 1F00I 2GCYB 1E2WA 2QLVB 2HJFB 1XCWA 1P5UB 2HRPL 4G9DA 4EUPB 1UH3A 2XKNA 4P9HL 3SDAC 2FEEL 3P4MA 1IGML 4UCFA 3ZIMA 4DESA 4ODUA 4NUGL 3L1GA 1QQDA 5EZLA 1CB4A 1RY7B 4RAHA 1D6EA 4N6RB 1KCRL 4HUWA 3VGEA 2Q1EA 3Q7JA 4JFOA 3S2AA 1S7XB 1ZTXH 3BVDB 4XO5A 1KG0B 4BA8A 4F3FB 5JA9A 4HCRL 1TQTA 1QFWI 3BP5B 4FNLH 4M8VA 4D0BA 1QSFA 5IBTH 3OB0H 2HFFA 4PRHE 2VLRD 4F33A 1DANU 3WIHH 4PJGE 4TUOB 5EWIL 4IMKC 5HY9A 4PBXA 5I26A 4FC3E 4IGBC 4EZLA 1XH2A 4K23H 3Q2VA 3UBFA 3KM1A 3BO8A 5K33A 5I73B 2Y7QA 5JXEC 3CZEA 3ESMA 4R4BB 3AU1B 1B6DA 3LV3A 3ULVE 3GZPA 4ETQA 5FECA 1V10A 1J9TA 2AMGA 3MLSH 3KLAA 5C0AE 5CJ5A 1MCKA 1P1ZB 1PKQA 3PXHA 5TE7H 2NOYA 2BPBA 3SPHA 1IT9L 2AGJL 5LBSH 3SBRA 1LK3H 3TP4A 1MUJB 5E6YA 4MD4B 3REWA 5KSVB 3VWKA 5FUZL 4XNBA 1DBAL 5I1EH 2UVFA 5DEGB 1TTUA 2WBXA 2Y1ZA 5C0IA 1R4XA 4YHKL 1CDUA 4PJXB 3HE6C 4PRIE 3D0AA 3MBXL 1JGVL 2C9SA 5F9JB 3SGEH 3MRQA 4K3EL 3B8SA 2F19H 2EDNA 2G2RB 2F1AA 5I8EA 3V4LA 1AY1H 2QVTA 2AABL 4AG4H 3BPNC 3RFZB 2PYFA 3CFUA 3ARFA 3SDXE 4APQD 4ODWA 2LAGB 3EO0A 4LMQI 1J1PL 2ERJB 3H6JA 4X4YA 2X4NB 5EPMB 3ZKQD 3N91A 4D94A 2Q2EB 3MV8B 1F56A 2GY5A 2V3FA 4TSCL 2EVFA 1FDLL 3RDTB 3ARBB 2I07B 3QIWC 3QEUB 4B9JA 2I5YH 3K5RA 4RSYA 4XVTH 3CMGA 3ZKXB 2K7PA 3CSYA 2CHNA 1P7QB 5HHOA 3RKPA 2HFEA 2UZYA 2YKLL 4JG0L 4CMMB 1QX1A 5E6UB 4C56A 3PQYD 3GS4A 1JTTA 1YYMH 4Q6IB 1RUAL 2DF3A 3GGWB 4HP5A 4P3CL 1PZSA 5CJOH 2M1KA 2DIBA 4BXSV 1E5UI 1Z9SB 4N2DA 4LCCA 1MZZA 4PV9B 2OXHA 5FB8B 1AI1L 2XG5B 1DBMH 4K8RD 4QCIB 2VO5A 4MQXC 4JREC 2QDWA 4PRHB 3QE5A 1MY5A 3ULUE 5CINH 5CLXA 3VSVA 4HV8A 3WHE0 4PJGB 4Z1PA 1C12A 1C8PA 1KV7A 4Y1AA 3WAJA 2NSMA 1Q0XH 1I3RA 3TFBA 1A4KA 1EFXA 2FAUA 4NGHH 4XCEB 2O6PA 1KF9B 5J8OA 2YSSB 1I8MA 3CXHK 3OKOB 4Z7OE 4JQIL 3SB3A 5B1BB 2J6WA 1AR2A 3OKMA 5KSAD 2CGRH 4K9EL 2ROYA 3NEXA 1RZIA 1IC0A 4C58B 4L9DA 2DOCA 3QJHB 5C0AB 2HT3C 4IKLA 3G6DL 4G71B 3IJEB 2F8OA 2L7UA 3L5XH 5EORL 1HQRB 4XXCC 2WYIA 3K4ZA 1U6AL 1DQKA 1VCBC 1DANT 4QO1B 4ODXB 3SBPA 3HC4H 2X3CA 1I8UA 4ZAKD 5DO2D 3T0EA 2X9XA 3RWCA 4PAZA 4OZGA 1FH5L 1U91A 4S10A 3VFOB 1T2QL 1CF1A 1LWRA 3ARBD 3EH3B 4J23A 1QR1B 1AZZC 4PRIB 1ZWIB 4BZ2H 1ZVSB 5I1JH 3VFMB 3ECBA 3K8KA 4LLVB 1NCCL 4N2HA 4I88A 4EI5B 2HVKA 5HGAA 4FXKB 4Q97A 1M2VB 2ZCLH 3HNVH 4M29A 4YDLC 5CZVH 4ZUUB 4HHGA 4ZYKB 4JMNA 2L04A 4X80L 2L3BA 3LEXA 1A14H 3VDBA 5E24E 4AT6A 2JWYA 3QPQC 1KPVB 3M07A 2QQLH 4YSRA 3C60B 5E4AA 3RWEA 3SDAA 3WN5A 1VACA 5KTEH 2CQVA 4PHZA 1BBDL 3WEXA 2DWDA 4JQXA 3GMPB 3N1PC 4RRPM 5ANME 3BP4A 5E08L 1RH8A 3ULVL 4JPWL 4WHYG 4XBGB 4KWUA 2D4FA 3HCVB 5L0QB 3MO1A 4CNIB 5E7BA 3MUJA 1THCA 4MQSB 4HIPA 4XPTL 3WNIA 1P4BL 2NPLX 1T4KA 1BXAA 4J1UA 4OZHE 2UY7A 1WAAF 2HYMA 4KO7A 2OZNA 4NAMA 2C1OA 4A6YH 3CE1A 3A5VA 4WSJA 5T3XH 4ODHL 4S2SB 4XPAH 5FYLH 2CIIB 1KWGA 4O2CA 4LSSH 4XPGH 4EIUA 1YN7B 1EJOL 3STZA 2R69L 3NCXA 4FFYL 4Z7OB 4DP8X 2YUWA 2F58H 3LIZA 1PS3A 3S8GB 4LRNL 3FN9A 1WEJL 1EVTC 2Q2LA 3UYPB 1KB5B 3B1UA 1R17A 4KKAD 2QSCH 3QXAB 5FO9B 1FNEB 1I9RH 2OV0A 3MRCA 4J3OC 4JHWH 1BJ1J 1QUNB 5DMKB 5C0DA 3N44F 4JFQA 3SE3C 4AMXA 1TLKA 5D4QA 4DZBA 4GKSA 3SY0B 3FULA 4X9GA 1G7HA 4GW5A 2XXCB 3ZE1E 1DCLA 4IJTA 2EYTB 3QQNA 1ZXKA 1FORL 4F2FA 3VW3L 5CEZD 1RKRA 3PY9A 4NPJA 1GSKA 3KPMA 4WK0B 3FQRA 3MA7B 1BAFH 2O26U 4GRWF 4B96A 1DJZA 1CTNA 4G42A 4F7EB 1GSMA 1QSFE 1GXEA 5DK3A 3PHOA 4PVNA 1BLNA 2WLLB 5EZOL 1XHHA 2QKSA 2X4QB 3L2LA 3O45A 4NKMB 1S7UB 1UD3A 2MPAH 4P9MH 1T66C 2H8PB 2CLRA 5D1ZC 4N1HB 2FYYA 4TTDC 1LNUB 2HLFC 2Z6FA 3BD5A 3KJ6H 5E8PB 1MHCA 1N6VA 3PWLB 2VABB 3KMDA 3SDCD 3ULUL 1OGAA 1W8NA 1IVLA 5ESAB 1PAMA 1W80A 2Z31A 3QIWA 3WO4C 4NZ8A 3WGUB 1DCEA 1S9YA 4RGNE 3IEAA 4WAFA 5D2NA 1YEIH 3L3HA 3KS0H 5I19H 2LLNA 4X7DC 1OW0C 1ZEAL 2CHZA 5EC1B 4AWJC 3OKEA 3ZXAC 2EACA 3UC2A 5HVGB 3LKQB 3SN6N 5KBPA 3UFIA 1QSEA 2AV1A 2W07A 3RWDA 3PUCA 3SPGA 3GSXB 3ZE2F 2QEJA 3RVXD 4OZHB 3IJ7A 3Q06A 3O3DA 1X5XA 1E27A 3DXAA 3ETTA 4XCCH 2VM9A 4RFEA 4D7BA 1JG9A 4J27A 1OB1A 3FO0L 5AVUB 5GRJH 4HKBB 1AZVA 1BQKA 3CFNA 1WA2X 1BBJA 4JG9A 2XPYA 3GTTA 4MVBC 3W9DB 5D7KD 2VKWA 2IOIA 1OCOB 3DSNA 3GMNA 1R24B 3MLWH 5LBVA 4B9KC 3NACL 1FO0A 2B16A 1C5DB 3U83A 3TEZA 3M1BB 2IAMA 4PJAE 2NCEA 5DQ9B 4XXCA 1WGOA 1HHHB 2Y22A 3CQQA 3OKYA 4M61B 1FL6A 3NCBB 4LSTH 5EU7E 5MHSD 1E9PB 3J7HA 5JZ7D 4NC0B 4PP2A 2VDNB 3WD5H 4U1LA 5HHOE 2VZVA 2N0MA 1D6EB 4NIKB 3W9EA 2VN6A 3ZE1B 4NQDE 5TFSH 4JFOB 4PJ5A 2R2HB 3HB3C 4HEMA 4JMXA 5D9SA 1MSPA 1ZOXA 4TXVB 1NAMH 5T1LA 2CO2A 3IK2A 1XD1A 3H54A 4XNQB 5E1AA 2Q6WA 3RBGA 1QSFB 1HN1A 2E6PA 1DBBH 4G72B 3EDJA 4WI5A 4X6FA 4DEWA 2E0PA 2G5UA 2NSQA 3F05A 4GMTH 5GRVL 4CU6A 5HY9B 3WO3B 2Z1PA 5LCVH 3MBWA 4NO2A 5C6TH 1L5GA 3BO8B 5HGBA 2Y7QB 4WI3A 3PDDA 2IADB 1U8OA 1RU9H 3RGVC 4GAJL 4ETQB 4XTRD 1QFPA 3NJKA 5AYUL 1CLYH 5HVHC 1KELH 3EYUL 4W6YB 5K1VA 4M1GH 4RGNB 2VL5B 3GWJA 1G9HA 4QYAA 4A7UA 1FNAA 2PCXA 4OLXH 1LP9A 1UQSA 3RGHA 4X7SL 5J11C 2ZOKA 3LTVA 1PZCA 1RK7A 1B4LA 3HNSH 3LEYL 5T1DL 1OPOA 2XWRA 4YZFF 1TZIB 1FAIH 3WE1A 1ADQL 4M00A 1YNLH 1IAII 4EKJA 3HC3L 4OZGE 4HSAC 3BWUF 4JQVC 5C0IB 1E5CA 5IEKB 1N10A 3G08A 4XVUC 3ZYOA 5AL8A 1YNKL 2X4PB 5F7LB 1PGRB 5EBMA 3GI8H 5LG6A 4HS6A 4OV5B 3FQ2A 3VRLF 2XV3A 5I8EB 2ZP0T 2C5DC 3L1EA 3WS3A 2QSTA 2DWSA 5CJBA 1MN4A 3ARFB 1JGEB 4Z6AT 4N9OB 4ODWB 1AHWB 5A2CA 5I1KL 4PEEA 1A21A 3RY4A 4JO2H 5T3ZD 4EI0A 2E76C 3L6FA 4QI3A 5I1IH 4PJAB 3REVA 1SY6A 4N87A 3UGEA 2FJGB 1OD7A 1JV5B 1RUQL 3P30H 1TVDA 4ZW7A 5DMGC 3CSYB 2BSEA 3HR5A 4FL4C 5HHOB 1O9ZA 4FQJL 3GT6A 3IPEA 4NQDB 2OBGA 1FYTB 4G7YH 1AGDA 3Q5OA 3ZQWA 2X87A 4Z7VF 5I1GL 1SVZA 4EN3A 2YMXL 5AENA 1P84K 1S78C 3QJTB 1XL6A 4N0UE 2OXHB 4WWNA 2D0HA 2VT0A 4EAEA 1CLZL 4HJ0D 1N7ML 2XY2A 4IU3B 3QDHA 5DUML 2PP8A 5CN2A 2V4LA 4HWEH 2H1LM 1M7DA 2ZICA 3WE6B 1C12B 3C5ZB 3X14A 2BHZA 1N8ZA 3C5JA 4RA3A 5I5JA 1VFUA 3BLKA 3Q0HA 3CZSA 3P40A 3OVUB 3C8HA 5DJAB 5D7EA 3LB6D 3RWJB 3EAKA 1NEZG 1RZIB 5C0JB 1DBJL 1U2YA 5DJYA 1PZBA 5FKAA 1G4RA 2NTSP 1X5JA 4NKIL 3V52L 1GAFH 3AT9A 5I1AA 3IRPX 5IHUH 1OQOA 4JM2F 3F12B 2NXYB 3Q8CA 4MAYC 1ZTXE 3VH8G 4OZGB 4AJ0A 2WXHA 1DQQA 3SEPA 2ZOLB 3WTWA 4ABQA 4EN2A 4EZMA 3H55A 4GFXA 4NJAH 3PWPB 4JFXB 5H8DA 3W81A 4XB8A 2XIDA 5E0QA 4AI7A 4HJSA 2ADIA 2HVKB 3O11A 1G0XA 5HGAB 3BYYA 4JKMA 3FTSA 4AC2A 4DQOH 3O3BB 4KC3B 3OLIA 4DGWC 3E2HB 5F44A 4NQDD 1FYTD 4FCAA 1T1XA 4GYBA 2B2XL 2OYLA 4DETA 3ARDC 1G9NC 3NH7H 3CXHJ 35C8L 4BCZA 2XJLA 3RL2B 3S7GA 3QJSB 2B3IA 5I1LB 4BD4A 3RWEB 1SF5A 3EXJA 1JWMB 3WN5B 4K9JA 2HUHA 2C4FT 5D72L 2BVQB 3TT1L 5L2KE 1P7KB 5D2NE 1K3IA 4URTB 1VCAA 3WEXB 2DWDB 4YDNA 3BP4B 3BIAX 4LO9A 1E67A 4OGZA 3VX0A 3F85A 2MPVA 1JD9A 1OAUL 3FQ1A 3DMMB 3U46B 3MO1B 1KCLA 2ZF8A 4GXUM 4N0UB 4YWGH 3FSZA 1KB9K 3BAWA 4QXTA 4HT1H 1NGYB 3VWJA 2TAAA 4BUGA 2C1OB 2KLRA 2HRLA 3EZJB 3RILA 5KYWA 4G6MH 3BZFA 5FGRA 3CFBA 1DQDL 4BXVA 3TTYA 2HP4A 5IMMB 4XBEL 3FCTB 4IK6A 4N28A 1JHTA 3F6IA 3TYGL 1UXLA 3RGVA 3DPBA 1N9PA 2W5PA 5E2VH 4WEUD 3PWPD 2YN5A 3TASA 1HWHB 3TNNA 3IE4A 2HTKD 3MUGA 1KYOJ 3BUYA 4FTDA 4HBCL 4TQ8A 1TQBC 3B37A 4LSVH 3PAUA 4WKXA 5JPMA 4NFDA 4GKSB 1JVOA 4KGLA 4JQVA 4NPYB 4PGCA 4GW5B 1D6VL 3MZGB 3QXDB 3IBEA 5FA4B 4AENA 2A9CA 5FOBB 1JJUA 3MN8A 4HEME 4OTXL 1WIOA 3KPMB 3FQRB 2CGYA 3ABZA 4WO4D 1N59B 4G42B 5CGBA 4LNVA 5EZIH 1T1YA 9PCYA 3DX8B 3FL7A 3P2BA 2R0WH 3TPKA 1XB6A 1T7WA 2Y2TA 3FQ4A 5IF0B 2RCSL 2WVUA 5F7MC 4JGUA 4BHUI 5M7QA 1B90A 4YFLF 4IYKA 1TLMA 4UQDA 4DQAA 4KKRA 5CILH 2FYYB 1E4JA 5SX5H 1J88A 1EXHA 1ET5A 1IEBB 4XT1C 3SDDD 1MHCB 5HGDB 1LEKA 1NM9A 3X3FH 1OSEA 25C8L 3VRJB 4C4BA 4XP6H 2Z31B 2OR9L 2VWEE 3CAFA 3GFUA 5L2KB 4HIJA 1S9YB 2Y7MA 3D12B 3M45A 3F8UB 5D2NB 1RUKH 4DT2A 1LP9E 4GJTB 4CDGC 1GGCH 1VZGA 3LIZL 3FT4B 4A66A 2YWYA 3R0NA 1G7LB 2A5UA 4M7LH 3GSVB 4KKLD 4TOYL 1JNNL 1ZV5A 2AJUH 2AV1B 2HZHA 2P24A 4L8SB 5D8JL 2WKGA 2PNDA 4MX7A 3HKZA 2PN5A 2G5RA 3AVEA 4Q9RH 1YEEH 2R7EB 3O3DB 5L8LB 1Q90A 3HLAA 2PR4L 4P2YA 4AVIA 5FCUH 2WXLA 1WFMA 1PD1A 2EDOA 4L1SA 1OB1B 5IQNA 3MJ6A 2QV2A 3WXWH 5C08A 2HVJB 5FFGA 2AQPA 5BCAA 1Q0YH 1BBJB 3NIFE 1LDSA 4AM0B 4JO5A 1ZJBA 2EE3A 3KXFA 1NMAH 2KI6A 5I6LA 5DTFA 2IAMB 5ID1B 3HNTH 5DRWB 4XAKE 5IHWA 1GGBL 5E70A 2J56A 5E5RB 1U4EA 4WRLA 2RFXA 4WTXA 4D9QD 5JR1H 3QULA 3CUPB 1ROCA 4NCDA 3VFRA 3L54A 2WNKA 4MAYA 3V6OC 2R83A 5E99H 4PP2B 4APQC 2DLTA 2Q87A 4Z7UF 3TWCL 4EIBA 3OGCB 1CGSH 4DK6A 2V7HA 1YEGH 2B14A 2ZCKL 5HJ3A 3ZGIA 1IFHH 1H3TA 5D9SB 2A74A 4YN3A 5T1LB 4PV8B 5ITBH 2YPVA 4KDTC 1N8OE 5E1AB 4H8VA 5F3HA 2CLVA 1U3YA 1EDQA 3LQZA 4LSRH 2X05A 3HUJF 2A9NH 1NLBL 3LPGA 3IGUA 4J3WA 2NCMA 3B2DC 1CUOA 1M1XA 3MBWB 4BV1A 4GSDL 3QIBC 5SX5K 2X6VA 1J9QA 5ILTL 2EXTA 4BYHA 2F19L 2Y3NA 5A16A 1XVSA 5I17A 4NP4L 1WTGT 2W88A 3EZ8A 3FUDA 4K8RC 2VLJA 2VNCA 3R7RA 1TYJA 4LCIL 2Z0UA 4NQUA 3Q2CA 1LP9B 4J3OG 2Z4TA 2ZOKB 2OCCB 2HMID 4AVKA 2WZ0A 5GGQL 1A7NH 3CZJA 3V9EA 2MTAA 1ZSDA 1JMZA 3WFCH 3BUPA 3Q8BA 2NY1C 4N2MA 5KSAC 1HQ4A 2I5YL 3ZU8A 5A2KH 4KH2A 1CLOL 2AXHA 1NCAH 4NO3B 2XN9D 5EBMB 3V4UH 4XP4L 3RGBA 5F0MB 1IQWH 1HT6A 2WLIB 5F21B 3B43A 1CK0L 3HZKA 4ALAH 3VNYA 4NWUH 3QQ9D 3WS3B 2B08A 2J4WL 1PU0A 4S1RL 4ZAKC 4FD0A 4QRQB 2XYBA 2WIIB 3IRZA 4PCTA 5JHDA 4HOZA 1E4HA 2OSXA 5DMIH 1TTRA 3NIFB 4XC1L 5I30H 1HAWA 5IHBA 3WMPA 3Q5YA 1TJHL 3UYOD 3F2LA 3NTCL 3REVB 3DUSA 4V1DD 4NGHL 3PU7A 4K3JL 3IAPA 1IGIH 3IJ8A 1F6AA 1M2OA 2AHIA 1SJEB 1D5MB 1C5CL 4WTZA 3KS0J 2W0KA 5IQMA 4FFVD 1MG3C 1PZ5A 4NZRH 1XGUB 3KJ4C 5JDSA 5L4JA 1NDTA 1OAZL 4KKBD 1UXWB 2GFBA 1NA8A 3Q9PA 3QXTA 1CBVL 4PJ9D 5DS2A 5KEZA 3ARTA 1VKXB 5IJCC 2WN3A 1AR1D 1NGQL 4EN3B 2CCWA 3ARYA 2JJSA 3MV9D 3U1SL 3VFNB 3WKNA 4A6YB 4R5TA 3BVTA 4PLJC 5EEYA 4RIRA 5KSUB 5IESL 4BWWA 2XQYK 4UT7H 1X9QA 1L7IH 2CIKB 2EKSA 4XH2A 3VMPA 1RAMA 4LSQL 1M7DB 1P69B 5HDQH 5HYSA 3X14B 4RWHA