2J1XA

Human p53 core domain mutant m133l-v203a-y220c-n239y-n268d
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
molecule tags Nuclear protein
source organism Homo sapiens
publication title Structural Basis for Understanding Oncogenic P53 Mutations and Designing Rescue Drugs.
pubmed doi rcsb
total genus 49
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2j1xA00
4HJEA 2X0UA 4XR8C 4LOEA 3Q05A 3EXLA 3VD2A 2BINA 3TS8A 3WTYA 2IOMA 2P52A 4KVPA 1HJBC 1CO1A 1TSRA 2BIPA 4L18A 5BUAA 3US0A 3QYNA 2J21A 3VD1A 3WTXA 4MZRA 5G4NA 1HJCA 4IBWA 2BIOA 1E50A 1YCSA 5A7BA 5KBDA 4L0YA 3D06A 3KMDA 2J20A 2GEQA 2AHIA 1EAQA 5ECGA 2J1XA 4IBYA 2OCJA 5AOIA 2FEJA 4AGOA 1HU8A 4QO1B 2J1YA 1EAOA 3D09A 2AC0A 5AOKA 3D05A 4GUOA 4AGMA 3IGKA 2J1ZA 2J1WA 3US1A 5AOJA 3ZMEA 3D07A 5AOMA 3WTUA 5LAPA 3QYMA 2VUKA 4AGQA 4IBSA 4AGPA 4A63A 3WTVA 2IOIA 1GZHC 5ABAA 3KZ8A 3Q06A 1UOLA 5G4MA 5G4OA 5AB9A 2H1LM 1GZHA 3WU1A 4G83A 2BIQA 3EXJA 4IBZA 4G82A 4AGNA 3IGLA 5LGYA 3WTTA 4AGLA 1TUPA 1LJMA 3WTSA 4IBUA 2MEJB 4MZIA 4IBQA 4L0ZA 1CMOA 5AOLA 2YBGA 4GUQA 2PCXA 1EANA 1T4WA 2ATAA 3WTWA 4IBVA 2ADYA 3Q01A 1H9DA 3VD0A 4LOFA 3D0AA 2IOOA 4LO9A 2WGXA 2RMNA 1KZYA 2XWRA 4IBTA 3D08A 4IJTA 2X0VA 1IO4C 2X0WA 2XWCA 2BIMA 2J6WA
chains in the Genus database with same CATH superfamily
4TVPH 1UZ8A 3KLAA 4PP1C 3A0OA 1TVHB 1Q4NX 1QI4A 1NGQL 4NNXA 3VD4A 1ZEAL 5D7IB 1MCOL 1R3LB 3WLWD 4CVWA 4X6BB 3CX2A 3TJPA 1RK0B 1JK8A 2X6MA 3PPEA 4HHWA 2E7DA 3RWEA 2UUDK 2PWFA 3BP4A 1KULA 4QD2E 1OK8A 4NUPA 1UM6L 1IEAB 3E9TA 1SYSA 4P5TD 1ZHBA 4JY6B 3T4YA 2EVFA 1ZANL 2GSIB 3VG9C 2MQ3A 3P9MB 1GTFA 4KRMB 1JRHI 2FX7L 5TDOB 1RXLA 1EXGA 2X88A 3BP4B 3AM8A 2O72A 1OO2A 1P4LB 2RIKA 5JHMA 4P5MB 1SN2A 3IMVA 1D9KD 3OB0K 3SCMA 3TZVC 5T1DH 1AYOA 3T0EC 3NSDA 2VDQB 1B2YA 1NCCH 4LBEA 5B4MD 2R69L 6FABH 1E4JA 1MI5D 3UO8B 1PX4A 1CDBA 4I48A 3WS3A 3TCXA 1R24A 1U3HA 1PD1A 1U8IB 3HE7A 4PJ5E 1E0OB 3IDIB 5G5DB 1SN5A 5FYKD 4N8PA 2JI1A 3CQFA 4URTB 3VCLB 2HLFD 2HT4D 3AGWA 4JPKH 3I9AA 1IAOB 3SE6A 1RZKC 4H20L 1A47A 1EDYA 4YE4L 1N68A 2WV3A 5DJXB 1FIGL 5IFAH 2VDML 4M7JH 1GOFA 3BGFC 4Y88A 2F54E 3B5HA 4JPVL 2DDQL 2G3XA 2BSRB 5EO9A 3BH9A 3BD5A 5JW5A 4X80L 3M8OL 3CFJB 1O7VA 3MRRA 4XCFL 1NJ9A 1MJ8L 4RGMB 3RB7A 1X5ZA 4TYUA 3GXTA 5EIIA 5AYUL 4FLHA 2Q86A 3GI8H 1QI3A 2Q8BL 3KYAA 4KI5D 2B1HL 4F1SA 1C5DB 2BNRE 3GLZA 1JI1A 2ZUYA 1QP1A 3KLKA 4NYLA 4NZFA 1FVCB 1W0WB 3O4LE 4JHZA 4KJPD 4RZCA 5E8NA 3CSPA 4ONHA 3T0ED 5IFAL 5DEJA 3GMPB 4Z77B 2MEJB 4A7GA 4FQHB 4NFBA 4Q8BA 3REVB 2WQVA 1ZA6B 1BYNA 1MFCH 1ZY9A 5HI5C 4XCCH 3ARBA 3BAXA 1RZ7L 4HLEA 2Y5TB 4KO9A 5AL8A 3ZUCA 5ALCL 1AXTH 2OZ4A 2IWEA 3WTWA 2V9RA 3LKRB 5B3NA 1KTCA 2CNYA 1AOZA 1A25A 4L1BA 4X9BA 4ZNCD 3KVQA 1ZRUA 3BX7C 1I1AD 3TVMB 2EIBA 5IMOB 4NC0B 4BUGA 1NWPA 1RSFA 1DUYA 1WISA 1TETH 1RU9H 1WZ1H 3ZL4H 1H3TA 5HVFB 3BKML 4UI2A 3HPLA 5DUMH 1A22B 3JWOL 4JFWA 3PWJA 4XX1E 3ULVC 4YNYB 3MRKA 3VD5A 3LKNA 4OI8A 5JZ7C 2LLLA 1B0RB 2JI2A 5EUOE 2JJVA 4I3SH 5HHOD 4GI6A 2VJXA 2R2BA 3QDJA 4BRJA 1QA9B 1IGYA 4U6YA 4QHLB 3QDME 2ADIB 2NLJA 2AQ2A 3FPXA 1TJXA 4H0HB 1CLZH 3CFBB 1B4JH 2XTJD 3I9GL 4HVBA 2F8IA 5I1IH 4UV7H 5KBDA 3T8XA 3IKCA 3QRLA 2OKMA 4W9DC 1G9NH 5DVLA 3TN0A 1HHKA 5K69A 4XMLL 4HZAA 3VFWB 1COBA 5EBWA 1RVFH 1XH3A 5K5YA 1NDGA 1XF4B 2XZQH 3WJLA 5I1LB 3DMMC 1E9OA 1OSZB 1NM9A 1TOXA 2CIIA 4QF1A 1UEMA 1EHLL 3H9SE 2R7EA 1NFDF 2P42B 3QDHA 4D9RD 4AL8C 4G6KH 4RETB 4XH2A 1N6QL 4ELME 1Z3GL 2UZPA 2HFGH 3MRNA 3D0VB 3QIBA 1XH1A 2R1XA 4PP2A 1F6LL 2ZP0T 2PR9A 4HBCH 2OV0A 5BQ7A 1Z32X 1QKZL 5DD3L 5DURB 1SQMA 3LS4H 2VDRL 3DIFB 2DPKA 2FSEA 2ICES 2ZKMX 1J11A 3HMWH 4X6FA 1FPTL 2R4RL 3HAEA 3N1QC 4UINH 3GZOA 5INDA 4DP0X 4URKA 4U3SA 5C0AD 2G5BB 3FO1A 4PJCB 5KN5B 4QTFA 2DWSA 4CKVX 5HYSG 2J2ZB 2QGBA 2R69A 4DP1X 4IKJA 3AREA 5EWIL 1P69B 3Q0HA 3OV6A 4FQIL 5HYFA 5IBUG 4HCRA 4Y5VB 5B8CB 1XO8A 2BDNL 4PJDE 4NHUB 4XPFH 4EVNA 1RHFA 4XCYB 4F7PA 3P69A 4D0CB 1ZGLP 5KVEE 4F92B 2W0PA 1NCNA 5FS5A 4WTXA 3VFOB 4XN8A 2CRYA 1U4FA 4I2XE 2Z35A 1IB5A 2EC9U 4WWNA 2MWCA 2J1KA 1AXSB 3EO9H 2D3NA 4JPWL 3TPKA 2OMNA 3O6MH 3QUYC 1K2DA 3ZTJH 2OMUB 3IJYA 1O6VA 4KVCH 3DDFA 1IAOA 1VF5C 4FFZL 5IUSA 3GS7A 4HEPG 4CVXA 1A4BA 3ME0A 4A7TA 4NEHB 3AXLB 4XR8C 3LSOB 4NZRL 1X5HA 5KVEH 1VCBC 3HS0A 5HYEA 1MEXL 4XMZA 3II1A 2EH8H 3C75A 5BNXD 5FLVA 3K71A 1AR1D 1OOWA 4XNDA 3KGUA 2DRUA 5DZOA 3RNQB 4WI5A 3ZHKA 3BW9B 3WFZA 1XGPA 3F64A 4DGIL 1AOHA 3HE6D 5C0AB 1R0AH 2RFXA 3ETBF 3UAJA 4X8CA 2YMOA 2D4DA 4LSQL 4HOWA 4H8WL 3B7RL 1TZGL 4M5ZH 4PJ8B 4FKEA 4QXTB 3M1OA 2AMUA 2R0KH 5KSAA 5FUOL 1R5VB 4OCXL 1SJHB 2IH9A 4PI0A 15C8H 4B9GA 3BQUD 4QRFA 3GZKA 4OQTL 1TTBA 1CFTB 3MRGA 3QUMA 2EKSA 5EU5A 2WCPA 5DK3A 3EGSB 1WO2A 4K3EL 1KEGL 4WHYH 1V10A 4L1SA 3EGXB 1BZ9B 4HJTA 2C4FU 1S7RB 4B9KC 1I75A 5JW4Q 5GIRA 2V17L 3ARGC 5K39A 4PLKD 1BF5A 2FBJL 4FS0A 2MTAA 2PCPB 3NK3A 3B9VA 4Y5VC 5B8CC 1CI5A 3U36B 8FABA 2J8UE 1PAMA 1FZJA 4PTUA 4Q58C 4MZ3A 4PB9L 1NMBL 4L9LA 3G5VA 4N0RA 3UTTA 3A4EA 3WI9A 1J8HD 3D07A 5E2VH 5JR1L 4JEGB 1CGSH 1G5GA 1XCTA 3ZOAA 3ARED 4PJEA 3NIFF 3PJNA 3W38A 3FZUD 4OLVL 4RCAA 3FB7B 3X1FA 4XMVA 3OXSA 2XSKA 4BH7B 3DETC 5SX5H 1U8CA 5CEXB 1FG2B 4OZHB 3FHAA 2BCMA 3L5WA 1DUZB 1KCVL 5I1KH 1OTUD 4L1DA 1DSYA 3SHSA 5J89A 5DF0A 2ILLA 4AM0B 2EDEA 2OK0L 1F2QA 3JTTB 2WAQA 5CSZB 1IZKA 1KIPA 1JHLH 1BF2A 1IAIL 4DQOL 1HKFA 3VXUB 2EE9A 4WW2A 4KMLB 1OW0A 3ERXA 3BH8A 3L1GA 4JDTH 3WEMA 2ZYHA 3U2IA 4P2YA 1MVUA 1SDDA 1UYWL 2R39A 4PR5A 1FVDB 3DMMB 5IB1A 4J2XA 1P5VA 1UXSB 3BAIA 3N9GH 4NNXB 4PJIB 1KIPB 4Y16B 3BZ4B 1PQZA 2ICWJ 3DTXA 3MGTB 4N2BA 3CFCL 4Z7OF 1F1DA 3TZVA 1JN6B 2XQYA 2EE6A 5H37G 4C4KO 1QQDB 3ZE2E 3AITA 3MOBH 3VXRD 2GI0A 2X3CA 4BV1A 3ULVD 3B2PA 5EB9A 1MJ7L 5CBEA 4MXQD 4F37K 1NFDE 1QSFB 3PGFH 3DNKA 3WJMA 4JGNA 2NYYD 5IY5B 4JPSA 4P2RB 2ZSVB 5HI3D 3I6GB 5IHBA 1D6EA 2DQIL 2HCZX 5EG6C 3RWIA 4PJGF 1GGTA 3COOA 1VENA 5D2LB 3O0RH 5E9NA 3ZT5A 1NCWL 1T2QL 5FUZL 1UXWB 3ATBA 4OZGE 4GO6B 2APVA 1E6JH 1XMEB 3FQTB 3IEAA 3MUUA 3FFCD 4AG4L 4DSYA 2AEIT 1WBZA 3V0WL 4ODVH 2AJYL 2WWMD 2DWDB 3ZZ1A 4Q9RL 3I6KB 2F74A 1UOVA 5C0BB 4GQRA 3GSRB 2APSA 3H7BA 1DBKL 2XHNA 1ACYH 1WFOA 3I9PA 5CKGA 5DMGC 4E42A 5D7SH 4N90D 1FLTX 4Z7UE 3UTPE 2H5UA 2AAAA 3QDGB 4YQXH 1QFWI 3CV5A 5IB5B 1SEQH 1WD8A 3N44B 3RNKA 4JO1L 2P5WE 2QQLL 3F6LA 3H7BB 1BFVH 4QTHA 2HMIC 1MUJB 2EDNA 3LEVL 3CMOL 1J0IA 5C6WH 3VWKC 4KK8C 1LDPH 1NDMB 3B6SA 4YAQA 2DQUH 4NZJA 2B39A 2OQJB 4R7NB 3ZRSA 4XBPB 4AENB 2B9AA 2H3NA 3RL1B 1MCQA 2NRDA 4HKBA 4YHIA 1MHEA 2FEDC 4RGMC 5MHSD 3GEWB 1IGTB 4QGYA 2NY3C 4OIIL 1FC2D 1KYDA 5AWNH 2ZCLH 4FYRA 5F89B 2PP8A 1UGNA 4GAGH 3UADA 3O3DA 2NW2A 4JFEB 3PHSA 5F7EL 5G4MA 2LVEA 3WU1A 3PDDA 3BGFB 3A21A 1E5CA 3HI5H 1U8MB 4TTDD 4PWKA 4UT7L 3POCA 1MXGA 3ROLA 3TBSB 4MCZA 2ZXBA 3W5MA 1MFUA 3MXVL 4EDWL 2I69A 1SHMA 5HYQB 3KPLB 1QSFD 1UD2A 3J7HA 1U91A 4U1MA 1OSPL 5FW8A 3G6JF 4LKXB 3RX9A 2FDBP 4RRPA 3UBHA 5KBMA 2BNRD 3QH3A 3TBTA 1NGYB 5E0QA 4F7MA 3WYRA 3JWNC 1A0QH 3X3GL 3ALXA 3TJEL 2IH8A 1PD6A 4XOCA 3MRCB 4AUUA 3KVPA 3I3BA 3OZLA 4NNPL 5IB4B 2NR6C 1B0IA 5EMYA 4F91B 4G80B 4WEBL 1TKWB 1O7DC 1I7TA 2ITCB 2J57A 1LHZA 3R4RA 1G9ML 5F9WC 3ZDXE 1EAPA 3VG9B 2IBZY 4P5SA 3ZGIA 4GO9A 5DYOB 3Q3GA 4WWOA 2B59B 2G30A 2VDNL 2ZP8A 2BFVL 1OQOA 3QG7L 4HQQL 4W9CC 2WTRA 5CZVH 5E9AA 3VRLF 4NQED 5I1GL 1E5BA 2DLIA 1ILUA 4TTDC 4GEIA 3UZQA 1WHOA 2LTQC 3NRPA 4JO5A 2H2SC 4BGDA 1HKLH 3SE9L 5AEAA 1Q9OA 4E0RA 3V7AG 3ZKND 1F90H 4E68A 3N55A 2OMTB 2QADC 4LEOA 4ZW8A 2NZ9D 5FEBA 3WSQL 3B2DC 2XWTA 2RA1A 4QRPD 4ZMPA 4B53A 1F4XH 2HKFL 4I2XB 2F61A 1BD2D 1J8HB 4F7CA 3NIGE 4X6BA 3X3FH 2NY2B 2X3BA 4XO4A 1YLBB 3OKNA 1JYVA 3AQDA 4X6EB 3X2QB 5IG7A 4PLKC 1ESOA 3GRWH 4GUOA 3HLAB 1IKFH 2FSEB 2VDNB 2E0PA 1OAUL 1QI5A 1JNLL 2VSKB 3EH4B 4M1CC 1B3IA 4UBDD 5IMLB 2X53A 1HEJC 2NZIA 3QCUH 3BEVB 5ISZA 2F19L 5MP6L 2MJWA 1XGTA 2PWEA 2V2XA 3FYEB 3FUHA 5KYXB 2BZCA 2VR8A 4C55A 5HHQA 2BCKA 3VMPA 1PIGA 3BPCA 3J2PA 4V1DB 1ZGLM 3WJMB 5ISZB 3RQ3A 5L4FA 1X7TA 5MEPA 4KTDL 2CRZA 4RMUA 5D1QA 2BRRL 4OT1H 1TCRB 4GT7A 5DJZB 2QGEA 3UBXI 3BMVA 4PCTA 1ND0A 2VXTH 2IWFA 2X6CA 2B3IA 4K07A 4L8CB 3E0GA 1KG0A 3V4UL 3SPGA 3OLGA 1MDAA 4RDQF 1QQDA 2CO6A 3L9RA 2DTML 4OV6F 3S36H 1JXJA 2IAND 4ZUVB 3SKJH 2IPUK 3FFCE 3TFKD 4CJ1A 5JNYA 2YK1L 5JPMB 3NFNB 1RP9A 2X40A 3MCLH 4WCYL 3IM1A 1D5MB 4AH2A 1PG7L 1J5IA 3PGCA 1GPOL 4QRPA 3RWHA 4OH2A 3MKGA 4IBVA 3O6FD 4XN5A 3KBHE 3NBNA 5JNYB 2ZJSL 4RQQB 2AQ1A 4UTAH 4FJ6A 2FE0A 2BVYA 5IT2H 3MSPA 5D2LA 2XWBB 4XOAA 4C4BA 3RA7H 4UDTA 4B27A 2DTMH 1F3DJ 3K0YA 3FQTA 2ATPA 3Q13A 5DWPA 4JG5A 2YUZA 3GMPA 3IU4H 2Q8BH 4Z77A 5C08A 1KXVC 5E2WH 3OZ9L 3VU1A 5SWSB 3TESA 2Y5TA 3MMEB 3SDDB 2G3NA 5F88A 5MERB 2CXGA 1YEJH 2ZX5A 2ZCKH 4E9VA 3B4NA 4TQ8A 1KIRA 3M86A 4FA7B 4HUNB 2SEBB 6TAAA 2EYTA 5HYSA 4QRRE 5BW7A 1MFDL 4YHYC 1QBAA 1NDMA 3OR6A 1F3DH 1BD2E 3K6SA 1GJIA 1L9PA 25C8H 5BOPA 3F7YA 1XD1A 1BAGA 1MCKA 3BI9X 2RFXB 3QXVA 4WFHD 4H5SB 2ICWA 4Y9CA 3ULVL 1IC7H 3JWOC 4JFED 2OCFD 4NDMA 1FIGH 4RNRB 1UM4H 2GHZA 5CS7A 5AOKA 3RWCB 3D6GA 5FECA 4X7FC 2BIIA 5I75C 4UV4H 3LZPA 3K6NA 4JPIB 1P7QA 3BIAX 4Y16D 4YK4C 4L8BB 2G5UA 4LSUH 4NCDA 5JUEL 3V0JA 2IJ0C 4ENED 3KLHD 3BC9A 4Q7DA 3LD8C 4KK8D 1HHKB 1RSYA 1NBQA 2ARJQ 3R7QA 2VRAA 4QIRA 1WGOA 3UAEA 1U41A 4F8QA 2QKIA 4HIJA 4LKCA 4ZMOA 4GSDL 2DEYX 3KPPA 3M8OH 2XWEA 5BPPA 3LZLA 1JFQH 1WJ3A 1FGVH 4FLQA 5BMFL 4HC1A 2DY2A 3BIBX 3B34A 5AB9A 4HCRH 5I9QB 2HKHH 4PJCF 1Q0YL 4CSPA 1E3XA 2HH0L 3WHE1 2WBKA 1ERNA 2JK5B 4P2RE 1FBIL 4OFQA 3M17A 1IL1B 3PL6A 1A3ZA 12E8L 1TJHL 3ZE1F 4WIQA 1KTDB 1AYRA 3PABB 4JQIH 2OW7A 5KOMC 1MRDL 4IKNA 4F20A 5FHBL 3E6HB 3ULUE 3L1FA 1K5NA 4NP4L 1KELH 3ZHLA 5T8IA 3LN9A 4DZ8A 3N41F 3WEXB 5I1AB 1MFCL 2VO5A 1JNNH 4Y5XA 1R3KB 4GKNA 4WI4A 4XZUB 2WZ6A 1QLFA 3BVNA 5AZUA 1BQ5A 4ABWA 3MRNB 3MBWA 2W07B 1JGDB 1ZTXH 4NQDD 3A24A 3P54A 5TPWL 3VWJC 1SEBB 4YHMH 3CUPA 5DT1L 4GAYB 1KJMA 3V4VL 3QK0A 1QRNA 2YPLE 1TCMA 5D70L 2HX8A 5GGVH 5I1HH 4QRQA 2AGJL 2WKOA 5C0EA 4HWNA 3TH2T 3V6OA 2P8LB 1I8IB 4E5XG 3X13A 1YEHL 3KLDA 3O4LA 4EI5B 3FU5A 4OLWL 4TTGA 1P4IL 4KKAC 1NPJA 4P46D 1AGDA 3KPNB 1MHPH 4L48A 3TEUA 1YYMH 3IMUA 1F86A 3JTSA 4MHHI 2BNQA 1L9TA 4YHOL 1HT6A 4E36A 2QDWA 5A16B 3H9SB 3IDMB 2W94A 2V9UA 5EIIG 5K9KA 3IFNL 1TTAA 5GGVY 4FFZA 1XTLA 1Y0LB 1TMQA 2Y07L 1JZ8A 3R4DA 2LLNA 3BEVA 4HK0B 3U1PA 3ZKNC 1JHKH 1WCBA 2E3VA 4FZEH 3SOBH 3VSTA 2IAAC 5L2JB 2W8CA 4JY4B 4X6DE 4KQ0A 4GS7C 2DJSA 1R75A 1ET5A 2M8XA 5IJBC 1H9VA 4DKAA 4LARH 2VWEC 5E2JA 4APQC 3HCVB 1KB5L 1RJCA 4FQCH 4K8RL 4EEEA 2NNXA 2I07B 3B3IB 3IJEA 4M1CD 4E9TA 3HBPA 5C1MB 5F3HA 5AFAA 2VH5L 3GJEA 2OMYB 1B0GA 4RWHA 1UXMA 1JPGB 4K3JL 4UDTB 1J05A 1I53A 3B9EA 1OANA 4MNQB 4TL5A 3IDIA 4AV0A 5ITFB 3ZKSD 3QRBA 4DCQB 3WY2A 3CZSA 3UO1L 1HTYA 1CDHA 5LAXB 4YR6B 5DJDB 1BJ1H 3NEXA 5IJVB 2VW7A 2Y7MA 4H8QA 5KAQF 1IAIM 3FQUB 4FYSA 4ZOBA 4F7EA 4MNQA 4ZOCA 1IGML 3BVXA 3FQWB 1IM9D 5DMJB 1M7IA 4MWFA 4XHJD 4N20A 3FOMA 4G8FA 3EO0B 2XN9E 1OV8A 3RPKA 3QNXB 2NX5B 4WY7L 3WEOA 4OD3H 4HJGB 3SGJA 1ADQL 1T89A 4KY1L 5CINH 4BZ2A 1AVAA 2QSCH 1M53A 4GG8A 2CWRA 1KBPA 3APNA 2A3TA 5K9OB 2ZX7A 1MAML 5EU5B 2O93L 3SPVB 5F72S 4YLBA 5ACLA 2DM2A 3BVTA 3EGXA 4BXVA 1PX8A 5CMAB 1FNEA 1B90A 4HFUH 4PV8A 4C8XA 2GSGB 4A68A 1ZSDA 3EO9L 4XAWH 3SE3C 2QLYA 1U42A 4DP8X 2VYRE 4EAEA 3BPLB 5F1OB 4BFIA 2VXVH 2B8OT 2Z91B 2PCFB 2H0JA 1WIUA 4NNYA 1JZGA 2BOLA 4PJAA 4DKEH 3PL6D 3ZR6A 2KI6A 1YMHA 5E6ZA 1TZHA 3EBGA 4HIJB 1RUQH 4LCCA 2CCVA 3W82A 1EO8H 3L54A 3LTVA 4LQFL 4MNHA 1GGCH 3BJLA 3UMTA 1UJ3A 1EIBA 3T3ME 5LCVL 3WV0A 1JF1B 1AJ7H 3S3BB 4I2XA 2VZSA 2EVGA 4L8BA 2AVFA 2DLHA 3CZLA 1M9SA 2NY5C 4XXWC 1Y18B 2N3JA 3WKYA 1IVLA 4M7ZB 1NAKH 3MGTA 2JE8A 4ATWA 1HSBB 1AHWC 4K55A 5I1EL 2HJKB 3U6XS 3QZPA 2R1WB 3VFGH 1OP3H 4PRBB 1E4WH 2MHAA 2GUOA 3UOAB 4FXKC 5CJQH 3WXWL 3KDMA 3KPOA 5GRUL 5CILL 1TJGH 4Y5XB 1HSBA 2X4NB 4WW2B 2WXFA 4Y4HB 3MRJB 2WD0A 1UACH 5BO1L 4JFFE 4QTIH 4XN1A 1WH0A 3WIHL 4DIXA 1AD9A 3LVTA 2IH1B 3H9SD 2WKLA 5GGTH 1PY0A 4GSUA 3K2UL 5DMGD 1TPXB 4LU5H 4PRPD 5KS9A 2V8MA 1KDIA 2ZUQC 4G9FB 2VLKA 4EI5A 3MR9A 3TT1H 3FFCB 1XL6A 5EC1B 5GGUA 4OCRH 3SJVA 3LNFA 1PYWA 4XMTA 2C5DC 5IHZA 3DIFA 3C6LA 5LHDA 1RCYA 3SQOL 2VM9A 5DRNA 5L88L 4FNLH 4TNWK 1KJVB 2IWGA 2VR9A 1MH5B 1J7VR 2EZ0C 2GK2A 2AQNA 4WLCA 5LGJA 3KVDD 1Y0LA 1T4KA 2P5EB 1HXMB 3DX6B 1O7SA 3WTTA 2IGFH 4WF7A 4DESA 4DGYH 1WT5C 4FQ1H 3PP4H 4YGVB 3NSYA 3CWGA 4ZDHA 4NWTH 1DE4A 2CLVA 5DRWB 4GUQA 1H6FA 3BZFB 2OMUA 4ZAKA 3GINA 4OCRL 3RY5A 4RBPK 3U0PA 5SWZD 4ZMZA 5DD0H 3CCHB 2VNCA 3CDCA 2YC1B 3MRIB 5D6CA 3KGSA 2GY5A 4N0FB 4QJ3B 2E86A 2IPUG 5AVQB 1CPUA 3LV3B 3P30L 2GJZB 5CGBA 3TWYA 5IZ7A 3FTZA 1EJFA 4HJSA 5D8JL 5JQ6H 2J6EA 3KBPA 1JPEA 1N8ZA 3ZHNA 5C0CB 3VFOA 4ACTA 3ZQ9A 4LBEB 4QRTA 4NUJB 4JZJB 5B3SB 2B7DT 4YHLL 3S37L 4Y8AA 1CGUA 1NUDA 4KU1A 1I85C 4F8NA 5C0FA 1DDHB 4P46A 4JDEA 3ZUNC 5I6OA 4HCGA 4ZFOA 2AJYH 2G75B 2VZVA 4P5TB 1GZQB 1HZLA 5BVPL 1RUAH 4X8JA 4YSDA 4CAGA 1DBBH 4HUWA 4X5XA 3S35H 5JHDA 4K2UL 1DDHA 4Z7QF 5DFVC 5H37H 5C0CE 5T3ZL 1BZ9A 3MACH 2F54D 3IFOA 5LNDA 4NQCE 4WSGA 1BFOA 4QLRA 5D7LE 3RFZC 2XXGA 3AU1B 1E4KC 3V5KB 3MNVA 1NBZA 3U30C 1ZTMA 4OLZH 2PN5A 2R2CA 3M88A 4Z7AA 1KT2A 1CICB 5B7MA 3ARGA 2JJSC 3MOAH 4OGZA 1W0WA 4WHTA 4PD4J 3NABL 1A02N 2OTUB 2G2NA 5BXFA 3QSKB 4NNYB 1VGEH 3BXNA 1T6VN 1N2RA 4BSVB 4S1DD 5GS1B 5IQNA 2ZX8A 1KT2B 2N7AA 5ADOH 4PBWD 5F9OL 3PWJB 4AIOA 2YFNA 5BZZA 5I5MA 3VFUB 1C8PA 2K4AA 2IFFL 4KHTL 4WJG3 5ACMA 2BSED 2JKIS 2XRAL 3IETB 4CMHC 4XHJC 3P73A 5J7CC 5CJOH 4WK0B 4LSSH 1FF5A 2OX5A 1UA6H 2X4OB 2KERA 3B2VH 3EYSH 4PCKA 4U3XA 5EOTB 3VH8G 1Y7VA 4TULL 4XWOC 2I9TA 1IM3A 2E27H 2A6JA 1YNTF 2ZAHA 3WJLC 1WQVT 4KUZH 4HSAC 4JFQB 3EJUA 5BUPA 3QC5X 4FQPA 1VZIA 4NO5A 5MENE 1A7OH 4G1MA 4BK8A 5ELIA 3QNZB 1R3IL 2YS4A 4IDJL 4YXLH 3FUEA 1FL6B 2FHBA 4S1SH 4DVRH 3HG1B 9CGTA 3D0AA 1FNSH 1XBDA 2DQCL 4P9MH 4G6AC 4UU9A 2DD8L 3VSQA 4NKMA 5DLLA 1UWEL 5DLML 1L7IL 4ANKA 1ZT1B 4BUHA 4MMXA 1GHFH 1L9RA 5KS9B 4KTDH 5FAAA 3RWEB 1I8LC 2WLYA 2XFXB 3VJ6B 4LASH 3O6FC 2P45B 1EUUA 3KYOA 1P84J 3NCYP 4RRPM 4DN3H 1T03L 4UQ3B 1X5AA 5L7XH 2ICWI 1J1XL 4Q2ZA 2XTSA 4JJ5B 5JYLA 5CZVL 3RWDB 4LLAA 3GO1L 2UXGA 2K9FB 1CXKA 4GQQA 3D50A 4ABQA 1E8WA 3WJJC 3NIGB 1IE5A 1R3LA 3ARTA 3TIDA 3P77A 3UEQA 3F12A 2YOAA 3WKQA 5HI4D 2X6UA 4FNSA 2WZPA 2V3EA 1INQA 4AT6B 1S7XB 4ENZA 2DICA 3RDJA 1H3GA 2A4EA 3PFQA 2QJDA 4HP5A 3ARBC 4PJ7B 4JHVA 3BWAB 1XXDC 1LO2L 4AH2B 1II4E 2YSSB 3MKKA 1PDKB 3FBQA 4N0CD 1YUHA 5DJXA 2ARWA 3RPIB 3D05A 5EIQA 5JIDA 1M7DA 2EC9T 4FABL 4BH8A 2VDOB 4FQJL 4G5ZL 3V0FA 2H3NB 2LU7A 3ZQXA 3L13A 4U0RC 5CU5A 2OAAA 4YHPA 3AXHA 3QIBC 3D34A 3EZJB 4PY7A 1ZE3C 3VACA 4WNQA 5GQBA 4TPRH 2BSBA 3LQAC 2HSIA 3DVNB 4WV1A 3F5WA 1FP5A 3IT8D 5MP6H 2UXVA 4G6JL 2YZ1A 4A2LA 5ACZA 1FZMA 3O2DH 3OC5A 3CZEA 5IJDC 2UY6A 2L7JA 3FKUS 4LCUB 3VA2C 3BE1H 3T08A 3NJNA 4KZDL 3MV7B 2WLNA 3QIWD 5B22A 4G83A 5BVJB 3EOYG 3IDGA 1IAKB 2X4QA 5MI0B 1BVNT 2FX7H 2FIKA 4FXGA 1MCBA 4N85A 3VXQA 3MV7A 3VGHA 3CX5J 1WICA 2XTLA 3HS9A 3LKRA 3KL0A 1HDMB 3SBWC 4AIZA 4R4NC 3WTSA 4J3SA 2K3HA 2HT4C 3L3KB 3IS0X 4M1DL 1MXDA 2PXYB 3LZFL 3MCLL 3PWNB 2XJLA 4HWZA 1LQSR 1QBML 2DEXX 3T0BA 3O2DL 4EN2A 4XTRC 4W6YB 1M2VB 4A7QA 4PW9A 1A5FH 1R47A 1WDAA 4N2EA 1BOYA 2E9IA 2AJXL 3AWEA 1AR1C 1ZA6A 4MD0A 2QMJA 3ZGHA 3CC5B 4Y4FD 1EXUB 3OXRB 1Z1WA 2BW5A 2GVYA 4LVNB 3QDAA 2CSPA 4G1EB 1MCDA 2V5SA 2X0UA 3L5JA 2XACC 3EH1A 1B0RA 1JGLH 3D3VE 5TH2A 4JGJA 5TQ0H 4YHNB 5C08D 3T3MF 1JXGA 4L8SA 3G6DH 1A14L 1OE2A 1U2HA 5AVVB 2JKNA 2K8QA 3MNZA 5DI8B 3WDJA 1R3KA 3LJ3A 4M29A 2NXYC 4GG6B 4Z5RA 3QYNA 5GSRA 3MA9H 1SFDA 1XH3B 4JPVH 4LCWB 1NAML 1RH8A 2F5AL 5DFVD 2X4OA 3MNZB 5IVXB 4Y2DC 3T1FB 5C0GA 5JHBA 2YRZA 3LZQA 4XXDB 1ED3B 3VMOA 3WGUB 2HX7A 4HFWB 3QXTA 4PS4H 4JFPA 5EEXA 1OCOB 4ZO9A 4ZX3A 3GI8L 5H4ZA 2CMRL 5FCUH 1IFRA 5EZLB 1MFBL 1Q0XH 4LEOB 4W9KC 5D9SB 4YDLC 5BZXA 4YBLB 1G94A 2DW5A 2Z4TA 1QFUL 1FG2A 2FJGA 4U6XB 2VLKB 4CSTA 2W07A 3FZUC 1P4IH 4XVTH 1U30A 1U0QA 2V2TB 3L81A 1D9KA 3ZL4L 4IGBC 5DJ8A 2LOEA 4J4PA 4TNVK 3FF7A 4YHOH 5KN5A 1CGWA 1S9XA 3CFNA 5DMKB 2ZWLT 3HUJF 4DOHB 3VTAA 3WNIA 2P44B 5CN2A 5KZCD 3ABLB 1L9QA 1RERA 4FP8H 5JDSB 2OTWB 2DQGL 5E6SB 4ANUA 1UOKA 3QIWA 4P48A 4FYTA 5E6UB 1U8NB 2XXFA 1YY8B 4EPSA 1DVZA 3FOLB 2IQ9L 4I0CC 5AW9B 2VDMH 5ICUA 4NQUA 2BIQA 4TLKA 1BGXH 3MZGB 1PQZB 3PFUA 5FDYA 1CLZL 3I9GH 1BVKB 3VFVB 3Q2CA 3GJEB 4NO0A 3DVFA 4UV7L 1D5MA 4G82A 1YPZF 4KX7A 1BDYA 5E70A 4M7LH 3E9UA 2CDFB 1KBGL 4H40A 4YE0A 2IPTH 2WSPA 3FOLA 3NZHH 1FI8C 4EZMA 4WO4C 1D7DA 2AK4A 3MV8B 1YN7A 2AEQH 2WP3T 3GLDA 3L3GB 4OFYA 4XWOD 5FGBA 3GMMA 1HOEA 3ISYA 2R2EA 4BWUA 3Q5OA 4CSZA 4FMKA 2O1AA 1OP4A 2UZYA 3P9WB 2ODHA 1MCCA 1PLBA 3L3DB 1JVKA 1OT2A 5IQ7H 2E76C 2FB4L 5BW7C 3UO1H 1KNOB 3AAZB 4X5QA 3U48A 3GMMB 4J5VA 5EA0L 2VMFA 2PYED 3KPSE 3WDIA 1N0LB 2O5NA 4ZFGL 1UG9A 5HXMA 1O6SB 3OKOB 1S7XA 3EJRA 4HJJH 5AB0A 2HB0A 4TOYH 4WKZA 2DM4A 2FYYB 4U1KB 5E1GA 4LOEA 4XNYH 3RL1A 1YEWA 3NK4A 4YHZH 2YWZA 3IDNB 4MRCA 4XBMA 3ARXA 1HJBC 1FZKB 2GCYA 1KJ2A 4XC1L 5JOFA 3CFJA 1M71A 2V9TA 4KC3B 4GXUM 3C5XA 2Z92A 1L0YA 3MBXH 3LS4L 1JYWA 3BSZH 3JWDL 4OCMC 3T4AA 2CU9A 4LPVA 2QPEB 3RDTA 2C9QA 3JWNH 4H5SA 4DFIA 2VDKH 4JM0A 4PJIF 4XVUC 2VUYA 2PTTA 1KPUA 4PJHB 5EUKA 1U33A 2PPFA 4K9EC 5TGBA 1BG9A 1KFAL 2PW1A 5I1CH 1GZQA 5ACZB 3GI9L 4AYEC 3ZU8A 3BGAA 2QQNL 4KBPA 2HWZL 3FMGH 2PNDA 2VLLA 2OMZA 1RUPH 1YA5A 1YEGH 2FATL 5EU6D 3APDA 4XMKL 4PJ8D 1DHKA 5J12C 2ESVD 2NY7L 3P4NA 3Q6FA 1KF9B 3CC5A 3RVVD 4JNXA 1ROWA 2E5EA 2DM3A 4PJEB 5I0DA 1LWJA 2HG5A 2ICEB 2WYHA 3GSOB 4X7SL 3O3EA 3NGBB 2FZ3B 4IK6A 5D6DC 4X7EC 3GSQA 3DGDA 2Z7ZA 3SYPA 4LBAA 2UV3A 3U36A 8FABB 4N2FA 4XRCA 5DI8A 5ABZA 3RY6C 2FT8A 1FL3A 2EIKB 5CZKA 2ZKHL 1AI1L 3ILQC 1MCIA 2A6JB 1X4YA 5CILH 4P2OD 4PQXA 1MEXH 1U8LA 4H8WH 1HHGA 3IMSA 3SKOA 3M07A 3MLZH 5E24E 4M8UA 5D72L 4FTVE 3UTTD 1Z3RA 4ZNEE 2GTQA 3CZFB 5IWLA 4NO2A 4YHNA 3BZEB 4OZHA 5DS8B 1B6DA 3APMA 1IGJA 5D5ME 2ENSA 2TAAA 4OZIA 2Y22A 3E6FB 3WNMA 1A4CA 1XIWA 1RULH 1PYWB 5IHZB 4GG6F 1QRNB 4YO0A 1BM3H 1D7BA 2NX5E 3RVVC 1G7JA 3IAQA 4JDVB 1XGRB 3QUZD 1BG1A 1I8IA 1DBJH 2A9DA 2FWSA 3AY2A 4DN4H 2CRMA 3QO0B 2CKBB 3ZX1A 5DA4A 4ELKA 1OE3A 3WS6C 3UJIH 2EKJA 3BP5A 1DSFL 1CL7I 4IRJB 2R15A 2AQRA 4GI8A 4O02A 5D1XB 2QSQA 3SDAC 4LE8A 3FQYA 1VADB 1EHKB 2ZOTA 4WFGE 3UAJD 3EYQD 3K1DA 4P2QE 3E2HC 1EEYB 2W9EL 5IK3A 4X6EA 3KLAB 4DGYL 3FTGB 1HILA 4N2KA 4FQ1L 2ARJB 1CI3M 5HDBF 4C56A 5FYKE 4IBWA 43CAB 3QAQA 2W65A 3IRZA 2DI9A 3LIZA 1CLYH 1DR9A 3QZNA 3VU2A 1BVKA 3VFVA 4DERA 3GSRA 4K4KA 3G6AA 2FJFB 2OK0H 1NAKL 2ZE0A 3S0PA 3O2VH 2AITA 1FORL 2KC0A 1YEKL 2X3AA 1W72A 2X09A 1HI6B 4FE9A 2OTWA 4OV5A 3BLBA 1QPPA 2CHXA 3GKWH 4I18B 2NQDA 5HYQA 2BLFA 3IDYB 3L3DA 4NQCA 4J1UB 5JQ6L 4F9LC 5DZNA 3NJIA 1TCRA 4L3EE 2HVBA 2VN3A 4M61B 4F7TB 1LEIB 4Y9EA 1DL7H 1RUKH 3HS8A 1AO7D 3FYIB 4GXFA 4QXWA 1KG0B 2BVTA 1OP5H 5CBAA 1F5WA 3RFRA 1QNZL 1G7PA 3OKOA 3WFBL 3C09B 3D85D 4AE1A 4K5PA 1HIMH 1MIEL 2AK1H 4JO4H 2DIEA 1KYAA 5DVKA 3U6RA 3HS0B 4CJ0A 1MJ7H 2XQYK 2BY2A 2YMTA 1WLHA 3UG3A 2IAMA 1CU4H 4K2UH 3RNQA 4KI5E 4Z76A 4K71B 3NAAH 3WIIH 3QFJB 4KK5D 4OJEH 1CR9H 3NPZB 3OMAB 2VTFA 1EFXD 3SBRA 2F8XC 1E27B 4BKTC 5F1IA 4LKXA 5HYSB 4FQXB 5CEZD 4PGDB 3LB6D 4JFFA 1QNZH 5H2BB 3ZYJA 1SLVA 5GJSL 4AGNA 2FYYA 3VB9A 4UCFA 2VZOA 4GQZA 4JZOB 3S3CB 1I1AC 3C9NB 5BXFB 4ODVL 4MZIA 3T77A 1CC3A 2P1YA 1NCAL 5ISZE 1MFAH 3RGBA 4F9PC 1CU4L 3NIGF 5MERA 5D93B 2D03L 3RVTC 4DO6A 1BFSA 1QLRB 3ZN6A 4R2GB 5KVMC 2ZCZA 3QWQB 5J6GB 5DSCA 1BFVL 2P46B 3R06B 1AH1A 4F8TA 3PWNA 2D7PA 3APFA 2Q1EA 4RGOH 4AQOA 1O6TA 1WD9A 3TF7C 1U3NA 4ZMWA 4KKCC 5JZ7D 5FO8B 4MB3A 1YQVL 4LPTA 3MRKB 4DF9A 5B38A 1EHAA 1A66A 5ID0A 1LMIA 3UJTL 3BEWA 1FNHA 3D2UD 1QMUA 4MGXA 1OPGH 1NCAH 4OVUA 5FYJU 1I8LA 1KBVA 5AWNL 5B1AB 3D2TA 2F7PA 4U2ZA 3GSXA 1T21A 1EAPB 4FGMA 4RWYH 2GUYA 4NSKA 3RY4A 3VE0B 2MOQA 1TZHB 2MHAB 2YAOA 4M93C 4QDGA 4IU2B 1PKQE 2J7LA 1HHJA 3ARPA 5AVZB 4H1LB 3H9ZA 2EIDA 4ICXA 4RISL 1TYRA 4S11A 3WMQA 1PU0A 4U1NB 1PFOA 2YXFA 4A2HA 1W8EA 4F93B 3V6FA 2NY0C 3MJ6A 1G7QA 1DBBL 3S35L 4XVUD 1UFUA 2R2HB 3MREA 4ZPVA 2OL3A 2PPAA 4NRZA 1FNSL 2X1XR 5GZND 5I19L 4G8GD 3AUVA 4NUGL 5B7FA 3PNWA 1FIEA 4TQPA 5DU7A 5TD4A 3HNSL 3TH3T 2WXNA 2OL3B 3HG5A 3L8QA 4CU6A 1IFHL 5F7UA 5HI4C 1BIHA 4QRUB 3L95B 5EBWB 1AZBA 4YDKH 2R0WL 4RAVA 3ARBD 3RZCB 5EBLB 3Q8EA 4AG4H 5D7JB 3VM7A 2K4WA 4AW7A 4EI0A 1GYVA 2XN9B 3DBSA 4AOFA 3BP7B 3QIUC 3V4PA 3H53A 1ACYL 3S88H 1I7RB 4ABVA 2IG2H 4ZUSB 2BP0A 5DA0B 2I27N 4FQQB 4RMSA 1INDL 5I5RA 2D3LA 3F62A 3BD4A 3PF2A 1S6NA 1U8QA 3N43B 2ZG1A 2EDOA 3WN5C 2X89D 5I74B 2WAHA 2TRHA 5CEZE 1NMAH 3W0WA 5D7LA 2IGTA 2ARJA 3KEHA 1NH6A 4HISA 5GRVL 3ZW3A 1IMHC 4GI9A 4JFEE 1ID5I 5EC1A 2MOVA 5CJOL 1A7OL 3B9KD 3FCSA 5TE7H 3TIDB 4JN2A 1F00I 3B2MA 5IESL 3MX0B 1YAZA 1S7QA 4O9HH 2ED6A 4PY7B 1CDGA 5DRNB 2GQHA 3G5WA 4O02B 1MCEA 5D1XA 4FABH 5DJZA 1SDYA 3VH8A 5D1ZA 2OA9A 3F5WB 5EOQH 5HGDA 3T2LA 1IQDB 2ITDA 2F5BL 2JQZA 4FTVD 3FXIC 4WRLA 3UTTE 2EEBA 3X3FL 2ATAA 3V4LA 1MW0A 4CGTA 1YUHB 3G04A 1A9VA 1I1RA 4JK0D 1IC4L 1MI5A 4P2QB 2VIRA 1F4XL 1U2CA 4XMPL 1JP5A 4ISVB 1N19A 4UDUA 1N5YH 5FKPA 3KEDA 2UY7A 3ULVF 4N0UB 4NWUH 3W2DH 4QRPB 3RWHB 2JH2A 2RCSH 3UH8A 3V5DA 4G11A 2WVVB 3CFTA 4YSAA 1E5AA 3CQQA 4MS6A 3GMLA 1MRFL 3KCPB 1XF2B 4PP1D 3RDTB 2CKBH 3LN4B 2F5BH 1TENA 1N12A 1T1WA 2ADGA 3W9DA 2PPEA 3IXTB 4NP9A 3B8SA 1J1PL 3OHXC 4U1KA 2H6PB 2FO4B 2H26B 4ODBD 4J4PD 2C1OB 2YAEA 4IHOB 3VFNA 4YN3A 3LX9A 1BVZA 2ICCA 3O8XC 5J4MA 1U8MA 5DZJA 5T1KD 4NKIL 2D7QA 1QZ1A 2R56L 3F83A 1HINL 3LEXB 4NWUL 1WFNA 3KPLA 3QQ9D 1K4CA 4L29B 2FUTA 2FRGP 4XPBH 2OL3H 1CYXA 1GOHA 3PWPE 5A2BA 1CN4A 1UASA 3JSSA 1J8HE 2DB8A 3IJHB 4N2DA 4PBVC 2VXTL 3F8UB 1HQ4B 3EIFA 3O6LH 4APQA 3U2JA 2RJMA 3GWJA 5KS9F 1L6XA 3SO5A 4XB3A 1AIZA 1WFMA 3O3EB 3QUYD 2PW1B 5B3JE 5DJYB 1BEXA 4PG2C 4OZHF 3ALWA 1KXHA 1S7VB 4Y9FA 3BKCL 5KYNA 3T1FA 3FU3A 43C9A 1J87A 1OAXH 4Z7WE 4LDOB 1ITBB 2HFFB 1EV2E 1PGRB 1OAUH 2DWYA 2EDMA 3L2NA 5GRXG 2Q8AH 1DLHB 2DQJH 3C08H 5K1JA 1K8IA 2BH0A 4AYSA 1Z9PA 3VXUE 2R4SL 2AXHA 2GAZB 1RIUL 3O8XD 4QR7A 5GS1A 1IM3B 5LN8A 2P47B 5C07D 4AJ0A 1OXYA 1KGXA 3UBXA 4YSQA 4I87A 1FAIH 3AZUA 4L5FH 4R96B 4CBZA 4KI5C 5T5NF 5FOBB 1N7MH 1YEJL 5A2KH 3AT9A 1XMWA 3B1TA 1BLIA 4I8DA 3IMTA 3JTBA 4M1DH 2I32A 3GMQB 3VFTB 3ZY7A 1IBHA 2YJQA 3OKMB 3QQNA 1AQDA 3SZ6A 5J5EA 4QJ5B 2ZQKA 3Q9QA 4U6YB 3HHSB 4KK9D 4W9IC 4XX1G 2R1XB 4I0PC 5ESAA 4UTBA 1V3MA 1DJYA 5DGQA 5DVNA 4NO0B 4ZXBA 2XWCA 4MB5A 1NCDL 3L1OL 1ZVNA 4LHUB 4OLXL 4C56B 3AXIA 3BDYH 3BZ4A 3DPDA 4QF1B 1D6VH 2JI3A 2VE6B 4Q6IB 2KL6A 3TA3A 1OM3H 5GGUB 1ZGLA 5E08L 3MFFB 4XGZB 5AD0B 1QTSA 1WCBB 3B7YA 2WWMC 2ORBH 1SVBA 2XTJC 2G60L 1HI6A 4ODTL 5J1SC 2XJKA 5AAPA 1KEMH 1DP0A 3K2KA 1MCPH 3KYKH 3ZJAA 5HJBA 1PKQB 3Q2NA 1A3LH 2VJ8A 1MCWW 2XN1A 1EVTC 2WXOA 1PZ3A 1LEIA 3VWJD 2W65B 2EEFA 4RX4D 4JO3L 5DHDA 4H1LH 4BH8B 1FYTD 5F9JA 3WMSA 2CM6A 3H3BC 3FQXB 1F11B 4TV3A 2O6CA 3SPIA 5IB3B 2VOTA 2FJFA 1JPGA 3U0PB 5L4JA 3ELQA 2Q76A 2XV3A 3S5LG 2JCWA 2B0SH 2WN3A 3L5HA 5FHBH 1P1VA 3BWAA 4RQQA 5AYUH 5G55A 4KKAD 4XC1H 5LVEA 4QOKA 2W60B 3DX6A 2X10A 5KG9B 3KXFD 3BSZL 2W0KA 3GM0A 1P6FA 2NDGA 3FQNB 3GHEL 4DPBX 1RVFL 4XE0A 4BGLA 4MJ5A 1KWGA 5DD5H 1IT9H 1HYRC 3OLEA 1GY1A 2A6DA 1VACA 2XV2A 5J9PB 3C60B 2Z4QB 3CZUB 4G6KL 5EEZA 4PRHA 3KZ8A 3F65A 1OTSC 3X1NA 1EBAA 2Y24A 3LNHA 1AKJA 3KG5A 2KS0A 1N8OE 3UJJH 1GCYA 3D2UA 2GB2A 1RZKH 3VD7A 4LLYB 1V05A 3DRQB 3HC2A 1I9JL 3EGDA 3QPXH 2HKHL 1HCYA 1S8DB 5EA0H 4L0ZA 2DLFH 5C0RL 3K71B 4DFHA 1NC2B 2YBGA 5C3IA 3MLXH 3WLBB 2ADGB 1X9UA 3W9DB 4D0DB 1WIOA 1QABA 2V2WB 4AQAB 2YQBA 3W11C 2FR4A 5H94B 1ZV9A 2WOBA 4PLNC 4OZIE 1TJIL 2ZG3A 4KRNA 3P11L 3BEWB 4TS6A 3POHA 4HWZB 4IBTA 4WW1B 3OF6A 1B4JL 5MEND 3KL5A 2ZKHH 3QXWA 2Z31D 5CMAA 3OAYK 4WFHE 2UYLA 4XMLH 2FEDD 5DSCB 3FU9A 4UIMA 2NY3D 4WU5B 4Z7VF 4HKZB 2AJSH 3T3PE 2AK4E 3VFUA 3HI1B 5I0XA 1A4JA 4APXA 4ZMAT 5BUAA 1CBVH 1AO7E 3T6XA 2CR6A 3RGHA 4DGWC 2Q7YB 4DK6A 3II3A 5I1CL 5G4NA 4FCHA 2N7BA 3GHBH 2WXPA 4L3EB 4G7YH 1PFCA 4TNVF 4FFYH 4HIHA 1D7CA 3QQ9C 1IGMH 4N24A 2K70A 4JFTA 4UNUA 1I3GH 3H3PL 4KQ3L 4JVPA 4RMBA 4XNUH 1QR1B 2D9QB 4HS8L 1XCTB 5E8EA 1F3RB 4MA8H 3MLVH 2C1PA 4A2DA 1H5BC 3CHQA 3HNVH 5T5FA 1AZUA 2R2HA 3MREB 3OKLB 5F7FA 2XBDA 3B83A 2NNAA 4ABUA 2E59A 4HXBL 1BV8A 1FWXA 2EIZB 1XGTB 2V2XB 5KVGE 3WKNA 4FNTA 3DV4A 1DLFH 3CDGB 3NFSL 3BQUA 2R0KL 3NSCA 4XTRD 3TO4B 3WGVB 4PIRF 3CFUA 1PF3A 3ZE2F 4HFUL 4HOZA 5GS0H 5DC2A 1RUQL 2APWA 1C5CH 1QO3A 3FONA 4IBSA 5D6DA 5BRQA 3Q1SL 1UD4A 5LGJB 5E6IC 2HRPL 4KI5F 3R18A 2IIJA 1MVUB 1SDDB 2A99A 2WIIA 4LP8A 4RIRB 1SVCP 4AMKH 1BBJB 4ZUSA 3SQRA 2BNQB 3K5RA 5CCJA 3C5ZD 2LAGB 2VDQL 3LH2H 4R5VA 3L3GA 2FHCA 5E00B 3P77B 2BCKB 1CFBA 5E4EB 2HJLB 4HU8A 4GUPA 2ZONA 2UZYB 3E7JA 3ML8A 2NXZB 3VXRE 4UQAA 2OMXA 3PGDB 4XNZB 3JXAA 4Z3TA 4S10A 3T9WA 4GOSA 4KGLA 4G6FB 1IAII 2F58L 4JG1L 1UZGA 1OALA 5DRZB 2ZZUT 3V6ZA 2HRPH 3UJIL 5GS0C 3ZDYB 1J1OH 5ECJE 4X4KA 4G9DB 4P4RA 2EH7H 2BFGA 2LAAA 5LBSL 4X4MA 4TLSA 1T04A 3WFHB 3NIDE 3EFFB 3TV3L 1XQ4A 4I0PD 4KZEH 4FL4C 3VI3F 5C0FB 4GYBA 2K3TA 1ORSB 3ES6A 15C8L 4UUJB 4F5CA 1ORQB 1WF5A 4J2QA 3O2WL 4JFDB 2G75A 2P52A 3Q8BA 5E94B 3KH4A 1KEGH 5T3XE 5JXEA 1QFPA 1T0NA 1XGQA 4NN5C 4IGBD 3ZKXB 2YPVL 5E2UL 3RBGA 2Z34A 1FA4A 3B37A 5DMIL 4RSVA 3VD1A 4YZFF 2WQWA 2NYYC 3T1WA 1ZLWH 3E1ZA 1VB9A 4GIAA 2CO4A 4ODXA 4UTBH 2QVMA 4X5WA 5T3XD 4JFFB 3CFCH 4ZFZA 1JZ3A 2IGFL 2HT2C 1H8LA 1XGPB 4RMRA 4YSPA 2FT7A 3CFIC 2FX9L 5CO1A 2EVIA 3KWXA 5ECGA 4FFWC 5C0JB 3RJDA 3BWSA 1MHEB 1E9PB 5DDHA 3QIBD 4GMSH 4M9PA 3WLBA 1NAMB 1F6FB 3LEXA 2WM0A 4F24A 1GGYA 4I7ZC 1P7QB 5JPNB 3TH4T 2EAEA 1FV1A 1HHIB 2OJEB 1H8SA 3LQZB 3LPGA 5F89A 3TN0D 1KCLA 3ASWA 4XC3L 2JELL 1UCBH 4JKNA 3RVUC 2WMPA 1F56A 3VWKD 3LQZA 3RWFA 1IJ9A 4ZTOL 1I8MB 5FECB 1ROCA 3HPLB 1TQTA 3IETA 5TH2B 3V0WH 1KGWA 4C58B 3PXJA 1H3PH 2VZTA 4TVUA 4U33A 3DUSB 4D3CH 1CE1H 1LNUA 1T22A 2KLTA 1CJYA 2VW6A 5KBKA 2K8MA 2JXMA 1EXHA 3GXPA 2RQ8A 1ZHNB 3HKFA 2BVPB 5B7EA 2DS4A 1LE9A 4HZ1A 2WXHA 3ZHFA 3NJMA 3E6HA 2R2BB 3HFML 4ZXBC 2X4SB 2F7IA 3HUJA 3OC8A 4I89A 5F7DB 3B2UC 1I7TB 1ZPLA 4KDVA 4OZ4A 1F42A 4JE0A 4NENA 4CKQA 1S9VB 4WWKB 3MCKB 4LLWB 4JRXA 2YD8A 4ZUWA 4BH7A 2CGRH 4E9XA 4K5NA 5L88H 2N01B 4Y4FC 3H42L 4FNLL 2DJ4A 2FGWL 3WNNA 2DN7A 2B16A 2J6EH 2YQ3A 4HS6B 1USZA 4OIIH 3KJ4B 5EOTA 1Y6MR 4PRIA 3WL9A 4LHUA 3VD0A 2BHFA 1AGBA 3ELAT 3UTPD 3EYUL 4JFQA 4UT7H 3P3TA 1TQBC 3TA3B 5K9JL 3C5ZA 3MV8E 3T0EA 2VR6A 1JE6A 1X5FA 1ED3A 3OKYA 4D8OA 3B8YA 5BQ7B 5EZIH 2E8YA 2V0AA 3UROR 1VGEL 5AD0A 2ED9A 2BP0B 5J6HB 4LVOB 7PAZA 3FB8B 4PREB 1X9LA 3AADB 3LRSB 3STLB 2CKBA 5CNHA 4XVOA 1OGAA 1T7YA 3WHXA 3W9EB 1VHPA 3BCDA 3P30H 1F1GA 3C8DA 4HS3A 4ZXBD 5IW6A 2E47A 3QG6B 4HULB 4PREA 5LO7A 2VIRB 3QCVH 1MRCH 2QQLH 4L8CA 1J8SA 1WZLA 2YOCA 2K9UA 2VQUA 4X5LA 4I18A 1S7QB 1U3HD 2WLKA 2ALAA 1SMAA 3FU0A 1LO4L 4K9JA 1CB4A 2ZSVA 4DVBB 4ZW3A 4XMPH 5CJXA 1T66C 1K8DB 5CCGE 5JXAL 3L45A 1U95B 4NUGH 3N5AA 3HG1E 4BCXA 1M2OA 2YD1A 5GGTA 3WD5H 3U4AA 1EAOA 1U8OA 1A3RH 4WQOA 3REWB 1W72B 4N87A 1T1ZA 2ERJC 5JQHC 3TURA 4UQ2A 1IGIH 4YDIL 4U4BA 4ODHL 2MNJB 2OMVB 3FRPG 3SGKA 3V0DA 4E42B 2WBWB 3L9BA 3NP3A 7TAAA 1YPZE 5CWSA 2H2PC 4M7KL 4BK4A 3L5XL 3V5DB 4HEME 2KDGA 1KN4L 4PVNA 1M7IB 3BVUA 5JW3L 4LLVA 3D48R 5IHHA 3NFNA 4S1SL 4DVRL 1YEDB 1XD0A 1YEIL 1E42A 2DQCH 2BS9A 1J1XH 2HA1A 4GJTB 5AYTA 4P46C 1H8NA 4K3DH 4I5BB 1GW6A 4E41D 3DXAD 4KKPA 4Y1AA 4R8WL 1IE4A 3OJDB 2XA8L 1XF5A 4P49A 2B2XL 3GXDA 3X3GH 1GZHA 1UGKA 3V4PH 1C7TA 3MLWL 3S2AA 1E9QB 4D0DA 4ODHH 1JZDC 3QE5A 1GC1H 3P3YA 2F53D 5CLTA 5C3LD 1KJ3L 2L7UA 1WTGT 4JFZL 2OTPA 3DYPA 3OVUB 5DQ9A 3KPQA 5I8EA 1A6WL 3ARFB 4BDVB 3D69B 2FT6A 3O9WB 4JFYB 5DYFA 1IKNA 3BKCH 3ZDZF 4HIIB 4LEEA 5F7NC 4XAKE 4B3VA 1ZAGA 4BYHA 4X9FA 2V7HA 3RWCA 3QR2A 1JPST 1S7RA 3SJVE 5AZ2L 5EF2A 5C7XH 3WMPA 5F3BA 2MTPA 1KZYA 3F05A 4M6OL 4NI3A 5LWYL 2PCPA 1Q9KA 3V0AC 2QZ5A 1HZHH 3GSOA 3NIDB 3QZWA 3EDDA 2R4SH 4PRHD 1W6LA 1Z66A 1FNEB 2V37A 3AMLA 3L3OC 3QEHA 4QKTA 4XPTH 4YZFE 5GSRB 3TS8A 1JF1A 2VN5A 3S36X 3WO4C 4YMPA 4XN9A 4EF3A 3OMZA 4KV5F 4XP1H 2XKUA 4X9IA 4MJJA 2BOBA 2HLFC 2X2IA 3BE1L 1J12A 1BVLA 1L7IH 4JFHD 4M48H 2N7SA 5AL0A 3VRJA 4R4ND 2QMKA 1G7QB 1NMCC 4A04A 5FM5O 3VFWA 5C7XL 5CEXA 2MPVA 4BQ9A 1JNLH 2R8SL 2B15A 1KSRA 5DEFB 4YNYA 5BS0D 1HZHL 4DUWA 5HDRA 3KMDA 3QCUL 4GP4B 1X4XA 5FB8A 2HP4A 3THMH 1EDQA 4I9XA 4NFDA 4Z7WF 2XY1A 2Y36H 1TVDA 1AD9B 2GJPA 2XYBA 4JUSA 5I76A 4MNGA 4WGVB 5L8KB 5D2NB 2BVPA 3N85L 3NCFB 4W93A 4U3CA 2GW5A 1W9XA 2BSCA 1OAXL 2C9XA 2IDTA 2P43B 4PRIB 3RVUD 2J12B 1G7HB 1MCOH 4KO6A 1JGEA 1MNUH 2JK5A 2N0MA 3RGVB 4X6FB 4B9YA 4MNGB 5JDSA 3F00A 4PJDA 3UYPA 2K0RA 4A37A 4WU7B 2P48B 5D7LD 2YAFA 1OCCB 3FFOA 3KS0J 2XQBL 2X89A 3CD4A 3FN0L 5D96B 5DTFA 5SWSE 2ENQA 3ZDWA 4F2MB 4G8EA 2AJXH 1ZANH 4HS6A 5DO8A 4LHQB 1HFUA 3E6FA 5L8LB 1S3KL 2C26A 4A2MA 1F11A 1MN4A 1IBYA 2DQJL 1VFMA 3GPEA 1N7ML 4Y1AD 5IBLC 4Y5VA 5B8CA 4WHYG 3RY6A 3TONA 3U2SA 4HV8A 1LTXA 4BK5A 3S7GA 1U8JB 4WW2F 4Z0BH 4YGVA 1LEKA 1OGSA 4KXCA 3RWIB 4GAYA 3CC1A 4NHCH 1G7MA 1MFMA 5FYLH 5D1ZI 1A6UH 2XVGA 4ZAKB 4NX0A 1A9BB 3EH5B 4IYKA 1MCRA 1P4BH 1U8KA 3ZIMA 1OIOA 4HIQA 3CCHA 1NZRA 1T5WB 2F8VA 1E40A 4UZGA 3U4EA 2GG1A 4AEHH 3ARWA 3TPUA 2BIHA 3EDEA 2Z7WA 5A1AA 4QY8B 1BQSA 1RKRA 2J4WL 4M03A 1XGUB 3MV8A 4BFEA 3QXAB 5DD5L 2ZWYA 1EJ8A 1DJZA 3F3HA 3SE4A 3UAJC 1D6VL 4XVTL 4D0CA 1XF2A 1KV3A 4X80H 4LLQA 3LIZH 1KENL 4QHUB 3EG9B 4GAFB 2CLZB 5LGKA 1B2WL 3E8UH 2CGYA 4K23L 4BKSC 4Z7QB 5CIPB 1ECZA 4P23C 4HWEH 3VXTB 5C07A 3WKPA 1ODAA 1T04B 3WFHA 4OV5B 5I1IL 3TC9A 4Y1TA 1IIKA 3SDYH 1JNNL 5BV7B 1XZWA 1OM3L 4NO3A 4UAHA 1MIML 3SYCA 1L3NA 2IH3B 2DQ6A 3X12A 2A77L 3VXTA 3EUDA 4A2FA 3QNYB 4ACPA 2L0DA 4HA1A 4JO3H 3PJSA 3RTQA 3S35X 4U4IA 1E50A 1X9RA 5CEZL 5PCYA 1SOXA 3QAZB 1V3JA 3U7YL 3NZHL 2DH3A 4GP5B 5E7BA 1JD7A 2ZT9C 3GMNB 3C9NA 2DWEA 1M1SA 4LAJH 3P2TA 4YXHH 2SODB 5JW5B 1EA9C 1TQUA 2CNZA 2YPLD 4LXFA 1TETL 3MTXA 1M42A 3B2XA 3BN9D 5I71C 3RWFB 2FECL 5BOJA 2FR4B 3SCMC 4JG9A 5C0DA 4AGOA 5E5RB 4DJMA 2AC0A 4L9LB 2A77H 4MNGE 4PEEA 1WFUA 4APQD 2V3FA 3GSQB 2VQ4A 1N2RB 4OLUH 4PGDA 3JVFC 2UWEA 3OB0H 4WJ5B 3O4OC 5IEKA 4HJJL 1X6NA 1F4AA 1FV1B 2OJEA 4XRCB 1Q0XL 1NIFA 3QXDB 1SRDA 1JBJA 1SLWA 2XPGA 3FO2B 4P5KA 1T83A 3ILDA 3P4NB 3Q6FB 2L04A 3GM8A 4MNHB 3O45A 2ICEA 1CFQB 1DEDA 2VSCA 1E8YA 3BLKA 3FO2A 5KVGL 1T7ZA 4X6CA 2DQEL 4OFDA 1BPVA 4BSVA 3PNRB 5CSZA 2ZYSA 3HHRB 4WFED 4B3EA 4XZ4A 4YHZL 2P5EE 2R83A 1P7HL 3BVVA 4JVUA 1NCIA 3WFCH 2E9BA 5G2NA 1V7MH 3SBPA 2JB5L 1JZ2A 4P0DA 2DZEA 3BPNB 3DJTA 3KW8A 3NIFB 5DJCA 1PZUB 3OAZH 1U8CB 4GH7B 3EJTA 5HJ3A 3WL9B 4J4PC 2IQ9H 5C70A 1YY9C 2DYRB 3J27A 3W57A 3HBQA 5TDPA 3FONB 2QFPA 4V2BA 1B6UA 1CWVA 1XIWC 2EVJA 5AVSB 4LL4A 4P3WA 4CNIB 4F57L 3OKNB 1CTNA 4FYQA 4O02L 4PG9A 4KHXL 2NW3A 3BT2L 3NCCB 5TFSH 1DO6A 1ZE3H 4PJ5D 3GSWB 3QA3A 1T66D 3MRLA 2JKWA 4N0YH 2V2TA 4R9HA 3FJTA 4FLOA 5D71H 1YYLH 3G9AB 2HPOA 4GUPB 3U46A 3OR7B 5GXBB 3ATAA 3SOTA 1HILB 1MWOA 3N0AA 3UZEC 5I30H 4UQBA 2P80D 4MZ2A 5MEOB 4Y4KA 2VDMB 1FSKB 5FYJH 4MCNA 1ULVA 4LLMB 3CG8A 3CSBA 3GFUA 3DSNB 3VJ6A 4PY8J 1CDJA 3NZUA 1UXWA 4LB8A 1I9EA 1WITA 2FBOJ 3D30A 4PJ7A 3QORA 3R8BB 2VH5H 1BAFL 2C3GA 1XGYL 4LSPH 5DC4B 3CBRA 1KLFB 3AREC 4R0LC 3MFFA 2HJLA 3GK8L 4L0YA 1HXMA 2BWQA 2CDFA 1XSKA 1TFHA 4WK4B 2PPCA 5DR5L 3L4TA 3VNZA 4PLJC 4HG4J 3ARYA 1Z6JT 4YSTA 2LU3A 1YN7B 5TE6H 4JAMB 1ZKAA 2A0LC 5C2BL 1ODUA 3AJ7A 3DSFH 3Q2LA 2VXSL 3QIUD 4QMEA 2XIIA 2Y3NA 4FFZH 5CF3A 5J11B 1C9SA 5AOIA 3BAJA 3C6LB 2X41A 2I26N 3AROA 4I4WA 5LCVH 2CUMA 1HX0A 1KJVA 1BBDH 2DWDA 3DJSA 1NC4B 4XN4A 5CP3H 1KB9J 4MJ5B 4HMEA 4GW5B 3AQYA 1L4IA 2IF7A 4BQ6A 3T2OA 5F71A 1Z9NA 2MH4A 2CCLA 1NUNB 2WVVA 2X4PB 3UERA 4AUYA 3QI9B 5D7KE 3EH2A 2CJTA 4Z8FH 4ICWA 2VLRD 4XCYA 4F7PB 4N2OA 5FX3A 4LSDA 1MFVA 1WWAX 4QRTB 2WBJC 1SDAB 2P8MB 5DZPA 2D73A 4YVNA 1OD9A 1OSEA 4AY0A 4PAZA 4JLRB 1JRHL 1YDPB 2DKMA 4FQLH 5CSBA 3Q7JA 1BA9A 2WTOA 4AQ8A 2QQKH 3IPEA 1ZVYA 3RVXC 3DX7B 3QZWG 3Q8FA 5LXGH 5IBLD 2CBMA 4GMSL 2J5WA 4JRYB 2EIMB 2W0FB 3ZDYE 3NJGA 3BPOC 2CLZA 3ARRA 2GK0B 2F6AA 2JVUA 3LPFA 3RYMA 2E75C 2A4CA 2J3SA 4HUMB 2RBLA 1HHHB 2D7OA 5A6MA 1V3KA 2P3YA 4PU2A 3T71A 4MA3A 2JCCF 5ETUB 5F3BB 2NY1B 2O61A 5LNEA 3CSYB 5KS9E 2D7MA 3RUGF 5CJ5A 2FIKB 2G9HA 2XXCB 3OLDA 2KUTA 1VAHA 3P4MB 1HHIA 1JRHH 3DOIA 1RMFH 4GG8B 1T1YB 1U58B 2DIJA 1YEKH 5ID0B 1H3PL 3ARFA 1RZIA 4ANWA 4MA1C 2FNBA 3QH3B 4W9GC 3VQMA 4QXTA 4QNPE 1V54B 4XAKD 3ZDXB 5I6LA 2NXYD 1BWMA 2RQEA 2AAVA 4EKJA 3KLLA 3DXAA 1BM3L 1ZLDA 3H4FA 4MD0B 4RGNC 3MRBB 1PZ2A 2LE9A 2C3HA 2F53E 5BRZD 4ELMA 3ARDD 2ETWA 1NBZB 2QL1A 2WKOF 4M3KB 5FYLE 3QEHB 3NEEA 1MREL 4XXDA 1HIML 2PTUA 3D85A 3QDMB 3TX4A 1YMHB 4LVHC 4Q9RH 1A6VL 1JHLL 4WJ5A 9PCYA 4NKOA 5DZVA 1U8LB 1XFPA 4YDVA 5HDBB 5TF0A 3H9HA 4QI3A 3FT0A 4K3GA 2G3ZA 4O4YH 4X4ME 5FM5M 4AV4A 1T21B 3VI3B 2QHRL 4HH9A 4KJWD 5IMMB 1UUNA 3N9GL 1S9KC 3QDJB 2DQHL 3QZOA 4MMXC 4CW1B 1VKXB 1DEEB 2X9XA 3STLA 2EDQA 1JK9B 2XWTB 4XZUA 4PRDA 2UWEE 1A1OB 4A1RA 5E8EB 3GSVB 2R0LH 3US9A 4BZ1H 2AW2A 3D7PA 3OJMB 1D2OA 4X2UA 3UABA 4JFHE 1VFBB 4O2CA 1T7WA 3QO0A 1S7WB 4OAWB 3QFJD 4OJYA 3GKWL 3UPRA 3VI4B 4K7PX 4ORGA 1A21A 1YEFH 3LXAA 2FJGB 2WHVA 1NUFA 4EIZC 4WKXA 5D1QB 5IEHA 3H6JA 5T1LD 4UNVA 5HGBB 2OPCA 2DQIH 2QDVA 4XPAL 1RUKL 4W6WB 4Q2ZB 1D9KB 1TTCA 3O4LB 4GAJH 2WUBL 3V10A 2VZ1A 5LBGA 2NNRA 4KGJA 4DETA 3PUUA 4O2FB 3ASOB 3PV6A 2QPUA 2H2PD 4H8UA 5DD0L 5CUSL 2AK1L 1E4HA 1MELA 5D1ZB 43CAA 2O6EA 1KTLA 2QQQA 2YGPA 5DHYA 1GMIA 1BF8A 4U3SB 2AXJA 2DMBA 1JDCA 2WIIB 3VGAC 4JFOA 1FO0L 1T83C 4K3HA 5DHVH 1QPKA 1SEQL 2H47C 3EYUH 3CXDH 4GRWH 4PIBA 2VLRB 4S1RL 2H2SD 5FO9A 5KSBA 3FUMA 3RX8A 4AC2A 1JPFB 2CO6B 2B4CL 3IDUA 4H8VA 3RLSA 4EQ2A 1P7KA 4XVJH 2X42A 1CFNB 4KO7A 4QRRA 3EFOA 4Q0XH 3ZZQA 5FR3A 2VDNH 4HQQH 2XLLA 4A66A 4P2OA 2PO6B 1BOGA 1CFSA 2X0VA 4ZTPH 1Z5YD 3EYSL 1LLAA 1DYZA 4Z95L 3QJFA 5TDNB 1OHZA 2VLRE 3VGBA 3VDAA 1PLAA 5JMOC 2C3XA 4WEMB 4YFLF 1N6UA 2XUWA 3B9KC 2TRYA 1IEHA 5IJVA 2P8MA 1KCUL 1Y6NR 1GGBL 2A6DB 3NZSA 4I5BA 4HH8A 4PJAF 3DO7B 2ATPB 4YUEL 4JFZH 1CE6B 3D0LA 3D39D 1TZIB 2IG2L 1CGTA 1ORQA 4L29A 4TSBL 4AYFB 5GGRY 2PABA 5I2IA 2YUWA 3HW7A 1BZEA 4QTHB 4J3OH 1E9QA 1N0XH 2EQDA 2W60A 5E7FA 3LDBB 5ANHA 4YPJA 1LK2A 4ZK8A 1ZD6A 2AZAA 2OZNA 4PJBB 3GBNL 3FQNA 3I6SA 4AIZB 1EJ6A 1A7NH 5CCKH 3V9FA 4XPGL 2RGSA 4EQ3A 1AGFB 1T0OA 1IGFL 4N6RA 3QJHA 5F44A 3P4MA 1EWHA 1TIUA 2AABH 2CHNA 1SMDA 4R3SB 4X50A 5E6RB 2E56A 2J1ZA 2C9AA 4LHUG 2HTLD 2BVUA 2VR7A 4PUBL 2RCSL 3HLKA 2VLLB 4IMKA 2O5ZL 1VLXA 4KKQA 3WJJA 3OLIA 4J3OC 4DEPC 4KOBA 1VFOA 1VA9A 4HWBH 2A9NH 2QV4A 5HVHC 3M45A 4M6ML 5GZOA 4XBEH 4F37F 4APXB 2VC2H 2XPGB 2D31B 1Z9SA 1JVOA 2YKKA 2H1LM 3UP1A 5DS8A 1TTGA 4IU2A 2ESVB 2WWKO 5DJAB 2G5RA 1WE5A 2DQMA 1EFQA 1LVEA 3DX8A 2WYTA 3OHMB 1GHFL 3KW7A 5EU6B 2PR4L 2VW4A 2Q0ZX 4POYA 3U7AA 3CFDA 4LIQL 4YX2H 4J39A 1SOKA 5FO7A 1MZZA 1HHGB 1ZS8A 3CJJA 3CIAA 3LZNA 2V7NB 3OL2A 4UT6L 4Y5YC 2HVKA 1YMME 4RFEB 3T2NH 4Z7NB 4Y2NA 2UVEA 2BNUB 3RA7L 3RRQA 1KY6A 5GS2D 3IU3B 1P1ZA 2WBXA 1QFWH 3G3LA 5DJCB 1UTDA 2OFQA 1VRSA 2HT2D 3BWUF 3L95A 1CDIA 5KJ7E 4XNMB 3WE6B 2AP2A 4NN6B 3FUIA 5I5JA 1RURH 1AMYA 4Z3GA 1ZCRA 5D7JA 3ZTNL 1AQKH 4OD1L 2AK4D 3R0MA 5C0AE 3HZ3A 1QYGL 4ELDA 1HE7A 1HL9A 4GSRA 4LLMA 4ERSH 1R3HB 5BCAA 4JMXA 4ODWA 4RGND 3FFDA 3B7SA 5DMKA 5CFAA 1XDTT 1BQKA 1KN2H 3A47A 1AE6L 4H44C 3SD5A 3NEOA 1KIQB 3CUPB 4LDLB 1QBMH 2V5RA 2NCMA 2FQFA 3AABA 1XR9B 2WNWA 5JLZA 4U1HA 3MUGA 3C60D 4JUTA 4P2OC 1EJOL 4M6AA 1SOQA 2Y7QB 1DFXA 1RLWA 4G42A 1G87A 2LQRA 5L2KA 3DROA 1TF4A 2D2OA 4ZMVA 2X2JA 3V8OA 3L4VA 1UM4L 1SJEA 5EU3B 3GMRB 3TTSA 1UM5L 3CSGA 4TUOB 1SY6L 3IJEB 5K9KB 1PNCA 4M4PA 3O3BB 5JHLL 1NCCL 4HX1B 3LHPH 4OTXH 4HK0A 1MPAL 3D9AL 2A74B 3N85H 2Q7NA 1N4XL 3BT0A 5IFJB 1EJOH 1XL4A 3FN0H 1ZIAA 3F6JA 1U2YA 5KSAC 4P4KB 5EV7A 5L9DL 1U95A 1RJZB 5JIQA 1SZNA 4PGEB 3OSVA 5D1ZD 1GW0A 3AACA 2OR8A 3MYJB 4UMSA 3C5ZC 1NJ9B 1OZUA 2HH0H 2X70B 5LGHL 1D5BB 4AK2A 5CBAB 5HJGA 4DGVL 4BCYA 2ZOUA 1PJ9A 2NY6B 4NRYB 1S3KH 5B1JA 3ECQA 1MPAH 1P4BL 3GLAA 1NCDH 5F0MB 6PAZA 1UOLA 5TQ2L 3IGUA 1JNHA 4MA3B 2O61B 5D4HA 1BOGB 1BYPA 1CFSB 1KEML 2IAMB 3MV9D 3RJQB 2BRQA 3KYKL 4OJCA 1UB6A 2JV6A 1V55B 2FJSA 1AIFB 3UDWA 4JKPL 3GHPA 2M83A 1PZDA 1J5HA 4HOMA 4ILDA 3VSVA 1DQTA 4JFSA 4HJGA 4OJFH 3OG6B 5EZOL 3DHMA 2KHAA 4X0NA 4PJ9C 5K93A 3UYRH 2OMZB 3EJSA 1SUJA 2ZUUA 5DK2B 1U3HC 1WAAA 2BZDA 2VZUA 1Y1DA 2Y1ZA 3FW6A 4OM0H 4Y2OA 5B38B 4LO9A 3VA6A 1YEHH 1E30A 4JM2F 3SKMA 4ZX6A 5L2KD 3T2QA 3W0WE 4CC4C 4JL2A 3UP6A 2QHLA 3PPSA 1GVIA 5EF0A 4KROB 3MJ9L 2CIKB 1FZJB 1JTPA 4L8SC 5FA3B 4C59B 4S2SA 3MBED 1BVOA 5FFOA 3WIFA 5LN4A 2Y7NA 3U1SH 2BVEA 3GEFA 1LE5A 4ETQB 2OSLA 3LY6A 3PE9A 4BFIB 4G80A 4FG2A 4R5TA 3RI5K 1K8IB 5MEQB 2UX6A 3HPJA 3ZZSA 4YDMA 4ZUUA 4PG9B 2HG0A 1TG8A 5DYOA 5F1NB 3KHOA 1GSKA 2Y23A 4OLXH 4CL7A 1NWOA 2AFNA 2YLHA 5KBPA 3CHRA 2R29H 4X4ZA 4NQEE 5CEZH 4X6DF 4NN6C 1UJ3B 1Q0EA 4I1PA 4ZD3L 4ZO6A 3CFDB 2XVKA 1MJ8H 4AYMC 4J27A 5DEGA 4ZAKD 2QGCA 1KCKA 5BZDA 3N42B 1ZLEA 1RHHA 1RQ5A 4WUKH 1TQCB 2WQ8A 5FGRA 5IVZB 3EBAA 4PJGA 3LRGA 1QRKA 2DQGH 2NTFA 1N6QH 2FEJA 4XODA 2P49B 4WTZG 5CKAA 5HP5A 3JWDH 1KBWA 1OGTB 3O41A 5HGBA 4F2MA 4RA0C 5DJAA 2C1PB 3BKJL 1B88A 3FFCA 4ESKA 4YS4A 2WY3B 2HLEB 4GFTB 3OKLA 2XFXA 1JCVA 1OAYL 2DQFB 1MHHA 3IFNH 4MJIE 4N1EA 2GT9B 1A8ZA 1VGKA 4LEXL 3VXOB 3WHXB 1WHPA 3NH7L 2C4FT 2GIXA 5C0NC 4QHKJ 3Q06A 2F2HA 3D33A 5ADPL 3C6SA 4WENB 3NFPB 2GJJA 3UC2A 1NFDB 3RKDD 3DSFL 5AW1B 4BCZA 4NHUA 1DVFC 2YO3A 1NC4D 1GJUA 1AG0A 1GSMA 2WBJD 3RWGA 3F12B 4OGQC 4CC4A 1D5ZA 2GPZA 1SJEB 4O2FA 2ENPA 5C08E 4JG0L 3AWGA 1PKOA 3ULUF 2AV1B 4XAWL 4FI7A 4ISVA 2J56A 1T4WA 4JCMA 3MGOB 1TTUA 3OAYH 4LEXH 4Z7NE 2R69H 5DJ2B 4U1HB 4DNLA 5HHMB 1NA8A 4I1NB 3CVCA 4W70A 2VABA 1ZHKB 5IHLB 5EU6E 1IQDA 4RFNC 5EF3A 5E6ID 5C0CA 3CFEA 1CDUA 2R1YB 3DJ9A 3IB4A 3W56A 3X11A 3HAEH 1PLCA 3BVDB 3D39A 3OBAA 5C9JB 2BVOA 3ZMNA 5JORA 1DJHA 1AJ7L 3QI9A 3KM1A 3OX8B 1UT2A 2C1OA 1YN6B 4PJ9A 5IM7B 4Y19E 4PRPE 4YHIB 1SYVA 1UH2A 5C0ND 1QX1A 2OYPA 5EUOB 4YDJA 3T0VA 2YGNA 2MRYA 2W91A 5CIPA 4F33A 3QJFB 5TDNA 1MCWM 3QFJA 4DP5X 5CJQL 3QJSB 4R97B 4CUCA 1U58A 1CGYA 3L4XA 3NT0A 5FFLA 4Y2LA 2OYLA 1T1WB 3KYMB 1CXLA 2GCYB 3BRDA 1XR8B 3VYOA 2WANA 1UACL 3SIKA 5GGSA 4ZFOB 3ARGD 3C8KB 3K1KC 4IBYA 4GRLD 1HNFA 3NCJH 3HOGA 3EFDL 3MZTA 3G5YB 3NA4A 3OJDA 4NN7C 4HIEB 1CICA 2D8KA 4WZ9A 4OIFA 2QR0B 1BX2A 1I3GL 3IRCA 2F15A 4KQ3H 4XNUL 3UFIA 1AAJA 3X14A 4E5XB 1FJ1B 5J6GA 4KJWC 3NSXA 5E4AA 1MOEA 4HWUA 3SGKC 4OM1L 5KANG 1OF2A 2EYRB 1EXUA 3OXRA 3RBSA 5CD3A 2UVFA 2DLTA 2QR0A 1WVZA 1WZ1L 1LWRA 2MQ0A 3FTVA 4L37B 4P04A 4W6XB 4X4YB 4L2LA 2L8AA 3A6BH 2Y5EA 3UCRA 1Z2KA 2X4SA 4HXBH 3L48A 1N70A 1DEEA 1RD6A 1OP5K 4W9HC 2I60H 3N44F 4LDEB 1NKGA 5ABAA 5D1QC 3QYCA 3D25A 2J25A 1VEMA 1A1OA 3TVMA 2V5MA 2EXYD 2OZ4H 2Z93A 4KXZI 4P05A 5JMRA 1QRNE 4KK5C 4LNRB 4PCSA 2FX8H 5I1DB 1DBJL 2IDUA 3MBEB 1JGVH 3EADA 1K6QL 35C8L 2J8UF 3LKQB 1RIHL 3LB6C 1DJXA 1W16A 3ZE0E 5E2UH 1SXBA 4HH9B 1YPZA 4LCCB 4PS8A 4ETYA 2ZUSA 2GITB 1I8UA 5HVWA 4QXGH 3BFQG 5L0QC 2QT6A 5ESAB 3EYVA 3ISWA 4J6RL 1MQ8A 2I60L 4W9LC 5KYUA 8PAZA 3SPHA 4NO2B 3F01A 4KKLD 3UG4A 1OGTA 3O41B 1URLA 5AKVA 4L4TE 1C16A 2AJ3B 4U1NA 1P2CB 2ZIDA 5IMLA 4B6ZA 2EDHA 2H1PH 4LSRL 3W9EA 3TN0B 1QG3A 1M6OA 1RIHH 4AXWA 3LRHA 1B0WA 3QWOB 1DJWA 1DVQA 2XQ0A 1MCNA 1P9MC 4Z7OB 4TSCL 4UT9L 1MFAL 4L9DA 5F6HI 2X4NA 3ILEA 5ILTL 2QKIC 3UTSD 4B50A 4L5FE 4O58L 2JCCE 1HOCB 1P7KB 1DQDL 3H2QA 1I9IL 3F7VB 2VN4A 3HFMH 2JMRA 4CVUA 4YOKA 2VLJA 3WN6A 3G08B 3O3BA 4JAMA 2J5LB 1DSWA 2C9RA 5AVYB 1I7RA 4UTAA 1WBXB 1XAKA 4GW1B 4WO4D 1P84K 4O4YL 3MUGB 4ONOA 3GSUA 3H55A 4BSWB 4G9FA 3CH1A 3CXHJ 3UC0H 4JY6A 3T4YB 2ITDB 4U1IA 3V9EA 2YBRB 5IEHB 2DV6A 3BGMB 3EO1A 4TQHA 3ZVVA 4N8UA 1U4EA 5AB2A 1OT4A 4XO9A 3OPUA 4Z95H 2NT1A 3QJRB 1YEFL 4WNQB 1I9IH 2WJ5A 3A6OA 1PL3A 1TZIA 2Z0UA 3HJEA 4WI6A 1MLBB 4JDZB 5F9JB 3JWNG 3DWTA 4IRSD 5AUMA 4QHUA 3WCYA 3CTTA 4N5EC 1QAWA 2OXHA 1D2PA 2NT0A 4R4BA 3TWCH 2OI9C 3X1GA 4TSBH 4U05A 3WFEH 1T1ZB 5FGCB 3ARDB 1L5GA 4MKMA 1IILE 4N1CA 3TBVB 3N04A 2BY1A 1WEJL 1FZOB 2B5IC 4WI0A 3P4LA 4AZUA 4OF5A 1KJ2B 3MJGX 1X5LA 2JTYA 1ZLUH 5A2FA 1P6AB 3QJHB 4TULH 1OD7A 5EZIL 1G1YA 3PAVA 5KVDL 4YXKL 5SWQA 3NPSB 5I8EB 2BSRA 3IJYB 4TXVB 1NCTA 1HCZA 5E8OA 2VXUH 1FZMB 4Q9CA 1G1KA 3MXVH 3HE7C 4G7QB 2JTDA 3WY3A 4D3CL 4EDWH 5C9JA 3SO3C 4WV1C 1HH9B 2WPGA 1KPVB 2VZ3A 4HMDA 1KPRA 2FH6A 4ZMLA 1JTOA 5IM7A 3HFFA 2BM3A 3UJTH 5C0JA 4OQTH 1CTOA 1U8HB 2VM4A 5M7QA 3L6FA 4JM2D 3TT3L 5EUOA 5EOCL 5I82A 5FWQA 5BOZG 4RZCB 3VXMB 4HWBL 5ITBL 5DQ9B 3PJSB 3RTQB 4PVBA 1YNKH 5DJ6A 3IVKB 3Q3GB 3WELA 3AREB 4XBGA 4W4OC 4U1LB 1S7SA 1M2VA 2F1EA 4JM4H 2FEEI 3O3AB 3VDCA 1EHNA 1AD0B 4ZMTA 3DGGA 1ETZB 4YQXL 5IMOA 4KRLB 1BXVA 1T0PB 5CEYB 4K3DL 5CZXD 5ICXB 4NPYB 4YDIH 2X2HA 3TT3H 2F8OA 3A4AA 1GGBH 3QWRA 2WXKA 5B39G 2OS7A 4TVPD 5I8OH 4BEIA 1KN4H 2C9UA 3ZSTA 4YSCA 5IMMA 1A4AA 4UIMB 1YEIH 2VMEA 1S7VA 4LGSB 3UC0L 2PYFA 3BN9C 4ETQA 4FZ8H 5AAWA 1GIGL 3V9CA 3T3PF 3W2DL 4H88L 3DDGA 1P9MA 2VERA 4KZCA 1CXHA 3S88L 3P40A 4NQCD 4HYTB 4ZUUB