2J1XA

Human p53 core domain mutant m133l-v203a-y220c-n239y-n268d
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Understanding Oncogenic P53 Mutations and Designing Rescue Drugs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
molecule keywords CELLULAR TUMOR ANTIGEN P53
total genus 49
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2j1xA00
1CO1A 5G4MA 2AHIA 3ZMEA 2FEJA 4KVPA 2XWCA 1KZYA 2J1YA 1GZHA 3IGKA 2X0VA 3WTYA 3QYNA 3Q06A 1UOLA 2IOMA 2J20A 5AOJA 3WU1A 3QYMA 5AOMA 1T4WA 2PCXA 2X0UA 4AGLA 1TUPA 3TS8A 3KMDA 1HJBC 4HJEA 2GEQA 4MZIA 5G4NA 1HU8A 5AOIA 4LOEA 2RMNA 2J6WA 2BIOA 2BIPA 4L0ZA 4IBZA 4G82A 1TSRA 3KZ8A 1EAQA 3D08A 5LGYA 5AB9A 1IO4C 3WTTA 3IGLA 2ATAA 5KBDA 4L18A 4LO9A 3D05A 4MZRA 4AGNA 1GZHC 4A63A 3VD1A 2BIQA 4L0YA 4IBQA 3EXLA 3VD2A 3Q01A 1YCSA 4IJTA 2J1ZA 5LAPA 2YBGA 2P52A 2J21A 2ADYA 4QO1B 4IBVA 2J1XA 1EAOA 2BINA 4IBYA 4XR8C 5AOLA 4GUQA 2IOIA 4G83A 5AOKA 3WTVA 4AGQA 3D06A 5ABAA 2VUKA 1EANA 3D07A 4IBSA 4GUOA 4AGOA 3US1A 5BUAA 3EXJA 1E50A 2OCJA 3D09A 4IBWA 1HJCA 1CMOA 4LOFA 3WTXA 2XWRA 4AGPA 1H9DA 3VD0A 5ECGA 3WTUA 3Q05A 2BIMA 3WTWA 2AC0A 4IBUA 2WGXA 5G4OA 3D0AA 2MEJB 2X0WA 3WTSA 2J1WA 2H1LM 4AGMA 5A7BA 2IOOA 1LJMA 4IBTA 3US0A
chains in the Genus database with same CATH superfamily
2OR9H 1UD5A 4GIPD 1SM3H 3VMOA 2YD4A 1Y6KR 2Y07H 2ZUWA 3LN9A 1VFUA 3U1SL 4BXSV 1W15A 2NR6D 4Q4EA 1MN4A 2IAMB 5AZUA 3PL6A 1UA6L 1S7SA 4P23A 1OT1A 3QCTL 3JVGA 1NAMA 1IILE 4PRDA 3NVQA 2EDOA 4F3FB 3QQ9C 5CMAA 3QYMA 2NNCA 3RY6C 1JCKA 4G6KL 3JYCA 4AGLA 2FZ3B 4PJIE 2BOCA 2YMTA 2XVGA 2WCPA 4WWNA 2ICWI 3PRZA 1HDMB 3I6KA 1UQSA 1URZA 5I15H 2J4WH 4GRLA 2HFFA 2YRBA 4XXWC 2GBVA 1QWHA 5IFAL 1X9LA 1ZHLA 4S0TD 5F3BB 4WO4D 3VYPA 4KRNA 2OXGA 3QEGH 3NCYP 4YFDB 2IAMD 1KENL 2R39A 2Y3AA 3PHSA 4PJ9C 4FTVE 4QY8B 4NQEE 3S3CB 4JM2C 4NM4L 1EHXA 3A47A 2ARJA 4NRYB 4RQQA 2WXNA 5B8CA 4P5TC 3RX7A 1W16A 3FUNA 4F9LC 4NT6A 2ATKA 5J06A 2PWHA 3MLSL 5D70L 3VDCA 1H3VA 2PO6B 3S35L 2FDBP 2YD7A 4J3OH 2DKMA 1B88A 2J8UF 1DBAL 4MZRA 3FQTA 3RX5A 3PWJB 1YNKL 4L8CA 5CBEA 5ERWA 4AQAA 4ENED 3GMOA 1FYTD 2IWFA 1JVLA 1WFNA 3D12B 3FXIC 4JZJA 4L2LA 5CEZH 5ITFB 4Y2DC 1LK3H 1FIGL 1DFBH 1MDTA 3AADB 5IIEA 1YZZA 2B0SL 5DD5H 1F4WL 4L8BB 4MYWB 1SBBA 2OJZH 3FQUA 4EXKA 1YUKB 5DQDH 1RPKA 5DZJA 2ADGA 3RWCB 3VWJC 4L4VA 4OD3L 4WI8A 5F0PB 1RK0A 4KY2A 3L3IA 3WO4C 2HFTA 2QQKH 4LVOC 4MJ4A 1BMZA 1G7PA 4ODBD 4M48L 3MRFB 3ZQXA 3GMNB 3RLSA 3RVWD 4DEPB 1VADA 5I2IB 5FGBC 5SWZA 4G3YL 1U8KA 2DQFB 2ICEA 1HWHB 2X4PA 1E9QA 2MCPH 2ZWYA 3MLTB 1NKRA 4Y2OB 1INDH 1S4IA 1N8OE 3N1MC 1NFDE 3HZYA 4DEPC 2L3BA 4G43A 5FA4A 4LOFA 1QUNA 1IEBA 2WBJC 1DR9A 2AC0A 1MCOL 2AJXH 2PLTA 2NZ9C 4YWGL 1JNNL 2N1TE 4RGNB 4F9PA 4GSXA 2X0WA 4HZ1A 1NCTA 2WYHA 1MCLA 3MCKA 3QRGH 1MF2L 2X4NA 2FH8A 3DX9A 4NYLA 1UG9A 1ZIBA 2DQIL 2AQQA 3B7TA 3OKDA 4U3HA 1CQKA 1PNDA 1R5WA 3HNTH 3FUFA 2WZ0A 4J6RL 1A6VH 2JKJA 3NJNA 4IS6B 1QFHA 3WIIH 2Q87A 1FL5A 2G2RA 3D69A 2Q76B 3VNYA 4AG4H 4YL9A 3QDJA 1E7UA 1YYML 1HH6B 5FYJU 6PAZA 2E0PA 4LSPH 5DS1A 1PZAA 2CR0A 1IAII 4OFIA 4H8WC 2FB4H 1R9FA 4YDIH 1A9EB 1NCJA 2PW2A 4MWFA 3Q2LA 2GTZB 1FYHB 2YKKA 1KN4L 4NQQA 3MRRA 3F62A 1TLMA 4OZ4B 3VG0H 2P45B 3IE9A 2HB0A 1WTLA 2C9RA 1K5NB 5EC1B 3NBNA 3ZTNL 1B3JA 4N5EC 3U1PA 3GS7A 5AZ2H 2XN2A 2BFGA 5J7CC 4EE2A 5JORA 3F7VB 3X3FL 4W81A 2Y5EA 1NCDL 2NXYD 1QBAA 4GRWH 1UOWA 4X8JB 5EOTA 3O6LL 4MQXC 1RIUL 1KTLB 1F3JB 5F7WC 1JTTA 1QD0A 2V17H 3ZDZF 5HYJE 2MJWA 3VQ2C 2HRLA 5EN2B 4J7RA 3Q8EA 4J3SA 3TJHC 5F7YC 4MA7L 2DWTA 1EZVX 1HL8A 1FGVL 5JR1H 3T1WA 4N1CA 4Q52A 3FT0A 2MOQA 3K4AA 2JCWA 4JHUA 3VFVA 4ELME 2XA8L 2ZAIA 1RZ8B 2AQRA 4AXWB 3T8VA 3VM7A 1PD1A 2D3NA 1HAUA 4XVTH 4JPKH 4FLOA 1S7SB 4P23B 3HNVH 1JZDC 4OY9A 3RVTD 3KPRD 1CXLA 3AM8A 1S7TB 2YUXA 4LCCA 4EOWH 3IU3A 5DK0A 4E36A 6PCYA 4AEHL 2ADYA 1RZ7L 2BP8B 5DVNA 4NS0A 5K9KA 4M61A 3GLEA 5JOEA 3DI3B 1ZSDB 3ZDZB 3C60C 3Q1SH 1DUZA 2BNRE 2WTRB 1UT1A 2ZOUA 4C56D 1A3ZA 4ZDHA 5I1HL 2ESVB 1IGJB 1AC0A 2CIKB 2V17L 3BUIA 3LPPA 1JP5A 5GJTL 5AZEL 3C5ZC 3ZIMA 4BZ2L 5KJRH 2DN7A 3EJRA 4G6AC 3HE7D 4EJ1C 5C0BB 3RGVC 4H5SB 3WMQA 2YEQA 3HA0A 3V6OA 4KUZL 3VFSA 1OLLA 4HXBL 4EO5A 1RUQL 3TX4A 1U3HB 1F00I 3ZTNH 2AF2A 2R83A 2WXMA 2W38A 3MREB 1UWGL 1WZLA 3P9MA 2NTFB 3BO8A 4HFUH 2OK0H 1QR1B 1JG9A 5F7NC 1MCEA 4XPBH 5L8LB 2QADC 4U1KB 1KPUA 4BWTA 5IR1B 4PGEA 3VRJA 3F7YB 5H37G 4UUJA 1LEGB 5EIIG 4DGVH 4DVRL 2JWYA 5JW3H 4ZFZA 1BVKA 2BSTB 4XPHH 1BA9A 2YBRA 5DLLA 3P77B 1N2RA 3PQYE 2Y7QB 4GAGH 4GOSA 3APFA 4UQBA 3UTSE 3IGKA 5TE4H 2Z4TA 5JXEC 3BWUF 3KWXA 3ZKMD 4HULB 1DUYA 1U8JA 1JWSA 1E6JH 1M9SA 4O9HL 4WGVB 3L6FA 3QRGL 5D7SH 3N85H 3H8NA 4M4RB 2WPGA 5I2IA 1DJYA 3GS0A 3P69A 4P3WA 2YZ1A 3GPEA 1UKTA 3VWJD 1NAKL 5GS1C 5FFOA 1UJTA 2YPLE 1U36A 3LRSA 1M1XA 3ZHKA 2G4EA 1IVLA 1XZ0A 5E8NB 4OAWB 3WXWL 4J3WA 4FTDA 2NZ1A 1W0VB 4LCUB 5IHUH 2IADA 4F93B 1J5IA 5E6IC 1MVYA 1HZHL 1NLDL 2YEVB 1GOFA 4JY4A 2QPEB 4JG5A 2AKRB 4IYKA 2NQCA 5DJYA 3WS6C 1PLCA 3LEVH 3TPUA 1ZV2A 1VGKA 5HHMB 3ILQC 3FO2A 2F53A 2NT1A 4X6BB 1IO4C 4LVEA 2EJ1A 1YMHA 3QDME 5FK9B 4R5TA 1C8QA 3E8UH 4LK4A 4MXQD 5GGVY 4DK5A 2Z92A 4U1NB 5KUMA 2FIKB 3C60D 5HY9A 2DI9A 2VR7A 1FNEB 1A1NA 4MDJA 3L4TA 2OQJB 2BIQA 1G94A 4X4XA 3QHFH 2XCMC 3TYGL 3EAKA 2CH8A 1NCCH 3GJEA 5F7LB 4OI9A 3KR3H 1CDCA 2G3XA 3M86A 5C86A 1FSKC 2CLRB 3GMQB 4LZKA 2J1XA 1Z7JA 2AZAA 3WFEL 2EVHA 2B1HH 2W80C 4LSSH 2PTTA 3M46A 4AOFA 2ZE0A 3AXIA 1KY7A 2OMYA 4R8WL 2D0FA 4YX2L 2JB6A 3HN8A 5HGDA 4H25B 2FEEL 4Q0XH 2YGQA 5AYTA 3E80A 5K9OA 3WFEH 1PGRB 2OYMA 5BRZA 4XC1L 3DPBA 4M6OL 3L3KB 1FVEB 3UJJL 2AEPL 1KTDA 2B2XL 2DBJA 3FQRA 5AVZB 1RZJH 5EZJA 4X42A 5IMKB 3WJMB 1AO7E 5I17B 4TQIA 4LCWA 4K55A 4MHHG 3ARGD 4M62H 5TD4A 2DQGL 5DMJB 2DWXA 4MGXA 5DJDB 5DYFA 2WWNA 1AQDB 2DKUA 2OA9A 1QLEL 4FZEH 2AXGA 3VFTA 1T7ZA 9CGTA 5JTWA 3SE8H 3KM2A 4WFEE 1MCIA 1PKOA 1QFUL 2X4OA 3F00A 4Y5YC 4PY8J 4KK5C 5B1AB 5ICUA 3TEXA 5C0IA 1JK8A 3VCLB 2ITFA 3C08L 2ZKHL 2WYZA 4EZLA 5K9KB 1AGFB 2JXMB 3L8QA 3PV6B 4NQSA 4YC2B 1E4KA 5DI8B 3V6ZA 4L4VB 4RQQB 1RUAL 1A8JH 1UWFA 3UAJD 5LJYH 3BPOC 5PCYA 1QQDA 5AVRB 3U4EB 4XO4A 3U9UB 2IQAA 2XSKA 5B39G 1Q0YL 5HDRA 4CVXA 3J2PA 4NQEA 1S8DB 4NO3A 2B4CC 3QUXD 4CU8A 5H2BB 4KTGA 1O6SA 4IIQA 4BQ8A 2X42A 3VX0A 1XEDA 2DLFL 2ROYA 4LU5H 2RQ8A 3NH7H 2VDLH 2GT9A 3BIBX 4L0ZA 2R4RH 5KOMC 4DGUA 3BMVA 5I5JA 5GS2H 5GZOD 3ZK0A 5FV2A 1JXDA 3C2AH 4JHWH 1G7JB 1OHZA 3WNLA 2HVBA 2AK4D 2VO8A 3DETC 2EVIA 2FATH 3OGOE 5ABZA 1ONQB 4X0NA 2WXFA 3WIFA 1KMGA 5IB1B 5E2WH 5AW4B 2R2BA 3JZ7A 5DQJA 4L37A 4MXVE 2VZUA 4OIFA 4XMXA 3RVVC 5D7KE 5FWQA 2VZ3A 1A65A 2PTVA 3BMWA 4OM1H 5DVPA 3VFSB 5F9AC 5D6CB 2I5YH 4KAQL 3QO1A 3CPUA 5B39B 2JQAA 3CXDH 1KXQE 2PW2B 3H3BC 4LQFH 4QTIL 4OQ1A 5GSRB 5DRZB 5DC4B 5C8JB 3FQNB 3V4VH 1RP9A 3V52L 2AQ3A 1AGBA 3HCVA 5CGTA 3ARQA 3C6EA 2PW1A 4LSDA 4KZEH 2L04A 4PFEA 5A2FA 2CR6A 3MHZA 2NY1C 3MFFA 4ATWA 1I4FA 5E8NA 3OXSA 4AGOA 1GMEA 1QMUA 3AITA 5FGCB 1M71A 3BPCA 1T0MA 3MGTB 4IEFB 5HHVL 4PJXB 3MRIB 4XMKL 5KTEH 5J13B 1BZ9A 4DNLA 1RVFL 5L4IA 4EN3A 4LLYA 3BUTA 4U1LB 2DWEA 1VRSA 1M56B 1TTGA 3JTTA 3CQQA 1ACCA 1MFMA 1X4ZA 3RHWF 2XG4B 5FHBL 3QEQA 2X7LB 5G4OA 3P9LA 1IX2A 1G9ML 1U8LB 1W72L 4FYTA 1GYWA 3QIBB 4YAQB 5HI5C 1H6TA 4M7ZB 3GSNH 3VFRB 4R4FL 4XWGH 5DWPA 2XZCH 3SYAA 3EH4B 1G7MB 5DC0A 5DUML 1ZSHA 5HGBB 5EWIL 3DGCR 1JDAA 5E00B 1XSKA 3N44F 3ULUE 3ABMB 2LAGB 5I30H 3I9IA 3X1NA 5LG6A 5GPRA 4HXAL 4OFKA 3VI4E 2AP2A 4NO2B 4JG9A 3EHBD 4GS7C 2M1KA 1J87A 3VXPA 2WSDA 4DGVL 3BRGC 3BUYA 1JF1B 4E41E 1CL7I 1NBCA 3FRUB 4U3CA 2Z91A 5AUMA 3ZUNC 4J4PC 4HUCA 4PJ5B 5E2WL 2E59A 4PP2A 2BP0B 2C4FU 3WUWA 1BVOA 2XUWA 1R3KA 2C3VB 4LSPL 4S0HA 3HE6B 4APQA 4HWEH 4K5OA 1RUQH 1SEQH 3W5NA 5IBLD 4MYPA 3J27A 1IC4L 2CM5A 3MA9H 4MJ5A 5DJZA 2JJTC 5DZAA 3PS6A 1S5IH 4FXGC 4KFMA 3V5KA 3BEVA 1K4DA 4FLSA 4ALAC 5EWIH 3S4SA 3V0GA 4F8PA 2OMYB 5JMRA 2N56A 2EVJA 1VKXB 1R33A 1WQVT 3F7PC 2F5BH 4A55A 3N42F 4CSSA 1J0KA 4PVNA 5JPNB 1IZJA 5GGUB 1JFQL 3KJ4B 3M6DA 3QPKA 2Y7QA 4YSTA 1F1DA 1EAPB 1MJ7H 3EXLA 1LM8V 2EC9T 5LAXA 4A2MA 2XQYG 3GRWA 4Y19D 2VC2L 2BFVH 4WSKA 4TV3A 5KS9F 1KULA 3CSFA 3RUGE 3NRFA 1Q9WA 2L0DA 3V2AR 2Z8SA 3KHOA 1YPZF 3VD4A 2AI0H 1SLVA 3QO0A 4FG6C 1MHPL 5FYKH 2J57A 5AAMC 4R4NC 2IQ9L 3D07A 1IBBA 3W9EB 3EBGA 4I87A 5BUAA 4IU3B 4Y16C 1CZ8H 1JHKL 1GOGA 1PLGL 4C4BA 4M7LH 2B0SH 1JNJA 2A77H 2HJFA 2J25A 3LKSB 5ECGA 3CNKA 4JGUA 1JGVL 2WXLA 3HG1E 3U4AA 3JZYA 2B59B 5EU5B 3WNIA 1OOWA 3T0BA 4HMEA 5C0DA 4CUCA 1A4JA 2Z0BA 3C6SB 4W9CC 5DI8A 3SDDC 5AG8A 3BEWA 3ALWA 3FHAA 4ZMQA 1EHAA 1HOCB 1GHFL 2VLLA 1HL4A 4TNEA 3VFGH 4L4TB 3JQOB 4AQ1C 4KTEL 3GBNH 1F6FB 3MROA 2FUQA 4XNDA 5AOZA 3B1UA 3A6CH 5EIVA 1J0IA 4OGQC 2X9ZA 2NYYC 3QZWG 3T8MA 1BXVA 4DKFL 4FQPA 3L4XA 3MPCA 1ROCA 4OGYL 5AKVA 3L1GA 3HG1A 4NJAL 5HGHB 2X88A 3O2WL 4JHWL 3IB4A 5JYLA 2FR4A 2VL5B 3NZSA 2QSCH 5IHBA 3MKGA 3U79A 1OP4A 3GMLA 2BOLA 4RESB 4PY7B 1XHHA 4ADGA 2R7EB 1ZPUA 1BZQK 3Q5TA 4O02A 2WV3A 2JIXD 4WWKD 4M3HA 4MJIA 5IUCA 3CIQA 2NUPB 2WJ7A 3FJTA 4AUUA 2F53E 3G5YA 1HN1A 1ZHNB 4OUUB 1CG9A 3E8UL 4KXBA 2OQJA 4PR5B 4G42B 4R4BB 1NPUA 1PZDA 3CVHH 2OTWA 2YD2A 4I3GA 2XQYA 5BS0A 1D9KB 2W65B 4ERSH 1ZTMA 2CLVA 2HTKD 2XC8A 4KFZC 3UTQA 1MFBH 1V3LA 1Z9NA 1FAIH 2WBJB 4UT6A 3SGEH 2EILB 3BPLC 2WZAA 4DEUA 2OKMA 4PJAE 4YHML 5I71C 1DSFL 4PTUB 5CLXA 1QTYT 1XTMA 2AXGB 2XV2A 5I6KA 2Q10A 2YUWA 1HCFX 1M1SA 5I18L 1T5KA 2CIIA 1D5MB 3OZLA 4K94C 1RIVH 4O58L 4P2OD 5IBUB 5BVJB 4U4IA 5DT1L 1XF4A 3UC2A 2F15A 4G9DB 1CT8B 1DVTA 4FXKA 4Z8FH 1LEIA 4HYTB 1LK3L 2FJHA 1KFAL 5IFHL 2YQ3A 3L3KA 5HDOA 1I7UB 2H0PA 3ECBB 1DLFH 4FC3E 4PEEA 2GYSA 4WWPA 5EUOB 3DRQA 3GSRB 4MTMA 3ZN6A 3TO4C 2Y72A 4V2CB 3QORB 3OKNA 2MPAL 1G6VK 3O41A 4PP2B 4YBLC 5I16A 4JY6B 4OAWA 4YPGB 1W0WB 2BCKB 1JGDB 5LB1A 3CGTA 1OGSA 3MRKB 2CZNA 3UYPA 1KGCD 1AP2B 1EFXD 2Q9OA 2LFEA 3OMAB 3WTXA 5A6MA 4Q6IB 3IDNB 4KRLB 3PLYA 3TOPA 2R59A 2DQCL 3L3JA 4WJ5B 3IBOA 2B1HL 2BSRB 1NEZA 4UT9L 2FWSA 5F6IB 4JRXD 1UCBL 3MRJA 3LV3B 3EZ8A 5LN4A 2IBZY 3UCQA 3RGVA 4ZQTA 4LARH 1JBJA 4F27A 4NO0A 4G6KH 1YEGH 1RJYB 2D3LA 3T6ZA 2CLZB 2OMTB 2AZUA 2KQMA 1E5AA 4NN5B 4OZFH 2XWCA 1KXVC 5T3ZD 2VB5A 2QTVA 5E94B 1PEZA 1X44A 1XCQA 3CSYA 4HPYL 3OJMB 2W1NA 3OSKA 5FIEA 5TFSH 1X4YA 1I8KB 1E9OB 3QXAA 1TTRA 4NC1C 4Z7QF 4F5CA 3PJLA 4OUOA 1VAHA 2JJWA 2UXFA 4ONGH 2Y06H 4NT6B 3LSOA 2K1MA 4HUXA 3KDPB 4POZD 5CLYA 1YNTA 4KTYA 4TNWF 4BKSC 3O6KH 1K4CA 3O6FB 2QPDB 3FHQA 1CFQA 1AZUA 2FH6A 4N68A 5E4AA 3PAZA 2WNXA 1NM4A 3C60B 4TRPH 5T3ZL 4C83A 1IARB 2QVTA 3O6FC 2ENJA 4PYGA 5IB1A 2P28B 5ESVA 3M7FB 2NPLX 2VSCA 5BRZB 2HJFB 5C0CE 3BHBB 3AU1B 4PRPE 4FMKA 5HYFA 4P5KB 4TMPA 3QI9A 1KFGA 1BX2B 1W80A 2OBGA 5HP5A 1BXAA 2APXA 4JN2B 2WSPA 1AIZA 3D08A 3D3VE 4XCEB 1XCTA 4GG6F 5EDXA 2P5PA 1X7QA 3QHTC 5HHME 5HHOA 5D71H 3BUPA 4BGLA 1S9YA 1OK8A 3OTTA 3EO0B 4FS0A 1IBYA 4JREC 3PXLA 3TCLA 3HC3H 1F4XH 1DFXA 1UURA 1XSOA 5AW7B 2NZIA 3CSTA 5F0JB 2PUQT 1KPRB 2IF7A 3DOSB 1AGEA 3OZ9L 4R97B 2Q20A 2CO1A 4A37A 2GIXA 1YQVL 3BUBA 4OLEA 2CBQA 2EYTA 2ID5A 3H85A 5D1ZC 4HKBB 3DETD 5IHLB 2C3HA 4C56B 2QVIA 1I8MB 2VXVH 1NIFA 1WFMA 3T3PF 4AKQA 3V9CA 2B59A 3SY6A 1FNSL 3SE4A 4LBEB 1KWGA 1NJ9B 2VMJA 2C9PA 2AXFA 3BVWA 3RX9A 1CG9B 5DJXB 5KOVC 4JKKA 4M5SA 3PGCB 3LEXA 5D2LA 4GAAA 4X7FC 4PW9A 1IC0A 3UZQB 2DLFH 3FH8A 3G5WA 5GSVA 3EYVB 2JSFA 3VMPA 3A4AA 5J1AB 4ELMF 4PJGF 1K5WA 5FYLE 2LLGA 4XTRD 4ZQKA 4X4YA 2ZP8A 3QNZA 1J0ZA 1H5BC 1AXTH 1NMAL 4PJCB 3HNVL 2CHWA 1H8LA 2IGFH 4OIIH 1NM9A 1P7KA 1IC5H 4G6JH 2GJ6B 3FAWA 3QNXA 1TENA 1I1AD 3THML 2WN3A 2DEYX 1NC4D 4P2YA 5EC2B 1J0JA 2X6BA 1CTMA 3LIZL 4LCVA 2P1YA 1F2QA 1YN6B 3FTVA 3WGUB 3KW8A 3ECBA 5DC2A 5HHXL 4Q7DA 4QJ5B 3ZW3A 3HE6A 2VTFA 1U42A 4NN6B 4XGZB 3ESNA 5AD0B 1YEKL 4G5ZH 3AT9A 3VFMB 4PCSA 3HMWL 3MV8B 1L5GB 3WEMA 3VXTB 5SWSB 3DLQR 3SOBL 4NP4L 4Q9CA 4APQD 4M8QA 4PG9A 1GH7A 3S5ZA 1WZ1H 4MJHA 2VDQB 3K72B 3UTOA 3MV7E 5AZ2L 3CXHJ 4YGVB 5C09B 4L3ED 4IU3A 3D33A 3LEYH 1U91B 2XTJD 4YE0A 1THCA 2BIOA 1MAML 2J88H 3STBA 1V7NL 3I75B 3SDCC 3NDYE 3NUKA 1TMCB 2AFNA 3MRHB 3T0EA 2I07A 1G5AA 3GBML 3JV5A 3GUTA 4HUUB 5IHWA 4KQ3H 4OLZL 1AG6A 1Z9SA 4ODHL 3DGGB 4ES9A 3EH5B 3ARTA 3IMVA 3QUZD 3OAYH 3LQZA 4N2LA 4L4TA 4YHLH 5FO9A 1OE3A 4PJGE 4ZT1A 3BP4A 4AL8H 3JT2A 4NUJB 4N90D 2V2XA 1QTSA 4Z0XA 1S7QA 3V7MA 3IYLW 4Z78B 2BS71 2P5WE 2VDLL 4KXCA 5C08A 1W0WA 4F8TA 5K9QG 3V6OE 4JM4L 2WLHA 2BERA 4KXAA 4QRSB 1VPOL 1HINL 3H9SB 4E9RA 1XF3B 5HGHA 5KVGH 2HKAA 2WLZA 2UZIL 2WQSA 3UAEA 4FQJL 3SGDI 3IPBA 4F33A 1BEYH 3HBPA 3V4PL 5D7JB 4AK1A 4MB1A 4KKZA 1MW2A 4NKDA 1TPXB 1YAZA 2ZSVB 1O9ZA 1QO3A 3BPOB 3E1F1 3DVGA 1ZTXH 5ESVB 1RJYA 1X9UA 2JKXA 1TITA 2H0JA 2X6CA 4GAJL 3E3QC 3UBXA 3NCJL 4JDEB 3DVIA 4G42A 4HCRH 2C34A 3L3GA 5LBVA 1B4JH 2W0KA 4BSWA 1ZWIB 4OD3H 1TCMA 1U8PB 1DQQA 5DQDL 4JO4H 3RUGB 4JPQA 3U6XA 4PJEE 4MCNA 2FO4B 3CDGB 3QDJD 2ZG3A 3FBKA 4OQTA 2GJ6E 5F0LB 1V3MA 1YDPB 7PCYA 1SXAA 3FQTB 3UYRH 3RQ3A 1GVIA 4AVJA 1FJ1A 1P4IH 1XZ0B 5IVXF 3LX9A 3H3PH 4X98B 1Z0NA 2WQAA 4MQ7B 4FQQA 1HZLA 1NBZB 4CILA 4HMCA 2VLJB 1VCAA 3M8OH 1J9TA 3SKJL 4UQ2A 5GRWA 1LEIB 3MBWA 1HKFA 2HG0A 4EVNA 1HH9B 3RWGB 4F20A 1EHNA 4HIQA 2J44A 1MPAL 4RFNC 1FL6B 5D7EA 1Q9WB 1FORH 5K1JA 4FFYA 3WMSA 5JXEA 5JW4R 4MXWH 4LSRL 1BX2A 4NIKB 4YN3A 1XQ4A 4UYPA 2PXYC 2WAHA 3H1ZA 5EEUA 1X5XA 2HWZL 1F0LA 5IY5B 2MQ0A 1UVQB 3J7HA 1BJMA 5IREA 2L7EA 3ZVVA 1WIOA 4IKJA 3WIHA 2ENPA 1BBDL 3E9TA 3N04A 3DV4A 4JUSA 4OCMC 4L3FA 5HDBF 1OAQL 2ZX6A 3TYGH 1Q9OA 2AEIT 3FONB 4X5RA 5FUCE 2AEQL 3C2SA 2QQQA 3TGXA 4H7VA 1NEZB 4D3CH 5IVNA 2BW4A 3DKHA 3VFNB 1GA2A 5DMGC 5IW6B 1Y1DA 2B4CL 4ONOA 3QB7C 1BYOA 3SJVD 4Y4KA 3QCUH 5D72H 2IPTH 5E7FA 1ZGLA 5CJOH 1ZDQA 3QIWC 2XQYK 5TDNB 3CBJB 4ORGA 3W0WA 1N4XH 3BAJA 3O3AA 3OHXB 2MIZA 3F6IA 1QBLL 1ZT7B 4HH8A 1GJUA 3FCUB 4GXUN 4KKRA 2CGYA 3BOVA 3F7QA 3FT1A 1OCOB 1OSPL 5GISH 4IDLA 4APXB 2PYED 2WKLA 1J1PL 3GBLA 2AVFA 1A25A 1EEZA 4PGDB 3DYOA 1IMHC 4RGOL 4YEFA 2NQDA 1U8HA 4U1KA 1TVBB 3N06B 3TCXA 1NL0H 5FYKE 3FT2B 4JDVA 3AQDA 3DURA 4NBZB 1ZT1A 2UY6B 2XZQH 5ESQA 3QPQC 1UADC 1ZEAH 2IPUG 5JYMA 1EZVY 4K9JA 4S1DD 5L88H 4CAGA 4C8XA 4PUBH 1DVYA 2QJDA 3HI6H 3M17B 5EN2A 1NL0L 4IBUA 3GZPA 1KCSL 2I27N 4OFVA 1YECL 3TO4D 2Y5TA 4MS8C 5DJ6A 1T4KA 4Z7QB 1D5ZA 5D1QE 5CEZD 4CMHC 1DN0B 5B22A 4PLJC 1LJMA 2DDQL 3BP4B 2DQMA 4U1MA 2PO6D 4PRHB 1PKQB 5CGYD 1VHPA 2VR6A 2VO5A 2ZCKL 1KELL 3QNYA 1RSYA 3OB0H 1SDAB 5I19H 3DOSA 3GSOA 3HNSL 3MRQB 4HJSA 1L6PA 4BH8B 1LMIA 1S46A 5CWSA 5I1DB 4GP5B 1HL5A 1HHIA 4ICXA 3ZHNA 3DOIA 2I7OA 3KEHA 1OLZA 4FQXC 1JS4A 1BM3H 2XV6B 2ZKMX 4QTHA 3X1GA 3AU1A 5A2IH 1GPOL 3V0EA 1RUKH 5CN1A 1DVFC 3QI9B 2A0LC 4I85A 5FGBA 1YJDH 2GUOA 1IGYB 2UY7A 3CDCA 3EDEA 4X0KB 4Z7WA 5E95B 3ZDZE 3MLXL 4F91B 1KJ2B 1J86A 3OV6A 3BKML 4GINA 4RMSA 2WO2B 5DQJB 3T3MB 3CZFB 4NP9A 4UAOB 4CDHA 4PHZA 4MDRA 4RA3A 5KVEE 3KPNA 3CZLA 2A4CA 2HLAB 4N8CL 5EF0A 2Y24A 1NBVH 5ESAB 1OPGL 3T6VA 3ULVH 3TT1L 4S2SB 4JQVA 1INDL 3DO4A 1QUPA 1CE6B 1PY9A 1H3PH 2YQGA 3QDGB 3NESA 3D1MC 4MQSB 4YK4C 5BQ7A 4AMXA 5IOPA 5AQ0A 1E5UI 2ERJC 3O45B 3F7KA 1INQA 4HQQL 5GJSL 3NEOA 3TVMA 2TRHA 3KAAA 1CYXA 3MGOB 3AU0A 4RGNE 1J8HD 3NPZB 4FQ2H 4YK4B 2UZXB 3VYOA 3SGJA 3HI6L 4PS3A 2OJZL 4U1JB 5F3FA 2KZKA 3FRPA 5M94B 5KJ7E 3HC2A 4Y5YA 3TONA 4YDLB 2FK9A 4RVBA 2P5ED 3MZGB 3O6LH 4L4VE 5EBMA 2V9UA 5H35B 4KKCD 4K5PA 1OT4A 2E7BA 3MLVL 2WBXA 2W92A 4PBWD 2K78A 1RUPH 4NQUA 5AW1B 5GSVB 1I3RA 3GPSA 4X7SL 5SWZE 3UAJC 5CP3A 1D6VH 4PJHE 1BOGA 4XRCB 4PJ7A 3CBKB 4B9IA 5D2LE 1FFPA 3PP4H 1PD6A 1MCPH 1WT5A 3CN1A 5F1OB 1OSEA 4YDIL 4BZ1A 5DD6B 4KGLA 3UMTA 2ZX9A 5DTFB 1L7IH 3N9GL 5HJDA 4O5LH 5DEFB 5IFAH 4P59H 4JFVA 1LE5A 1I1YB 2R2HB 3IJSB 3TN0D 2CXKA 1HH6A 3UTTD 3FTGA 3IU4H 4G9FB 4N5UA 4UB0H 4PJDA 5ACZA 4YHPB 5DHVB 4G8EB 2V2WB 3FW6A 3OB0K 4M1GL 4TYUA 4KHTH 3VXQB 4XNUL 1ICTA 1TEFA 4CKQA 4AEFA 4HIEA 4Z7AA 4K3EL 1LE9B 5JHMA 2X4TA 2A9ML 4I1NB 4PJ5A 3SQBB 3QC5X 4TL4A 1LWHA 3QWOA 3O2DL 5M95B 1B2YA 4MB5A 5KG9A 1TR7A 3T4AB 1SOKA 1ZA6B 2EDJA 3CVIL 1AHMA 3RBSA 5GZND 4AZ8B 4Q9QH 1BD2A 2XTJC 1YY9C 5CKGA 2ZAHA 1MCDA 3BEVB 4TUJB 1DBKH 5EF1A 4YR6A 5F97E 1RFDL 4KKAC 3UO8B 1JZFA 5AW8B 2XN9D 2YA1A 4WIQA 4ANXA 3L1EA 4PJXF 3MCLL 3UTZB 4YSDA 4PJ5E 2PYEA 4HETA 4JFDD 4UIMA 1F4WH 3T2LA 5FO9B 3HS9A 4G1MB 3VFPB 4Q9QL 3M8OL 3GTTA 3JUYA 4YBLB 1OP9A 2E7HA 5B38B 3PGCA 2D03H 1RERA 1XEUA 4P46D 4QHKJ 1MWOA 1MFNA 1NFDF 4QLRA 2A74A 4QRRE 3VSVA 1U4FA 4G82A 2EDFA 4FFVD 4ODUB 3GFUA 2FWOB 4NP4H 3RUGA 4MS6A 4NC2B 1HHJA 3W2DL 3BP7B 4L0PB 5F7DA 1I1FA 2ZPKL 4S1QL 3PQYA 3R1GL 4S1RH 2EDWA 3BP5B 4F7TB 1MDAA 4GRWF 4U6XB 1GZHC 1KENH 5I23A 3QEGL 1YCSA 4Y4HB 1NH6A 2K7QA 1BVNT 1RZKC 2CRIA 4CNIB 4FQIH 2HMID 2V5RA 3OMIB 4GBXB 2DB8A 2IMMA 1U3HA 4OCLC 4CU6A 4QD2E 3CMGA 3LVEA 2WLYA 2X2YA 3UROR 1KGYE 4HT1L 3A6BH 2L7JA 2NQ3A 1TTAA 2F19L 3GHEH 3QXUA 4QHLB 3H4FA 1V7MH 1PCSA 1G4MA 4NZUL 4CKVX 4QPEA 2A9DA 2OPCA 2ZWNA 2QKSA 3DMMC 1L9RA 1A6ZA 1LEGA 1P84K 3EJCA 4IOFC 5CWSB 1DBJL 2WIIA 2CJUL 2A6IB 1E90A 2K6ZA 4HIIB 4UQ3A 1NAMH 2PNDA 2AMUA 3G08B 2F5AH 1EZUA 4GUPA 3H9ZA 4LHJB 3TJEL 5K59E 4GW4A 4MAYC 2BVQA 2ENYA 4ZOBA 5AW9B 5GS0H 2MQGA 1KTJA 4XMWA 3UTSA 3G6DL 3BH9A 3A24A 4DZ8A 4GRLC 3I50L 4I18A 3BISA 5DZVA 1RU9L 5EPMA 3BUYB 4IBTA 1QEWB 5IHHA 3Q3GB 3GBMH 3GGWB 1BW8A 2FJGB 1BYPA 4ILDA 3SDDA 4DO6A 3PWPD 3CU1A 4LB8A 4GXFA 2MQ3A 4Y8DC 5KBNC 2NY2C 5J3HC 3ARBA 4QOKB 2H26A 5D1QD 4CDGC 12E8L 3D4YA 1KXVA 2BP3A 4JG0H 1I82A 3F85A 5D7IB 4U1HA 2V0AA 2ZCHH 2D7MA 1BOGB 3S9DB 3VW3L 3VVWA 3NFSL 1A7OL 2YPLA 4OGAC 5BS0E 4OKDA 3GD1C 4LCYA 2DICA 3WI9A 2GITA 4PRAA 2DJMA 1U8HB 1YJDL 4XAWL 2EICA 1DHKA 4A6YA 5L9DH 4MMZC 3I6KB 1BIIB 1CGYA 4IOFD 2HVKB 3TA3B 3PDOB 4L5FL 4YXLH 3E2HB 5CCHE 4F7PA 1LE5B 3RILA 4KXZI 4JPWL 1BGXL 1CFSB 3BVXA 4K5MA 5GISL 3MMEA 4PWHA 4GIOA 4GKNB 3OM3B 4H2CA 3E38A 1UEMA 4UM8A 3CUPA 3K6SA 1NFKA 3D0LB 1WZKA 3Q8AA 1A4BA 3FO0L 4N0CC 3DRQB 4OLXL 3QZBA 2EUWA 1S7UA 3EYSH 2C1OB 2Q86A 4XBGB 2X44D 3IFOA 4LASL 1P6FA 8FABA 1FJ1B 1OGPA 4RMTA 1JMZA 2VDRH 5IQ9A 1UWEH 3L2LA 4GQZA 4H25A 5GGTA 1AP2A 4D3CL 5DJCB 2X9XA 3FB6A 1N12A 1ZEAL 4HWZB 5BPPA 1CI3M 5ILTL 1YEGL 3H2WA 1SJEB 2ZTBA 2FSDA 1COBA 4DFHA 4NM8H 1BBDH 4WTZA 4XMVA 3VMNA 4XVOA 2PPFA 1FNSH 3WJMA 3ELQA 3HLAA 2WC7A 1AE6H 4XR8C 2NLJB 1NGZA 5L4FA 4ELKB 1J18A 2DQCH 3ULSB 4AIZB 5HDBB 3OAZH 2VUKA 3CCHA 2GB2A 4RX4D 2VXTH 2JK5B 4R7VA 4NQCA 3INUH 2RBLA 2E9IA 5JIHA 2XRAL 2VDKH 5FCUH 3W82A 3S37L 4S2SA 1MVUB 1VFAA 3DSNB 4MRCA 3KLAA 4W9HC 5FHAL 1QNIA 2MQCA 3ARWA 3UZEA 2DI7A 2G75A 1E4KC 4GT7A 5T33H 2BIMA 4N2KA 4F15C 3CH1A 1N4XL 2K70A 3OKOB 3OZKA 2Q8AL 3P0YH 5CCGE 5CJOL 5FCSH 3ZKND 3HW7A 3U7AA 1GAFH 3ZUCA 1WFUA 1BQHB 1EIBA 4XX1G 1SXBA 4NX0A 1M9WA 3LKNB 3FTYA 4EI5D 1K9TA 2VR8A 4LHUG 4RMRA 4FRWA 4UCFA 3L3HB 5DJAA 3ZXAC 3U36A 3V6FA 4APQC 3B9KD 2X2IA 2VERN 3VU1A 4P2RB 2EUZA 4XNQB 3AABA 5I1AA 1HSBA 3I9GH 4A6YH 1KN2H 4APQB 1YYLH 4PRPA 1Z9LA 2AK1H 1BQ5A 2IH8A 1IBGH 5E9DB 4Y2DD 1MI5B 5C3TA 4XCNA 3GRWH 4RAUA 1NMBH 4OZHF 2VRAA 1PX4A 1I9EA 3U6RA 1DDTA 4ZS7L 1YVLA 4BQ6A 5JOFB 2YGOA 2CIIB 5GGRB 2XG5B 4Y9GA 5DA0B 5IB5A 2K7PA 2EKSA 1U8CA 5AVUB 3WEXB 3KPSA 3AMKA 1KYFA 1GMIA 1TZHB 5HYSG 1C16B 1T80A 4AENB 1KTLA 4H1LH 4IRZH 4OZFB 3IJHA 4YDJB 4JM4H 4OKVA 5BNXD 3O4LA 5ADPH 3K5RA 1EMTH 4BSVA 3B6SA 2E75C 4P99A 4XPTL 4ELMB 1IQDB 1I3RB 2O26U 3IN0A 4JVWA 1CICA 4JRLA 2A9CA 1TT6A 1TG8A 5HGGS 3QIBD 1NQBA 3GINA 3D5OF 3ESOA 3OGCA 1NGWB 1MIEH 1ACXA 1OE1A 2BCMA 1BVNP 4Y7MA 1O5DT 4QOKA 1TFPA 2A1WL 2D7TL 4TKWA 2EH7L 5IV2B 4G43B 3FB5B 1MCKA 4H44C 2R4SL 4E0RA 3IDYC 1ZJAA 4L8SB 5JHLA 5EDSA 3CAFA 3UPCA 4M03A 4QTHB 2A5UA 3ZDYE 3QW9A 1IAIL 5AG9A 2X1XR 4Z7VA 3MLWL 1IBHA 2BOBA 2D7PA 4J3OG 1MCBA 2X2UA 1IM3A 3CLFL 5FM5O 1T1WB 1C08B 5MEPB 2EH8L 1TNMA 5DS8B 3V6BR 1XH3B 4WW1B 2IWEA 1NIEA 4KMQA 2ICWJ 1UUNA 2V8MA 1SJHA 3IDGB 3P40A 4ZNEA 2A74B 4ZAKC 2Q2LA 5FA4B 5E6UB 4NO0D 5I66A 4KVNL 3LS5H 5E6IB 5BXFB 4Z7UF 3GSNB 4ETQA 5ANHA 1E43A 3MV8A 4XP6H 1PAMA 3RDTC 3WOVA 4HLZG 4XMZA 4GMSH 4C4KO 1AD0A 4NO2A 4GMTL 4XXDB 2IGFL 3VRJB 4PS8A 4JDTL 2EDXA 4F7TA 2NY6D 4LVHC 5DO2D 2VDQL 3H9HA 4F2ME 4HHAB 2OI9B 1KB9K 5FPIA 3P2TA 3NFPB 4MMXA 1MW0A 1WAEA 5HTSA 4NN7C 4QXTA 2ICCA 3RWFB 1XT5A 3DHJA 4GY4A 5KAQG 3VM5A 5H35A 1I8IA 1P4UA 1XF1A 5D2NB 1E27A 5FS5A 3H55A 2TSBA 4E9LA 5K9JH 1DN2A 1N6QH 3FCSA 3DO7B 1A7QH 1PCXA 3EOBB 4MWFB 3MLRH 4HCGA 1AFVL 4NQDB 5AKSA 4IRJD 1MCWW 1U6AH 3RL2A 3V4VB 4W9GC 3W39B 1F45A 1SMOA 1WLHA 1IC4H 3MA9L 4O02L 3S0PA 3VO0A 1JDDA 2LU3A 2V2XB 1Z66A 2AJYH 4OGYH 3RDJA 4DVBA 2Z1KA 4FLQA 2JMRA 3FTUA 1C7SA 1BQLH 1XGZA 3PU7A 4L9LC 1OCRB 4KHXH 2QR0A 4GQ9L 5D8JL 5HJGA 4PJCE 1ZD6A 2P5WA 3IU3B 25C8L 4QI3A 5CXPA 5AAWC 3EGSA 4OF3A 5DWUL 2UUDK 4U3XA 3TTSA 3PWPA 4EZJA 4CN6A 1GZQA 2ITCB 4NKQB 1EAQA 4UU9A 1TQBC 3PGFH 3KYNB 4QY8A 5I24A 1RI8A 4CMMA 2F53B 2F6AA 3G9VA 4NKDB 3VWKC 1IGJA 2CIKA 5E8PA 3W9DB 3C5ZA 3DSFL 2JQZA 3FUMA 3KLLA 5HI5D 1LE9A 1NDGA 4GFTB 3NZ8A 1VACA 5JHDD 4H0HB 2PPEA 2CUIA 3CWGA 5B7MA 1RHFA 3GM8A 4Q8BA 4XNZC 4JFPB 2AQPA 3SYPA 4Y4FB 4C58B 4N6RA 4TSAH 5FO7A 4WGWB 3D25B 4B50A 3BO8B 5EU7E 4D9LL 4PWIA 4KV5F 2KLSA 2WP3O 2EIKB 2NW3B 4X9FA 1TCRB 5AOLA 3OKMB 2X4NB 2PN5A 4GAYB 3RRQA 1IT9H 4IDJH 1A4KA 3Q8BA 4X6EA 4X98A 3RDTD 3G04A 1CBVL 2ESVA 1U8CB 2OW6A 3B7YA 1X5ZA 4MAUL 5DFAA 2E3VA 3EOAA 4OGXL 4K9EH 1B0RA 1TJHL 3SKOB 1JNHB 4PJ9B 2H3NA 3PL6D 2F1AA 4XHJC 5F6IC 2VE6B 3QFGA 4QHNA 2GSIA 2XI9A 4HJ0D 1E6OL 1YSOA 3VRLE 2R23A 5JQ6H 4M4RA 1YNTB 3K0WA 1S7UB 2NTFA 1ZLDA 3VXTA 3GSXA 3V0WH 4W1TA 5GS1A 5T3ZE 3HN5A 3TCLB 4LARL 5HD8C 4KKLD 3WLBA 1OAZH 1HCYA 1ZLWH 5IGXH 4I5BB 3FFCB 2J5LC 1A7PL 2Q7AA 3K4ZA 5C92A 4Z7WF 5JPMB 4N0YL 3P3UA 5TTRA 1WA2X 2FX8L 5H4ZA 2XN9B 5EHFA 4GEIA 4FYSA 1FVDA 1FZOB 2WO3B 4JFDB 5KVGE 1KXTB 2G9HB 1MCQA 1MKFA 2WBJA 4UNIA 5TDNA 5DEGB 3WNMA 4HSAC 3VI3E 4QKTA 3FB7A 1SEBB 2C4FT 2E56A 1JPFA 4FQLH 4F58H 4YE4L 1TU2A 4K4KA 3HTLX 5ICYA 4WCYH 3WV0A 4YO0B 3SCMA 5TGBB 2ZX8A 4LU5L 5TFSL 1T5XB 4JCMA 3NAAH 1LO4H 1QNZH 5EUOF 5F7FA 5B7EA 2RAMA 3EFDL 2BVYA 1OHQA 1O9VA 3U46B 1DEEA 3OKOA 2E4FA 3C5JA 4ZAKD 3HHRB 4OZFG 3A0OA 4N8UA 4RSYA 3KYOA 2VXQH 5L7XL 4LPVA 3QS3A 4MX7A 3SPCA 1NUGA 1BVZA 3GXNA 3P73A 4K7PL 4X7TA 4L37B 4NQXA 3NCBB 5EUKA 2PPCA 4Z7VF 4F5CE 3CCHB 4EN3C 4FNTA 3DPBB 5CS7A 1CBJA 4BHUA 3Q01A 3P3SA 1XIWB 3BZFB 3IKCB 1NDTA 4UINH 3C8DA 1ZK9A 4FFYL 4XGZA 4ALAL 2AXHA 1F18A 1B4TA 2CKBH 3DK2A 3SKMB 5DRZA 2DWYA 1ADQA 1XIWC 2QGEA 3RL2B 3W39A 4E9WA 4KJYB 4RCAA 1AQDA 1YDPA 1X5IA 1HFUA 4ZUVB 1KYDA 3GEWB 2BO0A 1IB5A 3TASA 3ZKNC 1JE6A 4I0PC 4KAQH 3GZKA 3ATEA 1OP5K 2V7HB 5L4JA 1KFAH 3LB6C 2QR0B 4X9GA 4WHCA 2OTUB 2O61A 1K8DA 2YMOA 3GLZA 4X99A 4AJWA 4EXPX 6FABH 4YHNA 3K4DA 3EBAA 3BRDA 1P6WA 3ZMRA 1JF5A 1G9MC 4CC4A 5IBTL 3WHE1 3MRCA 3BKJL 5E9DD 5BRPA 3RPKA 4UM8B 5CUSH 1JHLL 5AVYB 1UFUA 1IQWH 2IAAC 4PRHE 2Z4QB 3CPLB 4E5XA 5BUGA 4OF7A 3TVMD 2G3ZA 1K4CB 3O6FA 4BE5A 4UBDD 3O6ML 5EFIA 5I0WA 3HZ3A 3BVUA 4Z5RA 3KXFA 4YIQA 1OVZA 4YDVB 2Z8RA 1FO0B 2GKIA 3T3MF 1F42A 2GCYB 2IADB 4NENA 4IMLB 3LZLA 3WIAA 5IFHH 3HG1D 1HILB 3BGFC 4YZFF 1ES0A 1UACH 1LDSA 2DWDB 2DLGA 4HLZH 2PCFA 2JTYA 2WINA 2IH1A 4OFQA 4WW2B 4GKLA 1YA5A 5FYLL 1MVFA 2VITB 3N44B 5CINL 5LGHL 1ZK5A 1KNOA 3JTSB 3COOA 5E24E 5EV7A 3NIGB 1OARL 1I3GH 1XCTB 3GK8L 3UDWA 5MEOB 4LSQH 2NY3B 3PIQA 5I1LA 1NDGB 3FO1A 4ANUA 4V1DA 4MJ6A 3WEAA 1JHLH 1LP9B 5LWYL 4P5SA 4EDWH 4HPHA 5B39A 1GGCH 3MU3A 2J55A 5I1EL 3V4PB 3GBNL 1JXFA 2DQGH 1JV5A 5C6WH 2ZUSA 3MRBA 3Q13A 3STZB 3L5XL 4ACTA 1MUJB 5DMIH 4EI6A 4DCQA 3L1OL 2OLDA 1RJLB 3JV6A 5E6RB 3WIFB 1RJCA 1XB8A 1JGVH 4L1SA 3CVBA 1KPVB 4L4JA 4MDIB 4UT6H 1NDMA 5GGVL 1PDKA 3T0VA 1LEKB 4HUNB 4TN9A 3RKDD 4L0YA 1W9XA 1ZLEA 1G9EA 1TETL 1BLNB 2X87A 2XN9A 3H42H 3P11H 5T1KA 2YHGA 1AO7A 3LQAC 4ICWA 4LPXA 3EFFB 5D7JC 3ZTEA 4N0FA 5JNYB 4FX5A 5I66B 3HRZA 4OR1A 4OSUL 4ZFOA 2MOGA 2VJXA 4LCWB 4TULL 4ZMLA 4OLWL 1Q0XH 2D2CC 4LQ1A 2TSAA 4XCNB 3KLQA 1M7UA 1XF2A 1YEJH 3O81A 3FUEA 4XP4H 4DZBB 1T83A 4XP5L 1ZTXE 2ZKXA 4XTRC 3V0FA 1CLZL 5GS1B 5IT2H 2EAEA 3KBEA 4PJFE 3WLBB 1Z9PA 4LPUA 1CGUA 3HZKB 5B1KA 1WZ1L 2OR7A 2XN9E 4W6XB 2BFVL 3JVGC 2ZWLT 3TT3H 1QFWM 3T5WA 4I0KA 3ISYA 1RZGB 2GJRA 3GNMH 3WY2A 1T20B 3MNDA 1IGFL 4GH7B 1BD2E 4L4TE 1RCYA 3L7EB 3RNKA 1PZ3A 4TS6A 2XVLA 3DXAE 4XC3L 4Y4KD 3P9LB 4HK3N 2UY7B 4JQIH 1DLHB 2IQAB 4F7MA 1OANA 3KDMA 4MRBA 1YEFL 2V5TA 5DJDA 5INCA 4JFHE 1KTKE 4Q97A 1CF8L 2DH2A 3T4YA 1WEJH 3CVHA 1B90A 4NJ9L 1T22B 4DGYH 2R2EA 2X4QB 4W68A 4ZX4A 1VEPA 1WK0A 2E86A 1T7VA 3I2CH 4XN1A 4OZIE 3DX8B 5F9WB 4RZKA 1EEZB 2IOMA 4V2BA 1UM4H 4N22A 3TA3D 3KVQA 3VSTA 3O3BB 3BT2L 5FV1L 5D1XB 1E5ZA 5D7SL 5JUEH 3V0VA 4NNXA 1UQSB 2NY4C 1O75A 1W0YT 1H8NA 4NQTA 5CU9A 3ZR5A 1JF1A 4JW3A 5F88A 2ITDB 4WU5B 1QFWI 2F7PA 5E9AA 3V52H 2QGCA 3V4VL 2DL9A 4GO6B 4XCFH 2YXFA 3T65A 3EJZC 4OCXH 3NEEA 3KLKA 2I69A 4L1TA 5MEQA 1FRGH 2PWFA 1JGIA 1XL6A 2OTWB 2QKIA 1PZCA 4IBZA 5EBWA 2LE9A 4PJGA 2NW2A 4JZOA 1UM6H 3WJLC 2JKRM 4LHUA 5HDQL 4LIQL 3H0TB 3JXAA 5FYJH 1AZVA 2ZT9C 4NRXB 4ZRGA 1SZNA 4PS4L 1QEXA 3QQXA 2VSMB 3DTUB 1DN0A 4LGSB 4POYA 1T6VN 2OP4H 2A7BA 4XNYL 3W38A 3RIKA 2IC2A 4TLUA 2HTLC 1TMQA 3AVEA 3QFDB 1ZY9A 2LVCA 4NRZA 4Y5XA 1USZA 2N3JA 3DIFB 4F7EA 3MJ9H 4Y2LA 2WLLA 5GZNC 2EYRB 4LCWD 5LAXB 5KS9B 1P6AB 2EDNA 5AZEH 2WB7A 2V9TA 2GPZA 1FFRA 1SF3A 3G3LA 3W0WD 4ODXA 3AB0B 5HBBA 2X9WA 3L3IB 2CBMA 2CA3A 3EYFA 3Q6FA 4KJPC 1NLBH 3CFNA 2BVOA 1M05A 4BZ2A 3F58L 3KYMA 4UDUB 5IQOA 3RZCC 4TVUA 4DP7X 1W72H 4QRTA 4EQ3A 1HIML 3UDWC 3PJSB 2WQ8A 1P1ZB 2VDOH 3TF4A 1FNFA 1JN6B 1RQ5A 1E2VA 3QHZL 4OZGF 4PHXA 1IEBB 3AROA 4AT6A 1NSNL 2H47C 4O2FB 1MWAL 2NCMA 2X1OA 1JK9A 1OP3K 5CCJA 4JJHA 4N8VB 5LLIC 1PBYA 2QQKL 1CVRA 4LLYB 4U1LA 3QDGE 1CGXA 1FLRH 3TXAA 4NZTL 2DIBA 1AQ8A 4KI5E 1X5JA 4N20A 1A4CA 3VFWB 4H8QA 4BCZA 5LVEA 1ECZA 3GLAA 4QXUH 4NUGL 3NJLA 4MJIB 3GNML 4U1GC 3U25A 1OAUH 3MROB 5CEZL 3AWGA 4P2OA 5CEZE 1L9NA 3EJJX 1HL9A 3TESA 1J9QA 1MHHB 1CL7H 2X0VA 3BCDA 5DYOB 2AEPH 4N85A 2Z7YA 1BZ8A 1DBAH 5IHZA 3QJQB 4KK8D 1ZLSH 4Y5VC 5JHDA 3GJFA 3CK0H 4L23A 2DM4A 4XMTA 1A7NL 2NYKA 3GDBA 1KCKA 3H6AA 3QPQD 2CJ3A 5H94A 4Z7IA 1IFGA 1S3RA 2H41A 2MH4A 4NCC2 4NJ9H 1XGRA 4DGYL 1KPVA 4ORGB 4N0UA 3N1GC 3ZE2E 1K8DB 2F7QA 1OZUA 2WKOA 4QF1B 1MCNA 2VLRD 2LV4A 4R4BA 5HVWA 1QSED 3UTTE 5E2UL 1ETZB 5FYLH 3UH8A 3IN2A 2NXZD 4PRBB 4WK2B 4OIAA 4XCEA 1TIUA 1O7SA 2VABA 4NOFA 2KYIA 4X6DA 3T0WA 1NUFA 3VFVB 2GFBB 1Q0YH 1ZVNA 5I8OH 4HUVB 2QTEA 4KRPD 4RFEB 5DCCA 5DEJA 1RZJL 3AUWB 3PWLB 5KG9B 5ERWB 4OB5H 3VXSD 2BSEA 3MFGB 2AQ2A 2YAHA 3SJVE 3V5DA 2FIRT 4IOSA 2ICWA 4LEBA 4Z7OE 3FAXA 4GB9A 4LRIA 3FF8A 1YAIA 3T1FB 4GIAA 5F7EL 1I3GL 3IJSA 4YFLI 3T0DA 2UV3A 3NCMA 1NBQA 3HPJB 1Q9KB 4HC1L 2XA3A 3JWNC 4HX1B 1N18A 1MLCB 4M6AA 4N0RA 5DGQA 5KN5B 3ULVD 2A6JB 4U31A 3IFPB 3OJ2C 1YEIL 3IKKA 4ZO6A 3SCMC 1E9PA 1Q1JL 4OV6F 4KKAD 3LPFA 4YFEA 3GHPA 1FIGH 1WT5C 3TIDB 2AQTA 4KZDL 4XO3A 1ITBB 3WFDH 3SCMB 4WSJA 4QT5B 3BN3B 5D1QA 1G7HA 3JV4A 3ZDXE 1MCHA 2Z6FA 3RIFF 1CMOA 1RUML 2BNQD 3D18A 1JPGA 4WNQA 1QYGH 1R3HA 4HA1A 4M7ZC 5AYUL 1ZMYA 4MVBC 3T8XA 3O3DB 1TEYA 3QUMH 1WISA 2EDMA 4IRSB 4M5YH 1H9VA 1O7DE 3PHQB 3UTSD 2VDKB 1SXZA 2YAEA 4ZOCA 1GGCL 4Z1PA 4ES8A 4S0SD 4PV1C 4X0KA 4PBVC 3HE6D 4Z7WB 2EKSB 4IRJC 3LKQB 4L5FE 5F7EH 4ETYA 4FL4B 1AHWC 2VISB 3IJYB 4KO6A 2P4AB 5E94A 1NSNH 1ZHKA 1OARH 3GK8H 1L9SA 5DHDA 2VXQL 2FX9H 3ALXA 3GEFA 2Z34A 4DKDC 2BM3A 5I15L 3ABKB 1AC6A 1UFGA 3G6JB 4G72B 3UTQB 3HRZB 1HOEA 1HVXA 5E9NA 5FM8A 1CE6A 2ETWA 3SKMA 2VSKB 1CICB 1GW6A 1BFSA 5JZ7D 1T03H 3U82B 4K94L 3CDZA 1WGVA 3EFDH 2B20A 4M7LL 1A6AB 4B3EA 5C0GB 5C0FB 4DP4X 5D6DA 1EV2E 5EF3A 3R18A 1KJVA 4ZMXA 1YNTF 4C56E 2YMXL 1E40A 3KWVA 5JORB 2Q8AH 3GM0A 2KZ1B 3G08A 1TTFA 3FYIB 2RQEA 5I6OA 5KYXA 2LQRA 3TBTB 5E9DE 4M1DH 2KPNA 4DPBX 4LL1A 4ZFGL 4DVRH 1D2OA 4K3DH 4TUOA 2Y2TA 4D9RE 1C5BH 2EO1A 4ZMVA 2CBOA 4ONFL 4P2RE 2VR3A 1C08A 4RAVB 3QEHB 1ZANH 4JM2B 4M8UA 1FFNA 5MEPA 2ZOTA 4N90E 1N9PA 1QBBA 2B39A 3AY4A 4HWUA 4AV4A 3VGEA 3BPNC 3DUUA 5JW4Q 5JPMC 1EUTA 1F58L 3LD8B 4OF8A 1GZPA 1HNYA 5CJ5A 2F58H 1KJ3H 2PYEE 2H2PC 3QEQD 4GAGL 1NEUA 1PYWB 1TQWA 5TE6L 5D93B 3IGAB 5J4MA 3N3EA 1NCNA 1GJWA 5EPMB 4NXSA 4I13B 2OMZB 3GSRA 3B7SA 2APFA 5JA8B 3IJ7A 2QADD 3JVFC 3FO1B 2X4PB 3CN0A 1AH1A 3BZ4A 1AQMA 1T7XA 1PS3A 5EBWB 3UZQA 5I1AB 4GP8B 1WCQA 2MNWA 1XB3A 1JHTA 4LT7A 2XA8H 1LLAA 4NKIL 4WWOA 4LCYB 2FE0A 4TM9A 1FCGA 2AV7A 5LBSA 2JKTM 1NLBL 4RFOH 5F70A 3OKLA 1CXKA 4BK5A 2AJSH 5A7BA 2IOOA 1F41A 2DQIH 1UXSA 2CDGB 3G5ZA 3ZE2B 1BHGA 3BN9D 4XP9L 4IHOB 3TN0A 1XL4A 2OZ4A 4AH2A 3NYKA 5C0CA 3C9NB 3DROA 1JTOA 4WTQA 4PAZA 2VM3A 1JGEA 4XNMB 2ISDA 1E7VA 1C9SA 4F58L 2NX5A 3X3FH 5A2JH 3QYNA 1HH9A 3RWGA 5I76B 1W72B 3BKCL 3D85A 4ZXBD 4J28A 43C9B 4UTBL 2IAMA 4IDJL 4KJPD 4KJWC 2OSXA 5I9QC 3FU7B 3TNNB 5FB8A 3RVTC 2AJUH 2F08A 5TPWL 1ZE3H 1IQDA 1JD7A 2ZXDA 3MJ8A 2EXYD 3CV5A 5FOBA 3Q6FB 3NOIA 5AW6B 2JH2A 2OP4L 2B3RA 3LS4L 5K33A 5I6MA 2Y1AA 4KUCD 5HHVH 1XO8A 2V5YA 2VZSA 2QFPA 3OF6A 4FFWC 3QPXH 4HJEA 3NIFF 4X5WA 2FZ3A 5FKPA 3BP5A 3NCFB 1IBDA 5K39A 3AS0A 2YD9A 4PJAB 3ZTCC 2GJ6D 3FB5A 1N5YH 1YYMH 3UG3A 3VTMA 1QX1A 4KZEL 3L81A 3V0WL 5IWLA 5B8CC 4PGCA 1SFDA 3LN5B 5CJXA 3G6AA 1NUNB 2WGNB 4XPAH 4Z7VB 3REWB 4NFBA 1HEHC 3PAYA 4PJDE 4MD4B 3U0WL 1F5WA 1T1XA 3EGXA 4FZ8H 4OJEH 4XNZB 5ISZA 5JDSA 4X5LA 2H0FA 3T4YB 5T1MA 1A2YB 2YN3A 3FSZA 3STLA 2YAOA 4QT5A 5D1QB 4GMTH 3QO1B 2YD0A 4ODTH 2AJVH 3B9VA 1IFRA 2Y6TE 7PAZA 2MPVA 3ILQD 4N1EA 4LSQL 4QRUB 5DD3L 4Y7OC 3FMGH 2ZCZA 3QG6B 2HJKB 2LU7A 5D1XA 2P5WD 4IBYA 1UZ6F 3C12A 4KVNH 1CPUA 3A67L 4N8VG 5KYUA 4B41A 2OSLB 2TAAA 5ISZE 3ILEA 5HPMB 2H3XC 5TF1H 4OLYL 4Q6IC 2VR5A 2R15A 5D6DC 4UQ2B 4BZYA 1PY4A 2DQDL 3T65B 4XXCC 2F18A 4R96B 2E47A 4XMUA 2ZOKA 1WZMA 1JYXA 5ETUA 2X6MA 2D03L 1LDPL 1WBZA 4ZFFA 5EU4B 4UTCA 3S35H 1WFJA 1YEJL 4X6DB 4F80A 3WTSA 4H1LA 3F01A 1HT6A 2R4SH 3MV7D 4UV7L 3U1QA 1ZV5A 3KCPA 2N1KA 1VERA 4MA3B 1BJ1J 1KJVB 4AM0A 2YBRB 4LLWB 1PW3A 5E03A 4I3RL 4XPFH 2FO8A 5IMMB 5LHDA 1MFAH 5EIIB 1ADQL 1UD6A 4I7ZC 2WUBL 1XXFC 4WEEA 1DZBA 4PGJA 2E7DA 5AVTB 4Q4IA 3W1ZA 3CZNA 2GUOB 4LGRB 4DQOL 3L5XH 4H8UA 3FSVA 2K8QA 1OQOA 3NK4A 1IAOA 2QEJA 1CGSH 4M43H 4AYBA 4PI2A 1UJ3B 4MCYB 4GLRI 1M53A 1ZT7A 2H3KA 3QGVA 1PFOA 4UTAH 1MRDL 3APNA 3MYZA 4OCRL 1S7XB 3SGKC 3BVTA 2P8LA 2ORBL 4EBQH 3KGRA 3RNQB 4TVPE 4GMSL 5J11C 3MV9B 5INDA 4N2MA 4GT0A 1KT2A 2NY0C 3DGDA 3VCLA 4ZW5A 5DJ0A 3PWVB 4F8OA 4X6CE 2JFCA 1CD1A 1E67A 3AY2A 3DDGA 4TOYH 4PRNB 3EGDB 1A6WL 4BQCA 1CFVL 2XPYA 4DN3H 4M9PA 3QQNA 4XNMA 4OVUA 4K7PY 3IJYA 1ILUA 2EDLA 1QHOA 4JE4B 3QNFA 3VD2A 1N3NB 2DBLL 4AV0A 4QEGA 3FULA 4GFXA 1W8EA 4G1EA 4PJEA 3QCVH 2HH0L 5JW5B 1OSZB 1WTGT 5ENWA 4F8LA 3QJUB 1HQ4A 2EIMB 4ZXBC 3JWNH 4NFCA 3LNHA 4X9YA 2AV1A 3FFCE 4PRHA 1OT2A 2DTML 5DHXB 2A9NH 2D2OA 3GMPA 1S9XB 3MFFB 2ZWKA 1KN2L 4BZ1L 4MLIA 4W9KC 3ZE0B 4NNPH 3HUJE 4IBSA 1O5PA 1U8MA 4WDIB 1TQSA 1BMWA 3D3VD 1XGQB 5I73C 4P5MB 3PHOA 3UGEA 4LOUD 3WEBA 1BPLB 5I1GL 5KYXB 2DMCA 2AJ3B 5HJ3A 2VAJA 5F9JB 4E9YA 2DS4A 4KY1L 3M17A 1BAFH 1P5UA 3PDDA 5AWNH 1EXHA 1OGAB 3UBHA 3L08A 1C1EH 4GJTB 3C5ZD 4ZUWB 1P7HL 3BFQG 2ITEA 5IB4A 1DDHA 1KF9B 3MLXH 2V3DA 2F8IA 2ZUXA 1D3CA 4PV9B 5FHAH 5GGQH 4DVBB 4HK0A 4UINL 4ZS7H 4AEEA 3RY4A 1NBZA 3N0AA 1XSIA 4U0QB 2Q1EA 3H9YA 3IPFA 1I8LC 5CAYB 3RFZB 5KVFH 3B2UC 3MBXH 5EEXA 5I5IA 3MRGA 4Z77A 3SPJA 1KB9J 4DERA 3VDBA 1LEKA 3O3AB 4UOW1 2CU9A 2GJZA 5GJTH 1K85A 3SBRA 1YEEL 2CJTA 4X5PA 4PJBF 5F6HI 4A04A 1P9MA 2YPKA 2EDDA 4FN0A 4HV8B 2ADFH 2YUZA 2Q2EB 3MGAA 3QFJE 4PGDA 5A7EA 1YMMD 4FCHA 1I1FB 3WY3A 3BN9C 2WW8A 4DZBA 4LEXL 5F44A 4EOWL 1RURH 5IKCB 3S3BB 4FJ6A 2N7BA 3N41B 5HHQB 3FSOA 4N4YB 5ESQB 1O7VA 1X5FA 3BLKA 1M2VB 3KS0H 2X53A 2YBGA 8PAZA 3ZRSA 5CN2A 2DJSA 3X3GL 1FIEA 5DVOA 3JYBA 2DQUL 1MAKA 3SB3A 2Y5TB 4LEXH 1QBLH 3TIEA 4WFFD 5AL8A 1TZAA 2Y7SA 3SDXF 4IK6A 4B9JA 3V0IA 3O41B 5E8DH 5JQ6L 3MXWL 4OCYL 1A47A 1H3XA 3U2JA 4L8CB 1VB9A 1K2DB 3ARVA 2DBLH 4MB3A 2DRUA 2VDMH 5DMKB 2IFFL 1TJGL 3E2HC 5CF3A 2JJUA 1TJHH 5TF0A 1ZV9A 3RA7H 3RTQD 4X6CB 1S3KH 3MRIA 3VXUB 4JZNA 3NGBB 3L9BA 4E9SA 3EDJA 2BVQB 3AS1A 2DWEB 4JE0A 4XB7A 5E5MB 1BZOA 3BAIA 3HUJF 4FXKC 3OLIA 2QDVA 1VZIA 4G8AC 4R2GB 1R75A 3ZHLA 3DTXA 5C2UB 3G6DH 1AY1H 1KNOB 3JTSA 5CP3H 4ZMNA 1BGXH 2N0KA 1NCHA 2VXSL 5CILH 1AD9A 1PSKH 4U7KA 1JZGA 4QRRB 4WNSA 5G5DA 4J6RH 3LS5L 1KZYA 4L5FH 2CJUH 2RH0A 5HHOE 1G7QA 5HVGB 3FNKA 3EW3B 3LZQA 5D7IF 1T66D 1I9IL 1KJMB 2H9GB 2HJLB 2NDFA 2RHEA 2WXPA 3NDZE 4FXTA 3CHPA 1SXNA 4G7VH 3VWJB 4P8QA 1YMMA 1A9BA 1QHPA 3PNWA 1G84A 4FA8A 3V6ZB 1P4IL 4K8RH 4XVSH 3PWPE 3PGFL 2PYEB 1J8SA 4FKKA 4J12A 1G9NH 3TYFA 3ZTDC 1QSEB 2PYFA 2O30A 2FWLB 2X09A 4H8HA 1PQZA 4H8WH 4XPFL 4X50A 5EBMB 3ABGA 3SGDH 4PREB 4ACPA 5D8JH 2EDKA 4RZCB 1CFSA 1TYRA 4GQPH 4BA8A 4H0GA 1KLUB 1M2OA 2J8HA 2DLTA 3NSJA 2EE0A 3MRLA 1CS6A 3NZHL 1KCLA 1XV8A 4L9DA 5GZOA 4TF4A 4F3FA 1LO2L 2D7OA 3HE6C 4QHLA 1A02N 1DFBL 1F1AA 2DJUA 4UDTA 2HT2D 4X83A 4JPVH 4P2QB 2Y1VA 3OC5A 4PMEA 4AKPA 1GGUA 3IXAA 1SYVA 1JWUA 3D05A 3F5WB 1W6LA 2DLEA 4JFYA 2VDNB 4LLWA 2A9MH 1ZRUA 5D1XE 1FFTB 1HILA 3RP1A 2AK4E 3IFLH 1H0DA 4OLYH 1VPOH 3HC0B 3T71A 3MLSH 1OY3B 2EDEA 3UZVA 2VE6A 3UAAA 4K3JL 3ZOAA 4CADB 2R56L 4PD4K 3EH2A 3RGHA 4KPHH 5EU4A 4F37F 3N42B 5C0EB 3Q3GA 1DBKL 2HT3D 3MBEB 4GSDL 2XIIA 5IFJB 3B2UD 2VIRB 2XWJA 3MNVB 5SWZB 1TTUA 2FJFA 2OMVA 4M7KL 3X12B 2M26A 5I0YA 4GUOA 3L4CA 5IWLC 2DQJH 4R3SB 1WAAF 4J3XA 3TNMB 3CFBB 2OXHA 1TOXA 1QWUA 5C7XL 1Y18A 4B60A 1M71B 3MV7A 4Y1TA 1IM3D 5DMGD 2YPVA 3ULVF 4YL4A 4WKXA 5EIIA 2VCOA 4DEWA 4X7CC 3CXFA 3KPLA 3PREA 3L5JA 3PWNB 1AXSB 4QRAA 4QRRD 4AM0Q 4J27A 4R6UA 1JZ4A 2NY1D 3ZYIA 3ECQA 2PCPB 4MNQB 3GXMA 3NIDF 4DK3A 1FZKB 3CFIC 3E8VA 5F1KC 3SOBH 2F7OA 5B4MD 3CC5B 2C5DC 4BKLB 3HPLA 4PJ5D 3V9EA 4KO9A 2KMWA 2Q76A 2DD8L 2J8UA 3CVCA 3I6GA 3H53A 2YGNA 1U8NB 2F54A 2V33A 3D39A 5B38A 1OIOA 3EFFA 2IH3B 1S7RB 5TGBA 3T09A 2H2PD 2VWEC 1ETZA 2HT4D 1LO5A 1OAJA 5F8QC 1XBRA 1FGNL 4KGJA 4ZMYA 1NINA 3QXWA 5HGBA 1P4BH 3OKEB 4JO1L 5BOPA 2GVYA 1PU0A 3M88A 1CN4A 4NO5A 2OTPA 1FZJB 1PIFA 1BM7A 3SJVB 4N2FA 4DF9A 1T04B 3OAZK 2NY1B 4RRPM 5IMOA 4WZ9A 1WIUA 4QRFA 4HWBA 2DQ6A 5GGRA 5E8OA 3MNZB 1R5VA 1AR1B 3TURA 5IJBC 4NAQA 1BJ8A 1QSFA 4B9KC 2QQLL 1NBYB 4X6CA 2X2HA 2ZWSA 1NC2B 5A6IA 1XCQB 1SJEA 2KLRA 3GI8L 4QRPB 3QZMA 4LPWA 3ZZLA 3HRPA 1J05A 3K1DA 3OAWA 1GPOH 1HX0A 4NQVA 4AVIA 5EORH 1RHHA 4Q56A 4CC0A 5E1QA 2BHYA 2QHRH 1Z0MA 3RWIA 2BZCA 5AW5B 2E9JA 3NIGE 1MREH 2X89D 3TBSA 2AQSA 4U6XA 3ARED 2VOTA 4LLVB 4LL4A 2E5EA 2GK0B 1JJUA 1VF5C 4H8VA 1KJMA 2H9GA 2HJLA 3ZE1F 2O93L 5TE7L 3OF6D 4N8VA 1S3KL 4ZX5A 2Q3ZA 5SWZD 3BIKA 5CGBA 3RFZA 4DPCX 1DL7L 2YR3A 3K8KA 1D6VL 3OLDA 4UM9A 1S2EA 5T3XL 3WNOA 3ZIYA 3L7EA 1EAOA 4XO5A 2VLRA 4OTXH 5F1NB 2ODIA 4ZFQA 1GAFL 5F7HA 1EVUA 1WICA 4R7NA 2DYRB 2EIZB 5E8DL 4EEEA 4PJ8B 3KM1A 3VXMA 3B8YA 3X1BA 1H6UA 1A1NB 2ARJQ 3FH5A 4MDJB 4LLUB 3QUXB 1SQ2N 2VLJD 4TNWK 1HHGB 3HB3D 2ZIDA 4GI6A 1NCAH 4LDLB 4JKPH 1IGIL 1JUFB 2HRGA 2WWOA 2WIIB 4XCYB 1DJSA 3MREA 2FAUA 3MJWA 4J2QA 1IVTA 2ED6A 2NY7H 1AGBB 1GOHA 3HCVB 3AUVA 2PTTB 3EOYG 5AFAA 2EKJA 4AK2A 1F56A 1YRKA 2D3VA 3SEPA 3L16A 1T2JA 4GEJA 3LNEA 1CLVA 2BY1A 5DZLA 4ZZFA 5E56A 2UZYA 4TRPL 5T3ZH 3Q2WA 4L9LA 3FRPG 1MY7A 2ALWA 1R3JB 5F9WC 3O6KL 2PYFB 3GMNA 5ACLA 3UXFA 5IB2A 2R69A 4IEFA 5IJKC 3ASOB 3SPVA 4JMNA 1YN6A 1AHWA 2NTSP 3RIAK 3RY5A 3E1ZA 2CK2A 3D9AH 1OTTC 5ENWB 2ZUQB 2IIJA 1QHQA 3P4OA 4KX8A 1IJNA 1G9HA 1M42A 3ZDWA 4BFFA 1EO8L 3R7QA 1R3LB 4ZUUA 3VX1A 3ZYOA 5IB3A 2I7SA 4IIQC 3P0GB 3X12A 3HE7C 1XH0A 2Z93A 1WFOA 4I9XA 5A2KH 3BQUC 3Q2VA 3ZDXF 2BXYA 4A6YB 4F1ZA 5BUPA 5C0NC 1W0VA 4Y16B 3DJSA 4D0BA 1CK0H 3QAZB 5DJCA 5KSUA 1WRFA 1E3XA 1HKLL 4IS6A 3OXRB 1MW3A 1DVXA 4PR5A 5HHNB 1D5RA 1VESA 3HC0A 4JO2H 5CZRA 5FYJE 1DSYA 3QQ4B 3VFNA 3BRFA 3O4LB 5DUBA 1MZYA 2VW4A 2DI8A 2LT9A 5KSBF 2EVFA 1S6NA 2F58L 2C1PA 2VIRA 2XWJB 3MNVA 5JQHC 3SY0B 1K8IB 3AGWA 2NY2B 4IBLT 1P0SE 1A7OH 1NEPA 2QQLH 4JFZL 5CNHA 1K5NA 3SDCD 3D3VB 4H1LG 1WAAE 1EFXB 4KZ0A 2NYZA 2J5LB 4M3JA 3X11B 4WK0B 3NFNB 5E5LA 2EYTB 3HB3C 3WD5L 4KVCL 1F3RB 4YC2C 2F7RA 2APWA 1RZGA 1MHCB 2HP4A 5HYJD 2OMXB 1YG9A 4UTAA 3TL5A 1T04A 3DA0A 1MJ8H 3SKNA 1L9TA 1L0QA 2G5BB 1MJUH 4OGZA 5MENA 3T08A 2YAMA 1FG2A 2LOEA 1WG3A 3LPOA 1C12A 5J12B 3L3HA 2Z7UA 5DJAB 1OK0A 1JPTH 2A83B 2HG5B 5K9OB 1KC5L 1ID5I 1G9NL 4KNSA 3DXAB 2WQWA 2C9AA 4KKPA 1KTRL 1LWRA 3P3RA 2B1OA 2XWBA 3S5YA 4ERSL 1V54B 4K8RL 3QCUL 5D72L 2XWRA 2FHFA 1LQSR 5HYSB 5KBPA 1G1OA 3IMTA 3N1PC 2ZUTA 1DQQB 3IAGC 1BEYL 5E6IA 5BXFA 5E0FA 3BT0A 3QIUB 4J3BA 2F19H 4YHYB 1I9IH 1T5WB 3FH7A 1D7BA 5C0GA 1OGAE 2ED7A 2EE2A 4YHKL 4YQXL 4RGNC 1VGEH 3MV9E 5C0FA 1AACA 1JWUB 3F5WA 2YUVA 1RK7A 1RJZA 2YARA 2ZXEB 3DVGB 2VN6A 5DD3H 4AENA 5LCVL 2FHCA 1EX0A 4M9OA 1F4AA 2P8PB 4LPTA 1T1YB 4P2OC 1CXIA 1GCYA 3LN5A 3QORD 2ICES 4FNQA 1AY1L 4E41B 4UM9B 3KG5A 4HWBH 2J2ZB 4UZSA 2VZOA 2X3CA 4BM7A 3S2CA 3DO7A 4JN1L 1S5HA 5DC9B 4Z95H 5IW1B 2BZDA 3RVWC 4Z0BL 1I8UA 1GTNA 5IVXB 1FYTA 4A2DA 1II4E 2JVUA 4YFLF 3RA7L 1CGSL 1X9QA 2V7NB 2DW5A 2H1PH 3BAWA 4I2XE 2VDML 4X7SH 4LSVL 3G5VB 5F1IA 4I8DA 3QDJE 3HLKA 1NC4A 2JF1A 3KH3A 1VENA 4KNUA 3TH4T 3F64A 1Q9OB 2EDYA 2WUBH 3FONA 4N6RB 1U33A 4AL8L 1C16A 4KMLB 1MWAB 3EUUA 3X2QB 4YDJA 1EZSA 2W9EL 3GBEA 3UO1H 5SWQB 1G7IB 3SDCB 3BD4A 3D52A 1FYTE 5KYUB 3KL5A 4CADA 1FLRL 4W9FC 4YSUA 2VDMB 3HAEB 1FFOB 5EEWA 4XXWA 3LKPA 2ZYIA 3LKQA 2FYVA 5K5YA 3CC5A 5D1QC 3FCTA 1JRHI 1MG2C 4WI0B 4UOZA 2AI0L 2VDPL 1J5HA 4UDUA 5CR8A 2AJZA 2BNRD 1M3IA 3QEUA 1JGUL 4R96A 2B08A 2BJML 4Z7NF 5C08B 2W65A 3KD4A 4PJ7F 4WUUA 2W8CA 3FN3A 2VN7A 2X6AA 4A1RA 5L2KD 3P4OB 3CZJA 3ESUF 2ZOOA 4I0CC 2AITA 1BF8A 4P23C 3MX0B 4NWUL 1Y1UA 2OSYA 43CAB 1N5AB 1ET8A 3TPUB 2NZ9D 1AD0B 2EE3A 2IOIA 4F8QA 1KG0B 1OW0A 3I3EA 2ED9A 5DD6A 4AGQA 4DK6A 4X6FB 4WI2A 3QQ9D 1KEGH 4X6EB 4G6MH 1MAJA 4QNPE 3GI9H 4RFOL 1MW1A 1IU1A 2GK2A 5T5NG 3V0DA 4PWEA 1WCBB 1TFHA 3AMLA 4MKTA 3BAYA 5CD5D 3LMJH 4ZUTA 2K9UA 3WHXB 3FPYA 3L7FA 2YAQA 1XGPB 3X1FA 3WFZA 5L0QC 3MTRA 2AAVA 5CKAA 4G6JL 2P26A 5KANG 3ZQWA 4KI5C 1ZGLM 3HMXA 4HJJH 4TSBH 2M83A 4F2FA 4FXGB 3OHMB 1R4XA 4NPJA 3F84A 1FHGA 2MSPA 3DRTB 2X4UA 4M8RA 5CEYA 4PRIA 2JQMA 3AS2A 1AI1L 3U0WH 1EO8H 2W07A 4L3EE 3SJVA 3FF7A 1YQVH 1ZLSL 2GUYA 1TQUA 1UM6L 4PPTA 3P2DA 2WXIA 3ZT6A 1I3VA 4UM9D 4OZHB 5IVZA 1RUPL 5GGQL 1RP8A 2JB6B 2C7FA 3S8FB 3MRKA 3UYPB 2F8XC 1JI1A 3ATFA 2W59A 1G0DA 5D71L 2EDBA 4OIBA 5JIIA 4XODA 1M6OA 1GZQB 2WNKA 3IWUA 3TBTA 2VLME 3UTPE 3TVMC 2C4XA 3UZVB 3B2PA 4OJCA 3DHMA 5LG1A 3QUZB 5DO2C 1YEHL 1R0AH 4J3UA 3NJHA 2NOYA 4AVHA 2KPWA 1PG7L 1C12B 1AANA 3WFCH 5F96H 4ANVA 1H8SA 1ZANL 2HKFL 4NI3A 5EUKB 3AQZA 3EJUA 5DK2B 4HCFA 3IDUA 5FHBH 4NNPL 4KRPC 2OXHB 4X8CA 1OSZA 3TH2T 5FYLD 2IEPA 1U95A 4BFRA 3U46A 4S1DC 3MRHA 1QTPA 2ADFL 1AAJA 5CMAB 1H5BB 5IQLA 4B9ZA 2BHUA 3BP6A 1E28B 4GQRA 5HPOA 2L7QA 2C8NA 2YMXH 3EADA 1FFQA 4MKMA 3WTTA 5IF0A 2WMPB 3UP6A 1EK3A 1UKSA 3QJFB 4NUMA 4P5TB 3B5GA 4U3SA 3IF1B 3OLGA 1Y0LB 2XQBH 3FC8A 1MFEL 5EU6A 4K8RD 4CSTA 3BWAA 2WANA 5D4QA 3BZ4B 2ILLA 5AVSB 1P53A 4BD4A 1DE4A 2G4GA 2KDGA 4WF7A 3B9DA 2NY6B 1PNCA 3U30B 1KJ2H 3RTQC 4I2XB 3FUIA 4S1SH 5FECA 1XF3A 3QIUA 3FTZA 1Q0XL 4JAMB 3TN0C 1ZGLP 1IKNC 3ZDXB 3FN9A 4WI7A 3ARYA 3MUZ1 4LMQI 3CFEB 4N2BA 2MMXA 4IHOA 3TN0B 4ZW3A 4P49A 3QQDA 4LCCC 1XBDA 2ZD0A 4BWWA 3GI8H 4HKZB 4LVOB 4O2EB 4YJZL 3QJTB 4B5ZA 3CZSA 5HHNA 4YHNB 4AE1A 4UQEA 3VD0A 4JFFE 2R29L 4NQCD 4URKA 4NAMA 2P43B 2YWZA 3BEWB 1S5HB 1UCBH 4P3DA 5DJ6B 5DEGA 5CJ8A 5FO8A 2OX5B 4N1HB 1RMFL 1N59B 4GKSA 4GRMB 4WAFA 3K46A 3T3ME 5CBEB 3NJFA 4Y4FC 2OMBA 1FL3B 1BQRA 1JPST 4P4RA 2A9NL 3HG5A 2XWXA 4TVPL 3VU2A 3C08H 3S48A 3FFOA 3MOAH 3QR0A 3MX0A 3I84A 2JCCE 2Q3XA 1HSAA 2X70B 2XQ0A 4HIHB 1MUJA 2DWDA 4HHGA 4XB8A 1MFBL 3MCKB 3VRIB 5HD8D 3CX5K 3HZMA 2DM3A 2IBZX 4ZD3L 4KROC 3QZPA 4MLSA 5F88B 3CFTA 3P73B 4X7TB 3L3OC 4PGZA 4D94A 3ELAT 3AREA 4V1DB 1NGQL 1XAUA 4Y2OA 2JELH 3MV8E 4P57B 3L95A 1OPOA 4UAOC 2VWEE 3NPSB 4P2QD 3K5SA 4QHPA 4XC1H 5BVPH 4QRPE 4GKOA 3Q9QA 4AQOA 1NCOA 2HYMA 3HVNA 4MJJA 4Q0XL 2B9AA 5C0BD 2HUHA 4U33A 4ODTL 5B1BB 4KPHL 2XXMB 1B3IA 2X5PA 3DNKA 4MA3A 2ORBH 4NN5C 2OAAA 2FRGP 2PABA 3FOLA 4OLUH 3UP1A 1YQ2A 2JKSA 1MZZA 4UOQA 3PJNA 3PWUA 3GUFA 2OMZA 4KTEH 2IAMC 5F3BA 1V7NH 4JFOA 1MAMH 1UEYA 2J88L 3GIVB 4MNQE 5MENE 1DVSA 3QG7L 2I07B 3BW9B 1MLBA 2JJTA 2AEWA 3H3PL 5ETUB 5IROA 1G0XA 1L7TL 5TH2B 4QO1A 4RA0C 6TAAA 3KHQA 1OXYA 1NFDA 3DUSA 1AD9B 4DGIL 4OCWL 3HS0A 4M8VA 3RU8L 1MG3C 4TTDD 4XH2B 1QLFB 3GXPA 2VMFA 3B5TA 4FFYH 3SN6N 1PY0A 5ADOL 4X5XA 4AIXA 2J6EL 4LAQL 5T1JA 3LEVL 3GBDA 4HC1H 1QFWL 4JRYD 3QA3B 2VR9A 4MBOA 2HFFB 4K15A 3CFCL 3ARDA 1DSFH 1I85C 1KV7A 1KXQA 1DVFA 3BP6B 5D7JA 3V0VB 2PXYA 2VDLB 1HIMH 5LBGA 3CN3A 1XGYL 2ERJB 5C6TH 3BKCH 1AXTL 1RPQA 3H2PA 4ZDHB 4CSPA 3LXAA 5IW1A 2EP6A 2LAAA 3GGWA 3QJHB 4TQ8A 3Q5OA 4G7VL 3DVNB 5KVGL 4R97C 1N10A 2ZXGA 5DK2A 1AIFB 4P2RA 4EUPB 2AABL 3L3GB 2GW5A 4Y2DB 2ZXCA 5DD1H 4JLRA 1IEHA 1TJMA 1PVHA 3HMXH 3WTYA 3AC0A 5DHVH 1A6TB 1RK1B 2XWTB 4U1HB 5FC9A 3UG5A 3WGVB 4AMWA 1LHZA 3MRPB 2CGRH 5ALCH 1HQ4B 3ATDA 3WAJA 3P9MB 3FDWA 5DK0B 2KC0A 1JV5B 2BSRA 3CDGA 3R4DA 2JE8A