2J1XA

Human p53 core domain mutant m133l-v203a-y220c-n239y-n268d
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Structural Basis for Understanding Oncogenic P53 Mutations and Designing Rescue Drugs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 49
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2j1xA00
5BUAA 3EXLA 3Q01A 3WTSA 3WTVA 1YCSA 5G4MA 3WTYA 2X0VA 2RMNA 5ABAA 1HU8A 5AOJA 2ADYA 3D06A 1H9DA 4L0ZA 3QYMA 3D07A 2FEJA 1TSRA 5LAPA 2J6WA 4AGQA 4HJEA 3D05A 3VD0A 1IO4C 4AGNA 2J1ZA 4L18A 1HJBC 5A7BA 4L0YA 1T4WA 4IBTA 2J1WA 1EAQA 5AOKA 3TS8A 3WTTA 1KZYA 3KMDA 2IOIA 2J1YA 1CO1A 3QYNA 4AGLA 2WGXA 1GZHA 4AGMA 5KBDA 3D0AA 4A63A 5AOIA 2IOOA 2AHIA 1E50A 2H1LM 3IGLA 1TUPA 4IBYA 3Q05A 5AOLA 2AC0A 2X0UA 1CMOA 2VUKA 4KVPA 4AGOA 2GEQA 4LO9A 4IJTA 2IOMA 4GUOA 3D08A 2J21A 2PCXA 4AGPA 2ATAA 2XWCA 3ZMEA 3US1A 5AB9A 4MZIA 4IBWA 2BIQA 5G4NA 2OCJA 4IBQA 4LOEA 2J1XA 3Q06A 3KZ8A 3WTUA 4GUQA 1EAOA 4QO1B 2XWRA 2BIMA 2X0WA 2P52A 2BIPA 3VD1A 1UOLA 3IGKA 3WU1A 2J20A 4IBSA 3EXJA 1EANA 1LJMA 2MEJB 5LGYA 4IBZA 4IBUA 1GZHC 3US0A 5ECGA 4G83A 5G4OA 3WTWA 5AOMA 4LOFA 4G82A 4XR8C 3VD2A 4MZRA 2BINA 3D09A 2BIOA 4IBVA 3WTXA 2YBGA 1HJCA
chains in the Genus database with same CATH superfamily
3NP4A 4Y1SA 5IJDC 3VFRB 3QCVH 5T1DH 2WOYA 5C6TH 1NKGA 2FT8A 1M7IA 5AZEL 2NY4D 3IDJA 4J39A 3ZDYF 3WTYA 1PIFA 3WGVB 4XMXA 3DHPA 5L7XL 4C56B 1PW3A 4AMKH 1CT8B 1MSPA 2VQUA 1N9PA 1QVOB 1BVZA 2FX8L 5F7BA 2AABL 1GY1A 4N0YH 1ZDSA 3QJHB 3ZR6A 2VZ1A 3OC8A 1TQSA 3VD0A 1F3RB 2LE9A 4DO4A 3B9AA 1T66C 1ZXQA 2WHVA 4P07A 1BLNB 1UWGH 3RL2B 2YGVA 3UMNA 4JG0H 1YEIH 2A7BA 5IHHA 4HIQA 4Y5XB 2HYMA 3CFKA 4JRXD 4OF3A 1YEHL 2OXGB 3REVB 2XWEA 1EH9A 2R1YB 1Q4NX 4UQ2B 1HOCA 1NGXA 2E3VA 4FTVB 3ES6B 3K2UL 2TRYA 3MLUL 4WWPA 4JO2L 5IZ7A 2OMUA 1XZWA 3LNIA 4PU2A 2NQDA 1IGML 2DQTL 3QIWB 4GRLC 4DF9A 4F58L 1C7SA 4F2FA 3FTGB 1BFOB 2GSGA 3FFDA 4PJGE 3WL9B 1I1YB 1PKQB 3DV4A 1ZTXL 3LRSA 5LGHL 5E7BA 3CDCA 1RPUA 1X44A 3B9EA 4N3TA 1VF5C 4KJWC 3HE6A 1U41A 1IZKA 5DS8A 3KH4A 3QHZH 3IFPA 3LQAL 3TN0D 3CAFA 3K3QA 2WV3A 3EH4B 1Q9KB 2IBZX 5KN5A 2ATKB 5C86A 1DQQA 4WSGA 5EUKB 1NEZG 4O2EB 4FADA 1U92A 2QHRH 1RULL 2ZYHA 3LHAA 1WPCA 2WQXA 3FB6A 4JM2D 2B14A 3BEVA 4G3YH 4H5SB 1KY6A 5EOTB 2RJMA 4RMQA 4MBOA 5KAQG 3HNTL 2OXHB 4G80A 2NYZA 2AXWA 4YE4L 4QHNB 3WHE0 3VI4A 4X0NA 1YAZA 1NJ9A 3TZVA 2PWFA 2MFNA 5C7ZA 3GLDA 1W8OA 2NY3D 3TF7C 1TVHA 4MA8L 3ERXA 3GTNA 3P9LA 4QXUH 5F9AC 3QE5A 2Y1ZA 3UO1L 1ZY9A 2XXGA 2JSFA 4TMPA 4HPOL 3KLHC 1LE5B 2HTKC 3U0PB 4LOFA 4UT6L 1ZHLB 4ZPTA 5GSVA 1VKXA 4EIBA 3K6IA 5K9QI 2F58H 1FHNA 3DGGB 1BREA 1JI1A 4JVPA 4Z7OB 1JG9A 1R5WB 5HI3D 1AOHA 5K59F 3N3EA 4NFDA 4RGNC 4YQXL 1IEBB 1K8IA 1PIGA 4JDZA 1QLFA 1GJIA 2FUQA 1SY6A 2X4TB 2FYYA 1DQTA 1SXBA 2K3HA 3D0LB 3FF7A 2PWEA 2I24N 1YUHB 5I8OL 1J5HA 5FGBA 3VQMA 1CDBA 3L54A 1RZ8B 2HTLC 2V5YA 5GS0L 1N70A 5JHBA 1JGEA 2VRKA 4DGYH 2PTTA 5K69A 1J1OL 2DLTA 4L18A 1NIAA 4XP5H 2X4SA 2X1WL 2HVJA 4RFOH 5JW5B 2XTLA 1KBVA 3NIFE 4G7VL 2GUOA 4I3GA 2X1OA 5FLVA 1JI2A 2BO0A 2EEBA 3DV6A 4A7GF 4AH2B 4GRWF 4CDHA 1LHZA 2OJEB 1EO7A 1A9BA 2DI8A 1MRFH 1S78D 2VDLH 3QWNA 1NM4A 1B0GB 2N59A 3CSYA 2FD6H 4XAWH 4DH2A 4O9HL 1O7SA 2JJSC 5CJXA 5K9KB 1QMUA 4JFPB 2AHIA 2VERN 2YOAA 1J0ZA 4HAKA 3V6ZB 5I1HL 2GJJA 2A4EA 1F13A 2GTZA 2VXTH 3GSOA 4P5MB 3ZR5A 1XO8A 1H6EA 3ZVVA 4ZX5A 1S9WB 5AYQA 3FBKA 5C0CD 5D4QA 2Q6WB 1NAMA 5EUOA 4ZMQA 2VLLA 1AZBA 2ARJA 1TTGA 3W2DH 1LWRA 1HSBB 2CH8A 3NUKA 1EAPA 5LQBL 3QS2A 4XPTH 1LWHA 5FB8B 3L1OL 1PAZA 4X8JA 4G6KH 4GO9A 8FABB 2XU9A 4X7TA 2VN6A 3VFTA 1JYVA 2VXQH 4FQJH 2XOTA 3HUJE 4WKZA 3PHOB 4EQ3A 4PBVC 3KWTA 3FCBA 2W95A 3FRPG 4WUUA 4C8XA 3C8HA 2TSBA 3L2LA 5HVGB 2NT0A 1A6WL 1X5JA 2RALA 5J13B 4U6VL 4HIIA 1VACA 1ROCA 1G7HA 1HILA 5MHSD 3PP4L 1UXMA 1FA4A 3EJZC 1SHMA 5C0DA 2VWEC 1HAWA 2Y25A 3OWEA 2JV6A 3HG5A 3QIUA 4KDTC 2D03H 2WUCH 4FXKC 3DRTB 5B1AB 2Z64C 4Z7UF 5EBLA 1Z0NA 2NUPB 3R19A 5FYLL 4NC1C 5CUSH 1ZHBA 2ZUQB 1GW6A 3VWJC 1F45A 4WUKH 1QFWH 3IDNB 4PGDB 4OCYH 1JGUH 3LZFL 4B96A 2JLPA 3AU1A 4OZHF 4BUHA 2YN3A 1RZKC 3BKCH 1DSFH 2GY7B 1QEWA 4FZ8H 1KC5L 4A55A 4PWKA 1DVTA 3OL2A 1QPXA 4R7DA 1AYOA 4D9LH 4PYHA 1FG2A 5CJOH 2IANE 3LDBC 3HE6D 4DVRH 5E1AB 2D7OA 4I48A 4AQEB 2CO6A 5FEBA 5E00B 5J6HB 1P7KA 4MCYB 3PQYE 4PCKA 2BSRB 1AG0A 2Z93B 2CE6A 3KYNB 4LLYB 4K94H 3HE7A 4L3FA 4PV1C 1AHMA 1R75A 4NQCE 1FL6B 3VFWB 4EVNA 1SDDB 3QI9C 3VXRA 4ODBD 4DP1X 2BM3A 3R7QA 1JZIA 4IIZA 4ZX6A 4BKSC 2C8NA 1UWXK 4KTEL 3KDPB 1O6SA 4BKLB 3TZVD 5FOBA 4AG4L 4UAOC 3BN9D 3AG4B 5TGBA 3H1ZA 5HD8C 5T3XL 5DT1L 3IGLA 1G7MB 2HKFL 4TUJA 5EU4B 5IFAL 4D0DB 4JQVA 4WCYL 4HKZB 3X13B 3DX4A 5ICZB 4S0SD 3P11H 1A6VH 1TO4A 4GT7A 5ICXB 2HLEB 2X9ZA 3FT9A 3OR7A 4HXAL 4OU3A 2XPZA 1GGYA 2WANA 4Y4HA 2UWEF 3GSVB 4CUCA 1THCA 2QLYA 2EH7L 3K91A 3VSUA 4L4VB 2ZUYA 3QHTC 3D4YA 1SXZA 3QXAA 5JORB 3VGGA 4PJDF 3RWHB 1HH6A 4KI5C 1XB6A 2J88L 4A6YH 3S5LA 2DQFA 1T1WB 1R6VA 4HJJH 5IQ9B 1M6OA 4TTDC 1KIQB 4RZCA 1U4FA 2B1AL 4X4MA 4MX7B 5F6HJ 4R84A 3SKJL 4HKBA 4CC1A 2CLRB 1J18A 1FSKC 1QRNA 3FUEA 3MODL 2J1XA 1PLAA 2CJSA 1A14H 2WVUA 2XA8L 4GXUN 2Z4TA 1LDPL 1SOSA 4XE0A 5HY9A 5M94B 1T7ZA 4NBZB 4EI5A 2WCGA 4BGDA 1T1XA 3GJFK 5EEVA 3VJ6A 3DK2A 4GAJH 1FQ9C 5JZ7D 1JZ8A 1NANI 5LGJA 4TNWF 5TQ0H 2RR3A 2A1WL 4M7LH 4P3CL 1U8JB 1WA1X 2P80A 3CX2A 3MBEC 4IJ3B 3CUPA 4LSDA 5GGSB 3UBXI 4KROD 1IM9B 2DQDL 5BOJA 1G7QB 2VQ1B 3PWPB 3F65A 3NJJA 3QH3B 2N0MA 3L17A 4XP9L 5IB5B 3WMSA 5CXPA 1OGSA 4ZQTA 3CX5K 1WK0A 4FI8A 3MA7A 3O4OC 2VLJE 1N6QL 1MH5B 2ADGA 3F01A 2A6DA 4PJAE 2GAZA 4J23A 2V5RA 2AEQL 3I2CH 4X6CA 4LAQH 2Y7MA 1FO0H 3IF1A 1S7UA 3KE0A 4Y0GA 1CBVH 4J12A 3QIBA 5D7JC 5FYJU 4NO2B 3SO3B 4KO7A 2EIBA 1M71B 1A21A 2KH2B 1U8HA 4FNQA 4WUUD 2J5LC 4P5KA 3WIIH 2ZOKA 1F8TH 3ZKQD 1SOXA 2DMCA 1F1AA 3QG6A 1NOAA 4AGLA 1JPST 1UKTA 3E2HC 3ZTNH 3MRJB 5E5RB 1XGYH 2J25A 4X9BA 3LZOA 1T6WA 1YMMB 1MFBL 1R24A 3TCLB 5FKAA 3D9AL 3QIUD 4L8DB 4Y16A 2FX9H 4N2BA 2IBZY 3MRHB 2DD8H 1JV2B 2ZX5A 2AJVH 2IWEA 3JTTB 1PDKA 3Q05A 2B3IA 1NH6A 4XB8A 4E9TA 2FATL 1F4XL 3AGVA 1U8QB 1MJUH 4PS7A 1VFAA 1AXTL 1WICA 3N50A 3UGEA 1TQCB 4OBRA 4N90E 5DHVB 1AKJA 1QFOA 1CK0L 2J8HA 5GS1C 4P9HC 3PJLA 3CVIL 5SV3A 1A5FL 1TFPA 1PEZA 3WSQL 2DRUA 1XSKA 2HX9A 1S3KL 1QAWA 3CFDB 3KLSA 1Q9WA 4KRMB 4XPFH 5F3FA 1G7PA 5D8JH 1UOWA 2DIBA 2H0FA 3WIHH 5CJQL 4R8WH 2MPVA 1TQVA 2FWSA 1T7YA 3KPSA 3NJIA 4U1LB 1HKLL 4RAVA 5HJDA 1RIUL 2JI3A 4Y7OC 2OL3H 4ZZKA 4MKMA 1NCWH 4F80A 4NP4H 4Z78B 1IJNA 2C4XA 5EO0B 3FFCD 2EILB 2EYRA 5E95B 2F19H 2FNWA 4F1SA 3EDJA 4G9DB 2WD0A 4PGCA 3VXRD 5L6YL 3MUJA 4JG1L 1WTLA 5CZXC 2AI0L 3G5YA 3T2QA 2PO6A 1I7TB 5DMGD 4P57A 1V7NH 1ET8A 5HYJA 1OLLA 4A7VA 1S8DA 3FYEB 3GSRB 3GD1C 3H2WA 1GVIA 2XFGB 1TZGL 2HWZH 3E3QE 4TNVF 1LMKA 4JZJA 1NBYB 3HB3B 5MERA 3C09C 1MCIA 4Q6IC 3QI9D 3Q5YA 1D5ZB 2COVD 2KUTA 4YAQA 1BQHA 5AW8B 5BUPA 2A9AA 4JREC 4HH9A 2DTMH 3BWUF 4LPCA 1P4BL 5I6XB 2X0VA 5HGGS 1AD9B 3SPVA 4JY6A 4F9LC 1RUML 5E51A 1QLRA 5H4ZA 1KSRA 1P69B 2ZOLA 1QSVA 4JUSA 1MCBA 1MCOL 4HS6B 2DQCL 4KUCD 5EBGA 4GT0A 3CVDA 3KPTA 4GEIA 3N9GL 3JXAA 3QAZB 4DUXA 3MRMA 5I0YA 4P05A 4ECNA 3NEXA 3H9SE 4QHKI 4OZFB 3O6FC 1QRND 3ARFA 4TS6A 2ZUUA 1I75A 2H9GA 1R5VB 5JUEH 3ZTCC 3G04B 2A2QT 4KUZL 1XBDA 4JLRA 3BVUA 4KI5D 4PJBE 5IJVA 1OAJA 3TN0B 1AS7A 4LEOB 3JQOB 2G2RB 3A4DA 2XXMB 2R1XB 3UTSE 1O7DE 2P80D 4JZOA 4WTWA 3LZPA 4ZMZA 2JFCA 2QFPA 3KW7A 5EU3A 3DYMA 2DQJL 3FJTA 3VH8A 1UA3A 4MSWA 4XXWC 3II3A 3L5JA 5DQDL 3GXTA 4KTGA 4F2MB 5SWSE 1LO0H 3V4UH 1D2OA 1S7SB 4IJTA 4IOIA 1UXWB 4AYFB 1NCJA 4PH8A 4XN5A 5T1MA 3SDDC 3WS3A 4W70A 3ZL4H 3MACH 3FU3A 2BVOA 3EYVB 4W4OC 1C5CL 4U1JA 3TYFB 2CA4A 1BOGA 2WO2B 3MRFB 5TE4L 1PSKH 5IQNA 5J6SA 1UD2A 1MDAA 2FWOA 1D5IL 3ZTDC 3RTLA 5F7WC 1G4RA 1EFXD 2H2SD 2QGCA 3QIBD 4JM2F 1IAII 2EIMB 3U4BH 1SQ2N 3MV11 4KXZH 4BE5A 3UG4A 2XVBA 1AAJA 3D50A 3RJQB 4OCSH 3IXTA 3L3IB 3JWOH 3UTQA 1JFHA 1F6FB 4JDTH 4CN6A 1JZ3A 1X9RA 2PPCA 4GXVH 5JDSA 4R26H 4Y16D 4IRSB 3TWCL 2EAEA 1KJVB 1QSFB 3LPGA 4UUJB 1K4CA 1O7DC 2BY3A 3UPRA 1TTUA 1ITBB 4DEPB 4I3RH 1EDQA 1LK2B 4R4NC 4EI0A 3WHE1 4JRYB 4X9HA 1AKJD 4M1GL 4PGBB 4YDLC 3VXMB 3APMA 3ZT5A 5C0GB 2FBRA 5D1QE 5DQJB 5HDOA 4XVTL 2F7IA 5D7IE 3FTZA 3ECWA 4HYTB 4HK0B 1IQWH 2ICWJ 3EDKA 3QUYA 1TITA 4HCRL 4KXDA 5ELIA 1C5DB 2UY6A 1PY9A 3KPSD 4A2FA 1XHHA 4NENA 4FERA 1P7BA 1JXGA 1SJXA 5KVGE 1N3NA 4R5XA 3HG1A 4JFWA 4XVUD 2FHFA 1IE4A 2X40A 3E80A 3Q13A 3VGDA 4NUQA 2N7BA 3D4GA 2J6EH 2OR9H 1ND0B 4PJIB 4YSCA 1ZLVK 1RIHH 4BHUA 3DI3B 3IDJB 4ZRGA 4Z76A 1YNTB 1E5AA 2XV2A 2BVYA 4BH7A 2XWZA 3F7RA 2PO6D 3ARQA 1VHPA 1JSYA 5HYJD 3KR3H 2HFGL 3OKEA 4GSXA 1JPFA 2P7TA 3TA4D 4XP1L 1QACA 4OVUA 3DPDA 1WO2A 5AAPA 5IW6A 4ETQA 2GIYA 2H2PC 2PW1B 3MV8A 1DVYA 1KB5A 3ZRCC 2WSKA 3ATBA 4Y5VC 4Z0XA 1MFEH 1NC4B 5TE6H 5CWSA 2MPAL 3VX0A 5I1KL 1K8DA 1NCCH 2VR4A 1G1OA 2W0FA 2MQGA 3T0DA 1ESOA 1MFMA 1HOCB 1DL7L 4K7PH 4N2GA 4OZGF 4P48A 4HSCX 4WJ5A 1OARL 1OXYA 2FJHA 4TLKA 3HOGA 2OMUB 4H8WH 2DZEA 1NTDA 1I8LA 3S35X 3DOIA 1HHJB 2YAMA 4PG9A 1DBBH 3FFDB 4OF6A 4JRWA 2GJZA 4UDUB 4WTZA 3WFCL 3BVTA 5I6KA 1GC1L 3ARFD 1DDTA 3AT0A 5D93B 1JXFA 2VLME 5T5FL 5F3BA 2UYLB 4Q9RH 3MNWA 1ZXKA 4P2QA 1JNJA 5I19H 3ROLA 2EYTB 1AG6A 1RXLA 3CVBA 2HJKB 4YVNA 4YXLL 3A6OA 3GUTA 1R3JA 2O5ZH 5KN5B 2CGRL 4EI6A 5B8CA 4QRSA 1IM3D 3VE0A 5MEOA 2X1XR 3FB6B 1FFNA 2KERA 4OCLC 5DD1H 5KS9B 1KJMA 2CRMA 3EXLA 4CSTA 3VVWA 3E9TA 5I66A 5JPMA 1JS4A 3FQTA 3FO0L 2KLTA 2GYSA 3VI4B 5F1OB 2E74C 3C60C 4G1EA 2XVLA 5BZWB 2ZJSH 3FZUC 4J3SA 4TTGA 5H37A 3HG3A 3ULVE 2ZXAA 3HEIB 4ISVA 2BJMH 3VFMA 1TVHB 1KN4H 3EH3B 4YHOL 4AQ1B 1UB5B 4KKNA 3P9LB 5ALBL 4EXKA 5ITBL 3HNSH 5I6MA 2CKBA 3HI5H 5E8NA 1NFIA 4Y9EA 2AVFA 1TLKA 4JUTA 3AWEA 5CU9A 3MO1A 1N10A 4K3DL 3HW7A 4DGVH 4L1LA 1PG7X 5C08A 1XR8B 2OZ4H 4R0LA 3IKCA 1BZ8A 2P5EE 4ESKA 1DBML 3S2CA 5K9QG 3G9VA 4U3HA 3K2IA 1YNKL 15C8H 4AQAA 4NDMA 2LW3A 3AREA 4P46B 4X6DA 4FGMA 4NN6C 1E50A 1MWOA 4RGOL 1WCQA 1TTBA 4M4RA 1M56B 4Z7NE 1E6JH 1NCGA 1ZGLP 2RIKA 2VLRE 2C4FT 2F1EA 3CFCL 1NBCA 4M3HA 1MQ8A 5IJKC 1JGEB 1WFTA 3JWNE 2WXMA 1SY6L 2PTTB 4G6AC 3DLQR 4JN2A 1GA2A 1CMOA 2F7OA 3CCHB 3DX8A 3F58L 4AL8H 3VX1A 1IC7H 2X4SB 4K7FA 3LTVA 2HVJB 4AMWA 4NPYB 1I1RA 2MNJB 4XCEB 4CGUB 4ZT1A 4UNUA 3CDGB 2GUOB 3RPIA 1GL4B 2H5UA 1U6AL 3PJNA 3DV6B 2Y0SA 4H8VA 1V8HA 3W39A 1E5CA 5JXEC 4MNQE 1A9BB 2XVKA 1U8NA 4OFKA 3MRKB 3ASOB 3VD3A 4CBPA 3IDMB 3LB6D 1MEXL 1UENA 4J2QA 4LKXA 3BCFA 3HG0A 3RYMA 1CL7I 1LMIA 2GTZB 3V0DA 3TVMB 4A2HA 3QUYD 1H8NA 2WOBA 4NT6A 5LXGH 3QC5X 1O9VA 1CD1A 2QSQA 1NAMB 2HUHA 4GBXA 3T4YB 1MI5B 5EUOB 4G1MA 3AXHA 2X41A 1MHCA 2ARJB 2VLKB 3HG1D 3JV4B 4RNRB 4P2OC 3ZE0F 4U0RC 1BIIB 1EAPB 1NAML 5D7LA 4UQDA 1KMGA 1RZQA 5D71L 4HUVA 2DV6A 2K6WA 4PI2A 3US9A 3TBSB 1KIRA 5JOEA 3BJ91 4X7TB 4HK3N 1H15B 1U8IB 3VFTB 4OB5H 1UJ3A 2O4EA 5E8EB 1HHKA 4XGZA 4Y2OB 3S98A 5HHVH 4F93B 2VR6A 2ZX9A 3PYCA 2ZKWA 4JEGB 4ILDA 4G9FB 1YUKB 3GXPA 2ORBH 1G7HB 1HILB 2WBJC 4HAGA 2QKIC 5SX4I 1WV7T 2CA3A 5AW0B 4JFZH 3H3BC 4NQXA 4HLEA 5C0DB 2XIBA 4L0PB 4KRPC 5DEFA 3S3SA 3RWFA 5F72S 1HJBC 3P30L 2YPLE 4OZIE 4M7ZB 4HWEH 5LVEA 1R9FA 2YPVA 4HAFA 3THML 4U6HB 2O5XL 2ATPB 2CHXA 1H3UA 1JNLH 4KX7A 5IMLA 2D2CC 3KMDA 2IDQA 3QYNA 2A9MH 3FK3A 2PPEA 5KWYC 4MD5A 4QRRA 5IVZA 3N06B 2ZX8A 1JTPA 1BBJA 1QEWB 3CZJA 3HAEH 2NSQA 1UM4L 2WVVA 4R7DB 1MHHA 3UZQA 1FIGH 1A64A 1FG2B 1KBPA 4P2QD 1MNUL 2XICA 3AY4C 4MZ2A 2Q8AH 2ZE0A 3WY2A 2CO6B 1JGDA 4UILL 4YBQD 3P2DA 4QRUB 4QTIL 4NZTL 5E4OA 3ZZLA 1B4RA 3N85L 3GSXA 3U82B 3VXQA 3U7YL 4EUPA 2PETA 1GH7A 4HA1A 3LH2H 2CNZA 3JV6A 4KOBA 1AE6H 2BFGA 1ZJAA 2B2XH 2E9JA 3EOTL 4DTGH 3HE7B 1N59B 1ZV2A 2BXYA 3LXAA 2ZKYA 2WKGA 2OV0A 2ZYIA 3IDXL 3N6YA 4XMZA 3DOHA 2YWYA 3WN5A 1DQLH 1X9LA 3DNKA 4Y5YC 4UTBH 1WAPA 4LCUA 2P5PA 4LLAA 2B5IC 4G8GB 9CGTA 3QQXA 3PPSA 2ALAA 5GSRB 1TT6A 4IBQA 4N0UB 5DO2C 5TGBB 3WJMB 3PWUA 4LNVA 3WTUA 1UEMA 4PLKD 4TUJB 4PVBA 1A4BA 3X1FA 3RTQA 1YECL 3BXNA 3CZSA 3OR7B 4FXTA 4EIZC 1XEDA 2HFFA 3C60D 5C08D 1XCWA 3UROR 3FUDA 1TFHA 1I85A 4Y4HB 4H40A 1PCXA 1AMXA 4Z3HA 4ELKA 5AALA 1YEGH 2AZUA 5D70L 2V4LA 1WWAX 4FLOA 5AYTA 3ARED 1HH6B 4WVRA 4ANUA 1A1NA 1HEZB 2CK2A 1M6OB 2ENSA 2ROXA 4ZYKA 5F6HI 3CBRA 4MXWL 1AGBA 4RCAA 3KEDA 4JDVA 2BHFA 3SQBA 2B39A 3IJ8A 3FTXA 3AS1A 2VR5A 3CNKA 3HC0A 3SKUD 4AJVA 1T03H 3JWNH 3VFVA 2GKIA 4EI5B 5AVRB 1MVUA 1T1XB 2VAAB 2X2UA 3VJ6B 3SY6A 2YJLA 1JXDA 3Q2WA 2V2XA 5TDOA 1A6ZB 4Q74A 4GW1A 3ULUE 3OMNB 5LGJB 1WHPA 3LHPH 1AZNA 1CGTA 4M3JA 5ANMA 1JPTL 1LK3H 3QNXA 5JPNA 3T0EC 2E56A 3IPBA 4OQTH 1FH2A 5GGRY 4KUCF 3UBXG 4F1ZA 5G55A 5F93C 3X17A 4JQIA 3AROA 1ZJBA 1FFTB 1NZRA 1OK0A 2NSMA 4N0FB 3UJJH 3WOVA 5BS0A 3BCDA 3BIKA 3IDGB 5EFIA 3QQ9D 3OXRA 4FA8A 3HMXL 1LEGA 1RUPH 1SM3L 1BD2E 3MA7B 4ZMVA 5BQ7B 4W6YB 3IAGC 2OTUB 4B9PA 3NZUA 4NZUL 1TPXB 2GAZB 2AJUL 1UD5A 3GBMH 4H8PA 3VFNA 1LO2H 4FXGC 1OB1B 4KI5F 5D7LD 4X6CB 1F02I 3BZFA 1QFUH 1CFVH 1OF2B 5DHEA 3U1PA 3VWKB 1PVHA 1AQKL 4NEHB 4UM8A 5MENE 2O5NA 4KNSA 3RGVC 2YWZA 5DSCA 2EH8L 3C2AH 5BO1L 3MOBH 3QIBB 1OSYA 3D08A 5F70A 2PXYC 1U8HB 3VXOA 3WIFB 4AXWA 5C0AA 1NCBH 1UH4A 4P5KB 2ZOKB 3EFDL 3IPEA 3H9YA 1T1ZA 2GUYA 3O4LA 3HN8A 1ZA3A 5HHOA 5ADOL 4RFEA 4LHUA 1KB9K 4NC2B 1URLA 1Q1PA 1FLTX 5E8OA 3Q6GL 2YA2A 4X83A 4GO6B 1WA0X 5T5NG 5FKAB 3U1SL 2ZYSA 4Y16B 5JW4Q 1E3FA 2B9AA 1A2YB 1INEL 2BC4B 3EO9L 2MNWA 3FONA 3R4DA 3PWJB 5E2JA 3RWCB 5I8CB 1PZDA 3ARPA 4WEUD 5JDJA 2P9RA 2RBLA 4CKQA 3AQYA 4LCWE 1KB3A 1VFAB 2JCCB 1KPRA 4NKIH 4WHDA 1D6VL 5E6IA 2ZCKH 1GGCH 5GRUH 2GC4C 4L8BA 3SYPA 1EHNA 4LLVB 4H88H 4FLQA 2Z35A 3SPGA 2UXFA 3BKJH 1Q9WB 3PGDB 1VCBC 4DO6A 3QQDA 3ARBB 1PYWA 2NY6C 2HX8A 5IVOA 1E5YA 4TUOB 5BUAA 2A73B 2HRPH 4KJYA 4D7BA 2HT3D 1P9MC 3EYUH 1JZDC 3FYIB 4QKXB 5CINL 3KCWA 4RMRA 1MVYA 4YLCA 4Z7QB 3S34H 4MMXA 3DIFB 4M6OL 4ZPVA 1U8LA 4IMKA 4CVZB 2D3LA 4HGMA 2FBJL 2EYRB 2XUWA 3OJ2C 4OCRL 3WFHA 4BH8A 3MLRH 3RWIA 5CSZA 4YDJA 3DJZA 4H0LC 4H1LB 2NCMA 4XCNB 1SFDA 1CE6B 3G5YB 1HXMA 1JHTA 4PWIA 4JFQA 4WW1A 2UZXA 5KSVA 4KMTL 5EMYA 5HYJB 3K5RA 1U8KB 4AV4A 1E6OH 1EMTL 4DP2X 5IGXL 2CD0A 3F7KA 2FGWL 4FP8L 1KWKA 5MERB 1E27A 2UY7A 1O5DT 3IJYB 1KGXA 4YAQB 1BQHB 5FW6A 3L4YA 3TBCA 3RTQD 5ABZA 4HH9B 3PF2A 4PJCA 1DBAL 4IKNA 4MS8C 3SPVB 1XF1A 1XCTA 3CSFA 5EU5B 5BMFL 1QLRB 1TUPA 3D51A 2ZOLB 3BGFC 1EERB 3RB7A 2DI9A 3MRBA 2APVA 4WW2C 2HMID 3TT1H 2HB0A 1CD9B 4GSUA 3MRMB 1NCDL 1WAEA 3DROA 2BW5A 3E38A 3L1GA 5I74B 1CDIA 3WNOA 4Y19B 3Q0HA 5FV1L 5FYKE 3H7BA 1OVZA 3NCCB 1A0QH 1EEYA 1L9NA 2H9GB 1D5MA 4MQ7A 4TYUA 5EZJA 2QSTA 2N1KA 3B2XA 4JLRB 2QBWA 4ATTA 2R23B 5IJVB 3NJMA 2E0PA 2NTFA 4LP5A 4PJ8C 1IFHL 2DLEA 2XWDA 4NM4L 4PRAA 2BNRE 5FUOH 3V6FB 4TQHA 2ZICA 3O6LL 2Y5TB 2N7SA 3KJ6H 3A6BH 4F57H 1EXUA 1JCKA 3BZ4B 4UIKH 4NJAH 5JHLH 5E9NA 4GNKB 4MSWB 1K3ZA 1T2QL 3B9VA 3NESA 3ZHKA 3WEOA 1MQKH 2N0KA 5ACMA 43C9A 5BS0D 1A3LH 2AEIT 4F7TA 2EC9U 4ZFFB 4IOIB 1TETL 2ZUVA 3O2WH 3PUUA 3AG2B 4YBHA 4PWEA 3JWDC 1IKNC 4ZSOA 2ESVE 3SYAA 1CLOL 4IIQA 4MWFA 1YVLA 3T0ED 1J0HA 4GQRA 3V4VH 2NNAA 3SE6A 4JFTA 2IDSA 1Q0XH 4X0KA 3A22A 2HA1A 2BVOB 1RJZB 2A99A 4U1JB 4MB1A 1QO3B 1JK9B 3EYFA 2PUQT 1NCIA 1VPOL 2X4QA 2AANA 2PCYA 3Q5OA 1ECYA 1WCBA 3U6RA 3VM7A 4ZMOA 3HNVL 4YXKH 1FVDB 4O4YH 5JW4M 1QHOA 3D5OF 1HQRB 5I0DA 2OMXB 1N0XH 1EEZA 4X7SH 1KXTB 5I15H 1IVLA 3NIGF 5C0AD 1JYXA 5L88H 1A7OL 1PQZA 2DEWX 4K9EL 4NXKA 4OJYA 1OQOA 3ARWA 5C0JA 5HHOD 2VDRB 4PG2A 5FYKU 4LHUD 1P1ZA 3NN8A 5TJWK 4AJWA 2KZ1B 3A4EA 3UTQB 5T33L 3VXPB 2ICEA 3FUMA 2CO4A 4QI3A 2WXOA 3DX6B 2VDRL 5L2KA 1UVQA 2PXYD 1ROWA 4AIOA 2H1PH 4XI5C 4HISA 1ED3A 3TV3H 3LKNA 4AYDC 4Q4IA 4AT6A 3A24A 2ZG2A 1J05A 4HT1L 4WQOA 3FB7A 5E6ID 3L3HA 4F27A 5FUZL 1IILE 1G4MA 1IGCL 1FE8L 2VXSL 3CHQA 5EOQL 3FOLA 1NMBH 3X12A 1SEBA 2BVQB 2DQHL 1ECZA 1HWWA 1MAKA 2I60L 4YDMA 1ZTXE 1WGOA 1QATA 1N67A 2B77A 3NCBB 1J1XH 1T7XA 3HG1B 3HZVA 3MYZA 4JHAL 1RUKL 4MCZA 3SE9H 2P49B 5CCHE 3TT3H 1N12A 5CGMA 3C5ZD 4ICXA 1B9KA 4J27A 1E4HA 4QTHA 3KXFA 4DGWC 1YJDL 2LU7A 2N3JA 2OCJA 4Y88A 1MCSA 4PS4H 3KWXA 4PRPA 4Z76B 1DBKH 5JHDE 3E8UL 2GPZA 4PRHB 4XPAL 2VUYA 5FO7A 1YY9C 4X7DC 4PWGA 4YUEL 3QJTB 3G7TA 2WNXA 5JQIB 4K3JH 4OCMC 4OIBA 3P54A 2IJ0C 4CVXA 1UXLA 1GKEA 2WXJA 1JGVL 2XLLA 4OD2A 1FNFA 3DDGA 3QRGH 1JHKH 2ADFH 1Q0YH 2MEJB 1ZK5A 3IFLL 2CRIA 3HS9A 5J1TC 3ZHFA 3JWDH 4QIRA 3MV8B 1KB5B 1WFUA 2P8MB 5F0PB 2L7JA 1R3IL 2CZNA 5CWSB 1K8DB 2KS0A 2Y23A 12E8L 5ANHA 2ED9A 5I75B 2ZZUT 2BIOA 3OMZA 1XV8A 1T6VN 1KB5L 4AKOA 1XL6A 4NQDB 3OXSA 3ARDB 1FLRL 1XX9C 5D7EA 3FSOA 4Z3EA 3Q1EA 2J2ZA 3RB5A 3GM0A 3JUZA 3MUGA 3SBWA 5LWYH 4HUXA 2V9RA 4L8SA 5CGBA 2GJZB 2IV8A 5F9WC 4GRLA 6FABL 1GIGH 2XZQL 4OT1H 3E6HB 4BZ1L 5IHLB 3LIZH 1OAYH 4CW1A 5IOPA 4P2QB 3ROLB 1DLFL 3LS4H 4XWGH 2XKNB 2EIDA 4M6NL 3HIZA 4XWOD 1GHFH 3L4ZA 5AZ2H 3FO2B 3O6MH 4S1DC 3NCFB 3VA2C 5F7EH 3GUTB 5IROA 3G6AA 1W0YT 2FT7A 4X8CA 5AKTA 3NCEB 3V7AE 4EI6B 4FABL 4IKJA 2PCFA 1KZYA 4P9ML 4YDKL 5A40E 1VFBB 5L9DH 5MEOB 4CU6A 4M7JH 5EF2A 2OMVA 2MOVA 5AQ0A 5I66B 4P59L 1JD9A 2VXQA 4QXTA 4MAUH 2HKHH 4LLDB 4PYGA 2LAAA 4JO3L 5KSAC 3T6QC 1Y18A 4G1EB 1QRKA 3U1QA 4MJ5A 4ZAKD 2CXKA 3GUFA 1M9SA 2ZWLT 3ILPB 3R0NA 4KAQH 4N9GA 4PJ7F 3T1FB 3VQLA 4DK6A 1Q90A 3VFMB 3O11B 2AJ3A 3C08L 1XH3A 4KK5D 1JFQH 1ACYL 1NFIB 1R33A 3ZKXB 1A3RL 3MO1B 3T3ME 2R4RH 5FCUH 5EC2A 4MA1B 2YGOA 1NBQA 1A7RL 4N0CC 3FCSA 4GINA 3GO1H 3HZ3A 4R0LB 3IKCB 4PCYA 1CR9H 4YHIB 1MLBA 5I1JH 2FQEA 2V5MA 2L4OA 2R1WB 4NDMB 1ZAGA 4X6DB 5A16B 2IVFC 4M4RB 5KSBA 2IH8A 2FX8H 5KUMA 3DOSA 1ZS8A 2AQ2A 4FI7A 4PJGA 4QTFA 5C6PB 2J8UB 2CBQA 2XVGA 3IU4L 5TTRA 3PE9A 5FS5A 1BW8A 1H3XA 2G5BA 4JO8A 4OLUH 4QRQA 4KNUA 3NA9H 3DX8B 2NLJA 1TXKA 3QARA 4K7FB 1CFSB 3VFOA 4L5FL 5K9JL 5L2KD 2Q8BH 3C87A 4WEMB 4GMSH 1XF4B 1CE1L 1CN4A 3B2VH 3TESA 4UTAA 5IM7B 2G9HA 1I8AA 4Z8FH 3OAUL 2Y6TE 5FYLE 5F9OH 3W39B 3PNWA 5J11C 4RWYH 3GBNH 2UZPA 5T1JA 2CO7B 4HV8A 4MD0A 4RGMB 3QS3A 4ZMPA 5HGDA 2K8QA 1A7PL 2C1OB 2FQFA 5AG8A 2AGJL 4M1CC 1MY7A 1AS8A 4P23C 1HHGA 1V3MA 5TDPA 4AVIA 1UG9A 1BGXL 4NT6B 1BZQK 4U1SA 5BVPL 4O2FA 4MZ3A 4GBXB 4QGYA 5KYUB 1UXSA 3FBQA 3TA3C 2C5DC 4DZ8A 4GJTB 5CLZA 1FORH 4FG6C 1SBBA 2Z0UA 3HVNA 1JYNA 5GZNC 4WGKA 3CFUA 4LPVA 3EFFB 2CBPA 2K78A 1MJJA 1E9QA 3ATAA 1MCRA 4HUVB 2Z8VC 3QXTA 3KXFD 1S7TA 3FT3B 1KIRB 3H9ZA 4PRPD 1NKOA 4OFYD 3RKPA 1U4EA 1HK6A 4NLAA 2DWYA 4WNQA 4XGZB 3UDWC 3QR1A 1CGUA 1HHIB 4GMTH 3NGBB 4A6YA 1QTPA 3BIBX 3FMGH 4DKDC 5I1GH 4N28A 3RWJB 1L3NA 2IOOA 2TAAA 3WEXA 5ICYA 4HJTA 5T3XE 1JZ4A 1FGVH 4WFGE 4FS0A 3VGAB 2WCSA 4MA8H 5AVXB 5DEFB 4CJ1A 4CSSA 3I9PA 1Z5HA 3DUUA 4ENZA 1TLMA 1J12A 4L3CB 4PFEA 5J3HC 5CZKA 4YFLF 2E76C 3M1CA 5KYWA 4FNLH 3E1F1 1MIML 2YAQA 4DP8X 3M45A 3AFLA 4HLJA 5IMLB 4YBLB 1WZKA 1EUUA 4EOWL 4QRRB 4NPKA 3V6OE 3TBBA 1XXFC 3TX4A 1KCWA 4XX1E 4WTXA 5JW4N 2X6AA 4DP7X 4QYAA 2E9BA 3G5VA 2WVVB 2WXLA 3S36L 2LTQB 3UZQB 2X1QA 2WNGA 1Y6NR 2XNAA 4LMQI 5CZVH 4I5BA 5DUJA 2OMWB 3CZKA 5JYMA 2EXYC 1E9OA 3S4SA 3NIDB 1T2JA 1PG7W 3SYOA 2BVPB 1JGDB 5I71C 5IROD 5DJAB 4BCXA 4A04A 1L9PA 3EJPA 3WXVH 3HG2A 2JTYA 3GSXB 1L7IH 4R2GC 4EUPB 4I1NB 2GBVA 4KU1A 2XN2A 3JV6B 3OB8A 3PGFH 5IP4A 5I9QC 4AENB 5BRPA 5EN3A 1IAOA 3W37A 2GJPA 3GMPA 3LN4A 2MCG1 3UZEC 4LCCA 4FQXA 3D8MA 4PY8J 3ECVA 3WN5B 3X14A 4OSUL 1XD0A 3WFDL 2XV6B 2VQTA 2D3VA 3CSTA 4WI5A 4ZUWB 4OV5B 2XTJE 4LCUB 4FFWD 2YBRB 3HUJA 3RIAF 3MBXH 4DKEH 1G7LB 4MB3A 5I17A 1OAUH 4ABQA 3CU7A 3PWUB 4PB0L 1WT5A 3R8QA 3PWPE 2KI6A 3P2TA 2H47C 3CWGA 4BZ2H 5HYFA 5ISZB 3N1FC 4P5TA 2PPFA 5D7SH 1K5WA 1M1SA 3BVNB 3BXNB 3TP4A 4WI9A 4JKPH 2WBKA 4KY1L 1KJ2B 3QUXB 1TSRA 4HC1H 4MNGE 4MHHI 4IK7A 4WV1C 1H5BA 3CFBB 4FNTA 5JQ6H 1SF5A 4UOJA 3VU1A 3LKSA 1X5GA 4BCZA 3IGAA 1P1VA 3QNFA 1HZHH 2D2OA 4ELKB 4XXDB 1WZ1H 2Q0ZX 5EU7E 2YD1A 2A74A 5LB1A 4XBEH 4JPKH 1AJ7H 1A1NB 2V5SA 3UJIL 2JB6A 4LDOB 4ZYKB 3BWZA 3TS8A 2PW2B 1PZBA 4JG5A 4LFHD 4R3SA 5LBGA 5LLIC 2B08A 3BPNB 3GMLA 3MYJA 3ZE1B 3FQXA 5I76B 1UT1A 5I0ZA 3SE4C 2XX1A 3HC0B 5CSBA 2Q87A 4Z7WB 2Y6SD 3WIHA 5GGQL 4LVOB 2H3NB 5DS1A 2WLYA 2IANA 4KC3B 4WWKA 2GJRA 1UM6L 1UZGA 2OL3A 4YDIH 2V2XB 5MEPA 5TDOB 2CR6A 4GW1B 4XN9A 2WP3T 3H8NA 3LVEA 5ANMB 3PQYA 4FDWA 2PLTA 5JPNB 3DETD 3EBIA 4KVPA 4MXVF 5SWQA 2L7EA 4NQCA 4ORGA 2WQSA 1T21A 1F4WL 4FX5A 4AGPA 4YJZL 3HR5A 1A4CA 5BS0B 2MTAA 2EDJA 5I30L 3OXRB 3AABA 3CC1A 4L37A 2R7EA 3SZKC 2KKQA 3RDTA 1AGDA 2J44A 4WLCA 2BOCB 1SOQA 1EGJH 4LOEA 1J8KA 4MNHB 3WLWC 1OP9A 3HTLX 3BZFB 2WJ7A 2A4ZA 5L2JA 3ZT7A 3RLSA 3HJEA 3QCTL 3TA3D 4X6BB 1OP5K 5LGYA 4G6MH 4BIKA 4LSVL 1ZT7A 1P84K 2ALWA 2E7DA 5GZND 5HHPA 3T4AA 2IGFH 4PB9L 5C0AB 1IQDB 2IDTA 4XNUL 4ABUA 4FHKA 4HBQA 5GJSH 3PL6C 1T1ZB 3O9WC 2NYKA 3O4LB 1HN1A 1Y6MR 5C7XL 3KBEA 5HHOB 1PZAA 5EEZA 1JV5B 4LHUB 4NIYE 1GGIH 3LEVH 3D25B 1A4KB 4EJ1C 4JCMA 1NDMB 3VD9A 4DNLA 3UX9B 2Z7ZA 3MJ8A 3A23A 2X4NB 3ARVA 3NZ8A 3C5SB 4KQ3L 4H20H 4IRJA 5AKVA 1BG1A 1KPRB 1WBXB 3ZGHA 3FO9B 4N8VA 1PZ3A 3Q5TA 3TJEH 5E94A 3WCYA 1M3JA 4J2XA 3STZA 3FF8A 1RZJC 4D0CB 2VDKB 2XZCL 2Z35B 5BXFA 5HHXH 3Q8FA 4HS3A 5JR1H 2H32H 1U8CA 3QB7C 1RK0A 3HN3A 4J3OD 1E65A 1PYWB 3MN8A 1C12B 1FL3A 3ILEA 4KJYB 2WKOA 2VDKL 4UT7H 2QSCL 2VLJA 3OBAA 3EGXA 4MMXB 3F7YA 4PJAA 1U8LB 3OKLA 3WFHB 4BH8B 5I2IA 3V0WH 4AEIL 5HI5C 2DJMA 5CCKL 4J3UA 3RWIB 5CSZB 4YDJB 3JV5A 5EIQA 3MRIA 2K7PA 1UA6L 5KVFL 4FQXD 5HDQH 4M62H 1P5VA 5C2UB 4HOXA 3BUBA 4JFQB 3TURA 2UZXB 4M6MH 3OLGA 5JXAL 2YSTA 5C0IA 5DFAA 5FIEA 3VFPA 3CDYA 3SOTA 4R2GD 5FX3A 1HTYA 4DN4L 1HCYA 1TZHB 4NN7B 4U6XA 5E2UH 2FX7H 1UUNA 1E27B 4M29A 4F2ME 3GHEH 3MNZA 2HRGA 1T5XA 3PIQB 4WO0A 5ESQA 5FC9A 4S0TD 1NGQL 2EYSB 1KPUB 1KLFA 3TH4T 4J4PA 2DIJA 1IEAA 3QO0B 3AW5A 5FCSH 2E59A 3MLYL 2RACA 5GISL 4PJCB 3TNMB 3ULSA 4TN9A 4OGAD 4KK9C 2K7QA 5DTFB 4J28A 4X2UA 1DVXA 1XEUA 3UAJC 4DFIA 2BIIA 4W9IC 5J6GB 1R0AH 1EZVX 4Y2DB 3IGFA 3MRBB 1WBYA 2CUAA 2W91A 4HDIA 1HL4A 2R0WL 4I3SL 2R27A 3MCKA 2CMRH 2KT6A 3AS0A 3DROB 4KKBC 4KVCL 5DLMH 2A6JA 3GM8A 2DBJA 1ZSDA 4RWHA 4Y4FA 3US0A 1Z1WA 3H7BB 4IDLA 4HQQL 4C57C 3ZHDA 2V2TA 2O30A 3BDYH 4YSSA 5C0EB 5FPIA 1WEJL 2IAND 1ADQA 4P5SA 4WWKD 5CKGA 3RI5F 1UYWL 5DXWA 3KYKL 3WKQA 5KYXA 1N7MH 2NTFB 1ADWA 1YDPA 3QG7H 4G7SB 3ZPDA 5EWIL 2OW7A 3E6FB 4PSPA 4JNXA 3PQYD 1VEMA 5D1XE 4Z5RA 2Q7NA 3QQ4B 3HMWL 1EXUB 2H8PA 4U2ZA 4I77H 1HU8A 3A6CL 4NQCD 5CILH 4UOQA 2I32A 1QSFE 4AIEA 5IB2A 3A4FA 2JB5H 4X8XA 4V2CB 2YIHA 3B8SA 1T7WA 5AOZA 1MW3A 3QCVL 4K07A 3RNKB 2D9CA 5T1DL 4FFYH 4ZFGH 5C6TL 3B3BA 4OJCA 2ED8A 4FFTA 1N6UA 5HGBA 3IWUA 4XXWA 4B9IA 1RZJH 1WHOA 1S3KH 1NINA 3APDA 4JRYE 3RDTD 5ICUA 4AMKL 3VXME 1R34A 3I02A 1W0VA 35C8H 5EIIA 3MXWH 4MWFB 1HEJC 5AVWB 3HFFA 3CFIC 3IAPA 4N0YL 4X0KB 3W56A 4WW2F 5BZXA 1Z9OA 3UPAA 4C4BA 1KYUA 4H2CA 3EYFB 2C7UB 1TJHH 2NW2A 1WCBB 4JFHD 4Y9CA 1CDYA 4AITA 3PWLB 4LKCA 1UWGL 4FE9A 1E42A 3ETTA 4MXQD 5HYEA 1IGJA 1YEIL 4JG0L 1OZTG 2ZG3A 2UVEA 1E43A 2NXYB 4P2AA 5FYJD 4PJIE 1XCXA 1PBYA 5LCVA 3MREA 1PQZB 4HUUA 2XN1A 1BBDH 1IBDA 5C0JB 1KCRH 3QJQB 2VUKA 2IAAC 3GXDA 1SYVA 3H9SA 5EO9A 3NN8B 3ZSSA 2Y2YA 3DPBA 4GAYA 3WDJA 1FCGA 5KBPA 1TSHA 2YEZB 3C8KA 1U3ZA 3DX3A 4RAHA 3V0GA 5F0JB 2NY2B 5IK3B 4KHTH 4CN4A 4U1GB 1KV7A 4QGTA 4PJBA 4UT9H 5BV7C 1ED3B 4IRJD 3RWDB 3O9WD 3KM2A 1Q72L 1RLBA 3QHZL 3L3HB 2WXKA 1Y1DA 3D18A 1J7VR 5JIPA 3BT2H 4AKPA 5ECJE 2NXZB 4FL4B 4LL9A 5A6IA 1OCWH 3FCTA 3K7UA 1QFWM 3LPOA 3X12B 3QPQD 2DOCA 1SEBB 2QHRL 5SWSA 3F8UB 1UQSA 2Y07H 1LD9A 1R3LB 4G3YL 4H0IA 2A0LC 3RVXC 2YFOA 3FQWA 4PLJC 4JFDB 1BF2A 1G6VK 2VLJD 3HZVB 3LZRA 4G82A 3GBLA 3LS5H 1JGLH 4GO8A 3HLAB 1KGYE 3NTCH 4QXUL 1NCOA 2CO3A 2OZ4A 1ONQA 2QDWA 4OGXH 3RA7H 5FF6A 1E4WH 2BLFA 1T5KA 2KC0A 1H3WM 1OT1A 5FO7B 4YFDB 2PTVA 1SJMA 2NY1C 2F58L 4UQAA 4FN0A 1S7VB 3BQUC 5D9SB 2R29L 4CVXB 4ERSH 5IV2B 4OD2B 1JXKA 5KS9E 2C3GA 1UT2A 3DMMC 3LXCA 3LKQB 1YO4A 3P4OA 4HZAA 2YPKB 4X5QA 1RUAH 1VEPA 4IGBC 4HIXH 1LQSR 4QOKE 4XCYA 3KDMA 4J4PD 4XMUA 1Z66A 2VL5A 4BSVA 4OGZA 3R1GH 3FNKA 2R56H 2IBBA 1KT2A 4K5PA 1NEUA 4AIZB 2E6JA 3L3JB 4BFGA 4DGYL 1JMXA 3OXSB 4KK6C 4CILA 1OAQH 5FHBH 4XP5L 2J2ZB 4ZXBC 4NWUH 3CXHK 4I0CC 1A6AA 1WIUA 5DEGA 3OHMB 1NPUA 3DRQA 2VDLB 4M93B 4RFOL 4N90D 3MUGB 2BFVH 1JVLA 4HUXB 4U1IB 4L8SB 1A1MA 3GSQA 4GRLB 5D1QA 4ALAC 4Y4FD 2E27H 4TKWA 1MW2A 4LASH 5D7IA 1MRFL 3UJTH 2VDLL 3P4NB 4E9QA 3G9AB 4TSAH 4XAWL 2FD6L 2AQSA 4G70B 4P5RA 5KOMC 5E24E 5EOCJ 2ITCA 3ZKND 1X5HA 4F7KA 4GAGH 1Q9LA 2VXTL 1IJ9A 5ID1A 2CBTA 3VMOA 4KKBD 3GMRB 3ZO9A 2WWKT 3QPXH 4HU8A 5DHMC 2F8IA 2D73A 3MJ7A 3RVVC 4K2UH 3W2DL 2QELA 4BFFA 3MI6A 2KZBA 5GGSY 4GS7C 5DQ9A 4QXTB 1IC5H 4XPTL 3NA4A 4KZ0A 3L4WA 4G6KL 1C08B 3CZUB 4MJ5B 1PD0A 4U1NA 3PWNB 3IPFA 4N9GB 4HG4J 4ZX3A 2VXQL 1BVKA 2QQKH 4FQJL 5ID0A 4M5ZH 5E2TH 1UADC 2AJ3B 4QF1A 1QKZH 5H35B 4Y8AA 4HCRH 5CIPH 2CPUA 3K6FA 4RRPG 4HF5H 1YSOA 4UWQB 3ZJAA 1ANUA 2AAAA 3ALWA 5D7KD 4BK5C 2FK9A 2V5TA 1MI5E 1J8HE 4W9DC 3AM8C 4JCLA 3L4UA 1FG9C 1MLBB 2DQGH 2VLKE 4XBGA 4HHAB 1LO3H 2D03L 2WUCL 3P77A 3P3YA 3MRDB 1DUYA 5KSBB 3CDZA 4CSZA 2DWEA 3ET9F 3C9NA 3KAAA 5CUSL 1YCSA 4RGNB 1I1CA 4WUKL 3UP1A 1CDGA 1MREH 5BRZB 1ZS8B 4PJGB 5F7NC 1QFWL 4HKXA 4LVNC 2WCPA 4PWHA 4OCYL 1MXDA 1JGUL 3AAZA 5DUBA 4PP2A 1HINH 3ABMB 4Z18A 4QRQB 5K5YA 4JO1H 1XIWC 2NLJB 4POYA 3BKCL 1DSFL 3IMRA 3VFOB 1RV6X 2YSSA 5DRZA 1YY8B 1F6AB 4FZ8L 2PP9A 4G9FE 1NFAA 4D9LL 4APXB 2G9HB 5CJOL 4DVRL 5HI4C 3UTSD 1AO7D 1AQHA 5DK0B 5AKSA 3G6JB 5GJTH 1TVDA 1B0WA 5D2NC 1OZUA 3DVGA 3CHPA 2J1YA 4HV8B 5D1ZC 4YHLH 3UAAA 1T4KB 4PVMA 5SWSD 4K94L 1GTNA 4C83A 2OZNA 3W11D 1HHGB 5TDPB 3TBWA 2BWDA 3RY4A 1T1YB 3I74A 4AK1A 4KO5A 3OGCA 2LVCA 4ALAH 1XDTT 3B9KC 4XTRC 1D7BA 3PY9A 1BJ1J 3K0WA 1NUGA 4W4NA 4CNIB 1BJMA 1FIEA 4NWTH 4GKNB 5EF3A 3WELA 3NACH 3FPXA 3K8KA 3LEYH 3BRDA 3CIAA 4PRDB 2HLAA 4AEHH 1S7TB 4JPIA 3WEBA 5ESVB 3MRNA 3VI3F 2A0LD 2XWBA 3OLIA 3K8LA 3P11L 1A6VL 1J1PH 1KEMH 1NCAH 2P5EA 1PZSA 3S96A 4EZKA 4NZ8A 2KLRA 3M46A 3V4PH 1TQBB 4A6YB 2WMPA 5K1VA 3V5HB 2EO1A 2X6CA 4HOWA 3RAJL 4K5LA 1UWEH 1SPDA 2O6DA 4FLSA 4N2LA 5F7KC 5ICYB 1A9VA 1U3YA 4A6YL 1LEKA 3N1QC 4HJJL 1FL5A 4NQEB 3AY2A 4BHUI 4ZNEE 1YA5A 4JJOA 4CMMB 3V0EA 4G8GE 4EN3D 3FQUB 3MJ9H 2ZWSA 3QRBA 1B88A 4N0UE 2X4PA 4NPJA 1A14L 2HXAA 1T89C 3DMMD 4FMVA 4LSQH 5ES4B 1BXXA 1P5UC 4FXKB 2FJGA 2IPUG 1XF5A 1VJSA 5TE7H 3RRQA 4GAJL 2E8YA 2JJUA 1AZUA 4R4BB 4MNQA 1D5XB 3VWJB 5BW7C 5TQ0L 3UACA 2G4GA 2L04A 3W1ZA 4M7LL 5D1QD 1QZ1A 2JTDA 5B39G 4BE6A 4CSPA 2YARA 4YC2C 1F0LA 3CPLA 4ENED 5G4MA 4L4JA 3TO4C 1AIFA 2GITA 3S4SB 1TIUA 5E5UB 2XV3A 3LDBB 3WKNA 1I8MA 3MUUA 5EH1A 1IT9H 4PWFA 1F5WA 3QUZC 4G8FA 1TR7A 3SD5A 2ZXCA 4OTXH 1AI1H 1UFUA 3PUCA 3Q6FA 3UAEA 5IVXB 1LLAA 4WI3A 3GMPB 1E7VA 3LN4B 4LCCB 2Y3NA 4PY8I 3NIFF 1FO0B 2QL1A 5EZLA 5L4IA 3TTSA 5EEXA 3X14B 5JO5A 2K0RA 3I2CL 4U6YA 2VO8A 1RSFA 3DURB 1G0DA 3PWVB 4LAQL 3WTTA 2AS5M 2BW4A 4JDEA 3N1GC 1FO0L 2FR4A 4Y5YA 5A2LH 4JO4H 1CBVL 4FULA 2OLDA 4NAQA 4NO5A 2PYEE 4UAOB 4J3OF 4P5TB 3WIIL 4Z3IA 5AVQB 1F8TL 4FG2A 5A43C 3E1ZA 2D7TL 3ZTNL 3CN4A 3SDYH 1XGYL 3ECBA 3RUGB 2XZAH 3KJ4C 3LKSB 1H8SA 1MCHA 2YPLA 3IGAB 4OZIA 2QTVA 4MHHG 4QHLB 1UH3A 2A74B 3OHXC 4JFOA 2FX9L 2ZKHH 4OF5A 2F68X 1O75A 2DD8L 3VU2A 2AJVL 3MRCA 3FTYA 2JB6B 1NM9A 2R51A 9PCYA 3OKMA 5CFAA 1IX2A 5ERWA 4R3SB 3CZFA 3GMLB 5DK2A 1NOFA 3HRZC 1MJUL 3HUJF 3MYJB 4PPTA 4PUBH 5IB4A 5JIHA 2F15A 3KPOB 3QEHA 1VESA 4ZMXA 2VMDA 4GSQA 3O3EB 4YNYB 2VLMD 3L3OC 2WKLA 5IBLD 4U4BA 1SUJA 3TASA 1UB6A 2IANB 2PWDA 4XPFL 2OL3B 5TDNB 5D8JL 5MEPB 4KK8D 1FP5A 3WIHL 3VB8A 4R8WL 5T1KD 1UWFA 5EB9A 1D6EB 3X1BA 1VEOA 1FNLA 4DO5A 1OE1A 2X70B 2OAAA 2OL3L 1OK8A 1KTLB 1NCWL 4NP4L 4XXCA 3VO0A 4ORGB 2HPOA 3OF6A 3MBEB 2IPKA 3IMTA 4NLHA 3MROB 4C58B 3IXAA 1P6WA 1T21B 4QNPF 4R96B 5CLTA 3SQRA 3CFQA 5K9OA 2F19L 3HR5B 3ABLB 4E5XB 3I6LE 3MCYA 1JJUA 4GXFA 2WYHA 2G30A 2JCCE 1TJIH 1S7WA 3DKHA 4RMVA 3RDTB 5IFHH 3GSUB 3ULVD 2MOGA 4DESA 4FKHA 4M8UA 3BO8A 1Q0EA 5H8DA 1V7NL 1HZKA 1NWPA 4YH6A 3BPLC 4L48A 3O4OB 4JY5H 3RPKA 4GQQA 2HWZL 2VXVH 5IR1A 4FQHA 4PJHE 2V3FA 1I1FA 3W0WE 4ACTA 3AGWA 3VB9A 4OIIH 2P5ED 1UGKA 1TZOA 3VXSB 4Z7QE 2DTML 4F37F 3B2MA 4MRCA 2F8OA 4PJ5D 3T4AB 3IDIA 5C0ND 2QDVA 2SEBA 3CZEA 2DM7A 2E6PA 4XOCA 1FH5H 3BE1H 4HUCA 1MWAA 2J5LB 2VLRD 4POZC 2LLNA 4OAWA 4YFLI 5HTSA 1KCSH 1CICA 4RESB 2EDKA 3TFBA 4YSPA 1CD8A 3FSZA 1P53A 3QDJE 3RI5K 1FNAA 4AI7A 1CXHA 3RVTD 2E7LC 1FZKB 3K72A 5JUEL 4HPYH 4IRJB 1I1AA 1S5IH 3L9RB 5HDWA 1OW0A 3QSKB 5DUMH 1QOKA 3ETBJ 5GGTH 5LKNA 1KLUB 5DJCA 4D8PA 2X09A 5J1AA 4Q7DA 4N8VB 1OANA 4MNQD 2OYLA 5JHLA 5E94B 4ZFOB 4LCYB 1XMEB 3FU0A 3TJHC 2GFBA 2WO4A 3OTTA 2DPKA 5DCCA 3L5XH 4HS3B 4XHJC 5K1NA 4XAKE 5GS1B 1MCQA 2RQ8A 4ZFOL 3GGWA 4Z95H 3T0VA 4BJLA 2AEWA 2OMTB 1BD2A 4WFFE 1LO0L 3RZCC 3SGEH 3LRMA 3NSXA 3V4UL 3ZHNA 3EGXB 2AKRA 2GK0A 1JTOA 3NSJA 4Y19E 4WJKB 5HVHC 5JIQA 4MAYA 1JNHB 1KPVB 2P42B 2RFXA 5F1NA 3HRPA 3EHBD 4ABVA 2VABA 4J1UB 5I2IB 3Q06A 4KTDH 2XWRA 2WAQA 2MCAA 1ZANL 1UHVA 2ZF8A 1XSIA 3GTTA 3ZL4L 5MENA 1R47A 2AK1H 3MACL 5DZAA 3BVWA 3VA6A 2V7NA 4Q52A 3TO4D 3ZMRA 1BPVA 1PSKL 3SBPA 1ZHKA 4E41B 3GRGA 5C0IB 2R0KH 1OCRB 3L16A 1Q9OA 2EKSB 4M6AA 1FNEB 1OCOB 1ZIBA 2RH0A 5AW6B 1T5XB 5ESQB 3U4BL 1KLFB 2WKOF 4D3CH 3C09B 1BXAA 3SJVA 3ULSB 1HVXA 1KIUA 5ADPH 5MEQA 4TLTA 5E8PB 4B9JA 4PJAF 1F41A 4OCSL 4JREB 3JWOL 3HI1A 4JDTL 1FDLH 2YPLD 4ZI8A 3ISWA 4S2SB 5K93A 2XTSA 2IG2H 4GXVL 4P4RA 1R3KA 4R26L 1WIPA 2CDEB 3GK8H 25C8H 3K6OA 1XF2A 1WBYB 2BSTA 4LCWA 4AYBA 3WDHA 2WC7A 4ZBJA 2Z8RA 3MCKB 5LAPA 3BSZH 3I75A 4I3RL 4K5OA 1RZIA 2KDGA 1ZOXA 4N2AA 1ZSDB 1UGNA 1OM9A 4F8LA 4B50A 4L0YA 2MKLC 2WLNA 2Y7QA 2VN4A 3ZHLA 3GJFH 4LBAA 1IMHC 3B7UX 5HPMA 5KYXB 3SCMA 1IQWL 4NXSA 3WO4C 3PGCA 2VW4A 3H85A 5BZDA 4UU9B 3MLVH 3FHAA 4X80H 1NGWA 4I7ZC 5JIIA 2H8PB 3S5LG 2DIEA 2YZ1A 3BFWA 4RBPH 3S5ZA 3OF6D 1XB8A 2KPNA 3BUYB 3BUDA 2BH0A 4RMBA 3MRGA 4OGQC 4XO3A 5IB2B 4QYOA 2IQAB 2EUXA 5DJZB 2J6EL 2OR9L 1BF5A 1XGRA 2NY0D 1FNHA 5I0WA 1RIHL 3NK3A 3DX9A 1RL1A 4L8CA 3LKPB 4A38A 5HGBB 3QUMA 3WS6A 2F5AH 5FHAH 1F3JA 3QXDA 3I6SA 5ETUB 5E03A 3I02B 5IW1A 2G3NA 1CG9A 3KR3L 1AGCB 2BHYA 3GBDA 2A9BA 2FNBA 2XY1A 3GDCA 1RJLB 2PMZA 4MAZA 5IEHA 5PCYA 4Y4KA 2C26A 3FAWA 2NW2B 1EZSA 4NS0A 4TSBH 2DTSA 4AV0A 1G9MH 1DVFC 5E1GA 1HSAB 4JQXA 1MFEL 5TE6L 1JERA 3ALPA 4YX2H 4LOVA 3ZT6A 4GEJA 1NCCL 4WDIA 1OWRM 4BRVA 2ARWA 3KD4A 2EP6A 2ZD0A 3F5WB 4LGSB 5DURD 5IFJB 1H3VA 4K7PL 4HUUB 5AW2B 2HX7A 3FRUB 4DP0X 4H8WL 3H9SB 2XRAH 1EEQA 4PRHE 4L3AA 5EO9B 1KDJA 4Y2NA 3DPBB 2ZXGA 4GAYB 4HFWA 1F97A 4ODVH 4Y7MA 3WEMA 2VN7A 1CICD 4AM0Q 1DBBL 2JELH 2JKNA 5F7DA 2A9CA 4F7EA 3F12A 4PGEA 4A2DA 1BZDA 4BFIA 4WO4C 4Q9RL 1QSEE 2YMXH 1I1AD 3SKMA 3ULUD 4NNXA 5I19L 3EYSH 2BNRA 3S7GA 3INOA 1ID2A 4POZD 5I6NA 3OKKA 4UZGA 5GRZA 4JPWH 2O5ZL 1E90A 4OH2A 5CD3A 3FCTB 4HWBH 5JLZA 5L4JA 2VDOH 3C5JA 4NQDE 5SWSB 4YDLB 1UQSB 1ERNA 1LD9B 3FQNB 3SZ6A 1T7VA 5DD1L 4PJXB 3EYQC 1AR2A 2BK8A 3ARYA 4K8RH 1DUZB 1UKSA 4Y2LA 2ESVA 3EJRA 5DJ2A 3GMQA 1UCBH 1KG0A 3FU8A 4ODUB 1B0RA 2ZJSL 2WZ5A 1LTXA 4MAYD 1SBSH 2W81C 3LCYA 4RDQG 3HZKB 4WEEA 2BSCA 2BJML 2XG4A 4WU7A 1KN4L 4AYMC 3UH8A 2GTWB 4PJBF 4KJPC 4GFXA 1INQA 2BMKB 3HNSL 2QLVB 1CFTB 3HI5L 4OJEH 2E4FA 4GW5A 2IEPA 3AC0A 2AJZA 4UBDC 4IDJH 2YXFA 4OJFL 1PS3A 4DGVL 4MDJB 5BVJA 3RHWF 1PZUB 2UZYB 2OZ4L 3GEFA 2VERA 3VFRA 3BQVA 5JIMA 3GZKA 4BZYA 4R7LA 1J0YA 15C8L 5CD5D 4H2AA 4U3CA 1JDDA 4HIHB 1RJYA 4QKTA 3GI9H 2YN5A 2HVBA 4XCYB 1QVOA 1T3FB 1E6JL 2VL5B 3QNZB 4WEBH 3QZPA 3ZO0A 4QEGA 2HH0H 1KCUH 2JE8A 3QWRD 4NC0B 1KT2B 3F00A 3SGJC 4XCCH 3H54A 4GRWE 1LVEA 1D9KA 1NC2B 3CQFA 1IGFH 4AL8L 1IC7L 3GYRA 4LCWD 1UUSA 2OI9B 2OTWB 5I1DA 1S3RA 4N6RB 4KMQA 4KH2A 1PPIA 1X5LA 4ODHH 3REVA 2OXGA 4ANXA 2ZIDA 3LQAC 2R1YA 2ADJB 4NCDA 5D7IB 1MY5A 1OLZA 1UURA 3EH5B 4WGVB 3U46B 1QPKA 3LN5B 2Z1KA 3QIWA 1DZBA 43CAB 1EANA 3L7EB 4BA8A 2ITCB 4ODSH 3FTGA 2WYZA 4UQ3B 5GS2D 3SCMD 2Z8SA 3SKNB 4E68A 4NSKB 4L5FE 5ID1B 3WL9A 2J8UE 1I1YA 4P4KC 4X98A 5LXGL 1EZLA 4CC4A 3OMIB 3KYOB 3LJ3A 3IU3B 3EBHA 3HVDA 4KGLA 3MJ7B 3WAJA 1SMOA 3MXVH 4IQHA 4X7EC 5DQ9B 1FNSH 5JHDA 1DHKA 5I8EA 4XNYH 1Q9KA 2I5YL 3UEZA 3CFTA 2ATKA 1UASA 3QYCA 5EUKA 1RJCA 4U1NB 4ELMB 1UJTA 3IT8D 4OFDA 4OB5L 1BVKB 2XIDA 5IHBA 5ITFA 2I9TB 1KGUA 4H5SA 3BPCB 3X1EA 4I18C 5HHVL 4LNRB 4JHVA 2OXHA 3OR6A 5A3IC 1G6RH 1BQLH 3D33A 4QHNA 4Z7UE 4L9LA 4EXPX 1A02N 4Y4KD 4BELD 2ORBL 1J5OH 2EJ1A 3H7LA 3EJCA 4UT6A 3VH8G 1GCFA 4JFZL 1HT6A 3KGTA 1YJDH 3WNPA 2WQVA 2QV4A 3GMNA 3U0PA 3P77B 3T65B 3FT4A 1ZHLA 1DUYB 4HWEL 2DWEB 3C9NB 2BHZA 1QBMH 4M61A 1RIVH 1M6UA 2ITDB 3DGGA 4TULH 1LEIB 3BYYA 4AYEC 1R5WA 1JNLL 3HAEB 4PP2B 1U93B 4MJ6B 4PJEE 5FYKD 3BWAB 4C54A 2A9ML 3C6LC 2VSDA 2G60H 2DH2A 2YSSB 2WIIA 3L4TA 2DLFH 4M4PA 4JFYB 2FH6A 4PCSA 1YUHA 1P6FA 3OC5A 1FIGL 2JCWA 1D7FA 1RZ8A 2YKKA 1I8KB 1AZVA 2BNRD 3QXUA 2Q8AL 3FQYA 3QFJE 3AXLA 3OV6A 3QZOA 4KNQA 3GXNA 1SOKA 3DVGB 1WGVA 3VXTB 4OGYH 2MNUA 4GAAA 2B15A 2I27N 1SXSA 3DC0A 2FB4H 1RZFH 5HYSG 3WV0A 4HZLA 3LH2L 2X4OA 1AE6L 3CU1A 2B2XL 2NZ1A 3PP3H 4M9PA 1XTMA 4DTGL 1GYUA 4C83B 5B38B 1IGIH 3ARGA 3G08B 1JIBA 3OGCB 2OJEA 2UV3A 1DQLL 2WM0A 3BRFA 2ESVD 1YAIA 3MOQA 3OJVC 4M03A 4UTBL 2Z1PA 4BZ2A 5HHMB 2JF1A 4KKAC 1ZEAH 4JBSA 4V33A 2HLAB 4IBZA 4P2OB 5C09E 3VRJA 5AB0A 1AR1C 1S9WA 1EHKB 5D5MB 3U83A 3EYQD 4N2CA 2Q6WA 2XWBB 3AG1B 1GMEA 3NIDE 4PJDE 2VH5H 2P5EB 5TFSH 1HIMH 5DHXB 3X3GH 4OKVB 1J48A 1HSBA 1M3IA 2YBGA 1IBBA 2P44B 1KTCA 2WMPB 1AHWC 3D1MC 5HDBF 5FB8A 3DWTA 5IUSA 1H3PH 1YEGL 3I50H 2OTPA 2VNCA 1DCLA 4BSJA 1BAGA 1LEKB 3F7PC 3SYCA 2VSMB 6TAAA 3CHXA 4IK6A 3ULVF 2NR6C 3PHOA 3MSPA 1L4IA 2H0JA 1A6UH 2DJUA 3X11B 2WNWA 2GTQA 2ZUQC 1UOVA 4KRPB 5F0MB 1T03L 3IGUA 3JYBA 4JJ5A 4HJUA 1U58B 3HC3H 4GRWH 4JRFA 3T09A 4ZO7A 5ISZE 3P0YH 5E0QA 4V2BA 5C2BH 3SE3C 1DANU 1I7UB 4K73A 2Q76A 3GFUA 4O2CB 5F0LB 1SHXA 2B7DT 2DMGA 5T3ZE 1TZAA 3LHPL 1V05A 3DRTA 4NOBA 4RMWA 4FTVD 1G1CA 3MV01 1LK3L 2K6ZA 3N91A 4NQSB 3ZTJG 2XI9A 3RURA 3UPCA 3U25A 4I0PC 3EIFA 4Z7NF 4DP9X 4F7MA 3FCUB 4OQTL 4ADIA 5CCGE 3IDNA 3QIWD 3O8XA 4AQ8C 1MIEH 1LO4H 3UJJL 3GMOA 2YMOA 4AM0B 2R69H 3M1OA 4YSOA 3ZE1E 1I8MB 1CTNA 1RUPL 2EDQA 2GJ6B 4PIRF 4OI8A 3EHBB 3KL5A 2APBA 3L08A 4GYBA 4Z7WE 3EOYG 1QTSA 4P8QA 2I7SA 3V5KB 2BVEA 5E1AA 4IEFB 4E42A 2G0LA 3GBML 4Z0BH 4AQEA 4JS7A 2Y72A 1LO2L 4WTZG 2IIJA 3UTTB 5JHDD 1OAXH 1OM3H 4F37K 4H25B 3GQFA 1QFUL 1CFVL 1QW9A 5K39B 5A1AA 4QHPA 3S36X 3V8CA 1KFAH 1DE4B 1F2QA 4JDEB 4LLYA 3FT2A 2FR4B 4Y5YB 2JIXA 5DJ0A 4JX0A 1KY7A 3C2AL 1FL6A 3B2UD 1MHEA 3MOBL 1SDDA 4RVBA 3VFWA 2B5IB 3GSNB 4NUGH 1TYEB 3F7LA 3ZGIA 2G3ZA 3N43F 4XH2A 4KJQD 1NCBL 1BQ5A 5KTEH 1OIOA 2JXMA 4BKLA 4ADJA 1M7DA 5CN3A 4NGHH 4OLVH 1IU1A 3QORA 1X5MA 3ECBB 1HOEA 5TPWH 3WNJA 3OD3A 4OZIB 2LT9A 5H4YA 1G7MA 5CR8A 3WKPA 5EU4A 5E9DB 1BYNA 2D4DA 1Z32X 4N5EC 4JFOB 4HKZA 3X13A 2AAVA 4N1EA 4Q97A 3CK0H 1JZ2A 5LDUA 4OCWH 3MRCB 3BFOA 3KPNA 5H37G 4ZOCA 3FN9A 5ICXA 3O3UN 5FDYA 3OKMB 1CU4H 1H19A 3H6JA 3PHSA 1TU2B 2XWTB 3CZFB 4DEUA 1WS7A 1WZLA 3V6OA 5IB4B 3HC4H 3GSVA 2LVEA 4NKIL 4XVJH 4G72B 5AAWA 2ZCKL 1RMFH 2H32A 4MQXC 4OJAA 4FEMA 5GS0D 3ARRA 1GGCL 1S7QB 5JORA 5EU6B 5GRUL 3RWHA 2F08A 1UB6B 5DC0A 3BP5A 4H88L 5B21A 5IQ9A 3BKJL 1ZGLA 1YRKA 1PLBA 4O02H 4GP4B 2O72A 1GYCA 5F7HA 1VERA 2CLRA 2OULB 1CTOA 2HRPL 4NM8H 4UV4H 5MI0B 3EYUL 2Y2TA 4B9KC 2EDEA 4ZOAA 3CVCA 3S34L 2F6AA 2IPKB 4TQIA 1JF6A 3IXAB 4NNPH 5HYQB 2Z6FA 3ZYZA 2R9HD 3MLRL 5K9OB 4MCMA 5GXBB 2DMBA 4QRTB 2TRHA 4BFEA 2XN0A 1U8JA 3N0AA 4LIQH 2R2CA 1S7WB 5CHNB 1OV8A 2F53B 4LSUH 1GKOA 4DW2H 3L3GA 4UB0H 4LSRH 1KACB 3LD8B 3U4EB 3PWPA 1E6OL 4LQ1A 3QH3A 5A2JH 5IB5A 2YQGA 4XPGH 1USQA 3STLA 4B27A 4TVPE 1YQ2A 1DJIA 1Z0MA 4PHXA 1ZLWH 2BPBA 4F9PC 1I1FB 3CTTA 4MNGA 1XR9B 3DTXA 3D0VA 2VKWA 4FXGB 1DDHA 1J86A 8PAZA 4XBMA 5CLYA 2EVFA 3U6XS 3VW3H 1QP1A 2JJWA 1PEWA 3BGMA 3SO3C 1ET7A 2Q9OA 4WNSA 1UT9A 2AC0A 4LRNH 4HUMB 1E4KC 1TEGA 3RGVB 1T83C 3MC0A 2YD9A 2SEBB 3G5ZA 3OMAB 3WJLA 2HCZX 3NRQA 5DRXA 3OKDB 1FHGA 3TT1L 3VACA 1E2VA 4OAWB 4PSRA 4EO5A 2A9NH 1QQDB 4FYRA 3FULA 1F4YH 4ONGH 2BHUA 3D39E 4QRPB 2AJSH 3F64A 1KXQE 2YUXA 2Z34A 3NVQA 2VR3A 1A0QL 2Y22A 2GEEA 1N26A 4JRXE 5AW3B 1I1AB 3D4ZA 4KO9A 3MRJA 1P0SE 4OIFA 3IDUA 4XMWA 5FYLD 5KSUA 4N2EA 1D7CA 1EV2E 2QQNH 4JY4A 3T0XA 2DLGA 1E8YA 1KJ2H 2AERT 5FUOL 2IFGA 5T3ZH 1RH8A 1XCQA 3JTTA 3A6BL 3KJ6L 4FFYA 4F57L 3CH1B 3VTAA 4UIKL 3OM3B 1F90H 2JQMA 3RVWD 5JHLL 4PJ9A 1U8QA 3O8XD 3BWUC 1BD2B 3D09A 3S37H 1MQKL 5DHVA 5KBKA 3JTBA 2YUZA 4HLZG 3S3PA 1A3LL 2AKRB 3V4VB 2GK0B 3FHEA 3O2WL 3VD4A 4L3EE 4R7VA 1K6QH 2RFXB 3CFDA 5F1NB 2VABB 1NEPA 1KCBA 4Z7VF 2J12B 4TOYH 4JPSA 5KJ4A 3V4VL 4ETYA 3NK4A 4NN5B 5DA0B 3ULUF 5E1IA 4U1LA 1Q0XL 5MENB 1M1XA 4HJGB 1DJSA 4IOSA 1OGTA 2V7NB 1V54B 3ARUA 1RZGB 5FO9B 1ZHKB 4QRAA 3L81A 5EO0A 3SOBH 5FDWA 2DQIH 4YXKL 4JN1H 3K80A 3GS4A 4O4YL 3HN5A 2EC8A 2JIXD 4YWGH 4GQPH 2JKWA 4I9WD 5AYUH 2EDTA 1N0XL 4X7SL 5I15L 1QG3A 5L88L 5T3XD 1C16A 1I7TA 4WFGD 4EUPG 2GBUA 1PFCA 4NB7A 3SJVB 3CSGA 1ZT1B 1RVFH 2VXUH 5MEQB 3GSRA 4R9HA 3FUJA 3QORD 1NUDA 1MCWW 1NIDA 1X5ZA 1KGCE 1FFOA 1YPZB 3QK0A 3WUWA 3ILQC 1R3KB 5CP3A 5DK3A 1D5ZA 5EA0H 3MV7B 1U8MB 4MQSB 2VQ4A 4LCWB 2JQAA 3TO2B 4HKJB 3BWSA 2H1PL 1FGNH 5CEZE 1NCUA 1JDCA 3ZKMD 1F4HA 3TV3L 2WUBH 3I75B 1B6UA 1RZIB 5C0FA 1AD9A 5IWLA 3JVGC 2GB2A 5DDHA 1Z2KA 3GMMB 1FVCA 2BS71 4JR9H 2GBTA 4HS6A 1NMBL 1EIBA 3T0AA 1S7XA 4LRIA 3TN0C 4Y8DC 5F7FA 1YEEH 2WZPA 4G71B 3W57A 2YXMA 4XNXH 3V0HA 4JE0A 3C6EA 5JOPD 4NJ9H 2AEOA 3QRLA 3EZJB 4OZFA 2WLIA 5G4NA 3PGCB 4KKCD 2YUWA 5BZDB 4JM2C 5T8IA 4EPSA 4KKZA 5TQ2H 1R5VA 1J1XL 1A1OB 1UC6A 4PJ8B 5DD5H 2FTAA 2OW6A 4MJIE 2DN7A 4BSWB 4FMKA 4YHKH 2NW3B 5E6RB 3WO3B 3SE9L 4G7YH 4UOW1 3TT3L 4F2EA 4QYOB 2WZAA 2G2RA 4N8CH 3NPSB 2XTJD 3HZMA 2VZ3A 4PS4L 3SKOA 4LU5H 3VYNA 2PYFA 1DBKL 2LOEA 2NY3C 3QXDB 1FVEB 4M5YH 2X9XA 3J8F7 3JYCA 5HGHA 5C0CE 4C4KT 5KW9H 1CG9B 2C3HA 2ENPA 1HWGB 4K3JL 4DKTA 4F2MA 3PWPD 2RB8A 4NNYB 4TNGA 4URKA 4XNAA 2BINA 5KJRH 1X4ZA 4ODWA 3QRGL 1E7UA 1JHKL 2ADFL 2WLMA 4OZGE 1PZ5A 1S9KC 4TVPH 1Z5LB 3FO1B 2R8SH 1KBKA 2H45A 4JFDE 3JWDL 4EBQH 5HI3C 4J3VA 1BVLB 5DVNA 3AVEA 3WTSA 3QHFH 2X6MA 3LYRA 4PBXA 3HPJB 4U33A 1C9SA 2QFRA 3IMSA 3TCXA 4BGLA 3EYVA 3TYFA 3MRFA 3QXWA 1H9DA 4HSQA 2AXJA 4EN2A 5INDA 1A6PA 4KQ0A 2KPWA 4HFWB 2Z4QA 3ARZA 4QJ5B 2DBLH 3A3YB 1RZ7H 3KPRB 5LWYL 2E47A 1VDGA 3QP3A 2F8VA 1AP2A 1GIGL 4OT1L 4ZUTA 3F12B 4PGEB 2J1WA 4BFIB 3LIZL 3P1VA 2A5UA 1OAYL 1AOZA 3SKMB 3D48R 1EJ8A 4HWUA 1XVSA 1FF5A 3FXIC 4DOHB 2VKXA 3L3IA 3LS4L 4XWGL 3STBA 2CRYA 1S78C 1GHFL 5AZ2L 5D1XA 4O5LH 1ICTA 3O6ML 3OKKB 3Q8EA 1MZYA 4RLDA 3MLTA 5F7EL 2VAJA 4J8RB 4AY0A 5GGRA 4IRSA 2V37A 5FM5O 2F0CA 1KJVA 1QSFA 4XNBA 4UUJA 2XACC 4YR6B 5L9DL 4LHUG 1ASPA 4K23H 4M7JL 4R5VA 4F7CA 4PJ9D 4YSTA 1A4JB 2EIEA 3NMEA 2FL5A 2FUTA 1CF8H 4JRYA 4MAUL 3T9WA 2HKHL 2ESVB 5DJ2B 4PGBA 3GMQB 5D4HA 3VXMA 4F24A 1MDTA 4HCRA 5C0GA 1KG0B 5CIPA 2WWNA 4BD4A 3BSGA 5DQJA 1HEHC 3MOAH 3BD5A 1MOEA 5I16B 4KAQL 1VADB 4FNPA 1J88A 3I6GB 1BQUA 4XO5A 3RWGA 4WK0B 4S0HA 4YO0A 2WLZA 1INQB 2OM5A 4B9FA 5FO8B 3L9EA 1JFQL 1K3IA 4Q0XH 2EDHA 4UANA 3ELAT 2R4RL 3K6NA 1TF4A 4HIJB 4M7KH 4M43H 5FCUL 2XQYA 2LGNA 4QRFA 3GO1L 2C1PA 2GT9A 5EBWB 1CR9L 1ND0A 1QI4A 4PJIA 2EVJA 4I4WB 3GRWH 1V55B 5I1JL 1YNTA 2NNCA 3LAFA 1RJYB 1GAFH 5F96H 1TNNA 2IWKA 4IU3B 5KANI 4GLRH 5C9KA 1N4XH 4XMVA 5L8KB 2DQEH 2AMGA 4GXUM 1I53A 3VXUB 1ZSHA 2GSIB 2IC2A 3HB3D 4OLUL 1AACA 1D9KB 3NA9L 1GC1C 4RX4D 3VYPA 2ZNWA 4KXZI 3ZDXB 2FSEB 4HEME 2PW1A 2Q8BL 5I1DB 4UM9A 4IBLT 1S46A 1NC4A 4GMSL 1YYCA 2AFNA 3B2VL 5CEZH 4LDEB 2X6BA 4K3GA 3BUQA 4Z8FL 3GXIA 3FAXA 5F9OL 5D93C 1PZCA 5D4JA 1BFVH 4RWYL 3GBNL 3JV0A 3B9DA 3HE6C 1A6TB 1Y6KR 5F9WB 3ILQD 2FEJA 1L0XA 4L2YA 2FBOJ 3ZE0E 1HHJA 5KSBE 4PJFB 3QZNA 2LAGB 3IETA 1ZV9A 2ITFA 3JZ7A 5T5FA 3MR9B 4RGNE 2WZPD 1NMAH 2W60A 5BRZE 2VE6A 3B2DC 3LN9A 4UDUA 4X98B 2CQVA 4A66A 3QXVA 2KHAA 2J3SA 2UYLA 1FORL 1FFQA 1FJ1A 3ZE2B 3H4HA 5E1HB 1Q72H 2EYTA 2QQLH 4OLZH 5M7QA 2HJKA 2YAOA 1DLHB 5JHDB 2D9QB 5I8EB 5CF3A 3TZVC 3V4PA 4MQTB 3QJXA 3QJFB 5F97E 4JHBA 3GHPA 3KLLA 3G6JE 4TUUA 3BN9C 1KEGH 2IGLA 3CC5A 1FZJB 1KTRL 5ITFB 2BSBA 5KS9A 3A5VA 4EDWH 4FI6A 1G94A 5D72H 1JZ5A 4GMTL 3FMGL 2I69A 3M7FB 3OR6B 4QOKA 5D2LB 2EQDA 5FWRA 5I1GL 2K9UA 4JKMA 4L9LB 5BZWA 3MJ9A 1KWGA 1U95B 1CFQA 4KO6A 1GOGA 4TV3A 4B95C 5AW5B 1FGVL 4N1CA 3M7OA 3MRQB 4AQ1A 1UB5A 4DP5X 1F1GA 1B3IA 3KYMA 1KYAA 4S1RH 3AM8A 2AQNA 3BH9A 3GMNB 4KTYA 3T0WA 4HOMA 2EDLA 2C9UA 1NMCC 3FT4B 5FGBC 4QLRA 4LE8A 4DPCX 3U0TA 3NZHH 3MRRB 3P4MB 4LBEB 4M61B 4FNLL 1XR8A 3RWEB 5DJXB 3LZLA 2E9WA 2YMTA 2R29H 4EDXB 5HVFB 2A9DA 2DIAA 2BIMA 2FHBA 3E8VA 3BKYH 3ME0B 1XGZA 2O26U 1SJHB 1WIOA 3U7AA 4A2EA 4QD2E 1GXEA 4P46A 4YHYC 2WIIB 4HOZA 5JZ7C 1BM3H 2P8LB 4H13C 5CZVL 4N5UA 4FYQA 1CLZH 4NQEE 4G8AC 3AXLB 4ADGA 4KROC 5D1XD 4KZEH 1CYXA 1YEJH 3POCA 5AOMA 3W5NA 5CJXC 3CCHA 2ZXQA 3L5WB 5TH2B 2C9SA 4IRSD 3WXVL 4DVBA 2FO8A 3INUH 1Q1JH 1L7IL 1QSFD 1X3DA 3O2DH 4MGXA 1KFGA 4HZLB 4NPYA 2VWEE 2X4OB 4XCEA 2VC2H 3PGFL 5J11B 5K1JA 3QFDB 3CDGA 4NAJA 3E0GA 3ARGB 5T1LB 3L4CA 2NUTB 4NC1E 3TGXA 3TEWA 4JRYD 3QJUB 3C8DA 3FH5A 4Z7OF 2WAHA 4P23B 3VXMD 3K6SA 2MIZA 3MRKA 5AOJA 3MBXL 3M6DA 4AE1A 3IDMA