2J2ZA

X-ray structure of the chaperone papd in complex with the pilus terminator subunit paph at 2.3 angstrom resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
216
structure length
216
Chain Sequence
AVSLDRTRAVFDGSEKSMTLDISNDNKQLPYLAQAWIENENQEKIITGPVIATPPVQRLEPGAKSMVRLSTTPDISKLPQDRESLFYFNLREIPPRSEKANVLQIALQTKIKLFYRPAAIKTRPNEVWQDQLILNKVSGGYRIENPTPYYVTVIGLGGSEKQAEEGEFETVMLSPRSEQTVKSANYNTPYLSYINDYGGRPVLSFICNGSRCSVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone/surface active protein
molecule keywords CHAPERONE PROTEIN PAPD
publication title Molecular Mechanism of P Pilus Termination in Uropathogenic Escherichia Coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 42
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2j2zA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2j2zA01
4WEBL 3LV3B 2OBGA 4RMWA 2VWEE 4POYA 3PE9A 1J1OL 1OGTB 3BMWA 1I4FA 4F7CA 5I8EB 4GXVL 1G7HA 3U1SH 3CNKA 1IQWL 5FUCE 3GHBL 2APTA 5HHPA 1J0HA 1FZKA 4QTIH 5BZWB 4LLMB 4YHKL 5B4MC 3WHXA 1WSST 4QYOB 5E8PA 4RRPA 4RX4A 1INQA 1ADQH 5EU6E 4JE4B 3OJDB 4R3SB 1YY9D 5C0EA 4G6KH 4YZFF 3BGFC 3FQTA 3WUWB 4DJMA 2NX5A 2OMNA 1JMXA 1KXQE 2KQNA 4YE4L 3O3AB 2D2OA 3LCYA 4NKDA 4PB9L 4ZQKA 3DX8A 3MRPA 1XT5A 5TF1L 3MBEC 4OI7A 1CE1L 1QRNB 4WFGD 3I02A 5E24E 1UXWA 3U36B 2VH5H 4XRCB 2R2BA 3QUMH 4HZAA 2BVPB 1N7MH 1LILA 3WJLC 5C0ND 3HNVL 4J3WA 4XCFH 4PB0L 4QNPE 1XF2B 1DBAL 1JRHI 3ALWA 3UTTA 1AO7A 3PGFL 4NQCE 1BBDL 3LS5H 4DGVH 2D7OA 3HMXH 1JTPA 1GZPB 3VH8G 1RIVL 2MJWA 4EKXA 1FG9C 4DAGH 3SOBL 3DXAD 1U8QB 1MRDH 1RJCA 35C8L 3QUXA 4KWUA 4H1LG 4JPKH 4HIXH 2YSSA 1OP5H 2A1WL 4Y2DC 2EH7L 1AR1C 3NCMA 4HUNB 4MDJA 4YWGL 25C8H 4IRSB 3TYGL 3NIDF 5CGTA 3OR6B 2X4TB 4LSQL 5EORL 2E7BA 4Y4HD 3HAEA 5FV1L 4DGYH 2XKUA 1MHPH 3AS0A 4IRJD 3O0RL 1C08A 1JPST 2YC1B 3E2HB 5E4EB 4PIRF 1TPXC 3MV7D 2KDGA 4IOIA 3O6FB 1QACA 4FFWC 2MQ0A 3N06B 5IVXB 1PZUB 4P46C 4LKXA 3W9DB 1CU4L 1GAFL 5DHVA 5IW1B 4GBXB 4XP1L 1GVIA 4Z95L 3WHE1 1A64A 4CBPA 2YEZB 5CP3H 5K93A 4F7PB 5JIPA 1RZ8B 4QRRA 2EE2A 5DVNA 2R8SH 1T1XA 4MNGB 1ZVSB 1J5OL 2GI7A 4PJGA 3SQOH 3CSBA 2VDLH 3W39B 4L3CB 5L9DH 4M7ZC 1ZS8A 4HWBL 2DQGL 3HC4L 1KELL 2FR4B 2VQUA 1BAFL 5JMRA 4LQ1A 4KMQA 5LWYH 1CGUA 2C1PA 1XR8A 5JXAH 2FJFA 4N0FB 3TT3L 1BD2E 1P84K 4NN6B 2XOTA 4MNHA 3GI8L 5J3HC 1E4XI 4WDIA 2PW1A 4PJDF 5HD8D 1WBXA 4HGKC 4TQEL 3EW3B 4QWWD 4GAYA 5A3ID 4Z7UF 4BH8B 2DYPB 4X9HA 1QZ1A 4PRHB 3R06B 3QXVA 3U7YL 1K9TA 1LMKA 5GXBB 5GGSY 5F3HA 3HRZA 4X4MA 2VDNL 3VI3E 4LHJB 4LU5L 1T89C 1NJ9A 3S34L 1LNUB 1Y18A 1U3JA 3BN9C 1U91B 4PJ9B 4AL8H 3MLUH 5F7EH 3BUYB 5DJAB 1HEZA 3VFWA 3RTQB 3TT1L 1FSKB 4WRLA 3GKWL 1FNGB 3MXVL 4ZUWA 1UZ8A 3DX7B 4NCC1 2IQ9L 1F42A 4NBZB 5I73B 1J0IA 3W11D 1V5JA 2VNCA 4YXKL 3VXUE 1FAIL 2C26A 5CCKL 1TTUA 2WANA 3H9SE 1FAKT 2HJKB 4LIQH 4H26A 3DX9B 5D1XA 4PGEA 1KG0B 4KKNA 4S1SL 3MJGX 4R8WL 1YEGL 1WUNT 4B41A 3QIUA 2A0LD 3FB5B 4DKFL 4M6MH 4X6FA 2NZIA 1K4CB 5A1AA 4G8FB 2M2DA 1OAQL 1N4XL 1FRGH 3QNYA 2FSEA 5HGHB 1YC8A 2EO1A 3MRQB 3C8DA 1V3JA 2RFXB 3EOBA 3SDXE 5HYJB 1CFNA 1UWXK 1CIDA 2HAZA 5EU3A 4KVCH 4M1GL 1R5IA 4X6CA 3QG7H 3X13A 3CD4A 4MZ3A 4CMMB 4KY1H 1FVCA 1A02N 1F2XK 1GOGA 1WWCA 3KPRA 5JW3L 3WFCL 1DVFB 4A6YA 1C7TA 3QJFB 3UMTA 4P23D 2Y4SA 5IBUG 2P45B 4NQXA 5IMKA 3UO1L 1XGRB 3LPFA 3G08B 1KB5H 1JHKH 1QNZL 2IC2A 1N26A 5DGRA 4LEOA 3TBTA 3L95B 4MA1B 1K5NA 4MXQC 4YXHL 4WNQB 3BSZL 4J3OC 4K3DL 5GRUH 5JW5A 4HJJH 4KI5C 5D2LA 1FZOA 4BQCA 3KVQA 3V5DA 3SJVE 1YC7A 3UYPA 1IGJB 4P4KB 1RIUL 3NZ8B 5B38G 2Z92A 3DYPA 5HJ3B 4ZPTB 4WI4A 1AY1L 2G9HB 1V8HA 2Y07H 3V4UH 2DL9A 3RWEA 3ZTNH 3JWOC 2ZUYA 2P4AB 5F8RC 4OLVH 3UBXI 1EHLL 4HS6B 4P9MH 3W0WE 4FQJH 5FA3B 1KPVB 3KPQB 2ITDA 3U6RA 2FLRT 3H7BA 5CSZB 1BMGA 3MLRL 4ESKA 4OCWH 4NC1C 5EUOB 1JZ4A 5A3IC 1IM9A 2OL3H 2ENYA 3DMMC 3MV01 2DQEL 1IAMA 2EIEA 4IS6B 1DDHB 5BZDB 4EOWH 5FO7A 4KK6C 3W9EA 4OZIF 2L0DA 2W59A 2A9NH 2DQJH 2CXKA 5D7IF 2NTSP 4OD3L 2ZG1A 4ZTPH 1ZVHA 3ULUL 4U1JB 4AMKL 1AH1A 4JRYB 1NGZB 3HB3D 1HNGA 1D6VL 3S5LA 3BRFA 3VGAC 5L2KE 2X42A 2AJVH 3MR9B 1UM6H 5IVNA 2HJFA 3DARA 1NCNA 2YD5A 2HKFH 1GC1H 3HS0B 3WNOA 2XA3A 4FFZH 1LQSR 4PG2A 1UCTA 1M4KA 1IMHC 3PHQB 3LMJL 1YNTB 4PJAF 4K71C 1DCLA 5J9PA 1JV5A 3TBSA 3F5WB 5KAQG 3RZWA 1NCCL 5ACLA 5MP6L 4MS8D 3MUZ1 3JXAA 3KWWB 4U1KB 5JO5B 1HI6B 3D69A 5FO9B 1C5BH 2B5IC 2O26U 5M7QA 4Z0XA 3CH1B 1XGPB 5E5RB 5DVKA 5E08H 2WUBL 4U7MA 3LY6A 2A0LC 4PJIB 3OB8A 4QXTA 1BOYA 2YMXH 3MLWL 4QXUL 5HYFA 3N1QC 1ZT1B 2AVGA 1VFBB 2ZJSL 4UQ3B 5HHOA 5GIRB 4R7NB 2VDPL 4P0DA 3MRHB 2G60H 2IEPA 4RISH 5JOFA 1O0VA 3MJ9H 3BH9A 3GIVA 4OI9A 3I85A 5CBAA 2HWZL 2CKBH 3MBEA 3MRLB 2E8YA 3MRFA 3CDCA 1TQBC 3DUUA 3P11H 4TSCL 5C08A 2ILLA 1W0VA 2HFEA 1NAML 5L2JA 2DKMA 3L3KA 4RCAA 3WJLA 4NM8H 4L3EB 2B1AL 5CINH 3PWVB 1NCTA 1SEBB 4QNPF 4V2CB 4GSDL 4N1EA 3LKQB 3UEZA 1JYXA 3OR7A 4NQEE 5FO8A 2L4OA 3OKNA 3TBVB 4UOW0 3RKDD 2VR5A 3KPPB 3FO1A 4K9EH 4XNQB 5TDPA 2AXHA 4IJ3C 5T1LD 1S7VB 3JTSB 2OZ4L 4HFWA 1AXTL 4Z7VB 5JHDD 4I77H 4MA8L 4D8PB 5KSAA 3MRCB 4Y2DA 1BVKA 3HLAB 2EIBA 4Y19D 4KAQL 5DI8A 1W72L 2EIZA 2FX7H 3IT8D 4LCIL 5GRJL 1R3JA 4OCXL 5MERB 4KUZH 1BX2B 2AP2A 5KS9B 2YKLH 3KYOB 1YJDC 2EEBA 1FGVL 3CFEB 4FNLL 1K6QH 1AP2A 3OAZH 3SKOA 3N0PB 3HC0A 5HHMD 1EGJA 5CILL 4PP1C 5IM7B 2VLRD 3C5ZD 4QF1B 2EEAA 4UILL 4FQ1L 4HUUA 5FYLE 5ABDE 4P46A 4TULL 1LK2A 4L4VB 1AFVH 1AQKH 4KKBD 3GSRA 1S7SA 3UTSE 2P5WB 2OI9C 4XNUL 5DD1L 5DURD 2XV6B 5F7DA 1VGKA 1QSEA 4WHDA 2O61B 4LNVA 2F8VA 1JNJA 4XMLL 1TJHL 2WWMD 4ODWB 1IEHA 1L0QA 3O3EA 4Y4KD 1SEQH 3GSXA 3RNQB 1XCQA 1RJYA 2F5AL 4G8GB 5IBTH 3QIWB 5KW9L 1AGFA 4K3JH 4MNGE 3EYUH 3TCXA 2PETA 4HWUA 2XWJA 4M48L 5HYEA 3QUKB 4KKCC 4LASH 1YN6A 3A67L 5DGQA 2OQJB 4CVXA 5AG9A 1A8JH 2XQBL 3LVEA 3OKDB 1Q72H 4X80L 4XVSH 2VLJA 5JDSB 1KTDA 4L8BA 2K7QA 1LE5B 3PG2A 5TE6H 4RMVA 5D8JL 4OZFH 2OLDA 3UPAA 3G5ZA 1IEBB 3NMEA 4Y5XA 4XP5H 1VCAA 3VI3F 1MPAH 1RUML 1T89A 5IT2H 3FQUA 3S3PA 4AY0A 1J8HD 4XC3L 1MFAH 5GS3A 1F6AB 3SO3B 2JCCE 3WIIL 1CT8A 2HH0H 2G5RA 2XWBA 1I9JL 2V5RA 1VFOA 2VSDA 2DQFA 5C70A 1RZFH 2N7AA 4M3KB 4HGWB 5EO1B 3QP3A 4L5FH 5INCA 4OBSA 3KPSB 3OAUH 3ARSA 4ZYKB 4FQIH 3BKMH 3VXQB 1A1OB 3LIZL 2HVJA 1RUKH 1ZEAL 1KEML 4MA3B 4QHKJ 4Z8FH 4KZEL 1MHHB 1B0WA 5ID1A 3FB6B 4C54A 2H1PH 4R4FH 1MLBA 4HCRA 4H8WH 1DLFL 1Q94B 3UBXB 1A7PH 1FYTE 1G7MB 5C09B 3BPOB 1ULVA 3UCRA 5FOJA 3KXFA 2NY5L 3NN8A 3V5KB 1IGML 1R0AH 4WTWA 1X7QB 3F12A 2SEBB 4MX7A 1L9MA 1IAOA 5AWNH 1D9KD 1T7VA 5D5ME 2I07B 2BZDA 4LP4A 5HGAB 1AI1L 1NMAH 1G0XA 1NGPH 3VI4E 3SE9H 3MLZH 3X3GH 2Z31B 4QHUA 3DXAA 1NCBL 1RJZA 4LLUA 3G6JE 3GSVA 3SDXF 1TIUA 4U6YA 1AGCB 3HPLB 4KQ4H 1MI5A 1FJ1A 4OFKA 1CD1A 5SWQA 3MROB 1RMFL 3KPLB 1MF2H 2Q86B 1PAMA 5SWZD 4Z7OE 3QFJB 1MREH 4LRIA 5HYJE 3L3JB 5T3XH 3CFJB 5TE7L 3WO3B 3QUMA 2DAVA 3OX8B 3IFPA 3MNZB 2YPLB 4CJ1A 4GKZB 5JPMA 1A9BA 4WUUA 1ZVYA 3B9DA 2VZOA 4XCCH 1PG7W 3QRGL 2BNQA 5CWSA 8FABB 3PV6B 4XXCC 1YEEL 1Q8MA 2UZXB 2HRPL 3JWDH 1BGXL 2XTJD 2VLKA 5GRYA 3DO7B 3QIBD 1H3WM 3KNBB 1HDMA 1V3MA 4FHBD 1YN7A 2WWMC 1C5DB 4K7PX 4QXGL 1LWRA 3V6ZB 5DK0A 1BBJB 2DICA 1AGBA 5E9DA 5J57B 3SE8H 3PWLB 1FO0L 4Q6YA 1NCDH 1KIRA 5GGVH 3LRSB 5E00B 4POUB 3BZ4B 2IMNA 2BJMH 2D7TL 4OGAC 2BOCA 2PXYB 2FJGA 1I9IL 2GIYA 4XCYB 5DJXA 3VFNA 2YPKB 4PFEA 1ZE3C 3R8QA 5C9JB 5T3XD 2NZ9C 3IFNH 1Q1JH 3D48R 3NFNA 4Q6IC 3TJEH 1K4DB 5C0IB 2D31B 4FG6C 4P3DB 5DJYB 5JOEA 5IB2A 4ZUSA 1P7QB 4WU7B 5H2BB 2VABA 3QH3A 1I8KA 2FBJL 4Q9RL 2NY3B 5CP3A 1DBMH 3W5NA 4Y5YC 4YDVA 4DZ8B 3GBNL 2CSPA 2FX9H 1TNNA 5EUOE 2WW8A 1KFAH 3MFFA 5T1KD 2ADFL 3ZYIA 5IQ7L 3V8OA 4DEPB 5E8NB 4LMQI 2BNRE 1AE6L 4HKZA 3NPZB 4U6VL 3O45A 3O11B 4GXUN 4KRLB 5D6CB 3I2CL 4MB3A 5GS2H 3IDMA 4JRYE 3IDYB 1UKTA 4JFFB 3W2DL 3CVIH 5E6IC 2JELH 4CN1A 3PWUA 1CGYA 2B7DT 3PQYA 5GISL 3ILPB 4R90L 3KPMA 3V0WH 4K8RH 4FMFA 3MX0A 3ARBD 3QXTA 1YY8B 5SX4H 2P8MA 1A6ZB 1SVZA 4I2XA 3T0EB 4ISVA 3QXAA 4U0RC 3BPLC 1G7QA 3CK0H 1W0WA 1Y0LA 2DJSA 1JNNL 2A6JA 1I7RA 1IFHL 5E6YA 5IKCB 1OOAA 1OCWH 4WW1A 3CFCL 2F9BT 4XI5D 3GGWA 2EYSB 4C57C 4JDVB 1QLEH 3VXRB 4J1UA 5CIPH 3PDOB 1FNEB 3IVKB 3OXSA 4PJIE 1CE6A 2OJZL 4X98B 5GS2D 5I1GL 2VXVH 4PJCB 5E1AB 3KYAA 1MCOH 2IAMB 1QLFA 3QDJB 1H15B 4J3SA 4R2GD 4IDLA 4JRXD 2QJDA 5D7JD 4M8QA 4BM7A 1Z2KA 5E8EA 5GGRB 4AENB 5BJTA 3PP3H 3EO9L 2PYED 1RV6X 4LLQA 2FATH 4K8RD 1RZGA 2IPKB 1ZHBA 3V7AE 4QRPB 2R0WL 1WZ1L 2EDXA 4OQTH 4NJAL 2OJEB 1ZLUH 2XTJC 1LE9B 3F8UB 4AEIL 4X9GA 4AEHL 1ZWIB 1PD6A 1X4XA 1MVFA 1QYGH 1YEJH 3HFMH 4NQVB 4G42B 3RWJA 5KJRH 1ED3A 1IAIH 4ENEC 1LGVA 1DEDA 1M71A 3FRPA 3RDTC 3IKKA 1FL6B 3IJYB 4BZ1H 4HXAH 1J1XL 1VGEH 4NM4L 5D6DC 2HVKB 3MYJA 3EDJA 3AAZA 4U6XA 3RWGB 2XA8H 2BY2A 4Z7VE 3MCKB 1FLTX 2AEIT 4QHNB 3H6JA 4TPRH 3L1OL 1MQKL 1NUNB 5KSUA 1JK8B 3CUPA 1I85A 2ZCKH 1KCSL 3T4AB 1AHWC 5MI0C 2CPCA 4XBEH 1JFQH 5DRZA 1EERB 4LPCA 3TO4C 1KENL 1RFDL 2VC2L 3THML 3DTXB 1J87A 3RVTC 1MCNA 5CD3A 1J11A 3JWDC 4OM1H 5GSVB 2V5SA 3O2DL 4WWKC 1LP9B 4M7JL 3BDBA 4JKLA 5DHXB 2P5WE 4RQQA 4U1HA 1UB5A 4BH7A 4POZD 1EK3A 4F7CB 3ARWA 2PTVA 3ARQA 5I1DA 4WV1C 4C58B 5HHPB 5CFHA 4U7SA 1IGFL 5LAXA 3QDGE 2XN9A 3WE6A 4FQHA 1INQB 4ZFFB 1KN2H 5EU7E 3VWJD 5SV3A 4P59L 4O00A 4DZBB 2WBJB 3TM6A 1RZJH 5DD3L 1ZLSH 3FQTB 4Q0XH 2OL3A 4XBPA 4ZFGH 1A6VL 2JJVA 3SGJC 4NOFA 3S97C 5I1JL 2ICES 2IMMA 1PSKL 2H9GA 4I3SH 3UC0H 1PJ9A 2HT2D 5J1SC 3S4SA 4U1IA 1R5WA 1KPUB 1CLCA 1PX3A 3MRPB 2JB5L 3LSOA 4YR6A 1KTKE 2JCCF 5BXFA 5GGTH 3VDBA 3HPJB 3I02B 3QWRD 1QSZA 1KJVA 3OL2A 2XZQH 5I15L 1MH5A 2K7PA 1T20B 2R2BB 5ETUB 5I8KH 4NQDA 4NWUL 4BFEA 2P8PA 5IIEA 1ZV5A 1C5CH 4JG1H 3P4NA 1NKOA 2C3VB 4NO2A 2ICWI 4PJHA 3S36X 3UTTB 2C4FU 3B2UC 4WO4D 5KVDL 1WFNA 3B9KC 1ACZA 4MVBD 4JHWL 1C16B 1EZVY 4EI5C 3QUYC 2R29L 4JB9L 4LGRB 3FO2A 5EG6C 4KGLA 3O6KL 3QUXB 3ES6B 5F70A 5F88A 2YSSB 4KXZH 5C07E 1NGYB 2UVEA 1MCFA 5DK2A 4MLIA 4AT6B 1H3PL 5TQ2L 2Z93A 4LVOB 2WLYA 1WQVT 1FDLL 1RZ7L 5D5MF 3OBAA 2NXZB 2EDRA 3VI4F 4JEGB 4JM4H 3Q6GL 5D1ZB 3U0TA 1OP3K 3PL6C 5D1QB 3G6JF 4MD0A 4OD1L 5J7CC 3WS3A 2ESVD 2OXGA 4Y19A 3HE7B 3ZT7A 1F2QA 5ICZB 1FIEA 1KIQB 4ODUA 1X5HA 4C55A 4LKXB 3MJ9A 3QG6B 4LRNH 3MV9D 4RAUB 3UJTL 3C09C 5DTFB 4M02A 4Z0BL 2PW2A 2CKBA 3RWDA 5M94B 4QRRB 2X6MA 3V2AR 2D7MA 3GSNH 5FKPB 2BVOA 1NAMB 1T1XB 1HQRA 1G1YA 4ORGA 3DHJA 1CGXA 1FORL 4PLJC 1T04A 5EZIH 3P0VH 1BJ8A 5E99L 4DOHE 4JM2D 4QT5A 3PWJB 1U9KA 3QFJE 2FEDD 2X4RA 1Q9OA 4XXCA 2FECL 3BIKA 1OTSD 2XWTA 2VWEC 2FJFB 2Q76A 3F7YB 4MNHB 3VGHA 5I9QC 4HIEB 5JLZA 1GPOH 5FUCC 3ZKSD 3MRJA 1BPVA 1F3DJ 2GJJA 4Q97A 3LAFA 4TUJB 4HXBH 5TQ0H 1F58L 1W72B 4HKXA 3BQUB 3CFKB 2BSSB 4AK1A 1N8ZB 2ICCA 1F4XL 3MLTA 4GJTB 3E6FB 4JPIB 1UQSA 1WTLA 4JQVC 3U4BL 3HRZB 2FL5A 4OIBA 4JZJC 2E8ZA 3CFBA 5AEAA 5EA0L 1J12A 5BVJA 5JZ7D 2VAAA 4M1CC 4XPGH 4ZS7L 1CI5A 4EDXB 4OD2A 4GW5B 1KGCD 5DUPH 1PVHA 1T2QL 4U1GC 5IVZB 3VFWB 1HSBA 2PF6A 1UVQB 4LPXA 1DQQA 2P43B 2H2SC 3FOMA 4WEMB 4WGWB 4FOMA 3SKMA 4KQ3L 3NVQA 4Y5YA 4PRPD 3D0VB 1MJ7L 3CVHH 4X83A 2NNAA 4LBEA 5EUOF 1UWXH 1RK0B 2WINB 4XVUD 3RWFA 4NT6A 2NY2B 2B1HL 3QJHB 2VR4A 3U82B 1N0XL 3SQBA 1ZHNB 5HDLA 1A4KA 4I3GA 1XFPA 4XBGA 3VXTB 4ZNCD 4X6BB 2QADC 3BDYH 3MA9H 4ZSOA 3GSWA 4PGEB 3RHWK 5DJDB 2BSTA 1OGAA 4WVRA 4PRDA 5LBSL 3MRNB 1JL8A 3HUJE 2OR9H 1AKJD 4L9LC 3AC0A 5DVOA 3L3DA 4HFUL 2VDOL 5E6IA 3T0VA 1RZJC 3BT2L 3ILQC 5J13C 1OF2A 1RU9H 3EOBB 3QB7C 4OZFA 5F7HA 4UDTA 1CFNB 2R56L 4TN9A 5IFAL 1CG9B 3AROA 2IH3A 3A6BL 1QKZH 4HMEA 1T1WA 3IRPX 4YXLH 5EU3B 3MRMB 4WW2B 3F7RA 5ILTL 5DD5L 4FQLL 1I7UB 4JFXB 1R24B 3VG0L 3T3MF 2P44B 5CJOH 3WDIA 1VACB 4XGZA 3ARDD 1E0OB 1R3HA 3KPRB 2ZUWA 5LVEA 3QRFM 1SJEA 4KTEL 2NLJA 4UINL 3UTQA 2DTML 3MUY1 4JJ5B 4ODBD 3GRWL 2DMKA 4NQXB 1DBJH 3WD5L 3TJHC 4PJIF 3L3OA 2JJUA 3E3QE 4PRID 3SPVA 1K5NB 1EHNA 5SWZA 2XG4A 3BRDA 1CR9L 2XT1B 5CZVL 4G3YL 4EEEA 5JW5B 1E27A 2B2XL 4DW2H 4XPHH 5FHBH 2BFVH 5D2LB 1FZOB 4WGVB 4JFQB 2BVTA 5DLMH 5ADOH 3OWEA 1WFOA 2NY0D 4AIZA 1HYSC 3O9WC 1G0YR 2CIKA 5EB9A 2APBA 5BRZE 1E6OL 4PJCE 4FTVA 3L6FB 2P5EA 1GYAA 5L6YL 4PJDA 5I1CL 2ID5A 4Z7UA 5DEFA 4NRZB 1KXVC 3MV8B 3SDCB 5ECJE 1A1MA 1CTOA 2ITDB 4YHOH 3AMKA 1BEYH 3U6RB 4B7LA 1FL5B 5HVHC 5C0CB 3RQ3A 5L88H 3RDTA 3LKSB 4GUPA 4R9HA 2OP4H 4DVRL 5BMFH 5E94A 2D9CA 4YAQA 3TZVC 3HZKA 1NFKA 4Z7VF 5L2KD 4GMSL 1N6QH 4OFVA 3AREC 1RHHA 4NO0A 4TTDD 3VXMD 3ZDYE 2HLFC 2ICWB 2X4SB 4NKMA 3C60D 5ACMA 3OHXB 3TF7C 1CLZL 1G9MC 1ZANL 2OX5A 1MAKA 1IC7H 3DYMA 4HBQA 3TO4A 4Z7QE 5KS9F 4LSSH 5BS0B 3RZCC 1MJJA 1CQKA 1DEEA 2C7UA 5IR1B 4JANB 1VEMA 1U95A 1U8NA 4WCYH 2F54E 4WWKA 4X0KB 2GTWB 4YGAB 2DQDH 3JWNC 3TPUA 1P84J 2GJ6E 1JV5B 2EDJA 2GAZA 4OZFG 4CAGA 4L4TE 5KVMC 5DZLA 1PYWB 2EICA 1L7TL 3MBXH 4JO1H 5IB4A 2ZOLB 4NYLB 2V6HA 3D69B 3GHEL 4W4OC 4WV1A 1XEDA 1PEWA 3ZKXC 3F6LA 2BOBA 2EZ0D 5IB1A 1U8IB 2FYYB 4WTXA 2IG2H 1N64L 5FAAA 4OLXH 3ZSTA 3BZDA 1DQTA 3MOBL 4IOFD 3MRIB 5ALBH 3WFEL 1CK0H 3BGFB 3L9RA 3BKYL 3KR3H 3C08L 1U8JA 3NTCL 4JO2L 3WNNA 3SGJA 3U46B 4JREC 1EO7A 5I1IH 2QTEA 2DIBA 4PJFB 5GJSL 2MQ3A 5JORB 4GG8A 5HDQL 4LFHD 1GGBH 3BH9B 2VERN 3GIVB 1UWGH 1CICB 4LCWD 5CBAB 3OPZH 3CLEL 1LEKA 5AZ2H 3MBEB 3U0WH 4RIRA 4EQ3A 3F62A 2VZSA 1CF8H 2B4CH 2BNUB 3QDMA 5AAMA 3QEQB 1W0VB 1QRND 4TUOB 1D5BB 2PKDA 2DF3A 2WUCH 4KRNA 4GKNA 3B6SA 4BA8A 5I17B 3MRBA 1L6ZA 1CDBA 1MUJA 4LSPL 5BO1H 3CZFA 2YD3A 1CXHA 5DK3A 3BIAX 5E8OB 1XIWC 3OR7B 4OFYD 5EC2A 5F96L 3C5SA 3B9KA 4X9BA 3FO1B 2NY1C 4P9HH 2H26A 4EI5A 3NCJL 3U7WH 4M5YH 3WFBL 1MHCB 3MACL 2FECI 1T6WA 4JRXA 3ZL4L 3O3BA 3V4VH 2X4UA 5D7JA 4DFHA 4MQXC 3WUZA 4J8RA 4JPWH 2GCYA 4MJIA 4F3FB 2PYEA 1HZHH 4HWEL 1EMTL 4JKPH 1OVZA 1Q0YL 2EIZB 1CFVL 4RDQF 4UBDD 4DK6A 4XPBL 4IRSD 1VKXB 4KJYA 3UJJL 1VENA 4JO4L 2WQ8A 4YDJA 3UTPE 1TETH 4PJ5E 3O2VL 3PL6A 3QHFH 4YBQD 1TPXB 4JFEE 3SKOB 4D9QE 3HC0B 1MCEA 4OZIA 1WZKA 3R1GL 4RGNE 4HJ0C 5T3ZH 5A40E 5D7IA 1I1AB 4HUUB 4P46B 5IB3A 3O6FD 3BZEB 1LK2B 1VADA 3CU7A 1MCWM 3GSOA 3QEGL 5KVEH 1QBMH 3I6GA 1EO8L 4GBXD 3FT3B 3O8XC 1MNUH 5FOBB 3FOLB 5F7DB 1EJ6A 1PY9A 1QSEB 3OMZA 3S37H 1OARL 5D7KD 4KMTH 2WK2A 4M7ZB 4TUKH 3EIFA 1LK3L 3LEVH 3IU4H 4PJAA 4NBYB 1XCQB 1RJYB 4C56D 4CADB 5C0GA 3U4EA 1WIOA 4X5XB 4OQTA 4Z77B 4LSRH 4KPHL 1C1EH 2UZIL 4NKIL 4IMKC 5D7LB 1YQVL 1MCDA 2XWJB 2VYRE 3DBXA 1UADC 2DI8A 4G6MH 1BM3H 5IMLB 1MHEA 3WEXB 2V5YA 3VFGL 1KCUL 3GSUB 2VLJB 4OLZH 1KTDB 5KG9A 4Y8DC 5JUEL 5T3ZD 5BV7C 4C4KT 2QBWA 2VXQH 3VCLB 3QEHA 2DYPD 3T0WA 4JQVA 1G84A 3N85L 3EYSH 2EZ0C 4JZJA 4PRHD 4U1NB 3ARUA 1JHLH 1NKRA 4OCYL 4P99A 4PGBB 1QSFB 2CUMA 4F8QA 3VWJA 2NW2A 4TSAH 3RAJL 3SDAB 4HS8H 2QQLH 4S1DC 4JDZA 1S78D 3GMPA 2EDKA 2NYYC 2YR3A 2DQFB 3IDNB 4FQQA 4MDIA 4YPGA 5C0BE 3IAGC 4N8CH 3RTQD 5INCB 2VKWA 1OAYL 2EDEA 3KYKH 3EO0A 1KNOA 2AAVA 1WAAE 2HVJB 4PLKD 3I6KA 4LNRB 3ZE1E 1OL0A 3KPOA 2JJTC 2X7LA 2VDQH 5E7BA 3O6LH 1T3FB 1MCPH 3DGGB 5IMMB 2FB4H 2APFA 5GGVY 4OLWH 4KKAD 4YHIB 2J5LC 4HHAA 3GB7B 5EBWB 4XNMA 1J05B 4MX7B 3NABH 5IK3A 1DZBA 4JQXC 3PWNA 3HUJF 4JG0L 1FFPB 4G8IB 3Q2CA 4S1RL 3D39E 4L9LA 3RWCA 1OSZA 4BZ2H 4IMLB 2A77L 1V7MH 3WNMA 1KPRA 3T08A 3RA7H 1URLA 1G9EA 1GGIH 3GSVB 4XXDA 4JFYB 1S5IH 2CLZB 2ZPKH 3GNMH 5DEGA 1T7YA 4J4PC 4TTGA 1CBVL 8CGTA 4AH2A 1KTLA 1A3LH 3D3VE 4WI2A 1UGNA 1LO5A 5SWQB 5D93C 3M1BB 2Z35B 4UBDC 4GAFB 2OTUA 4IRSC 4F9LA 5I30L 1P4BL 1FVEA 4PLNC 3B5TA 4GAJL 5GGTA 1GJIA 4LLYA 2JK5A 4YBQC 1MFBH 2ESVA 2B0SH 3KYMB 5E4EC 3ALXA 3K4DA 1MIML 4MA7H 4KHTL 3RVXD 3O4OC 3PHOB 3ARYA 1CLYL 2XG5A 3WS6C 4JLRB 3ELAT 2YA1A 5JPMB 5I1HH 4WUUB 3O6FC 4WFFE 1D7FA 3LQZA 3W81A 2BNQB 1UB6A 4M43L 3FN0H 2Y1VA 1CGSL 4GBXC 2ZCHL 4P9HC 2VLKB 4KDWA 1QA9B 1HHKA 4LHUB 4P2RD 1I8IA 3WO4C 5I66A 2AXGB 1CTNA 1A6UH 4GRWB 1BD2A 3U9PH 3O9WA 5HVFB 5L7XL 1AGBB 4MQ7B 3QQ9D 5E9DB 4PJCF 4P4KD 3FB8B 1QEWB 2RR3A 5D96C 3KDMB 5F89A 5E0QA 4X4YA 2UUDK 5F93C 4FQPA 4GKSA 4MJ6B 2FJGB 4G7VH 4RSVA 3VFNB 3TV3L 5HGBB 4NN6C 5MENE 3MLXL 3JSSA 5CBEB 3NFNB 3HG1B 1N3NB 1YNLH 2PYFA 1CFTB 5E5MA 4P3CL 4W81A 3AXLA 5C0DA 4ODHH 4ZUSB 3FT4A 4NUJA 3DMMB 3LRHA 4QRTA 1IKFH 2VABB 3QH3B 1I8KB 3TZVA 5HGDB 2A74B 1DP0A 1DSFH 3VFUB 3ZKND 4HK3N 3AREA 4YDVB 3GSNA 5C0CE 1G7JA 4IHOA 1A6WL 1UYWL 2E27L 3SCMC 1YEIH 5TFSL 5E2UH 4Z7QF 3QCVH 2E7CA 4PJ9C 3RZCA 5ALCH 3VXUA 3O45B 2A6DA 3MLYH 1MRCL 4OI8A 4J3UA 3H9SA 5CEYB 3DWTA 5FYJL 4K71B 4M03A 4N68A 4G80B 3WFZA 1MFDH 5BS0E 2AI0H 5F1IB 3PQYB 3RGVD 4W4OA 3OZ9L 4MSWA 4M7KL 2OK0H 3VFMA 1TJGH 4K7PH 1RURH 2P8MB 3RVWD 3SDXA 2AV7A 2IAND 1J0YA 5DQJA 4ISVB 1LP9F 2EXYD 1AKJA 2W9EL 4W6YB 2AJZA 2XZCL 3PJSA 2AJ3A 1GGCH 3ZHLA 2BSRA 3OXSB 5EUKA 3GMOB 3TVMC 1BFOB 1IC5L 3QO0A 4JR9H 2CJUL 4PRAA 3CVHA 3QO1B 2DQIL 4OIIH 1RD6A 1QLFB 1TQBB 5KTEH 4F2MA 1EAPA 5IEKA 4QOKE 1H9VA 4O9HL 1SM3L 3DIFA 1PG7X 2Q20A 1DLHA 1DVFC 1E28A 1I9RH 4YGVA 3C6SA 1XIWA 1JN6A 4LLQB 1S7QA 4L3ED 3ULUF 1ZHBB 3SJVA 4S11A 1ZA6A 1N6VA 4F33A 3SY0B 1YZZA 4MA1C 3V4PL 4IJ3B 4FFVD 3H0TA 2EYTB 2ED9A 3PP4H 3D0LA 4D0BA 3I9GH 3WIHH 4FABL 4XPAH 5DHYA 2DD8H 2ZKHH 1JNHB 1T5WA 4LSVH 5FKAB 5B39G 3SGEH 1YEKL 4P2CG 1D5ZA 2V9RA 4N9OB 3LRGA 3W0WA 2OM5A 3RL2A 1T0PB 2GT9A 4QY8B 3FQRA 4R0LB 5IMOB 1P1ZB 1XR9B 1MFCL 4P5KB 3AAZB 4M93B 3WHE0 3QWOA 4YHML 4U6XB 5GHWL 4P48A 5HYSA 2VE6B 4OF0A 3PF2A 1MCCA 2ADGA 4FMKA 4EUPG 3GKZA 3REVA 4JFDB 1U93B 4P57A 5DUMH 2R0ZL 3LQAH 5F6HI 1AIFA 4LKCB 5DQDH 1KCLA 4HIHB 1I7ZA 3CXDL 4YO0A 1G7LA 2OI9B 5DRZB 3VFVA 1N59B 1FNFA 1REIA 1L0YA 5EBLB 4L4VD 1F90H 3O8XA 1ZHLA 5L2KA 2W0LA 4G6FB 3RFZC 1NCAH 3RBGA 4PTTA 1B90A 3MGTA 4KH2A 2A83A 2AJUL 1G9NC 3ROOA 2UYLA 2P48B 4ODVH 5I76A 4HBCL 3K74B 1JGDA 3L3IA 2ARJB 4G7YH 1UB5B 4N8VG 4BH7B 1YPZE 2WIIB 3BGMA 3P77B 5I16B 1CLOL 4NNPL 2RGSA 2IFFH 4QEGA 2QR0B 5I1DB 5FYKE 4G8GD 2IALB 4NO5A 2HJLB 4IMKA 1G6RA 2E9JA 1ODAA 3TYFA 3QIWD 2GSGA 3WE6B 2V2TA 5TPWH 3WNPA 2F53E 2DBLL 4LHQB 1INDL 1KLUB 4WEBH 2NPLX 4HPYL 3LV3A 4MD5B 5LQBL 1J1OH 4XBPB 5TDOA 1J10A 2C4XA 1OGTA 4GXVH 3WDJA 5I8EA 1IQWH 5CD5C 5J11B 3GHBH 4HUWA 4E42B 2V7NB 1NAKL 4NDMA 3IFLL 4YHKH 3S4SB 4LLMA 3RRQA 4QYOA 4ZOBA 4G8EB 2FIKA 5BXFB 3OJDA 4R3SA 2BX5A 3VXSE 2VRAA 4NQDB 3BXNB 2A6KB 3WUWA 2R69L 4OV5A 1JJUA 1OP3H 5EZJB 3P4NB 5EU5A 5LGHL 4EN3D 1I7TA 3WDHA 1QSFE 4NO2B 4CJ0A 4XP9L 4ELME 3RP1A 3FCTB 4YE4H 3KPSD 3T65B 4PB9H 3ZE1F 2JJTA 3WXVL 1D5MA 1CVRA 4NQEA 1KF9B 1CE1H 1WEJL 4ZTOL 1QRNA 1MRFL 4G9FE 3RJQB 3V9FA 4Z6AT 3VFSB 3U36A 2ARWA 2V2XB 4XRCA 3B9EA 1AD9A 5GS1C 5C09D 3HNVH 2AABL 1CN4A 4YC2C 4JCLA 4PB0H 1DBAH 1HWGB 1PZ5B 3PGFH 1XF2A 2Z93B 1BBDH 5HYSG 4R4ND 3B3IB 2BDNL 5IV2A 5B22A 1GRWA 1HHIB 2NTFA 1XZ0B 3FFCB 5F1SA 1FG2A 3GZKA 3HE6C 1WBYB 1GZPA 1RIVH 4PJEE 5A2KH 5FEBA 2Z31D 1U8QA 5E2WL 5ISZB 2PN5A 3LZFL 4CUCA 1U8LB 1X6LA 4J4PA 2QV2A 4I5BA 2DQTL 2A1WH 4GFTB 4LAQL 4YWGH 3TGXA 1U3HD 4F57L 3TYGH 5E5UB 4IRSA 3ZYZA 4BKLB 3KLHC 4JVUA 5EORH 1JGVL 2CKBB 3RWDB 2VZ1A 3CSYB 2HN7A 5EPMA 3TIDB 2NW3B 2Y36L 3D85B 2O5XL 5GRVK 3E8UL 3U79A 1HQRB 2YC1A 1YEFH 2VL5A 3V52L 4ORGB 4WW2F 4CMHB 1NLBH 2HA1A 3EO1B 1G9ML 3WS6A 5GGQL 2BCKA 3ZSSA 5E2TL 1AXSB 2J4WL 3O6FA 4QT5B 5C1MB 3D9AH 2YPLD 1CU4H 1GAFH 3K2UH 3BIKB 3W9DA 4XP1H 2D0FA 4Z95H 2Q76B 4GBXA 2YEZA 3AUVA 1RZ8A 1OP5K 1NGQL 3FHAA 3LKPA 5CUSH 2R2CA 3S36H 2ORBL 5C2UB 1J5OH 4MNGA 5GRWA 3WBDA 3W39A 4L3CA 1JWUA 4P5MB 1DUZB 2DQGH 1KELH 3HC4H 4JGMA 5EU7C 1UT9A 2JIXB 1BAFH 2FR4A 3MLTB 1J0ZA 3PWPB 1CGWA 2VZTA 1S3KL 1T6VN 5J12C 2ZUQB 4HT1L 2FL5B 1JMZA 4N0FA 4F37K 3CFBB 3T09A 3GI8H 4PGCB 4Q6IB 3ISWA 4E41D 2OCFD 3EJJX 3EJYD 1TNMA 3LQAC 4WIQA 5FGCB 4TQEH 1KSRA 2W1NA 1JPFA 1M7XA 1ADQL 1X5ZA 5J6HA 1HSBB 4LFHG 1P7QD 2JCCA 2DYPA 3FOMB 5SWSE 4G6KL 4GQ9L 3LB6C 3U7YH 3T4YA 2YD9A 3U7AA 2NY3D 3HG1E 3RX7A 3PUCA 4KTDL 1F4WL 4LU5H 4I8DA 2NNAB 4YJZL 5C92A 1A6PA 2PO6C 3S34H 4NT6B 3SCMA 1LNUA 4AYFA 1BIHA 2Z4QA 5KSVB 3VJ6B 1U8OA 3R8BB 1U91A 4PJ9A 4YH6A 1WICA 3BUYA 2PR4H 4YBLC 3CGTA 3TT1H 2BSTB 3EOAA 3NPSB 4HLJA 3GKWH 4OGYH 1FYTA 1MWAL 4KTYA 1N7ML 1U58B 2IQ9H 3DX7A 4XB8A 3L3DB 3F7VA 1S7TA 5FUOL 3VFPA 5E6IB 1FAIH 5D5MA 5CCKH 4JFFD 3QZWA 1EBAA 3HMXL 4KHXL 3H3KA 4UDTB 1EAJA 1X5AA 1U8PA 2BY3A 2X40A 5JIIA 3DX9A 4OZHB 4KU1A 1TJIL 1HXMA 3G6JA 4S1SH 3PGDB 4U0RB 1YEGH 2YZ8A 2E7HA 1EH9A 4RFNB 3T0ED 4XGZB 4DKFH 3FB5A 25C8L 5IUSA 3SDYL 1R3HB 5FGRA 1K4CA 1OAQH 1N4XH 4NRYB 4PP2A 1SJEB 4G8FA 1ND0B 2NLJB 5HGHA 4XH2B 2HT3C 4OUUB 3MRQA 3MNWB 2RFXA 3FKUS 2DM3A 2VO5A 5HYJA 3G04B 1SMAA 1EDQA 2J8UB 3O4LD 3TVMA 4U6HB 4V1DB 3VXRD 4M1GH 4N0UB 5AYUH 2C9AA 1MJ8L 4TOYL 1A1NA 3BEWB 3BI9X 4HAGA 3IDXL 4QRQA 4CMMA 4KFZC 4BZYA 3GMNB 3QDJD 1A7BA 5JW3H 4PJFF 3WFCH 4WHYH 1DVFA 1BWWA 4FTVB 1JZ5A 1QNZH 3QSKB 3SQOL 4WTZG 4PJDB 1A9EB 5L9DL 4DGIH 4QRPD 4D9LH 1LDPL 3BSZH 2XXCB 4K3DH 1L9NA 4OFDA 4UDUA 3K1KC 4WNQA 3V79C 4CNIB 5FK9B 2FLBT 4MYWB 3A0OA 5JXAL 1H5BC 3RDTB 1RIUH 3KG5A 3V6OC 2R23B 5HJ3A 2G9HA 4C83B 4FQCH 5E94B 4MZ2A 3OSKA 5DRNB 4PD4J 1EHLH 2YUXA 5B38B 2R2HA 2AK4D 4NO0B 1CD9B 2PXYC 4HQQH 4HS6A 4ZNEE 5FA3A 4NKMB 2GTZA 2YRPA 3KPQA 5HY9B 4OLYH 3EJYC 2E9IA 2M26A 3MLRH 4G5ZL 1AHWB 3MZTA 5MI0B 5CSZA 5T5NG 4XHJD 5EUOA 4HEPG 4UV4H 5C0AB 2DQEH 3BD4A 4AZ8A 1DDHA 2C7UB 1S9YB 4EIZC 2IQAA 1L0XA 4JFDE 4Q2ZB 2BNRA 5F7EL 1BQUA 1U95B 1U8NB 2X89D 5DJZB 4XCNB 2BHUA 2XI9A 1A7QL 3ULUH 4AMKH 4U1JA 4X7TB 4XWOC 4JRYA 1D6VH 1NGZA 2EE3A 3KPNB 1YPZF 4JFHD 1LEIB 1Z6JT 1OB1B 4WV1B 1BLNB 4IIQC 4UTAL 3WIFB 5EO9B 2BOBB 2QHRL 3HS0A 5IW3A 2FHCA 4GW4B 4Y1AB 5GS0H 4LIQL 4R96A 3PHQA 3CDYA 3RX8A 4P2QE 5B3NA 1YNTA 3BESR 3BW9A 2ICEB 3F5WA 1U8JB 4LVHC 1BZ9B 2WBJD 1PQZB 3BAEL 4U1LA 5FDYA 5JO5A 4Q9QL 1EJOL 1HI6A 2J12B 3BKJL 3E6HB 4M62L 5FO9A 2DIJA 4J6RL 4PGDA 3M8OH 1X5FA 2WUBH 1XGPA 5ICXA 5FYLL 3D5OF 4PJIA 1P5VA 3ULUD 5F9OL 4JKWA 1FNAA 3E3QC 3MLWH 3QDMB 3LN4B 3QG7L 4MNQB 3ZT5A 4QXUH 3ZE0E 4GKNB 2G75B 2I27N 2JB6A 3MMEB 4R4BB 3MTRA 2ZJSH 1VFBA 5GIRA 4ELMF 4R7NA 4I0PC 3MRHA 5EC2B 4FFYH 5C3LD 3UTTD 1NUGA 5GS0D 2Y5TB 2HWZH 2H26B 4EI5B 1KB5L 3QUYB 2D03H 2QLVB 4HULB 3AU1B 5B21A 1BREA 2IAMC 4TSCH 1INEL 5CGYD 2X4UB 3PV7A 1NAMH 5I1EL 1ACYL 4J8RB 1I1RA 2DDQL 5GS1A 4MJIB 3QUXD 2B1AH 4L3EA 2BXZA 4YX2L 3CAFA 4ZFOL 3PWVA 2AXFB 3FO0H 3LKQA 5E2VH 1YYLH 3TBVA 4KJYB 1YMMB 3HZYA 4NZDA 4X6DE 5MEPB 3HE6A 3WV0A 2NXZD 4XNQA 4PJEF 1S7VA 2OZ4H 1QFWM 3ZKMD 3T04D 3BWUC 4YEFA 4OZIB 3DV6B 4MA8H 4Z7VA 5D7IB 4D8PA 3MRCA 5ACZA 3HLAA 4FQJL 4P2OB 5IB3B 4MAYB 1W72H 3C09B 4OCRL 2FGWL 2Z9TA 2CDGA 2GY5A 1VFMA 2VDML 4LCIH 5GRJH 4OCXH 3I6GB 2VR9A 4PJ8C 5MERA 2P42B 43CAB 1TZGH 5KS9A 1FGVH 3KYOA 3QI9C 4FNLH 2P7TB 4QRRD 4KV5E 1TVHB 3CXHK 2VUOA 1KLGB 4UILH 4FQ1H 4QF1A 3UAJC 2ADJB 5FIEA 4ZTPL 4XNUH 2P5WA 1HHGB 2H2PD 1IRAY 5DD1H 2AJVL 2BRRH 5I9QB 1TLKA 2DIAA 2O61A 1P5UA 1GC1L 1TJHH 4XCEB 1MHEB 3QDGA 1KC5H 1HCVA 4JFPA 4ODWA 1RAMA 4AM0B 2A2QT 5EU6B 3S98A 3RI5K 3RNQA 1A3RH 4IDJH 5FV2A 4G8GA 1B4RA 4KI5F 1OTUC 3BQUD 5KW9H 4JVWA 2BVEA 1F97A 5KSBB 4MJ5B 4GRWF 5C8JB 4M48H 4FZEH 2C3HA 1C5BL 1I3GL 2OQJA 4OJFL 3FT2B 4X80H 4U1GB 3GMPB 1G7PA 3I50H 5JDSA 5D8JH 4YPGB 4X99B 5TH2A 2E6PA 4KKLD 2YMXL 3LDBB 3F58L 5EOQH 4D9RD 2ZWLT 3ZE2E 1RUMH 3I6KB 3VRLE 5DRWA 1G7IB 3KPOB 4XC3H 3IETB 2G60L 3QYCA 4RISL 2X7LB 4IEFB 4MXWL 2IPTH 4NQCB 3ULUC 1F6AA 4TNWF 2NY2D 2WIMA 1I9JH 5KVGL 3VXPA 2N56A 4NNXB 3VDAA 2QADB 3FO9B 1BFVL 1CDGA 1L7IL 4XB7A 4BQ6A 4HGWA 5IK3B 2H32B 1H3TA 1KCRL 2J2ZA 3PWNB 5FCUL 5C07A 1H3UA 2J6EH 4ZYKA 1GL4B 3DVGB 3LIZH 4L9LB 3UZVB 1JPTL 3VXQA 1ZEAH 1IBGL 1T21B 4QHMB 1KPRB 1T66D 1MHHA 5K59E 3FB6A 4YHLH 1E4KC 4NCDA 3DI2B 4XNZC 1DLFH 5CGYC 1Q94A 4HUXB 4NSKA 4PTUB 4K9EL 4UIMA 1G7MA 4K23H 5DEGB 2VQ1B 4IM8A 5A16B 2MCPL 2NY5H 5FECB 1B0RA 3ARGC 1IGMH 3G6AA 1P6AB 2SEBA 3HI1A 1V7NH 4LOUD 2Y06H 4I77L 3IRZA 2OTUB 4AQOA 1FVEB 4RGNC 2HRLA 4UT6L 4LVOC 2I07A 4LLYB 5HGAA 1NCBH 2FX7L 3T8XB 5D1ZC 3KPRD 4OZHE 4JN1L 2VMFA 5D1QC 1Z3GL 4XAKE 3RVVD 7FABL 4Z78B 5I18L 4KVNL 3HE7C 2V9QA 5DJ8A 3MCLH 2PTTB 1YEDB 3KPLA 4JN2B 4MD4B 2Q86A 1CL7L 4PJBB 1HHKB 3QFJA 1AFVL 1AQKL 1R5VA 1G9NL 4GS7C 2J8UE 5TE7H 1BD2B 1MCWW 3CFJA 4V1DE 4BUGA 4K2UL 4N0UE 4K7PY 3OX8A 2XKNB 3MNZA 4X4YB 1HOCA 1SJXA 3UPRB 3DOSA 2R1YB 3QRGH 4HJGB 4GKSB 1YEEH 4EDWL 5IG7A 5D72H 3CPLA 2HRPH 4O51B 3N1GC 2CD0A 3D87B 2FEEL 3KNBA 3MV8D 2R1XB 4YQXH 1H5BA 2V7HA 5E5MB 3SDCD 2E6JA 4PRNB 4QXGH 4QO1A 3V6OA 1C5DA 3EYUL 5C86A 3V6ZA 3G6DH 2XACC 1BBJA 1PBYA 3B9AA 1BOGB 2LABA 4XVTH 3KPTA 3TZVB 3PWLA 2Q8AH 1WC7B 3SGKC 2YOCA 1Q72L 4XVSL 2VITB 1OD9A 2D7TH 3BZ4A 3AREB 1L4IA 3GSNB 2PXYA 3HR6A 1DFBL 1A3QA 3WJJC 4LVNC 1G7JB 4IHOB 5C9JA 1QVOB 4N0YL 1I8LC 3VD5A 1I3RB 2YPVL 1K4DA 3G5XB 5DA4A 2D31A 2CO7B 3J8F7 1MPAL 5DJYA 4XAWL 1VFAA 5EZLB 4WU7A 3RZCB 1BQHG 1VHPA 3VXUB 2FBJH 4Q9RH 4RMUA 2A6DB 5ERWB 2ZNXA 3H9SB 5K9OA 1J1PL 3T1FB 3GBNH 4KJWC 4R26H 4KJPC 1FZJA 1JZ8A 1QP1A 5ITBL 3H9HA 3HUJA 3UBXG 1Q9KB 1VFUA 2ADFH 5IQ7H 4HWBA 4C59B 2O5YL 2E6QA 1QFPA 3U83A 1HQ4B 5E8NA 4Z8FL 4IIQA 3BZFB 5LGKA 2AQ1A 1AE6H 3CFDB 4MSWB 4U6VH 3AGVA 4ODTL 3ZKXB 2ITCA 4H8WL 1GCFA 1A7PL 4FQXC 4KK9C 2YRLA 5FB8B 2W0PA 3ARPA 1KCVL 1K8DB 1A7OL 1T66C 1SBSL 4PY8I 2DN7A 5J1AB 3W2DH 1MJUL 2AJ3B 2K3TA 3BX7C 2OR7A 1T7XA 1B2WL 3EDDA 5GISH 4R90H 4APQC 3ILPA 3RJDA 1QR4A 2D3VA 5HHOD 2LAGB 5ID0B 4KC3B 4JQIH 4LOUC 4ETYA 2BK8A 4WW2C 1YY8A 5JTWA 1Q9WB 2GKIA 4N9GB 1A6ZA 2LFGA 3X14B 1CICD 3Q1SH 2GW5A 1WCBA 4F2MB 5IEKB 3KGRA 3MBED 1JNNH 1IFHH 4IRJB 1MF2L 5DC9B 2BRQA 2Y6SC 5DR5H 3CFCH 5IKCA 1DLHB 3QEQD 4KDVA 1QQDB 1BVLB 3RVVC 1MREL 3C6SB 1XIWB 4JDVA 4ODSL 1JN6B 5E8DH 3VXRA 2UY6A 5SX5K 4CVZB 1MWAB 4TVPE 5T3XL 5D7SL 5CJQL 1FNEA 3SJVB 3IVKA 5HVWA 2OJZH 3BJ91 3S88L 2A6IA 4X98A 2NY1B 5I1GH 5CHNB 4MNQE 4J2XA 5BRZA 3RUGE 4PJCA 4ZOAA 4HUKB 5E1AA 3EYQC 2IAMA 4D0BB 3TA3B 3EUUA 1T5WB 2MPAH 1NC4A 3EDEA 3W0WB 2NY5C 5GGRA 2HT4D 3EO9H 4Y2DD 2WM0A 3RL2B 1AR1D 4K55A 4I48A 1HINL 3FQRB 1WIPA 3VGBA 2BHYA 3JBG7 5CSBA 4HS3A 2R0WH 4GG6E 1FFNA 1WZ1H 4QRPA 4NJAH 4X6DF 1N2RA 2OJEA 4GQPH 5ANME 3SE8L 1UKQA 5DWUL 2ADGB 1GOFA 4AEHH 3VFTB 2P1YA 4JGUA 3QUZC 3MUHL 1CD0A 2XNAA 3DVFA 4G42A 4FFWD 4W70A 5CJBA 2AV1B 1YMME 3ZO0A 4OZGE 3REWA 1Q1JL 4P46D 1J1XH 3TJEL 4PJ8A 4FA8A 2HVKA 5GJTL 5KOVC 1EVUA 1ZHLB 2YS4A 5EOCL 5HXMA 4X8XA 3ULVE 4XTRC 5DC0A 1AD0B 3RWGA 4LSUL 3NACH 2W0KA 3S96B 3MCKA 4KV5F 3DETD 3X17A 3TCLB 1QSED 3L1OH 4QHNA 1XCTB 1MQKH 1P7HL 1MCIA 1MQ8A 1HH6B 1I1CA 4I9WE 5I76B 1DL7L 3L3IB 4PREB 1JK8A 3AM8C 2I5YL 3ECBB 4OLEA 1KCSH 1HXYA 4DQOH 2FX9L 1Z0NA 3T4AA 1GZQB 1A7NL 1KFAL 3ZYOA 4TSBL 4GRLC 2VC2H 1CZ8L 1RFDH 4L4TA 4NO5B 5EBMB 5FF6B 3THMH 1G6RB 3MUGA 1PG7H 3DTXA 3WMSA 4ZPVA 3TYFB 1T4KA 2O93L 4ONOA 3MO1A 3ALPA 1LEGB 5D7LD 5GSVA 5I6XC 3T2QA 5J3HD 4GO6B 1U6AH 1S9VB 3TN0C 5CEZH 1GH7A 1D5IL 1NH6A 5BV7B 1LP9A 2CR3A 4H0HB 4HCRH 2VLJD 5TDOB 3ULSB 4GAGL 5LCVH 3HMWL 3LPWA 4HUWB 3VFRB 5HHQA 4CVUA 3NA9L 4NDMB 5AZEH 4UNVA 3V0WL 4ZFFA 2ICWJ 2FIKB 1F6LL 3H9ZA 4L4JA 3SDAD 3O3UN 3NCEB 4DZBA 3OKKB 3BN9D 2WBJA 3RI5F 3NCBB 5KSBE 3QQ4A 1NDMA 4OV5B 4CDHA 5EU5B 4RBPK 1I7TB 4FN0A 3ARZA 4L29A 3P4MB 5I1JH 3MRKB 4AIOA 2Q3ZA 1OCWL 3IJSA 1PSKH 4M5ZL 3VU2A 5HDBF 3D2UA 4GOSA 3VRLF 1OQXA 1QLEL 3HC3H 1CICC 2YD2A 1D5MB 1KPUA 2G2RA 1S5HA 2JB5H 4NQEB 4G6JL 5JXED 5CEZD 3WN5C 3D1MC 3HPJA 4G43A 5I15H 1CL7I 3QNZB 1T20A 1MCOL 4NWUH 1AD9B 2J5LB 3IDGA 5ETUA 3GFUA 3DSNA 1JZ3A 5DYOB 3KXFD 4J23A 1WT5C 4JO3L 2GSIB 1JBJA 4P23B 2C3VA 1ITBB 1ONQA 4WEUD 5KVDH 5IV2B 2VZ3A 4H5SB 2AEWA 2NTFB 1FG2B 2LV4A 5K9JH 5K59F 1C16A 1E4KA 1A2YA 4XMKH 4MCYB 3O6KH 2RAMA 5C08E 4GRWH 3T77B 4I5BB 3ES6A 4PJ5A 2FEEI 1NGYA 4R97C 2HT4C 4JFEA 5KANG 3OTTA 5D93B 1QYGL 1YEJL 3NIGF 4AT6A 4WI6A 4XX1G 1MI5D 5TQ2H 1EEZB 3JWOH 4N90E 1QLRA 1GIGL 4BFGA 1GOHA 1IAIL 2HN7B 4HLZH 4WHYG 5EPMB 2XXMB 3Q6GH 4Z7WE 1MCBA 3UTSB 5DJ0B 5D1ZA 4MJ2A 1VGEL 2VL5B 1A6TB 4OZHF 1XF1A 4LEXL 3O4OB 5D1QA 5DXWA 3ZZ1A 2BCKB 4HUMB 3HE7A 5ICZA 4TPRL 1KIQA 3GI9L 1I1AC 4OZ4B 4AEFA 1EFXA 4WUUD 3QG6A 3UJTH 3FB7B 4RAUA 3WKMH 4Z0BH 4MXQD 5DTFA 3FMGL 2BNQD 2DM4A 2ZCKL 2EDNA 3WO4B 2VIRB 1BQLL 1HWHB 2I9LB 2VLKD 3DETC 4LHUD 3LKPB 4KI5D 5FKPA 2J8UF 5IEHB 1NAMA 3GMRB 3IS0X 1NFDB 4FQ2H 1FORH 1JP5A 3S9DB 1JWUB 4KZDH 3NCYP 5D96B 1F4AA 4NPYA 3IF1B 2AK1L 5E9DD 4ZD3H 1MAJA 4WHTA 4PJBE 3PWJA 2AXJA 1S9XB 3L5XL 1XGUB 2AGJL 3BUTA 4M9PA 1OM3L 1MCJA 4RRPG 3F7YA 2GFBA 3HCVB 2CRYA 1RJLB 1DR9A 2C1OB 3WLWC 2OZ4A 1I3VA 4HIEA 5DS8B 1F00I 2AJYL 4W6XB 3MOQA 5IFJB 1NSNL 1JPFB 4TUJA 4NHCL 5J6HB 1W72A 1B0GB 1I9EA 3T3PE 2QQNL 3GBML 4XMPL 2JCCB 3SGKA 5I1LA 3DMMD 1S9WA 3BQUA 3CFKA 1F4XH 2BSSA 4WFHD 1OLLA 1N8ZA 2R2EB 3T4YB 4JPIA 3E6FA 4KK6D 3U4BH 1NANI 1X5KA 3WJJA 4XPFL 1CXFA 5C0BA 2CUIA 4S1QL 5EA0H 1I8LA 3U0PB 2FD6H 3SCMB 4BJLA 2Z4QB 1NGWB 3SDAC 3UC0L 3BRGC 1Q0XL 4EDXA 5H8DA 1JIBA 4GW5A 1U8OB 2ADIA 1T2QH 2NY4C 5D71L 2ZSWB 5CAYB 5C7XL 4NP4L 2F19L 5EIIA 5IVZA 1UVQA 1YYML 1KN4H 3EOAB 3K46A 3UTZA 4KQ3H 1FYTB 1K2DA 3PNWB 3D0VA 1TTFA 3F7VB 4DVBA 1S7TB 3VFPB 1RK0A 2WINA 3Q5TA 3HR5A 5JXEC 2B1HH 1N0XH 5D5MB 3ARFC 3QZWB 3QJHA 1ETZB 1ZHNA 1F13A 1ZAGA 1U8PB 2GJZB 3VXTA 4X6BA 1P6FA 3PQYD 4Y0GA 1HXMB 1UACH 3G6JB 3OKMA 4ONGL 5DJDA 5LBSH 3G5YB 3HAEG 3MRNA 1JHTB 3SGEI 1EFQA 4YNYA 4BSWB 3D3VA 3QAZB 3TNMB 2VDOH 4WFGE 4PP2B 4O2CB 3BT2H 6FABL 1P53A 4APQA 2R56H 1H8SA 4IOSD 3MXWH 2X4QA 3NZHL 1CG9A 5HHNB 3TVMB 4UIKL 1TZHB 1KV3A 3MRMA 3EYOB 4WW2A 5ILTH 5DD5H 4FQLH 1A1NB 1T0NA 1T0MA 3O81A 3VG0H 4QRQB 1TVBB 1I7UA 4JFXA 1KTRL 1R24A 3MLPA 3RX5A 1YJDH 1NEZA 1IC4H 1VACA 1M05B 1MFEH 3MUJA 2CKNA 4LRNL 3DXAE 3JUYA 4OKDA 1U8HB 1HHJA 4KTEH 4NKOA 2CLVB 1UM5L 2DTMH 3RIAF 3GRWH 5KAQF 4JJ5A 4MQSB 1N5AB 1MY7A 3WD5H 3LQMA 2JE8A 4NRXB 1FBIH 2ZUTA 2J6EA 1S7XB 2Q7YB 1UA6L 5DO2C 5EZIL 5F1NB 3RUGF 3P0VL 1CR9H 4W4NA 1ZLWH 4G3YH 4UDUB 1J18A 2B2XH 1MELA 2WWKO 5DURB 3IB4A 4JFQA 3INUL 4Z7NF 3MV7E 3OKLB 5MENA 1IGYA 1GPOL 3L6FA 4GG6F 5L6YH 4URTB 1PW3A 4HXBL 3P73B 2R2HB 3RU8H 4NZRL 1RI8A 5I8OL 4NRZA 4WFED 3QUZA 3MV8A 1M1SA 4H25A 2GTZB 3SDCA 1NLDL 2YD6A 3K2MC 3QPQC 5CZXC 1FN4A 4PP1D 1FL5A 5F97E 1XGTB 5C0CA 3LKSA 4OZGF 4XPGL 3Q0HA 4DVRH 4D0DB 1GXEA 3CC5A 3LOWA 2IQAB 4LARH 2BNRB 1NC2B 1JTTA 1MLCA 1IT9L 4GMSH 4G6FD 4RFEA 2Q87A 3CX2A 2QSQA 4PV9A 2ICWA 5DMKB 2X4SA 3AM8A 1CLZH 3OKOA 1ZANH 3OHXA 2NY7L 3WXWL 1J8HB 1AC0A 2EKJA 3S7GA 2APVA 3I6LD 4ONFH 1JYWA 5ITFB 5MHSD 2XZAL 2BHZA 5BS0A 1WZMA 4KK8D 4UT7L 2DMCA 3TESA 3KYNB 4PBXA 1HCFX 1WGOA 2QEJA 5IR1A 1PFCA 1KCKA 4NFBA 4JANA 4R96B 2XN9D 4KKCD 3DYOA 2GTWA 4X0KA 3MRGB 3QPXH 4X8JB 2H41A 3TN0A 3C5JB 4NNYB 4JY6A 3BW9B 5L8LB 1CXEA 3HA0A 2ZUXA 1L7TH 5ENWB 4DUXA 1PYWA 1FO0A 2DWDB 3UXFA 2CGRH 4U1LB 3FL7A 2ZOLA 5DMYA 4LLVA 3GHEH 4NYLA 5CMAB 5HI4C 3VXNB 4PGDB 4P4RB 1RU9L 4WI8A 1U8IA 1N64H 2CXGA 2FYYA 3M45A 4ZO8A 5ICXB 1E4JA 4XP4H 2ZCLL 3F65A 3MOBH 1QO3A 1SY6L 1D9KB 1W8NA 3ARTA 4X4ZA 4OTXL 2P46B 4YIQB 3WFEH 2W65B 3MRIA 5CJ5A 1ZGLP 2F5BL 3BKYH 3H42H 4JO2H 1OPGL 3KLDA 1MCQA 2L7UA 4RGMB 5KSBF 2JB6B 4OT1L 5CJOL 1HIMH 3QXUA 3LS4L 4QOKA 1NBVH 4NQDD 3U46A 5GJSH 4ZXBC 5E7FA 2XICA 4PJFA 3S37X 5JORA 5F1KC 2DJUA 2RIKA 3FQWB 3GSQA 4NGHL 1CICA 1HKFA 4AQ1B 1DN0B 4DN3L 3WN5A 2AQ3A 2BNUA 3QEQA 4QKXB 3SKJL 5GS1B 4TUOA 1D5BA 3R4DA 1VERA 5I17A 4YC2B 5DDHA 3X3FH 1WT5A 4DW2L 2W9DL 5FHBL 3DUHA 5E8OA 5F96H 5DD6B 3HZYB 5LJYH 2VXSH 1IJ9A 4JY4B 3HE6B 1A0QH 3FZUC 3NCJH 1OAXH 2GK0B 1QTYT 1EEQA 3C6LB 3WFBH 1H8NA 3FFCD 5CJ8A 1MHCA 3ZL4H 2C3GA 5I2IA 5ISZD 2R9HC 4LIQE 2W38A 4F3FA 5ACZB 4HWEH 1EMTH 4CDGC 2XIDA 1KJMB 2CDGB 4JZNA 1CFVH 4Y8AA 2CO6B 4R0LC 4XPBH 1BFSA 5GZOC 4M7LL 1VKXA 1FQ9C 4JO4H 5FUZH 4Z7WF 1JVKA 4M93C 4O5LL 2CLRA 2OP4L 2D9QB 4OF7A 2VLLB 3O2VH 5D2NB 4RMTA 4LPVA 1MCLA 1ERNA 3NAAL 2BXYA 5EC1B 3RIFK 3EBAA 4MB5A 4ZG1A 2X41A 3S5LG 4X9FA 4L8DB 4NFDA 2ZOKA 3R1GH 1ZT4B 1LO4H 1I1AA 3B5GA 3BZEA 2P8LB 5DMJB 1H3GA 1YPZA 1CFSB 3FT3A 5FOBA 3FOLA 5J8OA 4LSSL 3MLSL 4MXVE 3JV4B 1OARH 4ACPA 4XNYL 3IDJB 3QDGB 4JFPB 1WWBX 1LK3H 2X5PA 4J7RA 4Y89A 1QBAA 5JOPD 1U36A 3Q3GB 1A5FH 4JAMB 4PJBF 4CADA 1X6NA 1SQ2N 1UH3A 5J12B 4I0CC 4X5XA 4KK8C 2JIXD 4KPHH 4Z77A 5IW6B 3PWPD 2X1QA 4OGAD 2A9ML 2KPNA 1YQVH 5D7LA 5E2JA 1E6JL 1KEGL 1NFDE 3OG4B 1KJ2L 3ME0A 1MIEH 1VPOL 2NZ9D 3EJZC 4CU7A 4ZMAT 4ZUVB 1FH5H 5IMLA 4FG6D 3VFGH 3WEXA 3FQNA 3RWHA 1G7PB 4KRPB 3GSUA 5JUEH 1HH9B 3T3PF 5I1AB 1DANU 4HZLB 2GK2A 1X5GA 5TH2B 5ALBL 3VCLA 2V9TA 3VXSA 3N85H 3VD4A 2JJSC 3AS1A 1PKQB 5J11C 2DI9A 4OCYH 4U1NA 1YMHB 2PO6B 5DRWB 4PGBA 1QSFA 4ELMA 5I0ZA 4MGXA 3UPCA 3SDAA 1GGBL 1PGRB 1QFUL 4U3HA 3UYRL 3VXPB 1NUDA 4RWHA 3U0WL 4YBLB 3IDNA 5AUMB 1CF8L 2B4CL 1OAYH 3AB0C 1CDUA 1OGAD 5C07B 3O2DA 2K9UA 9CGTA 3TIEB 4LNRA 2C3WA 5CKAA 5JXEA 2FJHA 1CCZA 5J6GB 3ARFA 3RL1B 4PYHA 4PYGA 5E6ID 4NSKB 1T3FA 4UIMB 2ED7A 3DGGA 5IMMA 1B0RB 4M5YL 1X9QA 4PJEA 3G6AB 4PY7B 4YHIA 3SE4C 3GB7A 1ZA3B 2YXFA 5EBWA 3HI1B 1J05A 2EDTA 3IJHB 4JG0H 3RY6C 3MZGB 1U42A 4EZMA 4JPWL 1FFPA 4S1RH 4G8IA 1HZHL 2D0GA 2GY7B 3LN5A 2BERA 4IMLA 2A77H 2EYRA 1ROWA 3OXRB 4XP6L 1GHFH 1KOAA 4JFYA 4J12A 5H37G 2CLZA 3DLQR 1CBVH 5DJ8B 5JPNB 2EKSB 4I18C 3FFDA 2FZ3B 15C8L 3M1BA 2Z35A 4K3EL 1BJMA 3ZHDA 4DOHB 2MQCA 2DMBA 4M4PA 5I30H 4RFOH 1OSPL 1SYVA 4Y4FC 1F3JA 3RGHA 5KVFH 1R5VB 1QBML 5JHDE 2VLMD 3GJFA 4HH9A 5C0JB 3MODL 2CMRL 4KHTH 3KYMA 4Y19E 1CLYH 1AQDB 4CMHC 3PHOA 2B20A 4HWNA 4JLRA 1HOCB 1BWMA 4FTVD 3T2OA 4KMTL 1S7WB 4UT9L 2YD1A 4DWHA 4PGJA 4LLWB 2P5ED 4M43H 4RWYL 5IG7B 5EOTA 5J1TC 1ZSDB 3CPLB 1CGSH 5B8CC 3E0GA 2EE6A 1QA9A 4LHUA 2DQUH 1R6VA 2AJSL 1QD0A 1H5BB 2V7HB 5HHME 2CUHA 2AXGA 1YECH 6CGTA 1ZGLM 3MRRB 1KJ3L 5L7XH 2VLRE 4ENED 1Z5LA 4MQ7A 3RDTD 4G6ML 3FB8A 2Z8VC 1QEWA 3KDMA 3QXWA 3GJEA 3PDGA 5IB5A 1DANT 5JNYA 1UXSB 4G6AC 1T80A 2Q1EA 2RJMA 5J56B 1ZTXL 4MJ6A 3EKCA 2ZUQC 2EDQA 3TV3H 2VXQL 2ED8A 3O3DA 5HGBA 3GMLB 3KJ4C 4NO0D 3HI5H 5CBEA 3HG1A 1RZKL 1N3NA 2Q8BL 4P3CH 1CFTA 1JHLL 2COQA 1VFAB 1HILA 4MHHI 5F7UA 3CXHJ 3DMMA 3L5WA 4BFIB 3TO4D 2YUVA 5HGDA 5C0AD 2A74A 5K9OB 3VFUA 3RVTD 2VDRL 4OB5L 5GSRB 1JGUL 4U33A 4NHUA 1FZJB 4JKMA 5E6ZA 4WWKD 1ZK9A 1A6WH 1UYWH 3H9HB 3HUJB 2YN3A 2E27H 3FTGA 1KYOK 2DQCL 4IIQB 1QG3A 2O5ZH 2ITCB 1FPTH 3O6LL 3NBNA 1MRCH 2GHWB 3NPSC 2FB4L 1O5DT 5FYJH 3RPIA 5CEYA 1FNSL 4Y1AD 4FRWA 4JPVL 5SX5H 1J8HE 1U92B 4G80A 1J86A 4DTGH 2ZZUT 4LVHB 1EO5A 1HSAB 1EEYA 1MY5A 2F8XC 4BZ2L 4ALAH 1V7ML 5F1IA 2EXWC 1T1ZB 1GGIL 4OFPA 2VTFA 1A47A 3ZDXE 1XGQA 2W9EH 3B5HA 5D70H 2XZCH 2NR6C 1WCBB 3BE1L 4ZS6C 3CDGB 1F3RB 4RFNC 4N0CC 4ZO7A 3F6IA 2CDFB 3QDMD 3O6MH 2X9XA 2HMID 4N1HB 1RHFA 5DZOA 3BYTA 2H6PB 4ZXBA 3OKEB 4I0PB 4XVJL 1MFBL 1IC5H 3GMOA 5F7MC 1BFOA 2A6IB 2CJUH 3B2UD 4MA7L 5FYJD 5ESQA 5IBLC 5BRZB 2DQIH 3B9KD 4LHUG 3P30L 3QO1A 1WBZA 3MV9B 4ZAKC 5MEQA 4HH8A 5CJXC 4EI5D 1BQSA 4J3XA 3QUYD 4O9HH 2AEQH 1SM3H 3FN0L 5FYKL 1NC4B 2HG5B 1DBKL 4PUBL 4MJID 1YUHB 4I48B 5F6HJ 4HLZG 3QXDB 4HS3B 4NIKB 1FFNB 1JRHL 3U9PL 5SWZE 1N2RB 3SY0A 3V4PH 1RPQA 3LH2L 5DMIL 2EYTA 4JFZH 4FABH 2OTPA 1DQDH 2Y7QA 3PL6D 2XNAB 4PR5A 1JNHA 2QQKL 1YEKH 4UTBL 5FKAA 4OGXL 5T1DL 2WMPA 3FN3A 3KLSA 4ZNEA 4YHZL 3REWB 4CW1A 1X5YA 3MJ8A 1NL0H 3DSFL 4QY8A 4MAYD 4R0LA 4PJ8B 1P1ZA 5IMOA 1XR9A 5LGJA 1X44A 4ZFZB 4P5KA 4YHMH 5H35B 1QFWL 5GHWH 2VQTA 3QI9B 1N5YL 4CGTA 2GUOB 2N7BA 2VE6A 4A2MA 3PIQB 1DSFL 1FVDA 4JFDA 1U93A 2R0ZH 1FGNH 1PDKA 2R0LH 2F54B 3GRWA 3VW3L 5F7NC 4PLJD 5IF0B 3V95A 3ROLB 2UWEB 4LKCA 1HXYB 3H2WA 3CXDH 4HIHA 2GJ6B 4EUPB 1VSCA 4L4TB 1N59A 2DWEB 5D2NE 3MUGB 3U9UB 4QCIB 5EBLA 1YEIL 4ZPVB 1T4KB 4YUEL 5E2UL 3MO1B 3QCVL 3MV11 4NZUL 4O58L 4MXVF 4RBPH 5ALCL 3TBYB 3BVNB 5T3XE 3RIFF 2DL2A 3TFKC 4HBCH 3PABB 4P2QA 4NN7C 4UUJB 2ARJA 3GIZH 1MSPA 5DSCA 3M07A 1CLOH 5F7WC 2WIIA 3P77A 4NNPH 5EU6D 5I16A 3ARRA 2NY6C 5HHQB 2QR0A 2IALA 2HJLA 3QCUL 2H32H 4ODXB 1NFDF 5EWIL 1FCGA 2XQYK 2DBLH 2EDDA 2D4FA 2BVUA 1IQDB 1E4XL 1TJGL 1INDH 4M1CD 1XGYL 2V2WB 1KLUA 2H3NB 3DPBA 4Z76A 3K0WA 5LQBH 3LPGA 4MD5A 5HGGS 3QQ4B 1NDMB 4GMTL 4L29B 2VOTA 2H2SD 1MVUA 3IJSB 2JJSA 5DFTA 1FFRA 5HYQB 1NAKH 3BKCL 3HI6L 4E42A 1DTUA 2V7NA 3D2UB 3IFLH 1D6EB 5DJ2B 3EFDL 3MSPA 2G2RB 1S5HB 5GPRA 3ZHKA 4G8EA 4NUGL 2X44D 1S8DB 4G43B 1QR1A 4NQCD 3OQ3B 4ONHB 2HMIC 4KROB 5EFIB 3IDGB 5ESAA 2R69H 1PKQE 3BXNA 5CP7B 5KTEL 2QADD 2A6KA 3KJ6L 4H88L 5LGHH 5EZJA 1TMCB 4XP9H 4OCNC 4DKDC 3M17A 2EECA 1ONQB 3FCTA 2IPUK 4FZ8L 5F72S 1I9RL 2BY0A 4NBXB 3T65A 5MEOB 3WXVH 1HNFA 5F8QC 3U2SB 1A2YB 3N1FC 4XNZB 1CFQB 1X5JA 1HYRC 5C6PB 1WEJH 4ZTOH 1MRFH 4N90D 4X6DA 3ILQD 4UU9A 5F9WC 3BWAA 3ARGB 3FRPG 3VFSA 3L3HB 4PJ5B 5B3JE 3DV4B 3SE4A 2V2XA 4JFEB 4HC1L 4XNXL 3I9GL 3WIHL 2J1KA 2OXHA 2FNBA 2DD8L 4R7DB 4M9OA 1PZ5A 1QLRB 4RGNB 5IQ9A 2BDNH 3B3IA 3VMPA 1HHIA 3A6OA 3PXJA 1XZ0A 3FFCA 1WBYA 1PLGL 4JRXE 3R0MA 4OCSL 5ISZA 2HYMA 1JPGA 5EZOL 2DQHH 5IROC 3ULVC 1U8LA 2DQTH 5J4MA 3ORJA 1F5WA 2CRZA 4I18A 2HKHH 4LAQH 3VH8A 1EFXB 5TE4L 3TJHD 4P2OC 4PD4K 4F57H 4GLRI 4MAYC 4F7MB 4ZUUB 4BKLA 2W60A 4Y4FA 1WCQA 4Z7OF 1DQML 3CSYA 2X2YA 3TIDA 4GS7B 5FDWB 2O5XH 2NW3A 4E0RA 3D85A 3BYYA 4RZCB 3NCYS 2LVEA 4O02H 3STLA 1BD2D 1G9MH 5GGQH 1HYSD 3EO1A 1TVDA 3O9WD 4NPYB 5GGSA 3RVUD 3MOAL 4NZJA 1AXSA 3GM8A 4WHTB 2VXUH 2AERT 1RZIA 4ODVL 5IHUH 1RK1B 5B8CA 1JNLL 3VA2C 2GFBB 4NFCA 2JTDA 2IFFL 1NGQH 5E4IA 3BP4A 1X4YA 4BK5A 4RGOL 1KBGL 1JE6A 1NCUA 4UB0L 4TNVF 5TPWL 4PJAE 5I1LB 3VG9C 5C9KA 4P5MA 1DUZA 1S9WB 3NGBC 2EDLA 4KK5C 2JIXA 1TITA 1A4JB 1U2HA 3TZVD 1S3KH 3PWPA 4HT1H 3MRDB 5E1HB 3S4SG 4D2NA 4JHAL 5EO0B 4LVNB 3BOVA 5C0BB 3ARED 2DLIA 4PGCA 2HLFD 4Q6IA 2VSCA 1OAKL 2IF7A 1FC1A 4TRPL 4PJ7E 1JWMB 2ADIB 3EHBC 4NO3B 5EIIB 3RZCD 3UTZB 4CVWA 4GQ9H 5DJ6B 3VXUD 1K2DB 4M6NL 3LDBC 4KTDH 3DURA 3D25B 3H9SD 1F4WH 3C8HA 5T5FL 3EZ8A 1R3KA 4DVBB 2NMSA 2XZZA 3HR5B 4LCWB 1RY7B 4K7FB 3A6CL 3MNVB 4MCZA 1JWSB 3D39B 4P5TC 3T0XA 4NN5C 5KSVA 1LO0L 3VJ6A 4W68A 2E5EA 2P47B 3OKMB 4CN6A 4PJXE 1UWEH 4FQXB 1MWAH 1KJ2B 3H3PL 3EGSB 3ZDZE 1WVZA 2R0KL 5I8CB 1U58A 4YNYB 3D3VB 1MEXH 4WY7L 5FUOH 1CDYA 1JZ6A 3DVNB 1CS6A 2UVFA 4HK0A 2IJ0C 2W9LA 4KHXH 3VRJB 4I1NB 4APQB 5DQ9B 3I75B 2X4QB 3JZ7A 3CLFL 5DMGD 5FHAL 1TJIH 4Y16C 1LO2H 1JPSL 2CR6A 1XF5A 4OZHA 2N1KA 4RA0C 3ZDXF 1EXUB 3PGDA 1T0NB 1T0MB 4D0CB 2E7MA 1MCHA 5KSAC 12E8L 4NZTL 5JIHA 1NEZB 3SDYH 1UFUA 4X5WB 1V05A 5DFWH 5A2FA 1U8KA 1HHJB 3EOTL 4NRYA 4NKOB 1QFWI 1ND0A 4YDLC 4XH2A 4OUUA 2HFTA 5EULV 3MNWA 3HZVA 3G04A 2J8UA 1ORQB 1XIWD 4N5ED 1YEFL 1DQLH 4U6HA 3FN9A 4V1DA 4YHYB 5I75B 3S35L 1NLBL 3P2TA 4N0UA 4PRBB 1MJ8H 3SJVD 4TOYH 4HIJB 3CMGA 2Z8SA 3BEWA 1F45A 2NY1D 3IDXH 4ZAKA 3D9AL 5CJXA 4M1DH 4OF8A 4PV8B 2I60H 5K9QI 3K2UL 2MCG1 3GMNA 4UMGA 2VN7A 3SDDB 2XRAL 4L1DA 2EDFA 2ESVE 1HKLH 2OR8A 3TA3D 4MQXD 5E56A 3BN3B 3EFFB 2OYPA 2DB8A 4F7EA 5MENB 1IGYB 3RVUC 5T1MA 3W0WD 5CUSL 3S36L 3QQNA 3IDUA 1YDPB 3MV9E 2CK2A 1A9EA 1CGVA 4C56B 1LDPH 1T83C 1G6RH 2BVQA 3VWKC 3QUZB 3OG6B 1MAML 4ZUTB 3AS2A 4H25B 2LU3A 2J88L 4DN4L 5KN5B 3CZJA 4CNIA 5FK9A 4FXKB 4PS4H 1FN4B 2LQRA 3V0VB 4YFDB 4HJ0D 5BV7H 1NFIA 2R23A 4WUKL 5D6DA 1NCWL 1SJHB 4C83A 5TGBA 3CC5B 2FBOJ 3HZMA 1Y6NR 1MLCB 5DRNA 3O8XD 4RFEB 5B38A 4D3CL 4XZUB 4O4YH 4FP8L 3DRTA 3GO1L 4PV9B 2UZYB 4OM0L 2F8OA 3X11A 1K8IA 2HFGL 5HY9A 3OKOB 1NBYA 5FXCH 1K3IA 3MJ6A 4G5ZH 4JZOB 4Y5XC 3ZYJA 2W07A 3LN9A 1AHWA 2A38A 1HHHA 1OD7A 4GRLB 4EXKA 1P4LA 1YY9C 5C0AA 3MLVL 1OAUL 2FH6A 5JW4Q 1Z9LA 3IAQA 5IESL 1IVLA 1RUQL 1S9YA 4NWTH 1CXKA 4Q2ZA 4YHNB 5DJZA 4XCNA 2FX8L 2PR4L 3LEYL 1J0JA 5I6XB 2HTLD 2UWEE 3TN0B 1A7QH 4OGYL 4JY6B 5J06A 3HNTL 3L3GB 1KGCE 4K3HA 4X7TA 1A7RL 3MA7B 3KPNA 5ESVB 1FO0B 3QDHA 3BO8B 4YDIL 1LEIA 3BD5A 4F58H 4LLVB 4UTAH 3UJIH 1OB1A 1YNKL 1BLNA 2QHRH 4F7TA 3GEWB 4PRPE 4UV7L 3WIFA 5EO9A 5E95B 4GW4A 4Y1AA 2DLFH 2KH2B 4HWZA 3WSQL 5C0NC 3K3QA 1QO3B 4OSUH 3K8MA 4OLUL 2Z8RA 4S1DD 5A2LH 2ICEA 2NYYD 1BZ9A 3QEUA 2GITB 2IBZX 4QOKB 3BAEH 1PQZA 5DMGC 4Q9QH 1EJOH 1IAKA 3BKJH 4LL9A 4M62H 1SVCP 3E6HA 4J6RH 1FE8L 3GSQB 3GMQB 2Q7NA 5LXGH 3LKNB 4E5XA 2DLHA 3FONB 5FYLH 2ATKB 5C6TH 3WN5B 5F9OH 5AYUL 1OT1A 4NQED 2KUTA 4MNQA 1LD9B 3DECA 3LN4A 3RUGA 5ICYB 4Y4HC 4IRJC 1P4IH 2IH1B 3VRIB 2G75A 2ZSVB 5DDHB 4R4BA 3MMEA 4LRIC 2W0FA 3BP6B 1W0YT 1QBLL 1WIUA 1DBBL 3DX6B 4N5EC 1DQJA 5HHXL 1UM4L 1FV1A 2CK0H 1TQCC 2EEDA 1NGXB 2Y5TA 3C2AH 1KB9K 3L7EA 5FM4A 3QUYA 4GG6A 2KL6A 4LP5A 1INEH 3AU1A 4DGIL 4S0TD 5I1EH 1ZHKB 4LDOB 4P2RB 1ACYH 5ANMA 4D9LL 2DDQH 3TA3C 4R97B 4ELKB 5I2IB 5B3JF 3S8WA 4J4PD 2FDBP 2Q3AA 5ADPL 4YX2H 2YWYA 3NH7L 4JZNB 4HPOL 4PRIE 2VUYA 2AXFA 2AEPL 1BF2A 1QOKA 2YWZA 1YMMA 1WLHA 4OZGA 5FYLD 2CLRB 2EE9A 2L7JA 3GBLA 5MEPA 4FQCL 1KIUA 2X70B 1B6UA 3UTSD 4OQ1A 5KZCB 5IROA 2ZOKB 2V17L 3DV6A 2BVYA 1B6DA 1RQ5A 4HQQL 3MJ7B 4P2OA 4OCRH 4MAYA 4KGJA 1X5XA 2FGWH 1D3CA 4OLYL 2F58L 2VDMH 3IDIB 4M6OH 5GGUB 5HD8C 1DUYB 1OY3B 5TDNA 1YPZB 4QWWC 3RNKB 2LTQC 43CAA 4UV4L 4X7SL 2P7TA 3MCG1 3GMMA 1IGTB 5JQ6L 2H45A 1TVHA 2YN5A 4FXGA 3DUSA 1P69B 4M6AA 1T03L 2F53B 3QCTL 3G9VA 1KLGA 1CIUA 2X4NB 1S7UB 1XF3B 1P9MC 2ADJA 1RUPL 1NBZB 4BSVB 4EBQH 4WJ5A 1UJ3B 1HHGA 4ETQB 5EN2A 1I1YB 3VXME 3GUTA 4X7DC 2HTLC 3VGFA 3SEPA 4H20L 4XCEA 3FRUB 4EIGB 4MAUL 3FQNB 3RWHB 4ZO6A 5GS0L 1F8TL 4AM0A 5EU6A 2RCSL 3W11C 5FM5O 3VGEA 4EQ2A 3VXSB 1TDQA 3BIBX 1W2KT 1RULL 2Z91B 5KSBA 3RGVB 4MJ5A 5C8JA 5I19H 4M8VA 1Q38A 5DJCB 4ELMB 1EA9C 3CX5K 5F7LB 2IANB 1I3GH 3L7FB 2DTSA 4OJFH 3SCMD 4PJ7F 2NY4B 3M8OL 4YFEA 3FT2A 4M61A 3WFDH 4PJ9D 3N9GL 4X99A 4G9FB 3F58H 2RB8A 2J8OA 3GK8L 1FYTD 4G9DA 1AJ7H 3D18A 4JDTL 1H0DB 2OSLB 1G7IA 2FJHB 4HF5H 4MXWH 3IETA 5F9DC 3ARFB 4NQCA 4FFYL 2G5BB 3B8SA 1FNLA 4P5TA 1AGDB 5KVGH 1JF1B 4NNXA 1CFBA 1BFVH 1L7IH 2D03L 4WU5B 4PJEB 3FO9A 4PJXF 3P0YL 1KCRH 1BZ7B 2H32A 3BP7A 1NDGA 5FCUH 3ZDZF 4P23C 4OAWB 4LCWE 1QFHA 1JPTH 3DVGA 4NC2B 3LN5B 1IBGH 4GW1A 2EYRB 2WBWB 1T21A 4QHMA 1IM3B 5D9SB 3FO0L 2R1WB