2J2ZA

X-ray structure of the chaperone papd in complex with the pilus terminator subunit paph at 2.3 angstrom resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
216
structure length
216
Chain Sequence
AVSLDRTRAVFDGSEKSMTLDISNDNKQLPYLAQAWIENENQEKIITGPVIATPPVQRLEPGAKSMVRLSTTPDISKLPQDRESLFYFNLREIPPRSEKANVLQIALQTKIKLFYRPAAIKTRPNEVWQDQLILNKVSGGYRIENPTPYYVTVIGLGGSEKQAEEGEFETVMLSPRSEQTVKSANYNTPYLSYINDYGGRPVLSFICNGSRCSVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHAPERONE PROTEIN PAPD
publication title Molecular Mechanism of P Pilus Termination in Uropathogenic Escherichia Coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/surface active protein
total genus 42
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2j2zA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2j2zA01
1AFVH 4F7EB 1ZK9A 2IH1B 4M1GL 3PWJB 4F15B 4PRPB 2FRGP 5I1IH 4G3YL 4XNYL 3WIFA 1T03L 3X3GL 2GJ6E 2W0PA 1CF8L 4ZUSB 1WQVT 1AQKL 3RZCA 3HMXA 1OP9A 5SV3A 4PRPD 1G7MB 4PLOB 5J1AA 3KLDA 4P46A 4Z0BH 4GG6F 3BZEB 1HSBB 4FQXD 4MDJA 4NNPL 3MLSL 2HRPL 2CDEB 2YK1L 4RGNC 1ZT7B 5F7LB 3O3BB 3FFDB 5IV2A 1Y6MR 3FQNA 1FCGA 2EO1A 4PJEE 4IS6B 1YEGL 4LLYA 1FNHA 3HNVL 2JB5L 5F1IB 3UPRA 2HVKB 5T1LA 3C8HA 2EICA 3GGWA 2LE9A 4U1LB 4X4ZA 1EO7A 2VIRA 3MJ9H 5FB8A 4AEIH 5I30L 5F89A 2GJZA 2H2PD 3VXMA 5BS0A 1UB6A 4HK0B 2YWZA 4OZIA 4XVJL 1YQ2A 4X5WA 3T0DA 1JHLL 3SGEH 2GSIB 4LL9A 3RNKB 1DJSA 3IFNL 5A16A 1FP5A 5D7JA 3ME0A 2YSSA 3SDYH 5LGHH 3HC4H 4PG2C 4HT1L 2VE6B 1Q72H 4LLDB 3OBAA 4MXVF 3PWPA 5DHXB 1DUYA 12E8H 2F5AL 2W60B 3BD5A 1E4WL 4NQEE 1MFBL 4PYGA 3O0RH 3ZKSD 4GW1A 1MFAL 3ZO0A 3AREA 1V7ML 4MXWH 1UXWB 4NUGH 4X8JB 5ERWA 4R2GD 4WUUA 4NSKB 5BO1H 1AD0B 2XWTB 4Y4FB 1UZ8A 3IDUA 4D3CL 1GRWA 1I4FA 2X4TB 4N0FB 4OGXH 2DQJH 4LSVH 2E3VA 1N8ZA 1SJHA 2X4NB 1LMKA 2EIBA 3CDFA 1H5BA 3LQAC 1Y0LA 4HUWA 4Y8DC 1TJIL 4Y4FD 5E8DH 4MNHB 5HYSA 1BVKA 3REWB 4NFCA 1N2RB 2W0FB 3QI9B 4MMXC 3S35H 1JHKH 4PJFA 3ILQC 4LLWA 4Q6YA 5T3ZH 1CL7L 4I4WA 4U6HB 1DEEA 1MUJA 1BEYH 3QNXA 4EQ2A 4CVWA 3DARA 3QI9D 2KQMA 4D0DA 3PL6C 3O6FA 1YPZA 2FX8L 1JZ5A 3RHWK 4HMDA 4HZLB 1C12B 4JPKL 2W9LA 4CKVX 2GSGA 2YXMA 4KDVA 1IM3A 3SKJL 4IRSD 1AGBB 3GKZA 3KVQA 2WLYA 5TDNB 4DVBB 2X4QA 4YGVB 5EU6B 3UTPD 4XVSL 1DDHB 2EDRA 1Z5LA 1UM6H 5EPMA 4G7VL 1CL7I 4YDVA 3CD4A 4X6FB 1A4JA 2D0HA 3I75A 1RZ8B 1WBYA 3OKKB 4JKPL 3ECBA 4O4YH 4M43H 5F3BB 1JBJA 4HGWB 4LCIL 4RZCA 4YH6A 1M05B 3IAQA 2P46B 1AGEA 4NO3A 3QHFL 3TEUA 3NZHH 1JZ2A 1NMAH 3NVQA 2DLFH 3UROR 2DTMH 3MO1B 2H1PH 4U1HB 5MI0C 3F12A 1MEXH 2ZP0T 4YXKL 3BIAX 4P9HL 1RZGA 2GTWB 1KN2H 4K2UH 1KCRL 5HHOD 2ZUWA 1AGFA 1F5WA 3UZEA 1ZGLA 2XIDA 1AHWB 1OAUH 4M7LL 4MD5A 3LD8B 1EGJH 2DKMA 1LHZA 4YFDB 4XPBL 2YD7A 1T22B 1ZA6A 4FFWD 4EQ3A 1EJOH 4NZUL 5H37G 4H8WC 5E4EC 3B8YA 3MR9A 4QXUH 3GSUB 4O51A 1D6EB 5JXAL 4PJEF 3QDJB 3MNWB 5IBUB 3QQNA 5IQ7H 2B20A 4Z7UB 5E2UH 4KK6C 4D0CA 1VKXB 1HNFA 2O5YL 3QDJD 2BY2A 2EDQA 5I16A 5JNYB 3DURA 4O9HL 3SEPA 5TH2B 1G6RA 4JANA 5CBAA 1S9YA 1BQUA 2ZOLA 3KS0J 3PGCB 1AXSA 4KUZL 4WIQA 2EYTB 3FQXB 1JNLH 5IHUL 5A3ID 3I9GL 4M00A 3A6BL 3VMOA 2APBA 5CILH 4NKOA 1FAKT 2V7HB 1R6VA 4ZO6A 1HKLH 1HINH 4HV8A 3ZKNC 3LEYH 1M6OB 4AG4L 1OGAA 1ZHKB 3O81A 1MHHA 1X5ZA 1UH2A 1QA9B 2BXYA 3V5DB 3RBGA 4AEFA 1KT2A 2DDQL 4NM4H 2YUWA 4GS7C 1DLHA 3BKYH 5B39G 2ICWJ 4HUMB 2GTZA 2H26B 3MQIA 3OL2A 2P42B 5E0QA 2XTLA 3VXSE 1KYOJ 2WIMA 4PJBA 5CUSH 5JOPE 1MWAL 4Q6IA 4R0LC 3UTZA 3X11B 1NGPH 1KIRA 2BC4A 5I1JH 4XHJD 2Q7YA 1PEWA 4ELMF 4WFHD 2OZ4A 5D1ZA 4ODVH 1K2DA 3QH3A 5DDHB 1A6AB 4I5BA 1KCVL 1BFOB 5C0AB 1HQ4B 1VACA 2BSED 1VA9A 3ARBB 4LSUH 4PRBB 4OIAA 3WJJA 4RWYL 4PR5A 2BOBA 4Y1AA 1VEPA 1XGYL 4X80L 5F21B 3NN8B 3QZWB 5C0AD 1JI1A 3FOMA 2A6JA 3ARBD 3FT2A 4HXAL 1Q8MA 3MRFB 4JZOB 1QNZL 2VL4A 3MREB 1QBML 3DX6A 1HHGB 4P59L 3X3FL 4B53A 3V4UL 2NX5E 1T1WB 5IOPA 1FNFA 5C0EB 3RVXD 3IDNB 3P4OB 4Y5VA 1DQDH 1Q0XL 3C6LB 3OR6A 1NGWB 2ATPB 2HKHL 3Q5YA 8FABA 4G43A 2FZ3A 1WFTA 3C6LD 5CIPH 4W6WB 3HCVA 1MJUH 3V9FA 2Z31B 3X13A 5IB3A 1AXTH 1G7HA 2C9AA 2FNBA 2VC2H 3BVNB 3T1FA 4JRXE 1T20B 4ZUTA 5GZNC 1QSEE 1WFUA 2X1QA 3T65B 1DQLL 1A7OH 2Z31D 2VDNL 4QXGH 3CDGA 5F1NB 2V9RA 4CU6A 3U0WH 1T66C 2XZZA 3HB3C 4PJAE 1OW0C 1KJ2L 2R2EA 1LNUB 3MRPA 4OZGB 4PY8I 1UVQA 4WO4C 4OQTA 1OTTD 4HJJL 1KN4L 1RZFH 5J06A 3CU7A 3QUMH 5ITBH 3KPSE 2AJUH 5BQ7B 3MLVH 1YYMH 3G6DH 3KYKH 1D5IH 1ORSB 2GUOB 4YDJA 5HHMD 2UVFA 1FL3A 1YEKH 1NCBH 2OJZL 1N0LA 1GGBH 1XMWA 4YFLF 1VFAA 2FX9H 3CFDA 5C0FA 2J12B 1TQBB 1IBGH 1MH5A 1C16B 1WBXB 5EC2B 1FGNH 4HCRA 4D8PA 3QIBB 2A74A 4MYWB 1HHHA 3OZ9H 4KGJA 5EWIL 5D7LA 4R7DB 2P8PB 1XF5A 3L3HA 4HC1L 3IDMB 3TZVC 3QIBD 1EA9C 2EE6A 3D0VB 2B39A 3WDJA 2EE9A 4X5XB 2JB6A 4R4BA 5F7YC 1PG7X 2JCCE 3BD3A 1C5DB 3WLWD 2V5MA 4YWGL 4I8DA 1RZ7L 2K1MA 4PJ5A 4N0RA 3SDCB 4K7PL 3SO3C 3IDJA 1GVIA 5GJSL 4WGVB 3TN0B 1YY8B 5DC9B 3MCLH 4QF1B 4ZDHB 1GPOL 4UAOC 1I1AC 5DJ8A 4YO0A 1PQZA 3TPUB 4UQ2B 1RJYA 2NTSP 4C59B 3TN0D 3UP1A 2AGJL 3MYJA 2LV4A 3CVIL 5E5MB 3O3EA 1J9CT 5IIEB 5L2JB 3FHAA 4JM2A 3WDHA 4FZ8L 5HVHB 3D1MC 3B6SA 1EEYA 3LN5A 1FLRL 4XCCH 1I9IH 4PS4H 1S9XB 4BFGA 1OAKH 4OD1H 4I0CC 3FFCA 4G6JL 4IRZL 4XRCA 4PGBB 1MNUH 5EO9B 2AEPL 3QHTC 2CGRH 5I66B 3CJJA 4NYLB 4QRRE 1MLCB 3EFDL 1F4WL 3CMOL 4CMHC 3PHQA 4J8RA 1J0KA 3EUUA 3I02B 4Z6AT 1UM5L 1VERA 1N5YH 3E0GA 2P47B 5D72L 1N7ML 3HUJA 1KXQE 4ZOBA 3QEQA 1HSAA 1LO3H 4ZAKD 3TVMC 1IT9L 1X5XA 3QG6B 2G5BA 2D3VA 1XCQA 3SDAA 1IC4L 4ZXBA 1UJ3A 3H3PH 4HS3B 3ZLQC 2MNUA 3HR5A 3FT3A 43CAB 4DVRL 4U2ZA 5DEZA 2OS7A 1F3RB 2FEEL 1CBVH 1PX3A 4PJ9B 4NQCA 1FAIH 1IEAB 2AEWA 1INQA 5EU5B 3A0OA 3MJ9A 2V7NA 4XMKH 1DVFA 5J7CC 3AM8A 3L1OL 1LO2L 3JV0A 1BAFH 1RHFA 3MCKA 1CQYA 2XI9A 3MV8E 5J11C 3L95B 2VN4A 2ADFL 1FG2A 4N0CC 2DQUH 1XF2B 1N6QH 4FOMA 5CJQL 3B3IA 2YRLA 2FEEI 3K80A 4I0PA 1YEFL 4LKCB 4PJAF 3K1KC 4XCEB 4YNYA 4GG6A 3IU4H 4MD0A 3VRLE 4UIKH 3TV3H 2F58H 3BSZH 3C9NB 3QNZA 4UT6H 1OAZL 1WGOA 3WJLC 3IDYC 4OT1H 3R0NA 3O8XA 1K8DB 2ESVB 1S78D 5C92A 1MJ8H 5DJAB 5E8NB 1I7TB 1WCBA 3EDFA 1A7RH 4LHQB 4KKBC 4WCYL 1R3LB 1YC8A 3PV6B 4LCWB 4MNQB 2ESVD 1YY9D 2NLJA 4HUNB 4ZUUA 3T0ED 2RQ8A 4DZBB 2WBJC 4QRPD 1YUHA 3HNSL 5E9DD 1PVHA 3AXLA 5FAAA 4LCWD 4PRAB 4MNQD 3BW9B 4MJIA 2I60L 3K8LA 1U8LA 4UMGA 1FZJA 4XVUC 5IESH 3L5WB 5EZIH 4E5XB 1KIQB 2FB4L 3O11A 1Q1JL 1JPSL 3LH2H 1D6VL 2MCPH 5TQ0L 4ZNCD 2DRUA 3GK8L 1A6ZA 2EH7L 2ZUUA 4GMSH 5H94B 2JCCF 2OJEA 2X1OA 4M48H 2MOVA 5FDWA 5I76B 2AXJA 3OPZH 3UJTH 3ELAT 1LDPL 2GY7B 4CMMB 2J8OA 4J3WA 1I1FB 4LHJB 4JFXB 4KV5E 1YMMB 3MA7A 1H15B 3RDTC 3I2CH 1AXIB 4NN6C 3QDME 4XB8A 4UV4H 3MRDB 4GRLB 2J5LB 1TVHB 4WEUD 1T2JA 3HAEG 4G6MH 1VFBA 5DEFB 5ALCH 3ZZ1A 3FZUC 3F5WA 1YMMD 2E9BA 4NJ9L 2NW2A 4M1CC 1TJHL 2H3NA 4GRLD 3WNLA 5F72S 2VQ1B 2PCPA 3WD5L 5KVMC 4XCNA 5CMAA 3UO1H 5FYJH 2XZCL 3HI1B 1BQLH 1J5OH 4HAFA 4YX2H 4CNIB 4PRPE 2B4CL 1BFSA 4AH2A 3U7YH 1BWMA 3C60A 1T83A 2X4RA 2CKBH 1S7QA 2KL6A 4HGMA 1H3UA 2IJ0C 2YPLB 1IC5H 2P24B 5D1QC 2WBWB 3QRGH 4TOYL 3FB6A 1YNKH 5EC1B 3V5HB 1CGUA 3U7WL 4LLUB 3QDGA 3ES6A 1EGJA 3D48R 4NO2A 3LKOA 4GRMA 3P73A 5IWLA 3MV7D 4ODSH 5DK0B 5C3TA 1CFSA 2V2WA 2YPLD 4KQ3L 3HPJB 3LSOA 1JPFA 1SM3H 3MROB 5JIHA 1OWRM 4UV7H 4NBYB 5BVJB 5ANMA 3RZCC 2WIIA 2A6KB 1CLYL 4QNPE 5IEHB 4IMKA 4P46C 3VXPA 1A7NH 4MX7B 3QIUD 4JO1L 1QFUH 2BNQB 1A6UH 1NCDH 4WW1A 2VR5A 3MRCB 2GAZB 4G8GA 4Y88A 1OD7A 4D0BB 3G5VB 1T7ZA 2K7QA 5EZJB 1TENA 3D9AH 3LS4H 1FG9C 5FO8A 1PY9A 3JTTB 3MACH 2KZWA 4NDMB 2BNQD 2JTDA 2R23A 4BQCA 5GQBA 5CD5D 2HT4C 3DTXB 1KB9K 4YBLB 3BWAA 4FTVE 1AO7E 1CDCA 3OWEA 1DEDA 1Q9OB 4NZTL 3NCBB 1CFVH 1P2CB 1N64L 4POZD 4X6EB 5DXWA 5JPNB 4DAGL 4UNUA 3F58H 1NGQH 2AK1L 2GJ6A 1KCUL 1KPUA 4DKEL 5IHZB 3EKCA 2G60L 4WU5B 3TH4T 1U8PA 4JDZA 3H0TB 3OF6A 3VRLF 5J1SC 4GAGH 3P9LA 1RULL 2XY1A 1WZ1L 4TNVK 1YNTA 5D7JC 3R0MA 1JWUA 3KLAA 4PJEA 1OTUC 5F7EL 2FH8A 4RX4D 4FQQA 4QHUB 4KJYB 1CF8H 4XNQB 3GBNL 5GISH 4F7PB 4N1HB 4JLRA 4E0RA 3C6SA 1RJLB 5JHDB 4RGND 4WGWB 4ZUVA 3H3BC 3TBYA 3MLSH 1EZVY 2HRPH 3GSNL 3KJ6H 1IQDB 3K4AA 3ALXA 5SWSB 1RHHA 5FUZL 3IS0X 1YEGH 5CJOL 2IMMA 1H5BC 1JPGB 4LSRH 4OLVL 2JB5H 1K5NB 3UTPE 3N9GH 1IQWL 2H9GA 5SWSD 2QR0A 4BUGA 4R3SA 5I30H 5GSRA 2IGFL 2BCKA 5EU6E 4U6VH 4FA8A 3S9DB 4M03A 4KV5F 4ACPA 4JZNA 4M6NL 2E7BA 4NQEA 4XVJH 3O6FC 5GGVY 4CN1A 4UT9L 1DQMH 1YQVH 5ESAB 2IH3A 2R0KH 1IJ9A 2ZG2A 2YBRB 3MLZH 3MLTA 4JFEB 4K9EL 4OKVA 4HT1H 5E8PB 3S3JA 5KW9L 4XC1L 5E4IA 5A2JH 4OLUL 1ZXQA 2F5AH 4TULL 5CIPA 1T1XB 4PJCB 1YEEH 1E4WH 1TVBB 1MFBH 1VFOA 1B2WL 4JFED 2FL5A 1MFAH 4MZ3A 1KPVA 5DD0H 4JFPB 4R4FL 1KNOB 1IE5A 1V7MH 2CPCA 1OLZA 1YN6A 4FXKA 1A1OA 5F44A 1U2CA 4M6ML 3OR7B 3OJVC 4DZ8B 1F4YL 1R3KB 5TQ2L 3O2DL 1R5WB 2W38A 4D3CH 2ZUVA 4J4PA 1V3JA 1FNEB 5BZWB 3QWOA 2NMSA 4B41A 5EZOH 2YD1A 4NCC1 3UX9B 3PL6B 4Q0XL 1FSKB 3ILQD 4I18A 4UTBL 3FQWB 4PTTA 4U1IA 2EC9U 3DV6B 2W9DL 2X4PA 5LKNA 2R56L 2QQLH 1CL7H 3QDJE 3PL6D 4PJXE 4MVBC 4QNPF 1YECL 2Y5TB 4L4JA 4WI9A 2AV7B 1H3VA 3LKNA 1R5VB 1N6VA 3IJSB 5HDBE 1J0IA 4G5ZL 1RK0B 2X4OA 1IAIM 4JPKH 3ZL4H 1CDUA 3ZYJA 5EUOB 1J8HB 4M5YL 4L3CA 1W8NA 1JWSB 3SKJH 3MLXL 2P5WB 4WDIA 3CFBA 4MA1C 1H3GA 1LD9B 3TO2A 4H88L 4Z76B 4L8DB 3VU2A 1S7XA 4KHTL 3LRSB 3W39A 1J8HD 4G7VH 4AQ1B 2P5WD 4L8SA 1CD8A 3AFLA 4G80B 3KPLA 1XGUB 1KXTB 3CX2A 5GGRY 2HH0L 4JKPH 1CVRA 1IGJA 4LCIH 4HJ0C 1KCSL 3FTGB 2QBWA 5IB4A 2XFXA 1RZJC 3L5HA 2BSSA 4MAYC 2K3TA 3IJHB 5HY9B 4M3KB 1VPOL 3PWLA 1W0VB 3MRHB 1B3JA 1T04B 4XPHH 4XZUB 4YXKH 4RNRA 3K8MA 1CXKA 1JWMA 4WFHE 3MLPA 1KCRH 2AJZB 2AAVA 2MPAL 3TWCH 5T1DL 2QKIB 2NCMA 4M7LH 1VEMA 3DHMA 4HFWB 5JOFB 2P7TB 4EDXA 4XPBH 1AP2A 3DVGA 4UIMA 1U8HB 4NZUH 4DUVA 2IADA 2VR4A 4S1SL 3DX7A 1JNNL 4F7TB 3JTSA 1IARB 3O2WH 5C0AE 3C08L 2N56A 2PTTA 2C1OB 3NFPB 4Q6IC 2FGWL 4KK6D 5JA9A 3NCJL 5HYSG 3P0YH 2V9QA 3CSGA 4X6BA 2D4FA 2MKWA 4QHMB 3QXVA 4KTDL 1IAOB 5TE4L 4O5LL 4HPOL 5DMKB 4DK3A 1RJCA 5D1ZC 1T21B 3HZVA 2VISB 2O5YH 1J05B 2F9BT 3MUGA 3N50A 1OAQH 1FZMB 3HRZA 1PBYA 3QWQB 3V5KA 4QOKE 4X4YA 4M61B 3GI9H 3ARFA 3KJ4C 3B5TA 2F54D 4KUZH 1S5HB 4KI5E 1A0QL 3VRIB 3A6BH 3ZKND 2Z93A 1LE5A 4YXHL 4P23A 3HC0A 4ODXB 5SX5K 4YDLC 1DQJB 5DO2C 3VXSA 4Z7QE 2ID5A 1ACYL 2L0DA 2VDKL 4AG4H 2W07A 3P77A 1A2YB 2BFVL 5EU7E 1N3NB 5TGBB 2HT3D 4FMFA 2DQEH 1NANI 2JE8A 3F7VB 1JYXA 1JZ7A 2Z4QA 4B50A 3BP5B 1KIUA 2BMKB 5MHSD 4BFBD 5D6CB 3MRQA 4Y5VC 2GK0B 4KGLA 4NQSA 4K3EL 3OJDA 4UOJA 3SOBL 3UYRL 3NPSC 5GPRA 1NBQA 2C3VB 1OP5H 4ORGA 1XEDA 1OHQA 3VCLA 2FIRT 2WINB 4PRNA 3RJDA 4XPFL 1MJJB 3WXVL 5CCKL 2DQDH 4OZGE 5KJRL 1VDGA 4QHKI 5AZ2H 5HHPB 4FQ2L 1AKJA 3RY5A 4HHAA 1T7XA 2PYEA 1KCVH 3TBTA 4EN3B 4PJXF 1XGPA 3CSBA 1I7RA 3QAZC 4U6TA 3MRLA 2NX5A 4RWYH 1KTRL 5DR5L 4K94C 3R1GL 4P5KB 2APWA 5EBLA 4EN3D 4R96A 5HPMA 3RL1B 1GGUA 1IGTB 4PREB 2VDPL 4CN6A 1QNZH 5HGDA 1MCQA 2O5ZL 4BELD 4PLNC 5HGBB 1QBMH 5I1KL 4JY5L 1KB9J 1SVZA 3P11H 4AL8L 3ARUA 1JN6B 5CD3B 1CGWA 2H8PA 5KS9A 4Z7VA 5GRZA 2VLMD 3FQTA 1P5UA 1HOCB 4JRXA 2OBGA 5IFAL 3PWUB 1QSEA 4HLZH 3WCYA 4ZTOL 2QHLA 1Q0XH 2CRYA 3EYFB 4OFYD 4RAUA 3WLBA 3L3OA 4C55A 5D7SH 4LGSB 1QLRB 3BP4A 4LCCA 4ZFGL 2Y06L 4TTDC 3OJMB 1MVUB 2D03L 4HWEL 3NFSH 4PGJA 1Z2KA 3BPCB 4PV9A 2IAMA 4JJ5A 5GZND 2FR4B 2I5YL 1RK1B 2BNUA 4JEGB 2FX7L 3KPSA 1J86A 2EDKA 3H6JA 4OAWA 2WQ8A 2R9HC 3QXTA 1DQLH 3IXTB 4OI9A 1X5FA 4I2XB 3L3IA 3UAJC 3GJFB 3A67H 1T66D 3HB3D 4CJ0A 3PNWA 3EO1A 3PP4H 3RWFB 3WKML 1U8JA 3DX9A 3LPWA 3QUYB 4ZFOA 5IJVA 4HJJH 4R4NC 1KN4H 2OTWB 5FYJU 4B0MM 5BMFL 5L9DL 3E3QC 2O26U 3GRWL 4YDKH 3B5GA 3DROA 2WANA 4TSCL 3DGCR 1DBAL 4JM2C 3VD4A 2DTSA 1R3JB 1L0QA 4I48A 4KRMB 5E1AB 5E2VL 3TZVB 1TCMA 1PX4A 3GUTB 5MEQB 2JCCA 2HJKA 1C5CH 1T4KA 5KTEL 3GSWA 3IDXL 2WQRA 1WISA 5MEPB 2EKSB 3TZVD 3WKNA 4KI5F 4UUJB 4PLKC 2QQQA 5DFTA 1UG9A 3WFDL 2Y4SA 4Z7QF 4HWBL 1UGNA 1JZ4A 3CVHB 3SO3B 3MLRH 4L3AA 1ZHNA 1EFQA 1P53A 3NTCL 3KGRA 3RZWA 3WFEL 1YEHL 3SDAC 1I1AB 2ZSWA 5KVFH 3NACH 4Z78A 2MKLC 3AS2A 4ZXBC 1UJ3C 3LKRA 5DZLA 4C54A 1P5VA 4YWGH 1PD6A 1JMZA 3FJTA 5FO7A 2W1NA 3MRKA 4XI5C 1MCEA 3K7UA 1I1AD 2C26A 2EC8A 3OAUH 2Z35A 4BZ2L 1G0DA 5GJSH 3CC5B 1I3RB 2ILLA 1RV6X 1BF8A 2FJFB 5M7QA 4C56D 3BGMB 3OG4B 4QRRA 3ZTJH 1A1NA 1DVFC 4U1MA 4TYUA 3CVIH 3AM8C 3IGAB 3I6KB 3ORJA 5EU4B 2VLRA 4OZGF 1CXIA 2JK5B 2OXHA 4FZ8H 5IHBA 4GOSA 5C09B 3CXDL 4LEOB 3NABL 4RISL 4K3JL 2ESVE 4RFOH 1MCPH 1KENH 2CUIA 4LCYA 9CGTA 1NSNL 2YR3A 1RMFH 3QEUB 4G8EB 4MD4A 3M17B 4Q9RH 1WWWX 3JWOL 3V0AC 4I0PC 4P2RB 3OGCA 4LCWE 3EFDH 4MNQE 2HG5B 4CADA 1F4WH 3CMOH 3D2UB 3TVMD 5L6YL 1YNLH 1DP0A 1UM5H 3I6LD 4NUJA 4NWUH 3EYQC 4JFDB 3SE4A 3H7LA 3L5XL 2BSTA 2BVQB 3U9UB 1N7MH 1EHXA 3O8XC 1UENA 4P2RD 1EO5A 3BUYB 4QCIB 3IRZA 2P8LB 5DWUL 1RD6A 1IC4H 4KROC 3TA3A 5EO1A 4JFDD 3VD9A 3SE8H 5IB2B 2WM0A 1WBZA 3D87B 3MV8A 3G5YB 3UBXI 3QEHA 3AC0A 3RX5A 5K9OB 3T0VA 5J11B 1H8OA 3REVB 5D9SA 1CFNA 3HZYB 1UC6A 3IF1A 2OXGA 3O41B 4JDTL 2X4SB 2ARJQ 1ZA3B 3OHXB 5C8JA 1LE9B 1MCWW 1I3GH 4DGIH 4N0CD 4ERSL 5BZDA 5JOEA 3RWGB 1NFIB 1JCKA 5E95B 5I73C 5IT2L 4K3GA 5IG7B 1G0YR 5EIIA 2CRZA 3IDYB 4FQHB 1I9JL 3RIAF 5CJQH 3DBXB 3NMEA 5GGRB 5CWSB 4HBCL 3V7AE 5EOQH 4NO5B 4M7ZC 5D93C 1K9TA 2WLZA 4ETQB 1JGUL 4LPCA 5FO9B 1H3PH 1WC7B 4KKBD 4BSVA 3TJEH 5LGJB 3RIAK 1TETL 5E5UB 2YPLE 1OPGH 5KSBE 3F7YB 4OGZA 4WCYH 1PFCA 1IKNA 1A6WL 4JREC 3SKOA 3MJ7B 2VUYA 4TUOA 4WU7A 4EVNB 4LP5A 2A6DA 3D0LA 5I1EH 5DJ0A 5I15H 3C60C 1AD9A 1T83C 4XVUD 1FNGB 5DYOA 4DGVH 1SVCP 1ONQB 4CVZA 3S6CA 1MRFL 3BXNB 3QDMA 4NBZB 3OB0K 2R0LL 3RDTB 5I2IA 4HIJB 5TQ0H 4NN6B 5IWLC 1PLGL 1NGZA 5EO0A 2EH7H 5D96C 2B0SH 1BJMA 4LARL 2DKUA 4UT7L 1MJ7H 1S7VA 3R8BB 3RDTD 1LDPH 2FJHA 4QRQB 5F9JB 1SBBA 4IMKC 2IH1A 3GIZL 5IMKB 2VLKE 3PWJA 2FJGB 4PRPA 3U4BH 1LQSR 3FZUD 1P4LB 5E8EB 4ZO9A 1F11B 3RVWC 5T1KD 1KB5B 3MLUL 4M62L 4ZUSA 1OY3B 3S88H 3K46A 4NBXB 4NJ9H 3QCVH 1G7MA 2YN3A 4W4OA 4G9FA 1TJHH 1HSBA 3AB0C 3KPRB 5J3HC 3BZEA 3SE9L 4YDIH 4LCUA 5A43C 3WD5H 5GRWA 2CDEA 1ZT7A 2XZCH 1OGTB 5L2KD 1RU9L 2UV3A 4CGTA 1WFOA 3FFDA 3KPRD 3QJHA 4AENA 5D1QD 3O3AB 1DBML 5LJYH 1NC4D 1GIGH 4Y5YB 5I71C 4MJ2A 4PY8J 5F1IA 1OP3K 3SQOH 1FORL 4TOYH 4NT6A 4U3HA 2Y36L 5JHDE 4JFQB 5J1AB 3W11D 2BX5A 1ZOXA 2BRQA 5C2BL 3MGAA 3C5JB 3BISA 4HK0A 2EZ0D 3RZCD 5KSUB 3IVKA 5SWSE 3L7FB 4P46D 2E7HA 5IV2B 5IJKA 4FTVA 1AO7A 2Z8SA 1GGIL 3RNKA 4H5SB 2L7UA 3MZTA 1MLBA 1CLYH 3MV9B 4U2YA 3FONB 3BO8A 3UPRB 2E9IA 4LDLB 2CKNA 1YC7A 4U4BA 3QO0B 3OXSA 2VXVH 2A0LC 3QIWB 2VE6A 2VIRB 4YAQA 5FB8B 3AGVA 3MV9D 1RVFH 4KRPC 5F89B 2GJZB 2DQTL 3GB7B 5BS0B 5J6HB 1UB6B 5E1HB 2F8OA 2DQGH 4KAQL 1MI5A 3QIWD 3STLA 5IBLC 2VOTA 4X8JA 1UXWA 5ILTL 5K9KA 2RCSH 1KEMH 3VXMD 4Y4FA 5BS0D 1Z3GL 1XH3B 2X9XA 2X4TA 5A16B 1D5ZB 1HH9B 2NY0C 2X42A 3C5SB 1OL0A 1LO4H 2AK1H 1D9KB 1KCUH 2X4NA 4I3SH 4AYFA 4N1EA 3MV01 1I8MA 2QTEA 2G60H 2NY7L 3MNZA 1L9MA 1F6AA 3PWPB 4OZ4A 3SY0B 4PJCE 5D7JD 2W0FA 3QI9A 4M8VA 4K7PX 4GW1B 1OTUD 5DT1L 4U6HA 1RULH 3B9KB 1XCTB 1REIA 3QQ3B 4WUUB 2HJLA 3PWPD 5EBMB 1ZGLM 3BZFB 1UZ8B 4KU1A 5F7EH 1T5XA 3EHBC 1I4FB 1ZV5A 3AMLA 4FFZL 4TSBL 1KFAH 1MWAA 5DD5H 4DW2H 1DZBA 1QPXA 2FHBA 3GBNH 4HZLA 3B9KD 1C12A 1SJHB 3V95A 4XP5H 4PBVC 4WUUD 1H5BB 2QLVB 3H9YA 4HIEB 1WAAE 3KXFA 3F7QA 3DSFL 4IRJA 1AGBA 2AK4E 5HYSB 1NAKL 4DVBA 5TDNA 3OV6A 5CS7A 1I7ZB 4QRUB 5EU6A 1M71B 4PJFB 2KPNA 4LLWB 4XX1G 5T5NG 1S7SA 1DDHA 3EYOA 1P9MA 4KDTA 1VGKB 3IT8D 3HE7B 4XP4L 3VD7A 5FUZH 3SDXE 4D94A 3QNXB 1GZQB 1I3UA 1TTUA 4OLVH 4D0DB 3O6FB 1YPZB 4I18C 3CCHB 2D9CA 3OKKA 4O00A 3OXRA 1I8IB 4HGWA 5EZLA 1J8HE 3NA4A 3GSRA 5GS0D 3DIFA 3O6FD 1MREH 5F7MC 2ATKA 2FBJH 3MO1A 2IFFL 5HDQL 4U1HA 3RWCB 4RAHA 4P9ML 4M6NH 5DMGC 1Z5LB 5EPMB 4K3DL 3O4OC 1MF2H 2GTWA 3I50L 1A4JB 1F2XK 3LHPH 3I75B 5SX4I 2ZNXA 3EDKA 1AHWA 5FKAB 2JJTC 3ECBB 4RZCB 4K9EH 1T22A 3K2UL 4X9IA 2E6JA 4AEHL 4XC1H 4OLUH 3M8OL 1ITCA 1D5MB 3TESA 4U6XB 4TULH 4ZPTB 1ETZA 4L8SC 2AP2A 3LZFL 1B2WH 3F12B 4QLRA 4RCAA 4NN7C 4R4FH 3QDJA 3MNWA 4C4KO 5HJ3A 3RWEB 2ZOKB 4PJXA 3VRJA 3MJ8A 3A6CH 5TQ2H 3O2DH 3SO5A 1MAML 1ZGLB 4MD5B 3P40A 1ZVHA 4XNXL 3QDHA 1ZA6B 3BT2H 5C0CB 3TIDB 4XGZA 5TH2A 5D7IB 4ELKB 1JRHL 4MVBD 1KJ2A 3PGCA 5E6YA 2ZUXA 1K4DB 3FQXA 2R56H 5T3XL 2CSPA 3WUWA 3MR9B 1FNLA 2X40A 3S36H 2OMNA 4HG4J 1FVCB 3VXUE 4D0CB 4CDGC 2PXYA 5FK9A 1Y6NR 4G5ZH 3MBEA 5E6IB 4KKAC 2HFEB 2L7JA 1DBJL 4M5YH 2C5DC 3V5DA 1MY5A 3KWWB 3MLXH 1K6QL 2PYFB 5CBAB 2VDML 4TQEH 5E6ID 1KPRA 1AXSB 5JW4N 4KHTH 1JRHI 2H26A 4MAYB 5B3NA 1T7WA 3RNQA 4QTIH 3QXUA 2V17H 5GRVL 2HH0H 2P4AB 1OGAB 4P3DB 3D39B 4MAYD 4U1JB 2EDLA 3ARFC 1MHHB 3L3KB 3E6FB 3LN4B 2CLZB 4PJCF 3D18A 1KT2B 5AYQA 4P23C 1C08A 1OGAD 4QHNB 4JFFB 3TM6A 3K4ZA 5GRJL 4ONGL 2EIEA 5C0AA 4JO4L 4PRBA 1GOHA 5GS0L 4E41E 1NMBH 4KK9C 4MDIB 5GGSA 4JFFD 3QZWA 2O5XL 2AXHA 5C0JA 4XVTL 4YFEA 4G7YL 1SJVA 1UM4L 3MRFA 2A2QT 3Q1SL 4KVCL 1WAAF 2Q7YB 1KJVA 2PETA 3PJSA 5AYUL 4MQ7A 2XA8L 1G9NL 4HUUB 4S1SH 3ULUC 4QOKA 3QH3B 1HHGA 1KACB 1JNNH 4P3CH 1FN4A 4RMQA 2J88H 2PO6C 3NCJH 5DJZB 5D1ZD 3KJ4B 3SDXF 2G2RB 5C0EA 4PR5B 1A6TA 3IDNA 5HYFA 4O5LH 4HPOH 2DWEB 1NGWA 4RIRB 4LASH 3FOMB 2A6JB 2VH5L 2IALA 1JHTB 4Y1AD 1FRGL 5CEYA 5AWNL 3W9EB 3DX6B 1IGFL 1VGEL 4XCFL 2Z31A 4JE4B 4K7FB 5DO2D 5JIKA 3SBWA 1A0QH 2ZJSH 3BVNA 1BM3L 4YXHH 5L7XH 5IOPB 4LNRB 3ISWA 3T65A 2QSVA 4Y5VB 1YEDB 3OR6B 4D9RE 5BVPL 1ACYH 2VDKH 2WUCL 4J3OC 1RIHL 5F1NA 4X7SH 5C0IB 3HE6B 2ZZUT 2GJJA 4G43B 3VMPA 2XNAB 4OZGA 3HCVB 1LO0H 1ZE3C 3X13B 1JI2A 1E4XH 4JPWL 4CU7A 3T1FB 5BQ7A 4GKZB 3VWKA 5ADOL 4H0IA 2QADB 4I2XE 2GUOA 1XGRA 4LCCC 4MCYA 4PP2B 1P6AB 2AXGA 3CH1B 2IAMC 4XPFH 3VG0L 3VFRB 3QA3B 4NNXB 1C16A 4W68A 4FXGA 4C58B 1CR9L 2R2EB 4MA3A 3VFVA 3MRPB 1NBVL 4LBEB 1UVQB 4FQ2H 4HS8L 4YHNA 2NTFB 2A1WL 4M9OA 1D7FA 3EOTH 4WI2A 3CZFB 2A83B 4R7DA 4JGJA 3IDMA 1RQ5A 3MRIB 1DUZB 5DR5H 4YDJB 3R1GH 2R0WH 2EIZA 5JA8B 3D0VA 1FL3B 2SEBA 3RGHA 3EJZC 4X5XA 3U83A 3CFDB 4H20L 4P0DA 5ACLA 5C0FB 3ULVC 1C5DA 2P8MA 1CLOH 3KPQA 1Q9KB 2O5ZH 4D8PB 3SDCA 4UB0L 4UI2A 3ARTA 4GXVL 5FUCE 1HHHB 1UA6L 2NNAB 1WEJL 4AL8H 3U0PB 1ROWA 1YY8A 3VXOA 3L3HB 1L6XA 2GITB 2RR3A 2J1KA 3CFEB 2UYLB 3K4DA 4X8XA 1P4BH 2ICWB 1XGTA 2DWDA 4R4BB 1X5GA 3NA9H 4O2CB 4F3FA 1KBGL 5IIEA 5L2JA 1AQDB 2CR6A 4KKLC 3BEWB 2MHAA 2PR4L 4K8RC 1L7IL 3W82A 2R9HD 1T2XA 1DQQB 3IDJB 1F6LL 2I5YH 2BJML 1V8HA 3B4NA 1FE8L 3UAJD 1HHIB 2D7TL 4PGBA 5EO9A 2FX7H 2OP4H 5C0GA 5I66A 4PJ5D 4YO0B 2ZCHL 2VZVA 1RJYB 4JFOB 4NGHH 4L1HA 3EYVA 3I02A 3MYJB 3QXWA 1IAIH 5BOPA 1UCBL 3NZ8B 3AY4A 3BZ4B 5EORL 4JM2B 4YJZL 4O2EB 4R4ND 3N85L 5E08L 5C09E 3T09A 3WKMH 3BN9C 4QWWC 3G6JB 4XWOC 4LRIA 2M8XA 3I6LE 5L9DH 4HS3A 4JM2D 3P4MA 4R90L 5C6PB 1U58A 4I3GA 4GO6B 4TSCH 1DBAH 2ED8A 2DBLL 3MUY1 3H9ZA 4PJ9A 3CK0L 2DICA 4PY7B 4J8RB 1IEAA 3FFCD 4YHYB 3UC0H 5E2VH 2XXMB 1U36A 5IW1B 5J13C 1UQSA 2H45A 4PD4K 4ZUWB 1B90A 1HSAB 4PLKD 4NKMB 4KDWA 5KTEH 2ERJC 1XCQB 4FQLH 3O2VL 2DMCA 4GSDL 4PRHB 4ZXBB 5MEOB 1E4KA 4ZOAA 3L95A 4P2OB 4JR9L 3T2NL 3HR5B 2YPVH 1NUFA 1ZKAA 4HWBH 1G9ML 2XV6B 3RVTC 3WYRA 3SDAD 3SE4C 4RMWA 1XF2A 1MQKH 1O7VA 3QHZL 1ZLWH 3UTSB 4ZXBD 3NTCH 4N90D 4P2OD 3BWUC 1QSVA 1ZSDA 2XZAH 4LKCA 3TA3C 4GJTB 4XCEA 4IDLA 2DYPB 2V7NB 1KC5L 5IVZB 3U46A 3UTSD 4NQCD 3ZKQD 3H42H 3MCKB 5JR1L 4IIQB 1LVEA 2ESVA 3EOBA 5L8JB 4Y8AA 4BZ2H 4TNWK 2DYPD 1I7TA 3T0AA 3QG7L 2R4RH 1FG2B 5F88A 4IBLT 2ENYA 1C1EL 4N8VB 1R3LA 2FCBA 3PV6A 3V52L 5I1DA 3FO1B 3B3IB 4MNQA 4AY0A 4LMQE 1GJIA 3PGFH 1E6OL 5FGCB 4DZBA 5FA3B 4YNYB 4GG6B 2Q8BL 3GDBA 4LGPB 4XAKE 3CXDH 3QNZB 3BW9A 4R97C 4X9BA 4RISH 5IVXA 3GJFK 3CXHK 4I0PD 3SKUD 4OGYH 3L5WA 4OSUL 2Z8RA 1WCBB 5I17A 3EYQD 5D4QA 2N7BA 2NY5L 4NZRH 1NCTA 3O8XD 1CZ8H 5L6YH 2F74B 3TIEB 5J56B 5H94A 5J12C 4OKDA 1HXYB 1PZ5A 2IEPA 2LAGB 5DK3A 3RU8H 1YUHB 1DBKL 1J12A 3MA9L 4CMMA 4U33A 1I1FA 4MJIB 3QBTB 5E7FA 1SEBA 2NXZC 1U8LB 1HILB 4Z9KB 4KI1A 1IKNC 3MRDA 1Q9WA 2NYYC 3GJFH 4K3HA 2R29L 1SBSL 5DEFA 4MJID 5T3ZD 1A6ZB 5J8OA 5IQ9A 5I73B 2ICWI 3QISA 3IXAB 3WNKA 1QLEL 1WUNT 1X5HA 4P57B 5AG8A 1MCNA 2NY2B 1DSFL 5HD8D 3HI1A 2CRMA 4F2MB 1HQRB 3MA7B 4ERSH 4LVOC 1FO0L 4M7ZB 3M1BA 5D93B 4ODHL 3HI6L 3ZE0E 2NY2D 3IFLL 3LIZL 5ADPH 3MOAH 5JQ6L 1W0WA 2YPLA 1CDJA 3DETC 1QG3A 1IFHH 5EC1A 1I9JH 2DJSA 3F5WB 3V5HA 5KSBA 1N59A 4FQPA 3P4NA 4X6CB 4DN4L 3RJQB 3OB8A 4UDUB 4KPHL 5F6IC 5DK0A 1KELH 2PCPB 2YXFA 4N8PA 4XCNB 1AJ7L 1HWGB 3HPJA 4JREB 3IAPA 1JGUH 3MROA 3LMJH 1A4KB 1EV2E 5FDYA 1IAMA 5BVJA 3WFBL 1MAKA 2X4RB 3CVHH 2A6KA 2CD0A 1TETH 4W4OC 5HHNB 4QHKJ 3MYZA 3O2DA 4MX7A 4NQDB 4JHAL 3VFNA 2B1AL 3C60D 4HH9A 3MRCA 2GAZA 4BZ1H 3LKOB 3MOQA 3G5VA 1KCLA 3GMLA 3P73B 4GRMB 3W9DB 2AW2A 1CFSB 1CDIA 2D0FA 4P9HC 4QRSA 3LSOB 5F97E 4NQDD 1JPFB 3QPXL 2G9HB 5MENA 5FGRA 5I1CH 1NGYA 1HZHH 2VLKA 1MRFH 1Q9OA 3MV9E 5GGVH 1W0YT 1BHGA 1FV1B 4OJFL 3VXPB 5JPNA 3WHE1 1PLGH 3T1WA 1MCJA 3IETB 5IHZA 4DEPC 3U4EB 4LP4A 4G8GB 4WU5A 4MLIA 4LARH 4XMLL 1I1YB 4UT7H 3H0TA 1G7IB 1QFHA 5IJKC 3DYPA 5FO8B 1Q0YL 5ID1A 1F8TL 2R23B 3OKEA 4MA7L 5T3XE 3RVWD 2WV3A 3BWAB 4G8GD 3GIZH 2UZXB 3RWJB 4EI5B 1CFTB 2XQYK 5FV2A 2R8SL 3PIQA 1QRKA 3W2DL 3ROLB 2DLHA 3GSVB 5K59F 1B0RA 1T0NB 5J3HD 4KJYA 4XPAL 4M62H 1UACH 4M7JL 1KPUB 4WV1A 4EI5D 1RJLA 5JHDA 1I9RL 1U6AL 1YEIL 2AJSL 3PWPE 4JDZB 1JF1B 3SE9H 3BKMH 1A5FL 4U6YA 3NIFE 4Y4FC 3TC9A 35C8L 3FRPG 1IKFL 3KLAB 3OF6D 5TFSH 3CFIC 5KVGL 1U8KB 2VDRH 2M1KA 1K5NA 4LGRB 1KTDB 4MJ6B 4NM8L 3BDYL 5KOMC 3FB5A 2Y36H 4JLRB 3MNVA 3QI9C 3C6SB 4JY6A 3MSPA 3E8UL 4RGOL 2OL3H 1J1PL 4GKSA 4EDWL 4UQ3A 1V3MA 3V2AR 4PJFE 2PF6A 1BPVA 4LAQL 5EH1A 1NDMB 5JHLL 3N1MC 2HKFH 4KRPB 1JZ8A 1NUNB 4QHLA 3LPGA 5DD1L 4M6OL 1YPZE 5ESAA 2BVOB 5BJTA 5C9KA 3VFUB 5GS2H 2OM5A 2CUMA 2VB5A 4EBQL 5FECB 4IRJC 4KRPD 4ALAL 4N68A 4UTAL 2QR0B 4Q97A 4MB4A 5E8PA 2NY0B 3BPLB 2ZG3A 5IBLD 1P9MC 3JVGA 2BCKB 4KDTC 1T1XA 4PJCA 1TVBA 4KAQH 1AY1L 4XT1C 4NQEB 3DX8B 4KKCC 4OLEA 1E28A 3VDAA 1KNOA 2NY0D 2YA0A 5ILTH 3ZE0F 4KJQC 1NBYB 3OR7A 4DZ8A 2BY1A 1A9EB 3BGFB 1Z3GH 5I18L 2IH3B 1RIVL 1FNEA 1XGQA 1HDMB 4NQED 5EBGA 1FDLH 2CDGB 2Q3ZA 1G7QB 4PJDB 4XXDB 1HXMB 2NY7H 4F80A 3FQWA 2WWKO 5FHAL 1WAAA 5EN2A 1EAPB 3ZKMC 3FRUA 2AK4A 1ZLVK 4FFWC 4DTGH 3D85A 5I75B 3FO9A 2FL5B 4HBQA 1KPVB 3EHBD 1S5IL 1AHWC 1YN6B 3F7RA 3BMVA 3LD8C 4LSDA 2Y5TA 2AV7A 3SDXA 3ZE2E 1A22B 3V6ZB 3IJSA 1OVZA 3LDBC 4FFZH 1TTGA 3VGFA 1RK0A 2EEAA 1YZZA 1JYWA 5FYKD 4H1LA 4LEXL 3EYUL 1YN7A 5C0CE 4I18B 4PD4J 5D7IE 1JWSA 4N5EC 1U95B 2PNDA 2W9EL 3JUZA 1NAKH 2DLIA 4LPXA 4U1IB 1LD9A 4DKFL 3OAYH 2Q76B 4Z76A 1EO8H 1INEL 5C0BE 5M95B 3ZT6A 4Z77A 4NHCL 2MWCA 1ZLVH 3B5HA 5L88H 4X9FA 1KB5H 1XGUA 1ZS8A 4R6UA 4WFEE 2YD6A 1OD9A 5IMMA 4UINL 3WHXA 2OCFD 4GQ9H 5JZ7D 4KC3B 4L3CB 1OAXL 5DMGD 3QFDB 5HY9A 3IJHA 1QLFA 4ODTL 4IOFC 5DHYB 3HMWL 3FAXA 2IFFH 3TO2B 1W0VA 3MRHA 5ELIA 3AAZB 4LSSL 5JW4M 3B9VA 4FQIL 4K55A 1AE6H 2PXYC 4K3DH 3MBEC 5I1HL 2Y25A 3TBVB 5L0QB 1G0XA 3NFNB 3WFHB 3WIHL 3D39E 3GHEL 2QKIA 4NRZB 4M7KL 2DQIL 5JOFA 1CIDA 4F7MB 1UB5B 4NO0B 4PBWD 4PFEA 3K2UH 2DN7A 5IB4B 3AROA 4AEHH 3NIFF 2BSSB 3V6FA 1DLFL 4JFFE 3M8OH 1EH9A 4F7TA 4UZGA 3IDIB 3MRRB 3CXHJ 3NFPA 4NO0D 5IGXH 1WITA 1NCCL 1S7TB 2R4SH 2VXQH 5HDOA 4ODUA 1J8KA 3LAFA 2AJXH 3OKDB 4OCWL 3VXUA 3GIVA 1T21A 2O93L 3KR3H 3BOVA 2VISA 1ADQL 1J05A 1LK3L 3U9PL 4XNXH 1FZMA 3D5OF 1ZGLP 1B4JH 2FHFA 3OQ3B 3ARSA 1RJZB 3DVGB 4UIMB 4PJFF 2VAAA 4JFYB 3DX7B 4J6RH 4GXUM 4QXTA 5C0ND 1RUPH 1EDQA 4Q9BA 1NPUA 5T3XH 1S5HA 1SEQL 3MRGB 1NAMB 4ODXA 1YPZF 4KKAD 3GRWA 4S11A 2PTVA 4KTYA 3CLFL 4NHUB 3HZVB 1A2YA 3RVXC 1N3NA 3HPLB 5TGBA 4IDJL 2V5YA 1WCQA 1DBJH 3HRZB 1OT1A 4Y4HC 4X4YB 4G8FA 2BMKA 3G6AB 1K6QH 4KI5C 2MTPA 5FOBA 3ARFB 1NCWL 1Z9LA 5D6CA 5EIQA 3U82B 3HI5H 4Y16A 2GK0A 3LEVL 3NPZB 3VA2C 3P4LA 2VL5B 1LE5B 1U8OA 4MAUL 1QRNE 1CDGA 5IF0B 3ARFD 4HWBA 4E41A 4JQIL 4HDIA 4NWTL 3MLWL 1HYRC 1MJJA 4P23D 3S96B 1BFVL 7CGTA 1CXHA 3VXSD 1S9VB 4HLZG 3SBWC 3NCFB 5JOPD 5HHPA 4FNLH 4ZS7H 5GRJH 4KK9D 4ONGH 4LLVA 1Y18B 4EN3A 4JO4H 4NQSB 1CFQB 3OJDB 5CGYD 5GS0H 3BFOA 2FIKA 4ORGB 2PO6B 4P5KA 3VDBA 4IEFB 3WIIL 2EXWC 4LIQH 1FYTB 4XVTH 3RL1A 1PJ9A 1IGTA 4G7YH 3ULUD 3RY4A 4PREA 5D7IF 4KVCH 4MA8L 1A7BA 2Z8WC 2PO6D 5AYUH 3V8CA 4FFYL 2FLRT 1G9NH 4XMPL 5HGBA 3VWKC 3K1DA 4HHAB 2R15A 2PYEB 2ADIB 4JRYE 3N06B 5ALBL 1JN6A 3UBXA 5CD3A 1XGPB 1XZ0A 1I7RB 2HAZA 2NX5B 5TE6H 1AKJD 2VAJA 4NC0B 3EYFA 2PYED 3QFJB 2YA2A 4R96B 2EH8L 3V6OA 1F00I 5TJWK 3BAEL 1CLZL 2NX5D 2HWZH 2H2SD 3DRQB 4BQ9A 2Q7NA 5HGDB 4B7IA 5C70A 4D9LH 2EDXA 3BPCA 1J88A 2NXYB 4HQQH 1FBIH 4GMTL 5CJXA 1VGEH 2QQKL 4JY4A 4EUPA 4I77L 5I8OL 1RK1A 4BH8A 4GFTB 1BM3H 2H8PB 5KS9B 4Z7VB 2ZUTA 5FXCH 3FQTB 4JG1L 5DJ2B 1BVZA 2NXYD 3IXTA 3C5ZC 4QGTA 1ZHLB 2P49B 3GJFA 3WLBB 4RWHA 2WUCH 3L3OB 4ISVB 4WI5A 1UKSA 4MQXC 2HYMA 3SDCC 1WWAX 2NY1B 5D2NA 3QUYA 5EULV 1PKOA 4ZQKB 1FFPB 3DXAB 2BHYA 4J1UA 3CLEL 2VZSA 3L3DA 4OZFB 3G08B 1Z9MA 2OTWA 1X5YA 2BNUB 4TPRL 1WTLA 3HR6A 3NCEB 1U91B 3N0PB 4OAWB 3VG9C 2HLFC 2DI8A 4RBPH 5DVLA 1UZ6E 3RI5K 2X7LB 1R3JA 5E1AA 2B7DT 2Z92A 2F19L 3VG0H 2W92A 3EO1B 1CCZA 3GUTA 5MEQA 5BRZB 4ZS6C 3BZDA 3QZWG 1G7PA 4K23L 3G6JE 3ZTJG 3ARPA 4XBEL 5MEPA 5IROA 2R2HA 2A1WH 3ZE1F 3PABB 3QP3A 5BRZD 1EAJA 3EJZD 4K71C 3LOWA 4ONOA 4BSWB 3B9AA 5D7KE 3VFMA 4LSPH 3AY4C 3ULVD 2MQ3A 3P2TA 4JKMA 4AT6A 4F8QA 1CICB 1ULVA 4OD3L 4H20H 3PWVB 4LRIC 4XAWL 2CDFB 2JCCB 1J0HA 2B4CC 4XNUH 4PRHE 4PTUB 4GXVH 1UKQA 4TUKL 3V4VH 3ULUL 1UA6H 3ROOB 1WEJH 4PJ9C 2WWKT 3MBXL 3CC5A 4OB5H 1I3RA 5B21A 4S1RL 3BGMA 3UTSE 1ZHNB 3VGGA 3HLAB 7FABH 3DVFA 3G04B 4CDHA 2JF1A 4KKLD 1FIGH 1V7NH 4K8RD 1NLBL 2ZSWB 4GW4B 5EU4A 1KBGH 5F9OL 4Z78B 2JK5A 3ZDZE 1E4KC 4U7KA 3V7MA 2Y6SC 3ABZA 4NQVB 2OR7A 5C09A 2A9ML 3MRKB 4L5FH 1L7IH 1UWEL 5KSVA 1OSZA 4GG8B 1FE8H 2Z35B 3JBG7 2D7TH 2B5IB 3M17A 2D31A 2ZCHH 3UTQA 1T3FA 1YMHA 2YKLH 5CEZD 3D2UA 2YD2A 1A1NB 4U1MB 1ZT1B 5FGCE 3BN9D 4QWWD 2BVQA 2VLRB 1K8IB 4XWOD 3HHRB 3QCTL 3N85H 3BUYA 4HGKC 5HHXH 2Z8VC 4QCIA 2P8LA 5D71H 3PHOB 2CMRH 5IB2A 2VLRD 1ED3A 5I8KL 2ERJB 3G5YA 4MD4B 4HEPG 4DKAA 2XOTA 4JFHE 4Y5XC 3TNNB 5DRNB 3EDJA 4CADB 2DBLH 4CN4A 3C2AH 5KVDH 2FH6A 5DI8A 1U41A 1FC2D 4QY8B 3O41A 1QZ1A 1BZ9A 5TDPB 2P5EB 4PLJC 4LPTA 2X4SA 3OHXA 3WN5A 1EXUB 1LE9A 4TSAL 4FABL 4OFPA 3O2VH 4GSDH 3RVTD 4PV8A 4L9LB 1WBZB 2DM2A 4JR9H 2P5ED 3T2NH 4BSJA 1NFIA 4Y89A 5IG7A 2VLLB 1G9MH 1QSFA 4FQHA 4PPTA 3QHZH 4RDQG 2AJYH 1BX2B 5D9SB 3TA3D 4K94H 5GS1B 4PRDA 4OBRA 3DBXA 5GGRA 4XPTL 5ENWB 4K7PY 5GSVB 4W70A 3EAKA 1KC5H 4NO5A 4TTGA 1ZTXL 1D5XB 3FB7B 2NR6C 1WC7A 5GGSY 5BZDB 1MAJA 1RZIB 3SKMA 5EUKA 5LGJA 1TPXC 1DBBL 2L4OA 1JPTL 3QWRA 3QG7H 4R97B 5IFHL 1KTLB 3KYNA 3PQYB 1UZ6F 3F7YA 25C8H 1C1EH 1BD2E 3V52H 4AM0B 2ICES 4X6CE 5I1AA 5GRYA 2DJ4A 4JM2F 4HCRH 1VSCA 1R0AH 1E6OH 5GGQH 1P4IL 3PQYD 3G6JF 2Q8BH 5BW7A 3BKCL 3LS5L 1ONQA 1J1XL 4BSVB 4JM4L 1A9BB 3BXNA 4HKBB 3Q6GH 2Q1EA 2NXZB 4K9EC 4NQDE 2NY5H 2DL9A 3SKOB 1OF2A 5I1LA 5E2WL 2B1HH 5ECJE 3TP4A 1U9KA 3BH9B 2X89A 2A9NH 2XICA 2A6DB 3TCLA 2NXZD 1AD9B 2EDHA 3MA9H 4QRQA 5F9JA 4N0UA 3H7BB 2NYYD 3SJVA 3P9WB 5IMKA 5F71A 2FJGA 1P7QA 1P4LA 2E27L 5E8EA 1I8KB 3EOAA 3Q5OA 3QB7C 1F11A 1QVOB 1KB5A 1Q38A 3LEXB 1RIUL 4LVOB 2XWJB 1NGZB 2EC9T 5EO0B 5E8OB 4POZC 3QEGH 2CK0L 1B9ZA 2EE2A 1S7VB 3ZDZF 4YBLC 4O58L 3QNYA 4XXCA 4S1QL 4V1DA 1DSFH 3ARYA 1A47A 5F6IB 1K3ZA 2JIXB 1XR8B 1FH5H 3DETD 3O3AA 3I85A 1J0YA 2GW5A 4ZD3L 3HI6H 4ETYA 3IFLH 4Y5YA 3H9HB 3B9EA 5SWZA 4U0RC 3BYYA 2JIXD 4JFQA 3BYTA 3NGBC 4ZG1A 4ESKA 1CDYA 1QUNA 1NLDH 1SY6L 4G9FB 4OTXL 2YEZA 4KPHH 5FGSA 4LCUB 3C5JA 4KUCD 1AJ7H 1RUAL 5KSUA 2BHUA 3QCUL 3OTTA 1RSFA 4IHOA 5B4MC 3L7FA 4YE4H 4G9FD 2ZUYA 3ALPA 3QJHB 4OM1H 4AENB 4LVHB 3P9MB 4H5SA 4N1CA 4JPVH 2HLAB 4WV1C 1NKRA 3MV9A 3HC3L 3FONA 1NCAL 2PKDA 5CP3A 1WJ3A 4NT6B 2ORBL 5FKPB 1EVTC 2DL2A 3QO0A 1VFUA 3QIWA 3U7AA 1TFHA 5F9WB 2BDNH 4LPWA 5FV1L 2APTA 1QR4A 3GB7A 4NFBA 3VGDA 5J6HA 4EEEA 4JQVA 4DEPB 3IVKB 2YRZA 3QPXH 1F2QA 4FTVB 1AO7B 1ZANL 4LKXB 2RHEA 1PSKH 4FQ1L 1MLBB 4LAJH 5HYEA 1XH3A 3BO8B 1D5ZA 1HH9A 1P7HL 4OFDA 1CD0A 3C5SA 1D9KA 4M1DL 4LLMA 4MZ2A 3TBWB 4FTVD 3OXSB 1AO7D 4YAQB 2HVJB 3OKOB 2GK2A 4XMLH 1PW3A 4QTHA 3SY0A 5HYJE 5J9PB 3T4YA 3KHQA 1MI5B 3TH3T 1NDGA 3STLB 5HI5C 3WMSA 2W65A 3B9KA 1XCTA 3QQ3A 3V7AG 5EBMA 3OG6B 5K9KB 3ILPA 3BZFA 2R8SH 2FATH 4M4RA 3W2DH 2Y07L 5IMOB 3PDOA 4PYHA 1MI5D 5FOJA 4X6CF 3JVGC 4XPAH 4NIKB 5TF0A 3FO2A 2J3SA 4PJDE 5FUOL 5IW6A 1I8MB 1I9RH 4JRWA 3RHWF 2AJSH 3MNZB 4HIEA 1HEZA 4RSVA 4R9HA 1JGDB 1BJ1J 1F6AB 3FMGL 1A5FH 4OZ4B 1I7ZA 5ABDE 4QRUA 5JTWA 1M71A 3VGEA 4W6XB 2FEDC 5AD0A 1EMTL 5FYKE 1VGKA 3HE7A 1QR1B 4DQOL 2HJLB 4Z5RB 1WIPA 5KVGH 4GKNA 4HAGA 1GZQA 4U1GC 1T5XB 5CSZB 5DUML 1FSKC 4FFVC 3CCHA 1MWAB 3WXWL 2YD4A 5T5NF 3BDYH 2FHCA 1I8IA 2KKQA 4OFVA 3GHBL 1PG7H 2CRIA 3KXFB 4IRJB 3VA6A 4OLYH 1KJ3H 1F02I 4LAQH 3RWCA 1S7SB 2RBLA 3HKFA 5DZNA 3ZTNH 3EYOB 1T0MB 2CJUH 3KXFD 4IRJD 2B2XH 4M6OH 5EU6D 3EGSB 5FKAA 4EBQH 3OXRB 4UTAH 5EZLB 4OCSH 3GSRB 4KKCD 3DIFB 2NY4C 3RAJL 2ATKB 1D5MA 4U6XA 4ZPTA 1HWHB 5F7DB 4KJQD 1CK0L 1WWBX 2UY7A 4HKJB 1X5LA 1AY1H 2HA1A 3RWEA 5ICZA 2ZOKA 1KXVC 3EIFA 5CINL 5I18H 2AABL 4MNGA 2RFXA 3GMNA 2KH2B 4H25B 5LVEA 3STZB 1ZLUK 4MQTB 3ZKMD 3LN9A 4G6KL 3LDBB 3IB4A 1XFPA 3TIDA 5C0CA 1H0DA 5D7IA 3C8KB 5FHAH 2P45B 1JZ6A 4ELKA 2NW3B 1F90H 4LSTL 4NKQB 1ETZB 1K4DA 1GGCL 4OCYL 5FGBC 3X14B 3BMWA 1BVLB 5AAMA 5C0BA 1FVCA 3V4PL 5HJ3B 3GJEA 4WENB 4PJXB 3VRJB 3MJ8B 5IBTL 2HFGL 5EA0L 1H3XA 4N5ED 5E6IA 1QKZL 1HCFX 4LEXH 2HFEA 3EYUH 3VXRE 3EO9L 5HXMA 3SGDI 3ULSB 1GGTA 4XGZB 3KWWA 2PYFA 1JGVH 1ZLUH 1JFQL 1KJ2B 5HVFB 5I19H 2YD3A 1JTOA 1INEH 3N1PC 1LO5B 3FOLA 3L6FB 2HFTA 3WUWB 4MAYA 4F9PC 2DD8L 4NHCH 4AMKL 3VI4E 3AU1B 4P4KC 1A7QL 4P49A 4FQCL 2QSCH 4N0YL 4OQTL 2PXYB 5FK9B 4P3DA 1TNMA 3D39A 3MBEB 1BZQK 4U1JA 3FN0L 3L3KA 4IOFD 3E6FA 2VDOL 5BXFB 2VWEE 3LN4A 2CLZA 1BMGA 3CU1A 3RTQB 5I8CB 2PXYD 2HT3C 4U1SA 3MBED 4QHNA 5INDA 4HWZB 2I07B 1KPRB 4JFFA 4LSSH 4FQIH 5FM5O 4I0KA 3RNQB 5JO5B 4MDIA 3D69A 4UILL 3GHEH 4PJDF 4M7KH 1F45A 1D5BA 3G5XB 3DUHA 3GSQB 4NKIH 1Z9OA 4HFUH 4KZDL 4YUEH 1WF5A 5I0ZA 4Y16C 4OV5B 3D18B 3LRGA 1GHFH 4HUUA 1DLFH 1C8PA 1XR9A 4FP8L 1C08B 2Y7QA 4D2NA 4BKLA 3ULUE 2ZPKL 1CGTA 5DJZA 1UWXK 1V05A 2G2RA 4YZFE 4Y2DB 5GGSB 4OCWH 1FYTE 4UU9B 2DWEA 4HUKB 3KPPB 3NCMA 4CRPA 4RIRA 5C0JB 1ADQH 2BRRL 3JWNC 1WVZA 1LK3H 4C57C 1JHTA 1KJVB 3PJSB 5DGQA 4EN3C 4MQ7B 3U2SB 3W9EA 4QOKB 2P48B 4H1LG 2PYEE 4Q9CA 2V5TA 1FN4B 4K7FA 1KEGH 4Y4HB 4GRWB 2R2BA 4CL7A 5B22A 1SEQH 3KPMA 4LNRA 5GGUB 4YHML 1A6TB 4QOKD 1QRNA 4HIIB 3UEZA 1VB9A 2DOCA 1X9QA 1YEDA 2ENSA 3QFJE 4WJ5B 3CLFH 4Y4HD 5JMOC 3BQUB 3UJJH 5A2KH 1BZ7A 5C0IA 2GY5A 2IALB 3HE6A 4KI5D 4M93B 4L4VB 1T7VA 5CEYB 4Q74A 2XNAA 5I1IL 1S3KL 5D5ME 3RY6A 5FYKH 2J6EH 4KK8C 3LEVH 4UOW1 3MLYH 3TYFA 5C6WH 5KS9E 4Z7VE 3JWOC 4L4VD 3V0WL 1X44A 5IK3A 4GKZA 1FPTH 4LDEB 4Z0BL 3V6OC 2V5RA 4PP2A 3GSXB 4JQIH 3VXTB 3MODL 3CH1A 3MLWH 4MHHI 3VFRA 3QA3A 2YHGA 5CJXC 5IEKA 4CVUA 4NNXA 5K33A 1XF4A 1J18A 3T0BA 3DXAE 4LBEA 1B4RA 2NTFA 1KTKE 3CSPA 3CZFA 4DGYL 2A83A 4WEBL 4JRYA 1FHGA 2QHRH 3VWKB 5DVMA 4BH7B 2EXWD 3SN6N 3MRIA 3LKPB 1DUZA 5HHQA 3MXVH 3GMOA 4AEIL 1XGRB 1TJGH 4MCYB 3WIIH 1EHLL 5D2NC 2AXGB 3BPOB 3DVIA 2UVEA 2EDJA 3QUYC 4KHXH 5ICXB 3VWKD 5JIPA 5DJ6B 5BRZE 4MA8H 4FXGB 1KLGB 1Q9KA 4MA3B 3RUGA 3VFVB 1KULA 3ULVE 4YHNB 2D0GA 2VKWA 3UTOA 2NNAA 1WLHA 3SDYL 3U0PA 1R5IA 5E00B 3HC4L 3EDDA 3VI4F 1OAYH 3BP6B 2GITA 3CFEA 2UYLA 2J4WH 2EIZB 12E8L 2ICWA 2SEBB 1TNNA 3O0RL 3WNOA 2NY6C 5HGAB 5IROC 4O2CA 3C5ZB 1AQDA 4MXWL 2P8MB 4F33B 3KDMB 3BEWA 3KPQB 2IC2A 2EYSB 5FUCC 5DFVC 1JUFB 3O6LL 3SGEI 1HIML 4GAJH 2I25N 4OGXL 2DQJL 1DQQA 3C5ZD 4I77H 5I8OH 3RA7L 4LSVL 4DFIA 1HHIA 2OTUA 3VXOB 1RZKL 3MXWH 5IMLA 4MQXD 4HEME 3FKUS 3SDCD 1A14H 3OAZK 4JFOA 43C9B 3S35L 1JHKL 3MGOB 1XGTB 2DWDB 1TLKA 3VG9B 4F3FB 1T80A 3NZ8A 3BZ4A 4O2EA 1BEYL 4Y7MA 2MHAB 3DI3B 3VGHA 5CEZE 1BBDL 3WV0A 3G6JA 4GW5B 3BESR 2HLFD 4HUVB 3T4AB 3ULUF 1T2QH 5CJ8A 1NAMH 2CLVB 2I24N 4YZFF 1FO0A 4DCQA 5C0GB 5LBSH 5JXED 4JDVB 1A02N 4PY7A 4ZS6D 2F15A 3EYVB 4K71B 5IW1A 2VLRE 2F19H 4OGAC 1UM6L 2ED9A 2DQCL 3NIDE 3VDCA 4ZUWA 4NKMA 4I9WE 4K23H 5HVWA 2E9JA 4XBEH 4PRHA 5MEOA 4G42A 4PRIB 3ZYIA 5ESVA 3FN3A 4M43L 2VXTH 4P2OA 4NRXA 1BOYA 3P4MB 2EKJA 1U58B 3PGDB 3U0TA 5LXGH 5DLMH 3UTSA 3DO7B 5CZVL 2DTML 4JZJB 4PRID 1EJ6A 5C0RL 1SMOA 4OD3H 1UQSB 1A3LL 5HI3C 2P5EE 4JB9H 1JMXA 2DYPA 5IVZA 4K2UL 4PJ9D 2ADGB 1OB1B 3QPQD 3VW3L 1ZEAL 4Z7VF 5KS9F 4IIQA 3ULUH 5DF0A 3UZQA 1JGEA 1EJOL 4EUPG 3MTRA 4N8VA 3FO1A 4PBXA 3WN5C 2Y6SD 1U8MA 3BUTA 1ZSDB 4N9OB 2YUZA 5FM4A 5FA3A 2AV1B 2BK8A 3WNMA 3U46B 1F4XH 1WZLA 5E2UL 5DTFA 1CDHA 2A9MH 3ARVA 3VFGH 5I9QB 5E56A 3EOBB 3RBSA 3PQYE 3IRPX 5F88B 1OCWL 1CG9B 5I1DB 2XQBH 2ZSVB 1FVDB 1M7IA 2F74A 3TIEA 4ZO8A 3MUZ1 1JNLL 4Y5XB 1HXYA 1M4KA 5CILL 3KPOB 3QCTH 3ZDXE 3ULVF 1JJUA 3TJHC 5ID0B 1HKLL 1HINL 3VE0A 5DD3H 1I1CA 5IVXB 1F3JA 1HILA 5I8KH 2OK0H 4MMZC 5I17B 2F5BH 8CGTA 3DMMA 3EW3B 4NM4L 4QT5B 3LY6A 4PLJD 3BKYL 5BW7C 3IXAA 1PZ5B 4P57A 2E7CA 4FXLA 3UXFA 4BUHA 5E2TL 3O45A 4OZFH 3KYMB 2Q8AH 3IFOB 5TF1L 4F2MA 1SEBB 3GSNB 1HQRA 2YD8A 5EG6C 1BOGA 1UXSB 5I1JL 1ZVSA 1Q9WB 3TLRA 1D3CA 3MRMB 5C08B 1Z9SA 1TPXB 2M26A 5IQ9B 1BD2A 2ZCKL 4PJ8B 1I85A 3ARDC 4X6CA 1NUDA 2XKNB 4UDUA 1WK0A 4XPTH 4LLAA 4LSUL 2NR6D 1NL0H 5C08D 3ULVH 2FYYB 2GT9A 4PJ8D 4KKNA 3RGVC 5F96L 3ZT5A 2D7QA 2IPUG 1A4KA 4YPGB 4IOIA 3M1BB 1DBBH 1CXEA 3TYGL 1JPTH 4G6FB 3MGTB 5HHNA 1W0WB 2UUDK 1EK3A 3IDGA 5CJBA 5KSBB 3BN3B 4NQDA 4XXCC 1N59B 1OM3H 4G9FE 3P4NB 4YK4B 4M8QB 4G6FD 3NIDF 4XCYA 1TVDA 3W9DA 1P4IH 1I1RA 4M3JA 3IKCA 4X7TB 1KGCD 4Z8FH 5JQHC 3W11C 5I0DA 4PJ7B 4Y5YC 2G9HA 3LS5H 4K8RH 4JM4H 3HG1E 2EZ0C 5C0DA 4Z95H 3T2QA 1Q94A 5F8RC 4RFEB 1FV1A 4R7NA 2C4FT 3UJIH 2FD6L 1N4XL 1INDH 2BVEA 2D4DA 3M45A 4YHZL 3VFNB 1RURL 1IEBA 3IETA 3PXHA 3EYSL 4HH9B 4PUBL 3U4EA 5E2WH 3WBDA 3L3JA 1AXTL 1I1YA 3GMLB 2VC2L 1G7IA 3RWDB 1A3RL 4PGZA 4QRSB 2C7UB 3WO3B 2XQYG 3QJFA 2BXZA 3SKNB 1A7OL 4MS8C 5CEZH 3IAGC 1CFBA 4M5ZL 1GZPA 1C5BH 5MENB 2MQ0A 4RFNC 3VH8B 3RWJA 4YBHA 4EI5A 3FQUB 1CFTA 1NGYB 4XNZB 2E27H 3L9RA 2VLKB 4G6AC 4Y4KA 2DMBA 3U0WL 3QIWC 2UWEB 5E70A 3ETBF 1VFMA 3K74B 4TNVF 3ROLA 3GSVA 1HI6B 1T0NA 1RIUH 3VFPA 5MEND 4WNQA 2H6PA 4O02H 4JQVC 3GMMA 2VLKD 1HH6A 1RZFL 5K9QI 3QUML 5ITBL 4MWFB 4U1KB 1JF1A 2YA1A 4JQXA 4U0RB 4O58H 2DJUA 3NGBB 3KYKL 1D5IL 1MI5E 4APQB 5ID1B 3OKEB 4PB9H 4TRPH 1YEKL 1NCBL 1F4HA 3LKQA 4M1GH 1IM9A 3MRBA 2FX9L 1GAFL 1MCRA 3PIQB 1D9KC 1U8KA 2I27N 1IBGL 5JUEL 1QQDA 1SHMA 4G3YH 3GBML 3WNNA 1FGNL 4APQD 4XNYH 1KTDA 2VERN 4MJ6A 3RWIA 1B0RB 3X3GH 1T03H 2DLTA 4Y19B 1AQKH 3GZKA 4WV1B 1H8NA 2IQAB 2XYCA 3MJ6A 4X99B 3OZ9L 5B8CB 5TPWL 5B4MD 4RA3A 3ZDXF 5LAXA 4NNPH 3B9KC 4U6YB 3L5IA 3S34L 3A6OA 1UYWL 2DIAA 2YK1H 1NDMA 4NOBA 5JHDD 3GI8L 1J7VR 1X5AA 3WHE0 3VJ6B 1U8IB 4POYA 3MRJA 1DN0A 2BVOA 3HNVH 3VFUA 1JV5B 2G75B 5GRXG 1NCAH 5FECA 3TNMB 1F13A 3FB5B 4NN5B 4WWKA 3MNVB 1ADQA 2E6PA 3CFJB 3KXFE 4JY6B 3UCRA 4GKSB 2DIJA 1T6WA 1LK2B 3EDEA 4UQ3B 3HE7C 1J1OL 5HYJA 4LLQB 1RAMA 3FL7A 1AGDB 5GS0C 3DX8A 2XACC 5F9DC 1R3HB 2E7MA 4QHLB 2PW2A 1JHLH 1NBYA 1ZANH 2J8UB 2FECL 4FQ1H 1A9EA 1MELA 3C8DA 3IFNH 5BJTB 4WHTB 1FGVL 4MXQC 3VFOB 1FL5A 1HDMA 5AAWA 3V0VB 1EVUA 2CDGA 4M1DH 1I9IL 4UDTB 4PS4L 1G7QA 1G9NC 3CIQA 4ODWB 1HXMA 4NNYA 4PJDA 1OAKL 4OD1L 4XXDA 1FCCA 3ZSTA 5HI5D 1MNUL 1EAPA 4W4NA 1XIWB 1BFTA 1E28B 2A38A 1JYVA 2J6EA 3NH7L 2FO1A 1U3ZA 4KUCF 1JTTA 2LU4A 3RKPA 3MFGB 1LO3L 3V6ZA 1XGQB 5D6DA 1XIWD 2FECI 5FUOH 3KYOB 4U1GB 2ED7A 2FEDD 3H3PL 1TJIH 5A40E 1U95A 3FMGH 5EN2B 3FRUB 2AK4B 2Q76A 3D85B 5SWQA 1CBVL 3GKWL 1EMTH 3FO9B 1IAKA 5BOZG 4D9QD 4FFVD 1ACZA 5IB5B 4DQOH 2XTJB 1JK8B 3L3GA 2AK4D 3SDXB 4RMVA 5AEAA 3RP1A 3D85D 2FX8H 4NC1C 2VUOA 3L7EB 1T5WA 3W0WB 4WTZA 4P2QB 2HTLC 2YS4A 4H1LB 3HAEA 4ONFL 1YN7B 4CW1B 4NP4L 1BAFL 1T6VN 5HPOA 3O6ML 2JJTA 3QFDA 1IZKA 5KSAB 5DHYA 3AAZA 1QACA 2DQUL 1N6QL 4XVSH 2FBOJ 1JNHA 2NY4B 4Z77B 1QBBA 4QKXB 2ARWA 3JSSA 5E6IC 2DI9A 3TBVA 5KSAD 3NFNA 3WFHA 1ZS8B 1BBJB 5IMMB 3IU4L 4NRZA 3WHXB 4UIKL 2NY4D 3TV3L 1AR1C 3BSZL 4F7MA 1UB5A 4UT6L 4NO0A 3H9SE 4Q2ZB 2HN7A 3TFKC 4YC2B 4OUUA 1MJ8L 3QHFH 1QLFB 1NEZB 2X70B 1A7RL 3IDIA 1CK0H 3MRRA 3BRDA 4P9HH 4PB0L 1FL6A 1KOAA 1S7TA 2LQRA 1FNSL 4KJPC 3OKDA 2AABH 1PG7W 5FYLL 1A7PL 1BREA 3SHSA 1WZKA 1S9WA 2QJDA 4MQSB 4NCDA 3VXRA 3ZHLA 3MMEA 5H2BB 2V2XA 5T1MA 3SGKA 1RJZA 5EZIL 1TMCB 3V6FB 3D3VB 4JFYA 4AIZB 1HYSC 2X1WL 3RL2A 2FWOB 2MCPL 1GOFA 4GMSL 5JXAH 3DOSA 1MCOL 3MRGA 1NAMA 3OX8A 4ODUB 3DRTA 4TUJB 3D3VD 1OQXA 3UPAA 2WZPD 4M48L 3PDDA 3OPZL 1M7DA 3BH8A 5IBTH 3UJTL 3VXUB 3GIVB 2HFGH 4NHUA 1DFBL 3E2HC 4KZEL 1QKZH 3HPLA 4P4KB 2EYRA 1PGRB 3AS3A 3I2CL 4O9HH 5DGRA 3G6AA 2VAAB 3VXUD 5LWYL 5IKCA 3GMQB 1JFQH 4QXTB 4NRYA 1CGYA 4XTRC 5ALCL 4GRWE 5IHUH 4P4KD 5D8JL 3I9GH 3K81A 5DJYB 2ADJB 2VL5A 4J3UA 2DD8H 1FZKB 5IF0A 1BQSA 4YHOL 2VLJB 1A7QH 4FQCH 4N0YH 5FYJL 1BQLL 1J5OL 3U30B 3S96A 4YX2L 3FN0H 4L4VE 3RQ3A 3U7YL 2VDOH 4NPYB 4X9GA 2VLJD 1S9VA 2R1WA 2CKBL 4G8FB 1KYOK 2DDQH 4RMSA 5FOBB 2UZIL 3WNPA 1W72B 5DQJA 4M9PA 1IC5L 4J12A 4Y16B 3JV6B 1YNKL 1Y18A 1CFQA 1U8OB 4WW2C 3BP7A 3HE6C 3DYOA 1MWAH 2PO6A 4E41B 4YQXL 4J7RA 5DRXA 1Z0NA 4JVPA 4Y16D 1FYTA 1NMCC 4HDIB 4HK3J 5SX5H 1SM3L 3RY6C 4NKDB 5ACZB 4E41D 2FDBP 3O9WB 4FP8H 4KRNA 5CEXB 5DRWB 4OD2B 4BA8A 5ISZE 2QADC 2ADIA 1A7NL 4LLVB 4BFEA 4XBGA 1G9MC 1QFUL 1A6UL 1NCDL 4YHLL 4MLSA 3O9WD 1XGYH 2FIKB 4X80H 5HDBF 3D9AL 4XP6L 3LS4L 1K85A 3QFJA 3MACL 3IU3B 2FO4B 2VSCA 4HXAH 2DQFA 4F7CB 3DRQA 1ZHBB 1OARL 3CX5K 1IEHA 1RUKL 1J0JA 4P59H 4P2CG 4XNMB 5CHNB 3X3FH 5D5MA 2IANB 3V4UH 1NGQL 3S4SA 3UBXB 1XZ0B 5EU3B 3DO3A 5I74C 5DJ2A 4XBPA 4NQTA 1KJMA 3UTTE 1ZHLA 1H8SA 2IAND 4ISVA 4ORZC 2HKHH 4LSQL 1VHPA 1IL1A 2DBJA 4C83A 4KK8D 5B38B 2FSEB 1KLUB 15C8L 4FQXB 1S3KH 4D9RD 4ZQKA 3ARQA 1FFPA 3DXAA 1JGLL 4JY4B 2IBBA 3G08A 4OZFA 4EUPB 3Q48A 5GISL 2IQ9L 4BH8B 5ACMA 3V0WH 3CZJA 3L5JA 2NY5C 1U91A 2A6IA 5FM5M 4ZFFB 2BSRA 5IVNA 2FLBT 2X7LA 4LVNB 2VDNH 3KJ6L 2ITCA 2JJVA 3MODH 1PKQA 5BRZA 5D2NB 1IGYB 1KJ2H 4CVXB 5FHBL 4LSRL 5SV4A 4J1UB 3L3DB 4YHKL 3N9GL 5IB1B 4M4PA 5HVGB 4DGYH 3PABA 4WEBH 3EZ8A 4BSWA 3QUYD 4POUB 3B43A 4HXBL 4WY7L 3PP3K 1EHLH 4U6VL 2OJZH 1F4AA 1CICA 4Z7WB 4WI7A 2Z92B 1UKTA 3PWVA 4ZODA 4TN9A 2CDFA 3VXNB 1HCVA 2XT1B 1DQML 1G7PB 1QO3B 1YQVL 1W72L 2NY6B 2G5RA 5AG9A 4OCXL 4GRWF 2R2HB 4OCLC 2R0KL 4PTUA 5K93A 4PRIE 3V8OA 3WS6A 3MLZL 3ROOA 5EWIH 4X0KA 2MQCA 4Q9QL 1KUMA 4YHYC 4HC1H 2NY6D 5HGHB 3VFMB 3VGAC 4HS6B 4R2GB 3HLAA 1CD1B 1TZIB 3G04A 4AT6B 1YEEL 5LGKA 5D70L 5DFVD 4GW4A 5DD0L 3PP3H 3MX0A 3KHOA 1U3YA 4P2OC 4NQVA 3WS3B 1RZ7H 3O6LH 4K7PH 1HIMH 5JLZB 1Q9LB 4GG8A 3RA7H 5EZOL 2VZ1A 3B2UC 1RZKH 2OI9C 4UBDC 4WWID 3S5LB 1GPOH 1MHEB 5HTSA 4ELME 4E42B 4Z0XB 2F53E 2QQLL 2AGJH 1ZT1A 2LVCA 1GC1L 1K8IA 2CO7B 4IIQC 2WP3T 1LEKA 3DV4B 3F6LA 4XP9L 5MERB 3PHOA 1BBDH 1FLRH 4IRSB 4GRWH 2VN7A 5KSVB 1OSZB 5JPMB 4G6JH 1N5AA 4IRZH 2AEPH 3ZL4L 4KMQA 2O61A 5C09D 2D31B 3TNNA 5DRNA 4OGAD 3UTQB 1T3FB 1YMHB 3KLSA 1W8OA 3J7HA 4TVSa 4NQXB 2XY2A 1IGIL 4EXPX 5DVOA 4OIIL 4OI8A 3FN9A 4U49A 2CIIA 4QY8A 5D72H 4FMKA 4RA0C 2DQCH 1SY6A 2P5EA 5TDPA 1IT9H 5GS3A 3D2UD 1EXUA 5IVXE 2XRAL 4J3VA 3IFPB 2N1KA 4L9LA 3VMNA 1ED3B 4QO1A 1NEUA 4DVRH 1DE4A 4PGEB 2VLLA 5GIRB 3SE3C 4WTWA 5HI3D 1BX2A 5CZVH 5HHOB 3P30L 5GS1A 4XPHL 5C0RH 3RWHA 1A3LH 5DI8B 2GQHA 1Z6JT 1BZ9B 5ENWA 3OKNA 3WL9A 5GSVA 3WN5B 2MJWA 2YPKB 2RGSA 3JUYA 2Z0BA 4RDQF 5FFLA 3TWCL 1D5XA 3FB7A 3L1OH 1LO2H 3VW3H 2X6MA 2YWYA 1ZEAH 4PV8B 5HD8C 1RZIA 3Q3GB 1ZT4B 3DMMC 2ADFH 3VGBA 5C08E 1KTLA 1NFKA 3PQYA 1QSFB 2EXYC 4J3XA 4L4TB 4MB5A 4AM0A 4R26L 2NY2C 1MHCB 1FVEB 3O2WL 4PRDB 1YEFH 3QO1B 3P0YL 2R1XB 1QSFD 2VITB 1KG0A 4L4TD 5GS2D 2CUHA 1QBAA 4MJ5A 5DSCA 1OAZH 1AH1A 3SKMB 1A9BA 5EUKB 4HKBA 1OAQL 3LKSB 3OMZA 2XKUA 1I85C 1KGCE 3KYNB 4JPIA 4XAKD 1OCWH 1T0PB 5C6TL 3GI9L 5I1AB 3ZKXB 4PJHB 3TJHD 3EJYC 3QWRD 4A6YB 3DGGB 2DKSA 2GCYB 3BH9A 3CUPB 3TBSB 3HNSH 4PJ7E 3LVEA 1ZVYA 2I60H 3H7BA 1DL7L 5E94B 4PJIA 2VTFA 2DQEL 1I8KA 1QVOA 2FB4H 3UYPA 1Q1JH 5A2FA 3LEXA 1JPSH 1D6VH 2XWJA 1A6PA 3GK8H 4OLZL 5E8OA 4JJHA 1OF2B 5I1LB 3MV11 4I3RL 1QYGL 3TCLB 2C1PA 4L3EA 2D2OA 1S7RB 2AS5M 5E2TH 4OF0A 3ARDB 5MENE 5TF1H 4N0UB 3VFSB 2JIXA 3SJVB 1XR8A 3X12A 1P7QB 1TTFA 2X89D 2UWEE 3FO0L 2VQTA 3EOAB 5B3JE 3H9HA 2DQDL 3RGVB 3ARDD 1CI5A 4HKXB 1NFDE 5AZ2L 3SJVD 1P7QD 2ZCKH 2EECA 3OB0H 2AVGA 5INCA 4N8VG 2VXSL 1I3VA 3RGVD 3QNYB 4V1DB 4EI5C 4Y4KC 1TZGL 4TVPD 3JWDL 5F7NC 1QHPA 2Q86A 5F96H 2B4CH 4JO2L 5CKAA 3P9MA 3BPNB 1EHAA 3HG1A 2HLAA 4V1DD 3TYGH 1I9EA 2ICCA 1NBZA 5SWZB 4Y19E 4JQXC 1IMHC 3U7WH 5FKPA 4JAMB 4EKXA 3P11L 1PDKA 2YEZB 1BF2A 3MZGB 5HI4C 5SWZD 3CX5J 4KQ3H 5IVXF 3HNTL 5I8EB 4MB3A 1KLFA 4IHOB 3CFKA 5D7SL 4LKXA 5E24E 2UZYB 2FD6H 1N4XH 3NFSL 4RAVB 4RFNB 1CGSL 4YHZH 4JO1H 1RURH 1R24B 5FYLE 2ARJB 4FZEL 3TBWA 3EYSH 2IBZX 2HVJA 4PUBH 1OP3H 3OKOA 1IC7L 5DC0A 4MS8D 2VXUL 1A3RH 5E6ZA 5J9PA 3WFCL 4G6AD 3CMGA 4OFKA 3ARWA 4M5ZH 3A67L 2J8UE 2BNRE 4NZTH 4WWKC 4KQ4L 1N64H 2OR8A 3PP4L 4HJGB 2D9QB 3NCYP 4QYOB 5IMOA 3BPLC 4DAGH 4G9DA 4OZHB 5E5RB 4X7DC 5T3XD 1ND0A 4LLMB 4A6YL 4DKEH 5HHMB 3S37L 1MOEA 5H8DA 1JGDA 4QTHB 2KUTA 4YDKL 4PJGA 3T4YB 1D9KD 1BLNA 3BGFC 1NDGB 3UZVB 1WZ1H 2W65B 1QR1A 1YA5A 2F8VA 4Z5RA 1GAFH 3ILPB 4WHYH 3S7GA 5JUEH 4LPUA 5CSZA 5KSBF 3GBMH 4XB7A 1C5CL 5CGTA 3PDOB 1OTSD 3LPFA 3S98A 2NZ9C 3S35X 2XWBA 5FYJE 1HN1A 3FO2B 4D9QE 1S9KC 1MRCL 5IW6B 5TPWH 1P1ZB 5I75C 1HEZB 4DN3L 5A1AA 2J2ZA 4PJ7F 1VCAA 1QEWB 2COQA 3MLRL 3GSNH 3S34H 1UYWH 4QRTA 5AD0B 2EDWA 2CXGA 4RMUA 1T0MA 5D6DC 3QUZA 2XTJE 3GI8H 1CGVA