2J3TC

The crystal structure of the bet3-trs33-bet5-trs23 complex.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
141
structure length
141
Chain Sequence
TVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLSFQTSRYKLHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVEFVVKNPLCPLGQTVQSELFRSRLDSYVRSLPFFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Architecture of the Multisubunit Trapp I Complex Suggests a Model for Vesicle Tethering.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport
molecule keywords TRAFFICKING PROTEIN PARTICLE COMPLEX SUBUNIT 3
total genus 37
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2006-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04099 Sybindin Sybindin-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.70 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2j3tC00
3CUEA 2J3TD 1H3QA 2ZMVA 2J3TC 3CUEC 2J3WA 3PR6A
chains in the Genus database with same CATH superfamily
3O87A 2B95A 4OLDA 5FI2A 3F1NB 1IYOA 2Y2JA 4QD4A 2GJ3A 2V8FA 2XRNA 2ZC7A 4ETXA 2JKTI 4WEJA 1ERMA 4GN2A 1PFLA 2Y4AA 3SW1A 1Y4OA 1GHIA 3U4LP 3BQAA 5HDDA 5G4YA 2J9PA 3T4OA 5CGWA 3CMZA 3QNBA 1YMSA 4S2PA 2GX5A 2Y2LA 1W63Q 4AFIA 3LYXA 3W4PA 1SCWA 3D9YA 3LR5A 3HUMA 1PW8A 4HIAA 5IHVA 5U47A 1NLYA 3N7WA 2PYPA 5DKKA 3OPHA 4E6WA 4HESA 3ZVWA 4UA9A 5AVFA 4NXFA 1GHPA 4KUKA 1MBLA 2Y2HA 1FQGA 3A3EA 3GECA 3N6IA 4S2IA 1CJFA 3BWLA 3ZNTA 5EVIC 3T12B 1LL8A 1P0ZA 3LR0A 1ZHHB 3LICA 3NY4A 2G2UA 5JYPA 4K08A 2FZ0A 5DJUA 3DTIA 4GLQA 3O3VA 3HLFA 4FOFA 1JVJA 4GDNA 1YLYA 4E3NA 5CXWA 4CQHA 2VGJA 4YWZA 2WGWA 4KZBA 4B93A 5J7EA 3F1NA 3S7NA 2QJ5A 3W8KA 1H5XA 3H9WA 5FQ9A 3G6OA 4OOYA 1VETB 1ES4A 5M18A 3OZHA 1MKIA 2HJ9C 2PHYA 3VP3A 4OKPA 3WS0A 5FAPA 4P85A 3UB7A 3NIAA 2ZBBA 3LFVA 3BLSA 4ZAMA 2JKRM 3T1QB 2VJWA 2EA9A 2XK1A 3P98A 4EEUA 3G30A 3NOPC 3PAGA 4QB8A 1OJGA 5EVID 4L0LA 2H10A 4NXGA 1GSXA 3UB8A 5HARA 4M3KA 1Q2QA 5A90A 1N4OA 5D3OA 2VGKA 1BZAA 4MEZA 3MQ0A 2RCXA 2Q9MA 2O9BA 2Z2MB 3IX4A 1VEUA 1JTDA 1ES2A 3LEQA 3UMDA 1W63M 2Y55A 1EW0A 1K4FA 3FWLA 4ZBEA 2HDSA 2WKEA 3LR3A 2PU2A 1L3LA 4GS9B 5GLCA 5G18A 3A3DA 1YKDA 4BENA 3QP1A 3LI9A 3LUQA 2WZZA 4JXWA 1P9WA 4LPZA 4WBGA 3DAVA 3UB9A 3FKWA 5HW3A 4MN7A 5CGXA 4GHIB 1LL9A 3BEBA 3R7WA 2FFYA 4KUOA 5EVIB 4LCMA 2XSSA 3RTYA 4LV2A 5EFWA 1NJ4A 4WF0A 5G4ZA 4WEKA 5A91A 4Q0HA 1BSGA 2QWSA 3UE3A 4JGPA 5FI7A 4Z1WA 5JYOA 2VV6A 3HLBA 4GD8A 1TEMA 2R9XA 4PKYA 3PHYA 4QY5A 5DFXA 1GSVA 4S2NA 1KDWA 2VV8A 3GMWA 2XQZA 1XA1A 1UGUA 4R70A 2WADA 4F3LB 4NXEA 4JXVA 3FKVA 1ONHA 4IHQA 2M7UA 3MF0A 3CPTB 3LIDA 2V20A 3KSIA 1PI4A 5FA7A 4Y0TA 3UNWA 1M40A 5FQIA 3FPVA 1YQSA 1QMEA 1VEUB 1K4EA 3ZYTA 1H0MA 3VP1A 1LLBA 4CLCE 2W3EA 4K0XA 3NHQA 3W4QA 5EUAA 1IEMA 2ZJ9A 2W1TA 2W27A 3KSGA 1E4DA 4M4XA 2JBFA 2Z2LB 5E2EA 3UE0A 1DRMA 1TVFA 4DE2A 3ISGA 3OC2A 4X1LA 4R3JA 5CHUA 5FEFA 3QHYA 4HJ3A 4HH3A 1XJ2A 5EOOA 3V50A 1IYQA 1NY0A 2IWDA 4KZ4A 3OCNA 1XJ3A 2O9AA 4ZRRA 2H0TA 2J7VA 1LI9A 4GJ4A 2WK0A 4QHCA 1PNEA 1TF1A 4GD6A 5CRFA 4KQQA 4EBNA 2YKHA 3IXGA 2IWBA 3LIFA 1F2KA 3M6HA 4Z9QA 2H0YA 3VSLA 4Y13A 3S7PA 2VA0A 2XA7S 3C7UA 4II7A 3T4SA 3H7WB 4RA7A 4S2MA 3KX0X 4EWFA 1V9YA 4WZ4A 4DE3A 4IUKA 3H82A 1OT9A 2JC7A 4CJNA 1XPBA 2OAP1 3BLMA 3MZEA 3E4QA 2J9OA 1DJBA 1BLSA 2HP6A 1PIOA 3IWIA 1ACFA 1BLPA 4JLFA 3NULA 2JKGA 1K56A 3NJAA 2QJ7A 3VOYA 1ZC2A 5K5BA 3BFEA 2WKIA 3MFXA 2RL3A 4WZ5C 4EUZA 3IHAA 3T1RA 4EEPA 2D01A 4EU0A 1L0FA 1S4RA 3IBRA 2Y2NA 1WYCA 2JHEA 2J3WA 3ZG5A 3FYZA 2OWHA 4L9GA 3VFHA 2KDKA 2NUPC 3WS1A 2VKSA 4UA6A 3ZFZA 2Q0OA 2G7UA 5GLAA 4S2KA 2EFUA 1BUEA 1XFQA 3OBFA 1Z09A 3B47A 2MJ6A 3UB6A 4RVAA 1O7EA 2QMIA 2VV7A 4RQ9A 3LCEA 4UA7A 3PR6A 3UPOA 4JF5A 2WAFA 3UDXA 5HD3A 2D02A 1KVLA 3IQAA 5FSRA 3MZFA 2VEAA 1YLPA 4NXBA 4FUWA 5FAOA 3Q07A 1PI5A 1NRFA 4HI4A 5DJTA 3EGDC 5CGSA 4CLCA 3QP5A 2OAQ1 3FZCA 1L0EA 1CK3A 5KZHA 4JGQA 5HDCA 3VP0A 1G28A 1C3BA 1FIKA 4OPYA 4JGOA 3SS3A 4EETB 3G31A 1NLZA 3D72A 3B33A 3BY9A 3DWZA 2EFXA 2PU4A 3G35A 4WUJA 2GDNA 3OOVA 4QPRA 4Y3IA 4ETZA 3S4XA 3KYEA 2ZM8A 3W4OA 2WYXA 2GNXA 4R6LA 5TJJA 4ZDXA 1STZA 3BFFA 2ZQAA 1VHMA 4LGWA 3TJZC 1L2SA 4S2JA 1PYYA 2KX6A 3I7JA 4MCWA 1K0KA 4IEDA 3UB5P 2YKFA 5M19A 3ZHHA 1NXYA 4E3KA 3LY3A 1VQQA 4EQ1A 1YAXA 4LV1A 2J80A 2WGWB 1S67L 1MWTA 1CEGA 3HJKA 3IS2B 2PT7A 1ZTUA 2P9VB 2A2LA 4KZ8A 3T4QA 3HL9A 4Q0IA 1K54C 5EVIA 1W8YA 3R4KA 3PBNA 2QKPA 3M6BA 3V3RA 5EV0A 3MSHA 5HFOA 1KVMA 3T4KA 1E25A 2IA2A 5IS1A 4X68A 2P74A 2HP9A 2ZQDA 3M2KA 3N4IA 1SKOA 4EBPA 3NDEA 1P9RA 1H8YA 4WL9A 5J8XA 1IYPA 1K25A 3HUNA 4EXOA 4BD1A 1NRJA 3Q81A 1H3QA 3DTMA 4MBFA 4JXSA 3OPLA 4X53A 4PMAA 4Q8IA 2KOIA 2QZ6A 4X69A 5IU1A 2Y8HA 3IX8A 2WGVA 3L7HA 5EECA 2XD1A 3JVVA 4NKPA 2I72A 1T1AA 3C4PA 4CLCD 1HD8A 1JTGA 5C5KA 4H8RA 3OCLA 1LSVA 4I38A 1AXBA 4KZ5A 3NI9A 4RX2A 4ARZB 2C6WB 3NBLA 5J4EA 2XF3A 2Y59A 2OLVA 1KGFA 3V39A 2O0YA 2Y91A 3MJQA 5CX7A 1K6SA 1YLWA 3BQ8A 5DF9A 4GOGA 4Y17A 4GKUA 1IYSA 3KSFA 1Q2PA 3TE8A 3CAXA 3QP2A 5DTSA 2ZC6B 4ME4A 4X55A 4ESPA 3JYIA 2OSUA 2ZMVA 5FASA 5F1FA 1CF0A 3O88A 2PAVP 1E3UA 3F1OA 1UWPX 2H5SA 4HBTA 3GTCA 4FCFA 3FV7A 4KQRA 2BG1A 4Q0JA 1FCNA 2DMWA 3IF6B 1ES5A 5HWWA 3ZG9B 4KZ7A 3HLWA 3CHWP 4N9KA 2PR5A 4GNUA 3C30A 4LRXC 1SKOB 2V8CA 3BFCA 2XH9A 2WKPA 3TRCA 1QMFA 5DVAA 4C75A 3A3JA 1VM1A 3NC8A 3Q1FA 1N9LA 1IFQA 3IX3A 4C6YA 3O5YA 3A0SA 4UQIM 3HLCA 3MXQA 1N9OA 5L09A 3F1OB 3Q7ZA 3MKFA 5GL9A 2ZOHA 4DF6A 4E04A 3IHBA 4HP9A 5HL1A 3QNCA 1CEFA 4IVIA 1DP8A 5HPIA 2HDRA 4X25A 4FH4A 4HJ6A 4JGRA 1BT5A 3SS5A 3C8CA 4X6TA 4E3MA 1X0OA 1PWCA 2PDRA 3MBZA 3DTKA 3IWOA 3C38A 2W3FA 3HREA 5HZHA 2HDQA 5A92A 1DJAA 3TW8A 3LEZA 2XFTA 4H6JA 3PBOA 5A93A 4GW9A 5M1AA 2Y2KA 4GZBA 2EX9A 2DNSA 3SZTA 3P01A 2W3DA 1MXOA 1ESUA 4PKYG 4S2OA 1YSPA 5TR7A 3ZG7B 1W7FA 4GS9A 4LRYC 3IT9A 4EESA 3T4TA 1K57C 2PBDP 3GDIA 2UWXA 4R4SA 4NG2A 4HEFA 4Y7PA 4HY8A 3RXXA 4EW7A 3CI6A 4OLGA 3MS6A 3T4LA 1ZKJA 2W0NA 3GR2A 4RYEA 3IXBA 2ZQ9A 3BFGA 4PM5A 2Z6CA 1KDSA 5DFYA 2NUTC 3P7NA 5KMWA 1T19A 2ZC5B 5GLDA 4PM8A 3V67A 5HAPA 2DCFA 4YFMA 1ONGA 4UHUA 2V9AA 5KSCA 4E6XA 4BJPA 3H82B 3HUOA 5HDSA 2X02A 2ZLYA 3EGXC 4GCZA 4BD0A 1KGEA 4JF6A 4BBUA 3P09A 3NOTC 5AQ9A 2L0WA 1KOUA 4JPMA 3ZVTA 1AWIA 2L1MA 1OT6A 2B18A 3E98A 1S66L 2ZMFA 3CITA 2WGIA 2WKRA 5HWVA 1D1JA 3CZDA 4U0TA 4BLMA 5CEBA 2XR0A 3C4OA 5J3WA 3KO6A 3KYQA 4EUVA 2ZC4B 3IH9A 4QWOA 2Y2PA 4IVKA 2Y2OA 3TG9A 1LI0A 2AVXA 4BQMA 1DP9A 1IKIA 1YLZA 3S7OA 3HVFA 3SOIA 4R23A 1GA9A 1OJ5A 3HBRA 3T4JA 3WS5A 1XFNA 3DW0A 2CC1A 3MFDA 2VK3A 3EOIA 5F68A 4DDYA 4N92A 2QHKA 1GCEA 2XEPA 1YLTA 1G5UA 4P6BA 4B4XA 1EI5A 2VGLS 2M7VA 3ICYA 5AVEA 2R9WA 4FSFA 4Y0OA 2PYRA 1LT0A 5I94A 4A5RA 3EQUA 1S0WA 2HV1A 2XLNA 2HZ5A 5FATA 1OTBA 3VOZA 3QP8A 5KIZA 4L9EA 4I3AA 1CI9A 2XFSA 4MLLA 3H7WA 3IXDA 3C7VA 5FDSA 4RX3A 1H8ZA 1K56D 1FSWA 1EWZA 1MY8A 2L4RA 1Z6FA 4BMWA 2EWVA 5DF8A 4K91A 4XT2B 1S6RA 4CLCB 3PXPA 4GB7A 3CLOA 2PR6A 3IF6C 3MQOA 4HP4A 2X71A 2P7JA 4Y2FA 1TDLA 1YSQA 1HTZA 4I5SA 1I2SA 2EX8A 1N9NA 1L0GA 3EEAA 1TD5A 4MNRA 5FQQA 4WELA 4G3KA 3VE3A 1OTAA 1VETA 5FAQA 3OLOA 3UMEA 3VFFA 3U2AA 1TS7A 2J3TD 3UPPA 1YLJA 2EWWA 1TS8A 1W8QA 3F1PB 5TFQA 5AQAA 3S22A 5CEDA 5EM0A 5LBRA 1BLHA 4LV3A 3D3OA 1XKZA 2E8IA 2ZC3B 2EXAA 1LSXA 4KG2A 3OPRA 2XGNA 2B5RA 4O0PA 2W1RA 3SH7A 4E3OA 1MWSA 4F3LA 1KE0A 1XJ4A 1G6AA 5MC7A 3DBAA 4PPRA 2WKHA 4OVDA 2J8YA 1V9ZA 4OP8A 3MMHA 3BJNA 5CERA 1DP6A 4LV0A 4Y5FA 5E2GA 4IJGA 4FTXA 1D7EA 1L0DA 4R3AA 5EVLA 3AGDA 5F69A 3LIEA 4WLAA 3TOIA 4OH0A 3SH8A 2BASA 1T18A 3T50A 4KENB 2A49A 1TS6A 3EQVA 4ID4A 5F83A 1NZOA 4PHTA 3DWKA 1S4SA 3V5MA 5L10A 3CWFA 1A0KA 4R38A 3ZQ5A 2R78A 4BWIA 2QYBA 3ZG8B 1GA0A 3LIAA 3UO9A 4JKTA 1K54A 3IBJA 3GSGA 1G6OA 1IOUA 4MN5A 1XJ6A 3GV9A 3UN7A 1BYWA 3UPNA 5DF7A 2CMNA 2Y2MA 1BTLA 5HD5A 3MKEA 3HJIA 3T1SA 2HJEA 1YM1A 2VLGA 4P0MA 3Q7VA 2JCHA 4X1MA 4EQIA 1K55C 1OMEA 2JKFA 4OQHA 4X56A 4I3IA 1EROA 1S1ZA 4MN6A 1F9IA 4MBHA 5GHXA 4E3IA 3ZNYA 4DE1A 3W2ZA 3ZGAB 2EX2A 3G4PA 1N9BA 2ZQCA 2V1ZA 2QPNA 1ZG4A 5HAIA 2HP5A 1MPLA 1F98A 1SZVA 2P04A 3CJMA 5FQMA 4XXRA 5DTTA 4O8GA 5HL6A 2V2FF 2PD7A 4YINA 4OQ0A 2WZXA 3Q82A 4PM9A 2OV5A 1YPRA 2JN7A 5L07A 1M6KA 3LY4A 1MC0A 5EPHA 4QU3A 3WS4A 1XX2A 1RCJA 1GHMA 4WYYA 4LCLA 3FPWA 1SHVA 3VP4A 1PRQA 4PM7A 3PBTA 3E0YA 1JWPA 4CLCC 1XGIA 4OOLA 3GRJA 5AJGA 4HBUA 5AQ7A 4OQGA 5GHZA 4DXBA 3ITAA 3R7WB 2W3GA 4K0WA 1NYMA 1ES3A 1OTIA 2W1TB 4KG5A 5GLBA 3WRTA 1LHYA 1BLCA 4UEYA 3HLGA 5I5LA 3GQZA 4N1HA 4PM6A 3VSKA 3CUEC 4FH2A 1ALQA 3CPTA 4MMNA 3M2JA 4Y15A 5HPFA 1JWVA 4KQOA 1FOFA 4KZAA 2WKQA 2ZL1A 4NETA 4UAAA 1DJCA 2FH5A 3WWXA 3SS4A 1WA9A 3NOUC 4JBFA 1FCMA 2K31A 1CQAA 2JKRI 4I3JA 5F1GA 4WZ5A 3VE4A 3PBRA 2KLIA 3RXWA 1PW1A 1RGZA 2V1AA 2PD8A 4WMCD 1O07A 3N8RA 4JXGA 4WMCA 4DE0A 3WRZA 3RH8B 2OOLA 2JE5A 3OPPA 1KE4A 4R0QA 3MXSA 4DDSA 1YMXA 3C5AA 3CUEA 3IH8A 4QY6A 3CG5A 4HOIA 1ERQA 4KZ3A 1XA7A 2XDMA 3UDIA 1FR6A 4O01A 5TGFA 5E2FA 5HWTA 5IT5A 3S1YA 4HJ4A 4O7DA 2EXBA 1J3WA 4KZ6A 1KGGA 4OPZA 3S7QA 2VGLM 5EVEA 3BYDA 4YOFA 4BBTA 3N8SA 4YNRA 1D06A 4UQIS 1IELA 2HPBA 4IBXA 4FD8A 1ODVA 3ITBA 1U60A 1DY6A 1FILA 2HDUA 4LLOB 5KSHA 3VP2A 1PWDA 4DJ2A 2P08A 4XUXA 4OONA 1TS0A 2C5WB 3F1PA 2WUQA 2IWCA 5FEGA 2ZQ8A 1KE3A 2JKTM 4CPKA 1WYBA 4HNBA 4MBKA 2Y79A 5EOEA 2W3HA 1RGYA 5HSQA 3BM6A 5EE8A 3IF6A 2GZAA 4KQDA 3KYZA 1JWZA 5CHMA 1MWRA 3VMAA 1H8MA 1T1CA 1K55A 3A3IA 5CTNA 1E3UD 2PRFA 3BECA 4N1XA 4S2NC 4HQAA 3NCKA 4OPRA 4D60A 1HVBA 2OLUA 3IWQA 1GSWA 3EEHA 5CTMA 1FCOA 1WE4A 1LL5A 2V0UA 2WAEA 3PBSA 3V3SA 3IXHA 2DRWA 3MQQA 4PAUA 4U0XA 5TBMA 5F82A 4IUHA 4EERA 2K2NA 3UDFA 3GVBA 1W5DA 1PWGA 1JNUA 4DXCA 2ZM2A 3PAEA 3JVUA 3JPUA 3ZCZA 3TSGA 4LRZE 3LR4A 1NZUA 3UE6A 3HCYA 3PYPA 2ACGA 1LSWA 2BTFP 2H28A 1YT4A 1MKMA 4KG6A 3D4FA 3G32A 4HH2A 3HLEA 5FI6A 2VZWA 2FFFB 5CHJA 3VOLA 2VX8A 2Z6DA 3BW6A 5L8MA 5BOHA 4OOMA 5DKLA 2XD5A 5FDHA 4F94A 4P87A 1I5QA 1NWZA 3RJUA 4BL3A 4I39A 1W79A 1Y54A 2ZQ7A 3IF5A 1I2WA 3VV4A 3EWKA 5FQJA 1FR1A 3PTEA 2I9VA 1XXMA 2BLSA 3UE1A 4DRTA 2HF6A 2K7SA 1P97A 2A3UA 2INWA 2E8JA 3FC7A 3DTEA 4EV4A 2B02A 2V1BA 1F5MA 2LB5A 3A3FA 4OQIA 4B9OA 1SDNA 3MR0A 1BULA 4JF4A 3QP4A 3UY6A 5TBMB 2ZM0A 4B88A 5E43A 1ESIA 1TDGA 2Q9NA 3IS2A 3ULFA 3ZG0A 2P9VA 3G2ZA 5E2HA 1SDEA 3O86A 3LI8A 3MZDA 3N8LA 2OWJA 3T1XA 1OTDA 3WS2A 3Q7VB 4MDZA 4ZTKA 4D2OA 1UWNX 4S2LA 1K57A 3PBQA 4IBRA 2Y2GA 2A24A 4R1GA 4BBVA 4C3QA 3A0VA 2XA7M 3B42A 1HLUP 3LGOA 1RP5A 1T1BA 3G34A 5EM1A 2Y2QA 5AQBA 2G2WA 3MXRA 1XGJA 5F5YA 4H6JB 4BL2A 1XP4A 3ZDJA 5FL3A 4P6ZM 2V0WA 3E2LA 3RFBA 4U3TA 1FSYA 2O99A 1G68A 3L9KA 3E2KA 3E4PA 5F6AA 4B4ZA 2HGVA 4NK3A 1PZPA 3QP6A 3LO7A 4LENA 3AGFA 3K2NA 1VB6A 4ZJ1A 2ZD8A 4NEED 1CI8A 4R3BA 1OPXA 2EX6A 2ZMAA 1HZOA 4DJ3A 1NYYA 3E4OA 2ZL1B 2ZOIA 3BFDA 4OP5A 3SH9A 3NECA 1Y28A 1MWUA 5HX9A 3HLDA 4ZJ3A 5GHYA 3KSHA 1K38A 4N9LA 4E3JA 4ZJ2A 4E3LA 3B3XA 1MZUA 4P6ZS 2M1CA 2UV0E 3NDGA 1PZOA 2Y2IA 2XROA 5FQKA 2O9CA 4OPQA 4ARZA 4WN5A 2A24B 1K6RA 1IKGA 2PBYA 2X01A 3FG8A 4GDBA 4DMZA 4EBLA 4QJGA 3LIBA 5CECA 3K3DA 3BY8A 3AGEA 4KZ9A 3K3CA 3A0RA 4L9FA 5HAQA 2J3TC 4Y0UA 4G3WA 3C2WA 1SKFA 4R4RA 4DN0A 2LB9A 4XT2A 3BRMA 4WM9A 1S1YA 3G2YA 4LFUA 4DKIA 4HHDA 1OTEA 5A8BA 5DTKA 1J9MA 4G3VA 1ZG6A 4GHIA 5L2FA 4XUZA
chains in the Genus database with same CATH topology
2ZMFA 3CUEA 3CITA 3UB6A 2WKRA 5HWVA 4HOIA 3F1NB 2GJ3A 2VV7A 2XRNA 4RQ9A 4ETXA 5J3WA 2JKTI 3KO6A 4WEJA 3KYQA 3PR6A 4EUVA 4O01A 3SW1A 5HD3A 3BQAA 5HDDA 1DP9A 5HWTA 2D02A 5IT5A 5G4YA 4HJ4A 3T4OA 2VEAA 4NXBA 3S7OA 4HI4A 5DJTA 3EGDC 1OJ5A 4CLCA 2GX5A 3T4JA 2OAQ1 1W63Q 1XFNA 3S7QA 4AFIA 3LYXA 2VGLM 3LR5A 3EOIA 4YOFA 4BBTA 4YNRA 4HIAA 5F68A 1D06A 4UQIS 2QHKA 4JGQA 5HDCA 1NLYA 1G28A 1ODVA 2PYPA 4JGOA 5DKKA 2VGLS 4EETB 1NLZA 2M7VA 3ICYA 5AVEA 4LLOB 3D72A 3B33A 5AVFA 4NXFA 3BY9A 4KUKA 5KSHA 4FSFA 2PYRA 1LT0A 4DJ2A 4WUJA 2P08A 3EQUA 3OOVA 4QPRA 4Y3IA 4ETZA 2HV1A 1TS0A 3GECA 3F1PA 1OTBA 3BWLA 5KIZA 4L9EA 4I3AA 2GNXA 4R6LA 5TJJA 2JKTM 1LL8A 1P0ZA 3H7WA 3LR0A 1STZA 4HNBA 2Y79A 1ZHHB 3LICA 2W3HA 5HSQA 1VHMA 3TJZC 4K08A 2FZ0A 5DJUA 2GZAA 4KQDA 2L4RA 4GLQA 2KX6A 3KYZA 4MCWA 4BMWA 2YKFA 2EWVA 4FOFA 1H8MA 4XT2B 1T1CA 4CLCB 3PXPA 4CQHA 4EQ1A 3CLOA 2PR6A 4YWZA 1YAXA 2J80A 3MQOA 4HP4A 4HQAA 4B93A 2P7JA 4Y2FA 1YSQA 3HJKA 1S67L 3F1NA 3IS2B 3S7NA 2PT7A 1ZTUA 5J7EA 2A2LA 2QJ5A 4I5SA 1GSWA 1N9NA 3EEHA 3EEAA 1TD5A 3H9WA 3G6OA 4WELA 3T4QA 4G3KA 4Q0IA 3VE3A 2V0UA 1OTAA 3R4KA 3PBNA 2HJ9C 2PHYA 3OLOA 2QKPA 3PBSA 3UMEA 3U2AA 1TS7A 2J3TD 3MQQA 4PAUA 5TBMA 2EWWA 3T4KA 4IUHA 1TS8A 3UB7A 2ZBBA 4EERA 2K2NA 3F1PB 2IA2A 3LFVA 5IS1A 1JNUA 2JKRM 5LBRA 2VJWA 2EA9A 3D3OA 4EEUA 3JVUA 1P9RA 1LSXA 4LRZE 3LR4A 3NOPC 4WL9A 3UE6A 3HCYA 1OJGA 3PYPA 1LSWA 4L0LA 2H28A 4NXGA 1GSXA 3UB8A 4O0PA 1MKMA 2W1RA 4F3LA 4HH2A 1XJ4A 5MC7A 4EXOA 2VZWA 3DBAA 3VOLA 1NRJA 1H3QA 1V9ZA 3MMHA 3BJNA 3MQ0A 1DP6A 2KOIA 2VX8A 2Z6DA 3BW6A 2O9BA 4Y5FA 5L8MA 4IJGA 5IU1A 2Y8HA 4OOMA 5DKLA 3JVVA 3UMDA 4NKPA 1W63M 1EW0A 1D7EA 1NWZA 1T1AA 4R3AA 4I39A 3LR3A 4CLCD 5F69A 3LIEA 4WLAA 3VV4A 5C5KA 3EWKA 4GS9B 3OCLA 1LSVA 2I9VA 1YKDA 4I38A 2BASA 4ARZB 2HF6A 1T18A 5J4EA 3T50A 2K7SA 3LI9A 3LUQA 1P97A 1P9WA 4LPZA 1TS6A 3EQVA 3UB9A 2INWA 2O0YA 3FC7A 3MJQA 4MN7A 5CX7A 4GHIB 2B02A 3BQ8A 4PHTA 2V1BA 5DF9A 1F5MA 2LB5A 3R7WA 1S4SA 4B9OA 3CWFA 3TE8A 3KSFA 4KUOA 3CAXA 4R38A 3MR0A 4ME4A 3ZQ5A 2R78A 4BWIA 5TBMB 2QYBA 2XSSA 3RTYA 5EFWA 2ZMVA 4WF0A 3IS2A 4WEKA 5G4ZA 3ULFA 3LIAA 4Q0HA 2QWSA 3F1OA 3UE3A 3IBJA 4JGPA 1IOUA 1G6OA 1UWPX 4Z1WA 4MN5A 1XJ6A 1BYWA 2VV6A 3LI8A 4PKYA 2CMNA 3PHYA 5HD5A 3HJIA 5DFXA 2OWJA 2HJEA 1OTDA 4Q0JA 1GSVA 2VLGA 2DMWA 4MDZA 1UWNX 2VV8A 5HWWA 1UGUA 4R70A 4I3IA 4F3LB 4NXEA 3PBQA 2A24A 4BBVA 4IHQA 3A0VA 2M7UA 2XA7M 1S1ZA 3MF0A 2PR5A 4MN6A 3B42A 1F9IA 3LIDA 3KSIA 3C30A 1T1BA 4LRXC 3FPVA 5F5YA 2WKPA 4H6JB 3ZYTA 4CLCE 2W3EA 3TRCA 3W2ZA 3NHQA 5FL3A 2W1TA 4P6ZM 2W27A 2V0WA 3KSGA 1N9LA 1IFQA 3RFBA 4M4XA 1F98A 3O5YA 1DRMA 2P04A 3A0SA 2O99A 3OC2A 4UQIM 3MXQA 1N9OA 3F1OB 4O8GA 3E4PA 5F6AA 5HL6A 2PD7A 2ZOHA 4E04A 2HGVA 4HP9A 2JN7A 1MC0A 4HJ3A 1DP8A 1XJ2A 4HH3A 5HPIA 4HJ6A 3K2NA 3OCNA 1VB6A 4JGRA 1XJ3A 3C8CA 3FPWA 2O9AA 4ZRRA 4NEED 1X0OA 2PDRA 1OPXA 3PBTA 4GJ4A 3E0YA 4CLCC 3C38A 2W3FA 5HZHA 1TF1A 4OOLA 4DJ3A 5AJGA 2YKHA 3E4OA 3LIFA 2ZOIA 3TW8A 3R7WB 3S7PA 4H6JA 2W3GA 2VA0A 2XA7S 1Y28A 3PBOA 4II7A 3T4SA 3H7WB 1OTIA 2W1TB 3KSHA 4GW9A 3KX0X 1V9YA 3P01A 2W3DA 4IUKA 5I5LA 3H82A 4UEYA 4PKYG 1OT9A 1YSPA 4GS9A 4LRYC 2OAP1 3CUEC 4EESA 1MZUA 3T4TA 4P6ZS 3E4QA 2M1CA 3GDIA 4MMNA 2XROA 2O9CA 4ARZA 4WN5A 4HY8A 2A24B 4EW7A 3CI6A 5HPFA 3T4LA 4KQOA 2W0NA 2WKQA 2QJ7A 3NJAA 3FG8A 2FH5A 4DMZA 2Z6CA 5DFYA 2NUTC 3P7NA 1WA9A 5K5BA 1T19A 3LIBA 3MFXA 3NOUC 2K31A 2JKRI 4I3JA 3V67A 3K3DA 3BY8A 4EEPA 2D01A 4EU0A 3K3CA 3VE4A 3PBRA 3A0RA 4L9FA 2KLIA 2V9AA 1S4RA 3IBRA 4BJPA 3H82B 2J3TC 5HDSA 4G3WA 2JHEA 3C2WA 2V1AA 2J3WA 3EGXC 2PD8A 4DN0A 2OWHA 2LB9A 4GCZA 4XT2A 4L9GA 2KDKA 2NUPC 2VKSA 4BBUA 3NOTC 1S1YA 2G7UA 2L0WA 2OOLA 3RH8B 1KOUA 4HHDA 1OTEA 5A8BA 2L1MA 1OT6A 1XFQA 3OBFA 2B18A 4G3VA 4GHIA 3E98A 1S66L 3B47A 2MJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CUE A;  2J3T D;  1H3Q A;  2ZMV A;  2J3T C;  3CUE C;  2J3W A;  3PR6 A; 
#chains in the Genus database with same CATH topology
 3O87 A;  2B95 A;  4OLD A;  5FI2 A;  3F1N B;  1IYO A;  2Y2J A;  4QD4 A;  2GJ3 A;  2V8F A;  2XRN A;  2ZC7 A;  4ETX A;  2JKT I;  4WEJ A;  1ERM A;  4GN2 A;  1PFL A;  2Y4A A;  3SW1 A;  1Y4O A;  1GHI A;  3U4L P;  3BQA A;  5HDD A;  5G4Y A;  2J9P A;  3T4O A;  5CGW A;  3CMZ A;  3QNB A;  1YMS A;  4S2P A;  2GX5 A;  2Y2L A;  1W63 Q;  4AFI A;  3LYX A;  3W4P A;  1SCW A;  3D9Y A;  3LR5 A;  3HUM A;  1PW8 A;  4HIA A;  5IHV A;  5U47 A;  1NLY A;  3N7W A;  2PYP A;  5DKK A;  3OPH A;  4E6W A;  4HES A;  3ZVW A;  4UA9 A;  5AVF A;  4NXF A;  1GHP A;  4KUK A;  1MBL A;  2Y2H A;  1FQG A;  3A3E A;  3GEC A;  3N6I A;  4S2I A;  1CJF A;  3BWL A;  3ZNT A;  5EVI C;  3T12 B;  1LL8 A;  1P0Z A;  3LR0 A;  1ZHH B;  3LIC A;  3NY4 A;  2G2U A;  5JYP A;  4K08 A;  2FZ0 A;  5DJU A;  3DTI A;  4GLQ A;  3O3V A;  3HLF A;  4FOF A;  1JVJ A;  4GDN A;  1YLY A;  4E3N A;  5CXW A;  4CQH A;  2VGJ A;  4YWZ A;  2WGW A;  4KZB A;  4B93 A;  5J7E A;  3F1N A;  3S7N A;  2QJ5 A;  3W8K A;  1H5X A;  3H9W A;  5FQ9 A;  3G6O A;  4OOY A;  1VET B;  1ES4 A;  5M18 A;  3OZH A;  1MKI A;  2HJ9 C;  2PHY A;  3VP3 A;  4OKP A;  3WS0 A;  5FAP A;  4P85 A;  3UB7 A;  3NIA A;  2ZBB A;  3LFV A;  3BLS A;  4ZAM A;  2JKR M;  3T1Q B;  2VJW A;  2EA9 A;  2XK1 A;  3P98 A;  4EEU A;  3G30 A;  3NOP C;  3PAG A;  4QB8 A;  1OJG A;  5EVI D;  4L0L A;  2H10 A;  4NXG A;  1GSX A;  3UB8 A;  5HAR A;  4M3K A;  1Q2Q A;  5A90 A;  1N4O A;  5D3O A;  2VGK A;  1BZA A;  4MEZ A;  3MQ0 A;  2RCX A;  2Q9M A;  2O9B A;  2Z2M B;  3IX4 A;  1VEU A;  1JTD A;  1ES2 A;  3LEQ A;  3UMD A;  1W63 M;  2Y55 A;  1EW0 A;  1K4F A;  3FWL A;  4ZBE A;  2HDS A;  2WKE A;  3LR3 A;  2PU2 A;  1L3L A;  4GS9 B;  5GLC A;  5G18 A;  3A3D A;  1YKD A;  4BEN A;  3QP1 A;  3LI9 A;  3LUQ A;  2WZZ A;  4JXW A;  1P9W A;  4LPZ A;  4WBG A;  3DAV A;  3UB9 A;  3FKW A;  5HW3 A;  4MN7 A;  5CGX A;  4GHI B;  1LL9 A;  3BEB A;  3R7W A;  2FFY A;  4KUO A;  5EVI B;  4LCM A;  2XSS A;  3RTY A;  4LV2 A;  5EFW A;  1NJ4 A;  4WF0 A;  5G4Z A;  4WEK A;  5A91 A;  4Q0H A;  1BSG A;  2QWS A;  3UE3 A;  4JGP A;  5FI7 A;  4Z1W A;  5JYO A;  2VV6 A;  3HLB A;  4GD8 A;  1TEM A;  2R9X A;  4PKY A;  3PHY A;  4QY5 A;  5DFX A;  1GSV A;  4S2N A;  1KDW A;  2VV8 A;  3GMW A;  2XQZ A;  1XA1 A;  1UGU A;  4R70 A;  2WAD A;  4F3L B;  4NXE A;  4JXV A;  3FKV A;  1ONH A;  4IHQ A;  2M7U A;  3MF0 A;  3CPT B;  3LID A;  2V20 A;  3KSI A;  1PI4 A;  5FA7 A;  4Y0T A;  3UNW A;  1M40 A;  5FQI A;  3FPV A;  1YQS A;  1QME A;  1VEU B;  1K4E A;  3ZYT A;  1H0M A;  3VP1 A;  1LLB A;  4CLC E;  2W3E A;  4K0X A;  3NHQ A;  3W4Q A;  5EUA A;  1IEM A;  2ZJ9 A;  2W1T A;  2W27 A;  3KSG A;  1E4D A;  4M4X A;  2JBF A;  2Z2L B;  5E2E A;  3UE0 A;  1DRM A;  1TVF A;  4DE2 A;  3ISG A;  3OC2 A;  4X1L A;  4R3J A;  5CHU A;  5FEF A;  3QHY A;  4HJ3 A;  4HH3 A;  1XJ2 A;  5EOO A;  3V50 A;  1IYQ A;  1NY0 A;  2IWD A;  4KZ4 A;  3OCN A;  1XJ3 A;  2O9A A;  4ZRR A;  2H0T A;  2J7V A;  1LI9 A;  4GJ4 A;  2WK0 A;  4QHC A;  1PNE A;  1TF1 A;  4GD6 A;  5CRF A;  4KQQ A;  4EBN A;  2YKH A;  3IXG A;  2IWB A;  3LIF A;  1F2K A;  3M6H A;  4Z9Q A;  2H0Y A;  3VSL A;  4Y13 A;  3S7P A;  2VA0 A;  2XA7 S;  3C7U A;  4II7 A;  3T4S A;  3H7W B;  4RA7 A;  4S2M A;  3KX0 X;  4EWF A;  1V9Y A;  4WZ4 A;  4DE3 A;  4IUK A;  3H82 A;  1OT9 A;  2JC7 A;  4CJN A;  1XPB A;  2OAP 1;  3BLM A;  3MZE A;  3E4Q A;  2J9O A;  1DJB A;  1BLS A;  2HP6 A;  1PIO A;  3IWI A;  1ACF A;  1BLP A;  4JLF A;  3NUL A;  2JKG A;  1K56 A;  3NJA A;  2QJ7 A;  3VOY A;  1ZC2 A;  5K5B A;  3BFE A;  2WKI A;  3MFX A;  2RL3 A;  4WZ5 C;  4EUZ A;  3IHA A;  3T1R A;  4EEP A;  2D01 A;  4EU0 A;  1L0F A;  1S4R A;  3IBR A;  2Y2N A;  1WYC A;  2JHE A;  2J3W A;  3ZG5 A;  3FYZ A;  2OWH A;  4L9G A;  3VFH A;  2KDK A;  2NUP C;  3WS1 A;  2VKS A;  4UA6 A;  3ZFZ A;  2Q0O A;  2G7U A;  5GLA A;  4S2K A;  2EFU A;  1BUE A;  1XFQ A;  3OBF A;  1Z09 A;  3B47 A;  2MJ6 A;  3UB6 A;  4RVA A;  1O7E A;  2QMI A;  2VV7 A;  4RQ9 A;  3LCE A;  4UA7 A;  3PR6 A;  3UPO A;  4JF5 A;  2WAF A;  3UDX A;  5HD3 A;  2D02 A;  1KVL A;  3IQA A;  5FSR A;  3MZF A;  2VEA A;  1YLP A;  4NXB A;  4FUW A;  5FAO A;  3Q07 A;  1PI5 A;  1NRF A;  4HI4 A;  5DJT A;  3EGD C;  5CGS A;  4CLC A;  3QP5 A;  2OAQ 1;  3FZC A;  1L0E A;  1CK3 A;  5KZH A;  4JGQ A;  5HDC A;  3VP0 A;  1G28 A;  1C3B A;  1FIK A;  4OPY A;  4JGO A;  3SS3 A;  4EET B;  3G31 A;  1NLZ A;  3D72 A;  3B33 A;  3BY9 A;  3DWZ A;  2EFX A;  2PU4 A;  3G35 A;  4WUJ A;  2GDN A;  3OOV A;  4QPR A;  4Y3I A;  4ETZ A;  3S4X A;  3KYE A;  2ZM8 A;  3W4O A;  2WYX A;  2GNX A;  4R6L A;  5TJJ A;  4ZDX A;  1STZ A;  3BFF A;  2ZQA A;  1VHM A;  4LGW A;  3TJZ C;  1L2S A;  4S2J A;  1PYY A;  2KX6 A;  3I7J A;  4MCW A;  1K0K A;  4IED A;  3UB5 P;  2YKF A;  5M19 A;  3ZHH A;  1NXY A;  4E3K A;  3LY3 A;  1VQQ A;  4EQ1 A;  1YAX A;  4LV1 A;  2J80 A;  2WGW B;  1S67 L;  1MWT A;  1CEG A;  3HJK A;  3IS2 B;  2PT7 A;  1ZTU A;  2P9V B;  2A2L A;  4KZ8 A;  3T4Q A;  3HL9 A;  4Q0I A;  1K54 C;  5EVI A;  1W8Y A;  3R4K A;  3PBN A;  2QKP A;  3M6B A;  3V3R A;  5EV0 A;  3MSH A;  5HFO A;  1KVM A;  3T4K A;  1E25 A;  2IA2 A;  5IS1 A;  4X68 A;  2P74 A;  2HP9 A;  2ZQD A;  3M2K A;  3N4I A;  1SKO A;  4EBP A;  3NDE A;  1P9R A;  1H8Y A;  4WL9 A;  5J8X A;  1IYP A;  1K25 A;  3HUN A;  4EXO A;  4BD1 A;  1NRJ A;  3Q81 A;  1H3Q A;  3DTM A;  4MBF A;  4JXS A;  3OPL A;  4X53 A;  4PMA A;  4Q8I A;  2KOI A;  2QZ6 A;  4X69 A;  5IU1 A;  2Y8H A;  3IX8 A;  2WGV A;  3L7H A;  5EEC A;  2XD1 A;  3JVV A;  4NKP A;  2I72 A;  1T1A A;  3C4P A;  4CLC D;  1HD8 A;  1JTG A;  5C5K A;  4H8R A;  3OCL A;  1LSV A;  4I38 A;  1AXB A;  4KZ5 A;  3NI9 A;  4RX2 A;  4ARZ B;  2C6W B;  3NBL A;  5J4E A;  2XF3 A;  2Y59 A;  2OLV A;  1KGF A;  3V39 A;  2O0Y A;  2Y91 A;  3MJQ A;  5CX7 A;  1K6S A;  1YLW A;  3BQ8 A;  5DF9 A;  4GOG A;  4Y17 A;  4GKU A;  1IYS A;  3KSF A;  1Q2P A;  3TE8 A;  3CAX A;  3QP2 A;  5DTS A;  2ZC6 B;  4ME4 A;  4X55 A;  4ESP A;  3JYI A;  2OSU A;  2ZMV A;  5FAS A;  5F1F A;  1CF0 A;  3O88 A;  2PAV P;  1E3U A;  3F1O A;  1UWP X;  2H5S A;  4HBT A;  3GTC A;  4FCF A;  3FV7 A;  4KQR A;  2BG1 A;  4Q0J A;  1FCN A;  2DMW A;  3IF6 B;  1ES5 A;  5HWW A;  3ZG9 B;  4KZ7 A;  3HLW A;  3CHW P;  4N9K A;  2PR5 A;  4GNU A;  3C30 A;  4LRX C;  1SKO B;  2V8C A;  3BFC A;  2XH9 A;  2WKP A;  3TRC A;  1QMF A;  5DVA A;  4C75 A;  3A3J A;  1VM1 A;  3NC8 A;  3Q1F A;  1N9L A;  1IFQ A;  3IX3 A;  4C6Y A;  3O5Y A;  3A0S A;  4UQI M;  3HLC A;  3MXQ A;  1N9O A;  5L09 A;  3F1O B;  3Q7Z A;  3MKF A;  5GL9 A;  2ZOH A;  4DF6 A;  4E04 A;  3IHB A;  4HP9 A;  5HL1 A;  3QNC A;  1CEF A;  4IVI A;  1DP8 A;  5HPI A;  2HDR A;  4X25 A;  4FH4 A;  4HJ6 A;  4JGR A;  1BT5 A;  3SS5 A;  3C8C A;  4X6T A;  4E3M A;  1X0O A;  1PWC A;  2PDR A;  3MBZ A;  3DTK A;  3IWO A;  3C38 A;  2W3F A;  3HRE A;  5HZH A;  2HDQ A;  5A92 A;  1DJA A;  3TW8 A;  3LEZ A;  2XFT A;  4H6J A;  3PBO A;  5A93 A;  4GW9 A;  5M1A A;  2Y2K A;  4GZB A;  2EX9 A;  2DNS A;  3SZT A;  3P01 A;  2W3D A;  1MXO A;  1ESU A;  4PKY G;  4S2O A;  1YSP A;  5TR7 A;  3ZG7 B;  1W7F A;  4GS9 A;  4LRY C;  3IT9 A;  4EES A;  3T4T A;  1K57 C;  2PBD P;  3GDI A;  2UWX A;  4R4S A;  4NG2 A;  4HEF A;  4Y7P A;  4HY8 A;  3RXX A;  4EW7 A;  3CI6 A;  4OLG A;  3MS6 A;  3T4L A;  1ZKJ A;  2W0N A;  3GR2 A;  4RYE A;  3IXB A;  2ZQ9 A;  3BFG A;  4PM5 A;  2Z6C A;  1KDS A;  5DFY A;  2NUT C;  3P7N A;  5KMW A;  1T19 A;  2ZC5 B;  5GLD A;  4PM8 A;  3V67 A;  5HAP A;  2DCF A;  4YFM A;  1ONG A;  4UHU A;  2V9A A;  5KSC A;  4E6X A;  4BJP A;  3H82 B;  3HUO A;  5HDS A;  2X02 A;  2ZLY A;  3EGX C;  4GCZ A;  4BD0 A;  1KGE A;  4JF6 A;  4BBU A;  3P09 A;  3NOT C;  5AQ9 A;  2L0W A;  1KOU A;  4JPM A;  3ZVT A;  1AWI A;  2L1M A;  1OT6 A;  2B18 A;  3E98 A;  1S66 L;  2ZMF A;  3CIT A;  2WGI A;  2WKR A;  5HWV A;  1D1J A;  3CZD A;  4U0T A;  4BLM A;  5CEB A;  2XR0 A;  3C4O A;  5J3W A;  3KO6 A;  3KYQ A;  4EUV A;  2ZC4 B;  3IH9 A;  4QWO A;  2Y2P A;  4IVK A;  2Y2O A;  3TG9 A;  1LI0 A;  2AVX A;  4BQM A;  1DP9 A;  1IKI A;  1YLZ A;  3S7O A;  3HVF A;  3SOI A;  4R23 A;  1GA9 A;  1OJ5 A;  3HBR A;  3T4J A;  3WS5 A;  1XFN A;  3DW0 A;  2CC1 A;  3MFD A;  2VK3 A;  3EOI A;  5F68 A;  4DDY A;  4N92 A;  2QHK A;  1GCE A;  2XEP A;  1YLT A;  1G5U A;  4P6B A;  4B4X A;  1EI5 A;  2VGL S;  2M7V A;  3ICY A;  5AVE A;  2R9W A;  4FSF A;  4Y0O A;  2PYR A;  1LT0 A;  5I94 A;  4A5R A;  3EQU A;  1S0W A;  2HV1 A;  2XLN A;  2HZ5 A;  5FAT A;  1OTB A;  3VOZ A;  3QP8 A;  5KIZ A;  4L9E A;  4I3A A;  1CI9 A;  2XFS A;  4MLL A;  3H7W A;  3IXD A;  3C7V A;  5FDS A;  4RX3 A;  1H8Z A;  1K56 D;  1FSW A;  1EWZ A;  1MY8 A;  2L4R A;  1Z6F A;  4BMW A;  2EWV A;  5DF8 A;  4K91 A;  4XT2 B;  1S6R A;  4CLC B;  3PXP A;  4GB7 A;  3CLO A;  2PR6 A;  3IF6 C;  3MQO A;  4HP4 A;  2X71 A;  2P7J A;  4Y2F A;  1TDL A;  1YSQ A;  1HTZ A;  4I5S A;  1I2S A;  2EX8 A;  1N9N A;  1L0G A;  3EEA A;  1TD5 A;  4MNR A;  5FQQ A;  4WEL A;  4G3K A;  3VE3 A;  1OTA A;  1VET A;  5FAQ A;  3OLO A;  3UME A;  3VFF A;  3U2A A;  1TS7 A;  2J3T D;  3UPP A;  1YLJ A;  2EWW A;  1TS8 A;  1W8Q A;  3F1P B;  5TFQ A;  5AQA A;  3S22 A;  5CED A;  5EM0 A;  5LBR A;  1BLH A;  4LV3 A;  3D3O A;  1XKZ A;  2E8I A;  2ZC3 B;  2EXA A;  1LSX A;  4KG2 A;  3OPR A;  2XGN A;  2B5R A;  4O0P A;  2W1R A;  3SH7 A;  4E3O A;  1MWS A;  4F3L A;  1KE0 A;  1XJ4 A;  1G6A A;  5MC7 A;  3DBA A;  4PPR A;  2WKH A;  4OVD A;  2J8Y A;  1V9Z A;  4OP8 A;  3MMH A;  3BJN A;  5CER A;  1DP6 A;  4LV0 A;  4Y5F A;  5E2G A;  4IJG A;  4FTX A;  1D7E A;  1L0D A;  4R3A A;  5EVL A;  3AGD A;  5F69 A;  3LIE A;  4WLA A;  3TOI A;  4OH0 A;  3SH8 A;  2BAS A;  1T18 A;  3T50 A;  4KEN B;  2A49 A;  1TS6 A;  3EQV A;  4ID4 A;  5F83 A;  1NZO A;  4PHT A;  3DWK A;  1S4S A;  3V5M A;  5L10 A;  3CWF A;  1A0K A;  4R38 A;  3ZQ5 A;  2R78 A;  4BWI A;  2QYB A;  3ZG8 B;  1GA0 A;  3LIA A;  3UO9 A;  4JKT A;  1K54 A;  3IBJ A;  3GSG A;  1G6O A;  1IOU A;  4MN5 A;  1XJ6 A;  3GV9 A;  3UN7 A;  1BYW A;  3UPN A;  5DF7 A;  2CMN A;  2Y2M A;  1BTL A;  5HD5 A;  3MKE A;  3HJI A;  3T1S A;  2HJE A;  1YM1 A;  2VLG A;  4P0M A;  3Q7V A;  2JCH A;  4X1M A;  4EQI A;  1K55 C;  1OME A;  2JKF A;  4OQH A;  4X56 A;  4I3I A;  1ERO A;  1S1Z A;  4MN6 A;  1F9I A;  4MBH A;  5GHX A;  4E3I A;  3ZNY A;  4DE1 A;  3W2Z A;  3ZGA B;  2EX2 A;  3G4P A;  1N9B A;  2ZQC A;  2V1Z A;  2QPN A;  1ZG4 A;  5HAI A;  2HP5 A;  1MPL A;  1F98 A;  1SZV A;  2P04 A;  3CJM A;  5FQM A;  4XXR A;  5DTT A;  4O8G A;  5HL6 A;  2V2F F;  2PD7 A;  4YIN A;  4OQ0 A;  2WZX A;  3Q82 A;  4PM9 A;  2OV5 A;  1YPR A;  2JN7 A;  5L07 A;  1M6K A;  3LY4 A;  1MC0 A;  5EPH A;  4QU3 A;  3WS4 A;  1XX2 A;  1RCJ A;  1GHM A;  4WYY A;  4LCL A;  3FPW A;  1SHV A;  3VP4 A;  1PRQ A;  4PM7 A;  3PBT A;  3E0Y A;  1JWP A;  4CLC C;  1XGI A;  4OOL A;  3GRJ A;  5AJG A;  4HBU A;  5AQ7 A;  4OQG A;  5GHZ A;  4DXB A;  3ITA A;  3R7W B;  2W3G A;  4K0W A;  1NYM A;  1ES3 A;  1OTI A;  2W1T B;  4KG5 A;  5GLB A;  3WRT A;  1LHY A;  1BLC A;  4UEY A;  3HLG A;  5I5L A;  3GQZ A;  4N1H A;  4PM6 A;  3VSK A;  3CUE C;  4FH2 A;  1ALQ A;  3CPT A;  4MMN A;  3M2J A;  4Y15 A;  5HPF A;  1JWV A;  4KQO A;  1FOF A;  4KZA A;  2WKQ A;  2ZL1 A;  4NET A;  4UAA A;  1DJC A;  2FH5 A;  3WWX A;  3SS4 A;  1WA9 A;  3NOU C;  4JBF A;  1FCM A;  2K31 A;  1CQA A;  2JKR I;  4I3J A;  5F1G A;  4WZ5 A;  3VE4 A;  3PBR A;  2KLI A;  3RXW A;  1PW1 A;  1RGZ A;  2V1A A;  2PD8 A;  4WMC D;  1O07 A;  3N8R A;  4JXG A;  4WMC A;  4DE0 A;  3WRZ A;  3RH8 B;  2OOL A;  2JE5 A;  3OPP A;  1KE4 A;  4R0Q A;  3MXS A;  4DDS A;  1YMX A;  3C5A A;  3CUE A;  3IH8 A;  4QY6 A;  3CG5 A;  4HOI A;  1ERQ A;  4KZ3 A;  1XA7 A;  2XDM A;  3UDI A;  1FR6 A;  4O01 A;  5TGF A;  5E2F A;  5HWT A;  5IT5 A;  3S1Y A;  4HJ4 A;  4O7D A;  2EXB A;  1J3W A;  4KZ6 A;  1KGG A;  4OPZ A;  3S7Q A;  2VGL M;  5EVE A;  3BYD A;  4YOF A;  4BBT A;  3N8S A;  4YNR A;  1D06 A;  4UQI S;  1IEL A;  2HPB A;  4IBX A;  4FD8 A;  1ODV A;  3ITB A;  1U60 A;  1DY6 A;  1FIL A;  2HDU A;  4LLO B;  5KSH A;  3VP2 A;  1PWD A;  4DJ2 A;  2P08 A;  4XUX A;  4OON A;  1TS0 A;  2C5W B;  3F1P A;  2WUQ A;  2IWC A;  5FEG A;  2ZQ8 A;  1KE3 A;  2JKT M;  4CPK A;  1WYB A;  4HNB A;  4MBK A;  2Y79 A;  5EOE A;  2W3H A;  1RGY A;  5HSQ A;  3BM6 A;  5EE8 A;  3IF6 A;  2GZA A;  4KQD A;  3KYZ A;  1JWZ A;  5CHM A;  1MWR A;  3VMA A;  1H8M A;  1T1C A;  1K55 A;  3A3I A;  5CTN A;  1E3U D;  2PRF A;  3BEC A;  4N1X A;  4S2N C;  4HQA A;  3NCK A;  4OPR A;  4D60 A;  1HVB A;  2OLU A;  3IWQ A;  1GSW A;  3EEH A;  5CTM A;  1FCO A;  1WE4 A;  1LL5 A;  2V0U A;  2WAE A;  3PBS A;  3V3S A;  3IXH A;  2DRW A;  3MQQ A;  4PAU A;  4U0X A;  5TBM A;  5F82 A;  4IUH A;  4EER A;  2K2N A;  3UDF A;  3GVB A;  1W5D A;  1PWG A;  1JNU A;  4DXC A;  2ZM2 A;  3PAE A;  3JVU A;  3JPU A;  3ZCZ A;  3TSG A;  4LRZ E;  3LR4 A;  1NZU A;  3UE6 A;  3HCY A;  3PYP A;  2ACG A;  1LSW A;  2BTF P;  2H28 A;  1YT4 A;  1MKM A;  4KG6 A;  3D4F A;  3G32 A;  4HH2 A;  3HLE A;  5FI6 A;  2VZW A;  2FFF B;  5CHJ A;  3VOL A;  2VX8 A;  2Z6D A;  3BW6 A;  5L8M A;  5BOH A;  4OOM A;  5DKL A;  2XD5 A;  5FDH A;  4F94 A;  4P87 A;  1I5Q A;  1NWZ A;  3RJU A;  4BL3 A;  4I39 A;  1W79 A;  1Y54 A;  2ZQ7 A;  3IF5 A;  1I2W A;  3VV4 A;  3EWK A;  5FQJ A;  1FR1 A;  3PTE A;  2I9V A;  1XXM A;  2BLS A;  3UE1 A;  4DRT A;  2HF6 A;  2K7S A;  1P97 A;  2A3U A;  2INW A;  2E8J A;  3FC7 A;  3DTE A;  4EV4 A;  2B02 A;  2V1B A;  1F5M A;  2LB5 A;  3A3F A;  4OQI A;  4B9O A;  1SDN A;  3MR0 A;  1BUL A;  4JF4 A;  3QP4 A;  3UY6 A;  5TBM B;  2ZM0 A;  4B88 A;  5E43 A;  1ESI A;  1TDG A;  2Q9N A;  3IS2 A;  3ULF A;  3ZG0 A;  2P9V A;  3G2Z A;  5E2H A;  1SDE A;  3O86 A;  3LI8 A;  3MZD A;  3N8L A;  2OWJ A;  3T1X A;  1OTD A;  3WS2 A;  3Q7V B;  4MDZ A;  4ZTK A;  4D2O A;  1UWN X;  4S2L A;  1K57 A;  3PBQ A;  4IBR A;  2Y2G A;  2A24 A;  4R1G A;  4BBV A;  4C3Q A;  3A0V A;  2XA7 M;  3B42 A;  1HLU P;  3LGO A;  1RP5 A;  1T1B A;  3G34 A;  5EM1 A;  2Y2Q A;  5AQB A;  2G2W A;  3MXR A;  1XGJ A;  5F5Y A;  4H6J B;  4BL2 A;  1XP4 A;  3ZDJ A;  5FL3 A;  4P6Z M;  2V0W A;  3E2L A;  3RFB A;  4U3T A;  1FSY A;  2O99 A;  1G68 A;  3L9K A;  3E2K A;  3E4P A;  5F6A A;  4B4Z A;  2HGV A;  4NK3 A;  1PZP A;  3QP6 A;  3LO7 A;  4LEN A;  3AGF A;  3K2N A;  1VB6 A;  4ZJ1 A;  2ZD8 A;  4NEE D;  1CI8 A;  4R3B A;  1OPX A;  2EX6 A;  2ZMA A;  1HZO A;  4DJ3 A;  1NYY A;  3E4O A;  2ZL1 B;  2ZOI A;  3BFD A;  4OP5 A;  3SH9 A;  3NEC A;  1Y28 A;  1MWU A;  5HX9 A;  3HLD A;  4ZJ3 A;  5GHY A;  3KSH A;  1K38 A;  4N9L A;  4E3J A;  4ZJ2 A;  4E3L A;  3B3X A;  1MZU A;  4P6Z S;  2M1C A;  2UV0 E;  3NDG A;  1PZO A;  2Y2I A;  2XRO A;  5FQK A;  2O9C A;  4OPQ A;  4ARZ A;  4WN5 A;  2A24 B;  1K6R A;  1IKG A;  2PBY A;  2X01 A;  3FG8 A;  4GDB A;  4DMZ A;  4EBL A;  4QJG A;  3LIB A;  5CEC A;  3K3D A;  3BY8 A;  3AGE A;  4KZ9 A;  3K3C A;  3A0R A;  4L9F A;  5HAQ A;  2J3T C;  4Y0U A;  4G3W A;  3C2W A;  1SKF A;  4R4R A;  4DN0 A;  2LB9 A;  4XT2 A;  3BRM A;  4WM9 A;  1S1Y A;  3G2Y A;  4LFU A;  4DKI A;  4HHD A;  1OTE A;  5A8B A;  5DTK A;  1J9M A;  4G3V A;  1ZG6 A;  4GHI A;  5L2F A;  4XUZ A; 
#chains in the Genus database with same CATH homology
 2ZMF A;  3CUE A;  3CIT A;  3UB6 A;  2WKR A;  5HWV A;  4HOI A;  3F1N B;  2GJ3 A;  2VV7 A;  2XRN A;  4RQ9 A;  4ETX A;  5J3W A;  2JKT I;  3KO6 A;  4WEJ A;  3KYQ A;  3PR6 A;  4EUV A;  4O01 A;  3SW1 A;  5HD3 A;  3BQA A;  5HDD A;  1DP9 A;  5HWT A;  2D02 A;  5IT5 A;  5G4Y A;  4HJ4 A;  3T4O A;  2VEA A;  4NXB A;  3S7O A;  4HI4 A;  5DJT A;  3EGD C;  1OJ5 A;  4CLC A;  2GX5 A;  3T4J A;  2OAQ 1;  1W63 Q;  1XFN A;  3S7Q A;  4AFI A;  3LYX A;  2VGL M;  3LR5 A;  3EOI A;  4YOF A;  4BBT A;  4YNR A;  4HIA A;  5F68 A;  1D06 A;  4UQI S;  2QHK A;  4JGQ A;  5HDC A;  1NLY A;  1G28 A;  1ODV A;  2PYP A;  4JGO A;  5DKK A;  2VGL S;  4EET B;  1NLZ A;  2M7V A;  3ICY A;  5AVE A;  4LLO B;  3D72 A;  3B33 A;  5AVF A;  4NXF A;  3BY9 A;  4KUK A;  5KSH A;  4FSF A;  2PYR A;  1LT0 A;  4DJ2 A;  4WUJ A;  2P08 A;  3EQU A;  3OOV A;  4QPR A;  4Y3I A;  4ETZ A;  2HV1 A;  1TS0 A;  3GEC A;  3F1P A;  1OTB A;  3BWL A;  5KIZ A;  4L9E A;  4I3A A;  2GNX A;  4R6L A;  5TJJ A;  2JKT M;  1LL8 A;  1P0Z A;  3H7W A;  3LR0 A;  1STZ A;  4HNB A;  2Y79 A;  1ZHH B;  3LIC A;  2W3H A;  5HSQ A;  1VHM A;  3TJZ C;  4K08 A;  2FZ0 A;  5DJU A;  2GZA A;  4KQD A;  2L4R A;  4GLQ A;  2KX6 A;  3KYZ A;  4MCW A;  4BMW A;  2YKF A;  2EWV A;  4FOF A;  1H8M A;  4XT2 B;  1T1C A;  4CLC B;  3PXP A;  4CQH A;  4EQ1 A;  3CLO A;  2PR6 A;  4YWZ A;  1YAX A;  2J80 A;  3MQO A;  4HP4 A;  4HQA A;  4B93 A;  2P7J A;  4Y2F A;  1YSQ A;  3HJK A;  1S67 L;  3F1N A;  3IS2 B;  3S7N A;  2PT7 A;  1ZTU A;  5J7E A;  2A2L A;  2QJ5 A;  4I5S A;  1GSW A;  1N9N A;  3EEH A;  3EEA A;  1TD5 A;  3H9W A;  3G6O A;  4WEL A;  3T4Q A;  4G3K A;  4Q0I A;  3VE3 A;  2V0U A;  1OTA A;  3R4K A;  3PBN A;  2HJ9 C;  2PHY A;  3OLO A;  2QKP A;  3PBS A;  3UME A;  3U2A A;  1TS7 A;  2J3T D;  3MQQ A;  4PAU A;  5TBM A;  2EWW A;  3T4K A;  4IUH A;  1TS8 A;  3UB7 A;  2ZBB A;  4EER A;  2K2N A;  3F1P B;  2IA2 A;  3LFV A;  5IS1 A;  1JNU A;  2JKR M;  5LBR A;  2VJW A;  2EA9 A;  3D3O A;  4EEU A;  3JVU A;  1P9R A;  1LSX A;  4LRZ E;  3LR4 A;  3NOP C;  4WL9 A;  3UE6 A;  3HCY A;  1OJG A;  3PYP A;  1LSW A;  4L0L A;  2H28 A;  4NXG A;  1GSX A;  3UB8 A;  4O0P A;  1MKM A;  2W1R A;  4F3L A;  4HH2 A;  1XJ4 A;  5MC7 A;  4EXO A;  2VZW A;  3DBA A;  3VOL A;  1NRJ A;  1H3Q A;  1V9Z A;  3MMH A;  3BJN A;  3MQ0 A;  1DP6 A;  2KOI A;  2VX8 A;  2Z6D A;  3BW6 A;  2O9B A;  4Y5F A;  5L8M A;  4IJG A;  5IU1 A;  2Y8H A;  4OOM A;  5DKL A;  3JVV A;  3UMD A;  4NKP A;  1W63 M;  1EW0 A;  1D7E A;  1NWZ A;  1T1A A;  4R3A A;  4I39 A;  3LR3 A;  4CLC D;  5F69 A;  3LIE A;  4WLA A;  3VV4 A;  5C5K A;  3EWK A;  4GS9 B;  3OCL A;  1LSV A;  2I9V A;  1YKD A;  4I38 A;  2BAS A;  4ARZ B;  2HF6 A;  1T18 A;  5J4E A;  3T50 A;  2K7S A;  3LI9 A;  3LUQ A;  1P97 A;  1P9W A;  4LPZ A;  1TS6 A;  3EQV A;  3UB9 A;  2INW A;  2O0Y A;  3FC7 A;  3MJQ A;  4MN7 A;  5CX7 A;  4GHI B;  2B02 A;  3BQ8 A;  4PHT A;  2V1B A;  5DF9 A;  1F5M A;  2LB5 A;  3R7W A;  1S4S A;  4B9O A;  3CWF A;  3TE8 A;  3KSF A;  4KUO A;  3CAX A;  4R38 A;  3MR0 A;  4ME4 A;  3ZQ5 A;  2R78 A;  4BWI A;  5TBM B;  2QYB A;  2XSS A;  3RTY A;  5EFW A;  2ZMV A;  4WF0 A;  3IS2 A;  4WEK A;  5G4Z A;  3ULF A;  3LIA A;  4Q0H A;  2QWS A;  3F1O A;  3UE3 A;  3IBJ A;  4JGP A;  1IOU A;  1G6O A;  1UWP X;  4Z1W A;  4MN5 A;  1XJ6 A;  1BYW A;  2VV6 A;  3LI8 A;  4PKY A;  2CMN A;  3PHY A;  5HD5 A;  3HJI A;  5DFX A;  2OWJ A;  2HJE A;  1OTD A;  4Q0J A;  1GSV A;  2VLG A;  2DMW A;  4MDZ A;  1UWN X;  2VV8 A;  5HWW A;  1UGU A;  4R70 A;  4I3I A;  4F3L B;  4NXE A;  3PBQ A;  2A24 A;  4BBV A;  4IHQ A;  3A0V A;  2M7U A;  2XA7 M;  1S1Z A;  3MF0 A;  2PR5 A;  4MN6 A;  3B42 A;  1F9I A;  3LID A;  3KSI A;  3C30 A;  1T1B A;  4LRX C;  3FPV A;  5F5Y A;  2WKP A;  4H6J B;  3ZYT A;  4CLC E;  2W3E A;  3TRC A;  3W2Z A;  3NHQ A;  5FL3 A;  2W1T A;  4P6Z M;  2W27 A;  2V0W A;  3KSG A;  1N9L A;  1IFQ A;  3RFB A;  4M4X A;  1F98 A;  3O5Y A;  1DRM A;  2P04 A;  3A0S A;  2O99 A;  3OC2 A;  4UQI M;  3MXQ A;  1N9O A;  3F1O B;  4O8G A;  3E4P A;  5F6A A;  5HL6 A;  2PD7 A;  2ZOH A;  4E04 A;  2HGV A;  4HP9 A;  2JN7 A;  1MC0 A;  4HJ3 A;  1DP8 A;  1XJ2 A;  4HH3 A;  5HPI A;  4HJ6 A;  3K2N A;  3OCN A;  1VB6 A;  4JGR A;  1XJ3 A;  3C8C A;  3FPW A;  2O9A A;  4ZRR A;  4NEE D;  1X0O A;  2PDR A;  1OPX A;  3PBT A;  4GJ4 A;  3E0Y A;  4CLC C;  3C38 A;  2W3F A;  5HZH A;  1TF1 A;  4OOL A;  4DJ3 A;  5AJG A;  2YKH A;  3E4O A;  3LIF A;  2ZOI A;  3TW8 A;  3R7W B;  3S7P A;  4H6J A;  2W3G A;  2VA0 A;  2XA7 S;  1Y28 A;  3PBO A;  4II7 A;  3T4S A;  3H7W B;  1OTI A;  2W1T B;  3KSH A;  4GW9 A;  3KX0 X;  1V9Y A;  3P01 A;  2W3D A;  4IUK A;  5I5L A;  3H82 A;  4UEY A;  4PKY G;  1OT9 A;  1YSP A;  4GS9 A;  4LRY C;  2OAP 1;  3CUE C;  4EES A;  1MZU A;  3T4T A;  4P6Z S;  3E4Q A;  2M1C A;  3GDI A;  4MMN A;  2XRO A;  2O9C A;  4ARZ A;  4WN5 A;  4HY8 A;  2A24 B;  4EW7 A;  3CI6 A;  5HPF A;  3T4L A;  4KQO A;  2W0N A;  2WKQ A;  2QJ7 A;  3NJA A;  3FG8 A;  2FH5 A;  4DMZ A;  2Z6C A;  5DFY A;  2NUT C;  3P7N A;  1WA9 A;  5K5B A;  1T19 A;  3LIB A;  3MFX A;  3NOU C;  2K31 A;  2JKR I;  4I3J A;  3V67 A;  3K3D A;  3BY8 A;  4EEP A;  2D01 A;  4EU0 A;  3K3C A;  3VE4 A;  3PBR A;  3A0R A;  4L9F A;  2KLI A;  2V9A A;  1S4R A;  3IBR A;  4BJP A;  3H82 B;  2J3T C;  5HDS A;  4G3W A;  2JHE A;  3C2W A;  2V1A A;  2J3W A;  3EGX C;  2PD8 A;  4DN0 A;  2OWH A;  2LB9 A;  4GCZ A;  4XT2 A;  4L9G A;  2KDK A;  2NUP C;  2VKS A;  4BBU A;  3NOT C;  1S1Y A;  2G7U A;  2L0W A;  2OOL A;  3RH8 B;  1KOU A;  4HHD A;  1OTE A;  5A8B A;  2L1M A;  1OT6 A;  1XFQ A;  3OBF A;  2B18 A;  4G3V A;  4GHI A;  3E98 A;  1S66 L;  3B47 A;  2MJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...