The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
52
|
sequence length |
189
|
structure length |
184
|
Chain Sequence |
AASLVGKKIVFVTGNAKKLEEVVQILGDKFPCTLVAQKIDLPEYQGEPDEISIQKCQEAVRQVQGPVLVEDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQLLAGFEDKSAYALCTFALSTPVRLFRGRTSGRIVAPRGCQDFGWDPCFQPDGYEQTYAEMPKAEKNAVSHRFRALLELQEYFG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Hydrolase
|
molecule keywords |
INOSINE TRIPHOSPHATE PYROPHOSPHATASE
|
publication title |
Crystal Structure of Human Inosine Triphosphatase: Substrate Binding and Implication of the Inosine Triphosphatase Deficiency Mutation P32T.
pubmed doi rcsb |
source organism |
Homo sapiens
|
total genus |
52
|
structure length |
184
|
sequence length |
189
|
chains with identical sequence |
B, C, D, E, F, G, H
|
ec nomenclature |
ec
3.6.1.9: Nucleotide diphosphatase. |
pdb deposition date | 2006-08-29 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01725 | Ham1p_like | Ham1 family |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Complex | Maf protein | Maf protein |
#chains in the Genus database with same CATH superfamily 2DVP A; 2P5X A; 4F95 A; 1VP2 A; 4JHC A; 2DVO A; 2PYU A; 2CAR A; 1EXC A; 2DVN A; 1U14 A; 4OO0 A; 3S86 A; 4HEB A; 2E5X A; 4P0E A; 2MJP A; 2AMH A; 1ZNO A; 1K7K A; 2ZTI A; 4LU1 A; 1B78 A; 2I5D A; 4P0U A; 1ZWY A; 2Q16 A; 3TQU A; 1U5W A; 4BNQ A; 2J4E A; 1V7R A; 1EX2 A; #chains in the Genus database with same CATH topology 2DVP A; 2P5X A; 4F95 A; 4UUX A; 1VP2 A; 4JHC A; 2DVO A; 2PYU A; 2CAR A; 1EXC A; 2A9S A; 4CTA A; 2DVN A; 1U14 A; 4OO0 A; 3S86 A; 4HEB A; 2E5X A; 4P0E A; 2MJP A; 2AMH A; 1ZNO A; 1K7K A; 2ZTI A; 4CT8 A; 4LU1 A; 1B78 A; 2I5D A; 4P0U A; 4UOC A; 4UUW A; 1ZWY A; 2Q16 A; 3TQU A; 1U5W A; 4BNQ A; 5KOL A; 4CT9 A; 2J4E A; 4CTA B; 5KVK A; 1V7R A; 1EX2 A; #chains in the Genus database with same CATH homology 2DVP A; 2P5X A; 4F95 A; 1VP2 A; 4JHC A; 2DVO A; 2PYU A; 2CAR A; 1EXC A; 2DVN A; 1U14 A; 4OO0 A; 3S86 A; 4HEB A; 2E5X A; 4P0E A; 2MJP A; 2AMH A; 1ZNO A; 1K7K A; 2ZTI A; 4LU1 A; 1B78 A; 2I5D A; 4P0U A; 1ZWY A; 2Q16 A; 3TQU A; 1U5W A; 4BNQ A; 2J4E A; 1V7R A; 1EX2 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...