2J53A

Solution structure of gb1 domain protein g and low and high pressure.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
56
structure length
56
Chain Sequence
MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDAATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pressure-Induced Changes in the Solution Structure of the Gb1 Domain of Protein G.
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Immunoglobulin
molecule keywords IMMUNOGLOBULIN G-BINDING PROTEIN G
total genus 14
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2006-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2j53A00
2I2YA 1HZ6A 1UWXA 1XF5L 2N7JA 5JXVA 4HJGE 2PW9A 4GLSC 1K53A 2OEDA 2ZW0A 1PGAA 1EM7A 1IGDA 2ON8A 3MP9A 1P7EA 1YMHE 1QKZA 2LHDA 1MVKA 1GB1A 1IGCA 5BMHA 1P7FA 2KACA 1FCCC 2J52A 2LUMA 2JWUA 2NMQA 1GB4A 5HI1A 2JXTA 2KWDA 1F2RC 2J53A 4OZBA 2KDMA 1MHXA 2N9LA 4KGSA 5HHDG 1F2RI 1PGXA 5HFYA 2ONQA 3FILA 2IGHA 1FCLA 1C9FA 1HEZE 2JSVX 4KGTA 4MACA 1K50A 2PTLA 3GB1A 1HZ5A 5BMIA 2KQ4X 3UI3A 3V3XA 4OZAA 1YNTE 1XCTL 4WH4A 2JZPA 1XCQL 2IGGA 2I38A 4IKGA 4D2KA 2QSDA 2IGDA 1KH0A 1K51A 1D4BA 2RMMA 1IBXB 2QMTA 2LHEA 1MHHE 2RPVA 1Q10A 4HKZE 1PGBA 2K0PA 5BMGA 4IOIE 1MI0A 2EELA 2JU6X 2PLPA 3FILB 1JMLA 1ZXHA 2GB1A 4OZCA 1FD6A 1IBXA 2KN4A 2ZW1A 5HG2A 2LGIA 4KGRA 2N9KA 1K52A 1MPEA 2GI9A
chains in the Genus database with same CATH superfamily
2AEHA 3CMMB 2I2YA 2QILA 1R4MB 3HIZA 1EUVB 5JH5C 2W82A 1WSPA 2IBIB 4KKIA 1WM2A 2OJWA 2PEAA 3IFWB 4LJOB 4LNFA 2BYFA 2PIAA 3KLSX 4DWFA 3A4SC 1N60A 4EE2A 2FIFA 2KDIA 3TL5A 5C3JB 2R2QA 1QOAA 4HCNB 3DBRI 1UWMA 5TR5A 3QQ8B 4OVUA 1I4PA 1ZXIA 1YJJA 3BYYB 4YL8A 3VHTC 2XN9C 2EKIA 2KWDA 3TEYA 1NYRA 2JRHA 2NPTA 3Q2AC 1MHXA 3ZXRA 1B9RA 1YQBA 4PK1A 2KFJA 2HE7A 2W54A 4US8A 2KN5A 2JPHA 2CHXA 3FILA 2KX3A 1FRRA 1FEHA 1PQSA 2KANA 1WRDB 2M8SA 4US9A 1E90A 1HXYD 3R7RA 5LNK1 2ZCCA 4IKGA 3RPFC 1UF0A 2BYEA 2SEBD 3AMZA 4WWNA 2QHOA 2MLBA 1TS5A 2KYWA 3M62B 2JVCA 2FE8A 4J6IA 3ZNID 3ZTDA 2MSED 2NS5A 4C4VB 4RNAA 3UQAA 3NJTA 2BGFA 4NNJB 4WQOB 5LXIB 2PLPA 1QOFA 2M0AA 3DVGY 4JPSA 3OAWA 1ZXHA 4XZ4A 2GBRA 3NVZA 3UIOB 1Z5SB 2Z0DB 3ZTCA 1NEKB 1YN3A 2JWZA 1P98A 4M02A 4AUQC 4DHJD 4BZAA 4N6EB 1E8XA 4NJCA 1GPXA 4BFRA 4IG7B 2Y5CA 3VR9B 3TEXA 1L0YB 4WJQA 3IG3A 2PVOD 3ETRA 2LXAA 1XLPA 2MJDA 2AX5A 2IYDB 3DHHC 4HRSA 1XD3B 3RT3B 1ZGUB 3EFCA 1ESFA 2BS3B 2LZ6A 2IY0B 3DVNV 3ECIA 1R7SA 3DHIC 3Q3JA 1JW9D 4XE0A 4DBGA 2KFKB 1QOBA 1C3TA 4B9KA 5AZFA 1V49A 2W9NA 4HWIB 3TJPA 5G2NA 1TT5B 4MGYE 1BMLC 1QLBB 3C8YA 4OZBA 2LMCA 2WX1A 3VUWA 1U4AA 4A3PA 3RNFC 1SE9A 3IXSA 3T3NA 4RF0A 1L7YA 5DPSA 3E56A 2KQSA 1KLUD 4I6PA 5CHVC 4REZA 4M0WB 2BT6A 2V3SA 2KQ4X 3BK2A 3PT2B 1OQRA 2KMAA 3TEZA 1XCTL 2MRPA 2VZKB 3WANA 1J19A 3N32A 4HK2A 2WXLA 1NI2A 4AQ7A 3NVVA 4FHJA 2JYTA 1TS3A 4MGZE 1R4NI 1V80A 2GOWA 2RDGA 1AYFA 1K8RB 3PLVA 1ISNA 2BPSA 1J7BA 3VTUA 3Q3NC 3ABVB 2RDBC 1IBXA 2KN4A 3GZNI 4KGRA 3T8MA 1OEYA 1V1PA 2LWPA 1WXQA 1GC6A 2N7JA 1VR9A 3ZNZB 1NVID 4B95A 1CQVA 2K9XA 4PS3A 2WDRB 3DBHB 4UDUC 2PMVA 2DENB 2KTFA 1I4QA 2D11A 2K25A 1UGMA 1N6ZA 1VZ7A 1N5WA 1GB1A 4CYEA 2K8BA 2MEKA 1FCCC 4BVUC 3PLUA 1ZW7A 3RNCC 4E71A 2JF5A 4W9JA 3SDLC 1V1OA 2LEKA 3U2SC 2KHWB 4K7WA 2MBBB 1GOZA 3NRZA 1Z2MA 3TSSA 4KIKB 4K3CA 2WP9B 3VTWA 1C9FA 1SSNA 5TSSA 5J2RA 2WDTB 3PV1A 3MTNB 1FMAD 4NJ6A 4TMAB 5G55A 3AE9B 1HZ5A 3Q69A 4RM8A 2K1FA 2DZKA 3VFKA 2LRUA 3V05A 3OWEB 2YEPF 3E9SA 1AW7A 3SFEB 3AEFB 1C77A 1JWAD 1WIAA 2CKHB 3V6CB 5BYRA 5L95C 1RFAA 2JZ3B 1F9JA 1PGBA 1D5XC 3RNEC 4FULA 1N63A 2JU6X 2Y5BB 1S3SG 2XK5B 4ARIA 1HQRD 4ZHPA 2KX0A 1K52A 4AJYB 1KRHA 2N7DA 2LGYA 2YVCA 3BVZA 2NBUA 2E6XA 4ASWC 4KKJA 2O2VA 2DYOA 2CJOA 3DPDA 1K53A 1PFDA 4C56C 4BAXA 4JIOU 1P7EA 5I4DA 4MSMB 2INDC 3W2DA 2MQJA 1YMHE 3ZGZA 3FAHA 4PS7A 1QOGA 3PHXB 2CS4A 3AU5A 2FUHB 3MHZA 2KACA 4OVZA 1Q1OA 3HRDD 2WXFA 4YSZB 1CK1A 1F2RC 2JUOA 2K5PA 2KZRA 2H89B 3NS8A 1WI0A 4HPLB 3ML8A 1UBQA 2XBBC 3B9JA 3Q14C 1WFYA 2IO3B 3CSTA 1UZXB 5G5HA 1WR6E 5EE1A 4KDLB 4LNNA 1JQ4A 4G50A 4WURA 1LM8B 4GDKB 1L6UA 3V60A 2L7RA 4C00A 1UUPA 4WJNA 4IM2A 1ZDXA 2M19A 4HXDA 2KDFB 1JCKB 4LCDE 5AZHA 1X1MA 1OQQA 1DOXA 4M8NA 3PTFC 2BW2A 2QMTA 2RPVA 3DWGC 2WXHA 1RFKA 1YJ1A 1LO5D 5JHAA 4ANWA 5GMVA 5H8YE 1E7VA 2CHWA 3RZFA 3NG0A 1QF6A 5CHWA 1RWSA 3TCAA 3RFZB 4AS1A 2J0KA 1UH6A 2Q5WD 1V2YA 3BVMA 3A9JB 3A33B 2PW9A 4EZLA 2V4IB 3P4QB 1P3QU 3QIJA 3NZSA 5D7GA 4JX1C 2KTRB 4RGMA 3MP9A 2W3RA 3O13A 2GMIC 1FNVA 2GBMA 2N4FA 1KJTA 3W5VB 1TY0A 2M1MA 4LJPB 3HVDA 2DLBA 2G3QB 2L8JA 4MH0E 2K39A 3W1SC 1M94A 4TKNA 3IT6B 3ZYYX 4IWPA 4A6QA 2G1EA 2N9LA 3WA0A 1L5PA 3IAS1 5FKAC 1C76A 2JT4B 3N20C 3IVFA 2BS4B 1VCBA 2QC8A 1WJ6A 4EEWA 2WLBA 2B3AA 2KT7A 2KVZA 3VRAB 1F52A 4MJSA 3TUOA 4ICVA 3A9JA 2VH1A 3GB1A 3ZXVA 4HDOA 2VH2A 3EA6A 4EKUA 3TBLD 2IGGA 4KDIC 1UNSA 2O6VD 5IN7A 3L4PA 1GAQB 3ZJUA 4ZRIA 3PREA 1FFVA 2MH7A 3HUIA 2WYQA 2NBVB 3VVWB 1E0ZA 4MM3B 1SIFA 3ZDTA 3L17A 4IOIE 1E5WA 3VH4B 2YEPB 4HEA1 3W1YA 3ZVVA 2GB1A 4DXAB 4FLHA 3AB5A 3GE8C 2O6VB 3AEDB 2N9KA 1TY2A 4W9GA 1IPGA 3EECA 2BS2B 4X57B 4K3BA 4FXCA 1L4DB 3N9YC 4IM0A 1LXDA 3AE7B 1QQRA 2ICIA 5JXVA 4GLSC 4ZHOA 2KK8A 4GB9A 1TYGB 1M4VA 2C7HA 2WX0A 4JLCA 1WXVA 1FXTB 4KSKC 4BBNF 2V9HA 1MVKA 1WJUA 1PYWD 3Q8BA 1XO3A 2J52A 4MJSB 4RFBA 3PHWB 3APFA 2DBYA 2KDMA 5D94A 3Q6BA 4S0RA 2NVUI 2WNMA 3IBEA 3L13A 1SGHA 2LVOA 1H4RA 3P1MA 5DPTA 2C7MB 2N9EB 2KMCA 2HJ8A 4PS8A 1FCLA 4GOCA 3P2BA 4P1BC 3A4RA 4MT5A 2QJLA 4II3B 1E8WA 1OEYJ 3ZLZA 4H2AA 3QARA 2D10A 2LFIA 3WAPA 3BIID 4F7ZA 4WH4A 4B6WA 1H8CA 1DGJA 3S2AA 3RYTA 5L83A 2FCNA 2N7EA 2INPE 3RI7C 2LGSA 4EFOA 3ZIMA 4DQOC 2DZJA 1J0GA 3MJ5A 2DZMA 1YX5B 1STEA 4ZDVA 4R3DA 1YX6B 2UYZB 4JWUC 1XT9B 5HG2A 3HHMA 2K6DB 4FJYA 4WWPA 3K9OB 3U7ZA 3P4SB 5DPWA 4M00A 2CJNA 1S1QB 1SE4A 2D2QA 2G4SA 2HTHA 1OFFA 4HJGE 3HM6X 5J17A 2AL3A 5D3DA 2WXKA 1T0SC 3H7SA 3VUXA 2Y5PA 1EM7A 1ENFA 2INNE 2DHZA 2K22A 2KQ7A 3BZDB 2PE6B 3NUHB 3RMKC 2IDYA 2J0MA 5JZEB 4M8MA 2KJHB 2D3GA 2LHDA 3L16A 3LYYA 5BMHA 1FXIA 3UINB 2QDFA 4JWSC 3KYDD 2V1YA 1SF0A 4KZ0A 3AXCA 4EZKA 2BB6A 1WM3A 1D3ZA 1KOTA 1G6JA 1I4RA 4ZRPA 1QZEA 2JQRB 3BVGA 4C7ZA 4BOZB 3QAQA 4KZCA 4HPMB 3T9LA 2UWQA 3N1XC 1V9JA 1NI3A 4USAA 2BWFA 3OG5A 3NZ3A 3V3XA 1WGYA 4IUMB 2L0FA 5EE0A 4RMAA 2PPHA 4K81A 2R61A 1GG3A 3UQBA 3C19A 2YLMA 5EE3A 4OHJA 1L0VB 2NBWB 1WXMA 3EFUA 4NAWA 3GP7A 2I1JA 2K0PA 1TZ1A 2LRWA 2ZPYA 3QHTA 1UGJA 3N1YC 1I4GA 4OZCA 2L83A 4P7IA 1AARA 4W9LA 2MCNB 3BK1A 4N58A 1JWUD 2KTRA 3VXWA 4W9CA 1XLQA 3EUB2 4ZOHC 1WRIA 4WWMA 4E3CA 2TSSA 3V62A 2N1WA 2OEDA 2ZW0A 1TJEA 1KLGD 4F8CB 1L4ZB 1JROA 3APDA 2IPKD 1WX8A 1WGRA 2JXXA 1VJKA 3B2GA 3IHPC 4WIPA 4A90A 2BB5A 1IGCA 2IY1B 3PRMB 4RGNA 1KLVA 3CIRB 1FNWA 1SJHD 2JXTA 4P16A 4G11A 4CO7A 5MPOA 4DHZE 4KGSA 4YTNB 3WAMA 2DNFA 1N5XA 1VRAB 3AEEB 1D5MC 3SHQA 3ZDMC 4EZJA 3LXFA 1KF6B 1R4MI 3BINA 4NZLB 2WHIA 2KLCA 3MC0B 3RNAC 2CR5A 2JSVX 4NY0A 1I4HA 3PZDA 4MACA 2MBEA 2ZVOA 2WWZA 3V6EB 5AZGA 4K1RB 5KHOA 2JRIB 1BUIC 3B1LX 2I38A 4D2KA 1UBIA 3ZJTA 4TV3A 2D3BA 5C23A 1ZE3D 3UF8A 1KM7A 1TIFA 3ZRCA 1V81A 3SU8X 1P9DU 3BYTB 2MJEA 4OVVA 3FKYA 2KO3A 4N59A 2LGXA 3RCZA 2KVRA 2ACZB 4YXDB 3W1SA 4KX6B 2H88B 3URYA 2KWVB 3BWUD 2MJ3A 1FD6A 3QK0A 3TEWA 1EU3A 1L0XB 3R2TA 3AULA 2WXRA 3I9V1 3OLMD 2FIDA 3ENEA 2MWSB 2WXOA 2KJRA 2Z59B 2BTEA 2B76B 2INCC 1V97A 2LI5A 1SB3C 1WE7A 1IYFA 5E6NA 4MH8A 4C7YA 3ONSA 4CHKA 1E8ZA 3JSVB 4O1NA 3R8BA 4W9HA 3VH3B 4WJOA 1T0RC 5HI1A 4ZRQA 3QC8B 2JX5A 3B2FA 4L2YA 1BXTA 4W9IA 3OJ4B 1BT0A 1IP9A 2WXGA 1WE6A 2WXNA 5HFYA 2NTTA 3AE6B 4N9F4 5KHQA 5CX3A 1WGKA 2IO1B 3NVYA 2Z0EB 3MC8A 1TGZB 4TQ1A 4PYUA 1F1HA 4CQNA 2KJ6A 1C1YB 3TIXA 1OTRB 4W9FA 1A5RA 2JZZA 1WXAA 4BOSC 4DXGA 2FCMA 4HVBA 4ANVA 1ZP0B 4ARCA 1TTNA 2L3ZA 1HA5A 2FCSA 2DAJA 2X38A 1AN8A 2GBNA 3HVZA 1RAXA 4P6VF 4NQKE 2K8CA 4KIKA 3I5JC 3RUIB 4KSLC 4LLGM 3AE2B 5DCNA 1LGRA 1WX9A 1VZ6A 3ZNHB 1RYJA 4ANXA 3QX1A 3I3TB 2G4DB 2LGDA 4C80A 3WALA 5BYQA 4F1SA 3NY5A 3PS6A 1QKZA 1PDXA 1YQ3B 2KMMA 2R2OA 1WJ4A 2DYMA 1WR1A 2BYTA 2NMQA 1GB4A 1J7AA 2ZEQA 3N1ZC 4WJPA 5IKCM 1B1ZA 2KD0A 2XK5A 1DOYA 1F2RI 4WAFA 1VDVA 2M4NA 3R7QA 4FN2A 4YT0B 4TSSA 3U52E 2HTME 2L52A 4GDLB 1TS4A 3ZO5B 2BYVE 3RNBC 4K7SA 1WYWB 1K50A 1V5OA 2N1VA 2PTLA 4MELA 2O2VB 1SIJA 2PKOA 2KOXA 3PRZA 2VRRB 2PVGC 4OZAA 2V4LA 1Y8RC 1EF5A 1JWMD 1XCQL 2ZJDA 3AU4A 2V0GA 1D5ZC 3LJ3A 3LDZE 1E8YA 2ASQA 2AQ3B 1EO6A 2DX5B 2BWES 2RD0A 5IP4D 4MGKE 3U8ZA 1C79A 4PT5A 2BVCA 2IO0B 4ACFA 4WWOA 1T6BX 5LLIA 3DBSA 2MBOA 1JWSD 3AM9A 4ZYNA 3KH0A 1GNUA 3KUZA 2NTSA 3Q3OC 2ZCBA 3KYCD 3FC4A 3NS1A 3KUDB 1J8CA 1E7UA 3AV8A 4MDKE 4MEMA 1FPYA 3QWZB 1PGAA 1ET9A 2RR9A 3TMPB 4GXBA 3DBLI 3VUYA 2EMSA 5LXHA 2MA9B 2ZNVC 1YIWA 4XDDA 2E3TA 3NHEB 5DPRA 3O65B 2N0SB 4YSXB 4XC2A 3DVNU 4BBNC 3AEBB 1FFUA 2MP2A 3H7PA 3KQ4A 2W55A 3AI5A 4DHJB 5IA7A 3Q3FA 3PGEA 1YN4A 2D07B 2PE9A 4RGOS 1HEZE 1KTKA 1ZKHA 4I6NB 2VZKD 4AOFA 3JYUA 3U30A 3UI3A 1LFDA 4W9EA 1Y56A 5H92C 3AH7A 4E74A 4L23A 1NYQA 2KC1A 3A9KA 2J4XA 2FUG1 1RM6C 4HCPB 1MFWA 2D3CA 3VRBB 2BBCA 3GE3C 2XEWA 4LNIA 1AWDA 3PPAA 1FRDA 2RMMA 3SEBA 3Q8CA 4P1CC 1IBXB 4DXFA 2L32A 3NOBA 2M17A 4AWJA 2RGFA 5J18A 4Q2JA 4HROA 1CJEA 2WU5B 3R66C 4B0EA 4RGTA 1CZPA 1F77A 2EMTA 4JGHB 4M01A 5EDSA 1MPEA 2L00B 4LNKA 4NJ7A 4A8XC 1Q0WB 2JY6A 1C78A 3BY4B 1GUAB 3VDZA 1HZ6A 1XLOA 1UWXA 3ML9A 2WS3B 4IDIA 3ZUNA 1I35A 2WDVB 4M0WA 3PRPB 1V5TA 1I42A 4S17A 1E9MA 3HM3A 4NQLB 3U4EG 3H7PB 4A55A 3DDCB 3HK0A 2LVPA 3UIPB 4HLEA 4MGIE 3SFDB 2UU7A 1ZPSA 5FK9C 1OQYA 4XWWA 1HTQA 2OHFA 2LUMA 3I57A 4WAAA 3SD5A 1FO4A 4ANUA 2J53A 2L1AA 1ZDVA 3P4PB 5G5GA 2O6VA 3EGRA 1WX7A 3WIMA 4RCOA 2WDQB 2ONQA 1EWYC 2LASA 5AUKA 2CU3A 2AWTA 3ALBA 2K8HA 4HDQA 4NAMA 4IWOA 4RF1A 5IAAC 1T5XD 4W9KA 2WU2B 4YWGG 1WXSA 1YD8U 1VLBA 2KNBA 2AL6A 5AUIA 3P63A 1K51A 3T3OA 5BYSA 1WJNA 3JSVA 2MP2B 3QCAA 4A3OA 1WGGA 3L08A 4JL9A 1JMLA 3RULA 3N30A 4WQMA 2L0TA 2HD5B 2MBQA 2A4ZA 2C60A 3DVGX 1YQ4B 2N9PC 3WAOA 3AE1B 4PYZA 4IM3A 1JRPA 4MSQB 1C4CA 3B0AA 3W5UB 3A1QB 2MW5A 1LQBA 1IGDA 1E6EB 1V6EA 5E6PA 1HE8A 4XX5A 4LK0M 2MHJA 1HTOA 1L2NA 2BF8B 5FR6A 2NPTB 3Q3MC 3Q8EA 2V3NA 1NDDA 1WZ3A 1TKEA 4QAYA 2L76A 3V61A 3AN1A 3WCQA 4HJKA 4KVGB 1N61A 1ZUD2 3VR8B 2C7NB 2LJIA 3ZRFA 2QCZA 3LB8C 4GN1A 3KVFB 5HHDG 4G3XB 4FHKA 5D6JB 4BKGA 4GDKA 4XDCA 5C2TB 1NENB 3CF6E 4GIVA 5CHFA 1FM0D 1XQQA 2PJHA 2J7QB 4TQ0A 3R2IA 4FA6A 2CU1A 4FBJB 1D6EC 3EHVA 1C4AA 1YN5A 2ZNVB 3U7DA 2J0JA 2KFKA 2JZPA 2XNAC 2QSDA 1QT9A 2IGDA 3X23A 4YSYB 2CHZA 2M56B 2GLSA 1UELA 1ACCA 3J9CA 4RM9A 1MG8A 1V1PB 4HKZE 4HPPA 2KKCA 1SE3A 1MJDA 1SE2A 3K9PB 3MFGA 4GGQA 4W9DA 2EELA 1ZOYB 1NBFC 2K3UA 2KXJA 1RRBA 3L0WB 3GZNB 2ZW1A 4IWQA 2KLGA 3RNGC 3H1UA 1I4XA 4JE3B 2LD9A 4DK5A 2WXIA 1WY8A 4XYCA 1JRUA 3QJZA 3KWVA 4YTPB 3AE4B 1XXGA 3VAWA 4XWTA 1ET6A 4TUUA 1CMXB 3PZ8A 2MX2A 4GSWA 3CSFA 2DAFA 4HKQA 4NPNA 1TKYA 4AP4C 2WXMA 1SJED 1WF9A 3P42A 4BKTA 3L54A 3M3JA 5JHBA 2AQ1B 2L05A 2J42A 4L1BA 1FNUA 2WXQA 1GJZA 3H6NA 3QA8A 3KWLA 3ZKJC 1JWBD 1YJIA 1C4PA 2AYOB 4LDTD 1GC7A 1V86A 3CWIA 3M63B 3DCGA 3L10B 4BKSD 1TZOA 2V3PA 2IGHA 3IAM1 3AE5B 3GOEA 4KGTA 1PUTA 3Q8FA 5BMIA 2ZVNA 4ZRJA 3DOWA 4FJZA 1Q5WB 4IW0A 4DDGD 2GBKA 3ZNGC 5D3IB 1R4NB 2WGSA 2K6QA 1TS2A 4EOYA 3H9DA 2DWQA 1A70A 2RSUA 1E7PB 5AEKB 1MHHE 2M0XA 3UGBB 1Q10A 4KV2A 2KWCA 5BMGA 1RLFA 1MI0A 2Z8LA 3NVWA 3MC9A 2G9HD 3PO0A 4AJWA 4GDLA 4NAWB 2BKRB 2SAKA 4GU2A 2LGIA 5E6OA 2ZZPB 5BO4B 5FR3A 3AECB 3JW0X 5IOIA 1JALA 4GMVA 3AE8B 3APCA 4I6LB 2IJ0A 1XLNA 3M95A 2RDHA 2DZIA 2ON8A 3ZW3A 2N9XA 1P1AA 2KAJA 4ICUA 1WWTA 2FBWB 5D2MB 2A5UA 1P7FA 5CTRC 3B08A 3AEGB 3PVLA 4OW0A 4MM3A 3VTVA 3PSEB 4LTUA 2GRIA 2MBHA 3ZQ4A 2GBJA 4URKA 2G45B 3W9CB 1WGDA 2C5LC 4DDID 3R3MA 1YOVB 1PGXA 4LNOA 3DQVA 4G0NB 4ZRKA 3Q8AA 4LDTB 3VQIA 2X8XX 1WMHA 2BKFA 2FAZA 2HJ1A 4C4VA 3DBRB 1OGWA 3IT4B 3C0RB 1J7CA 1TKGA 1T0QC 2IO2B 3DBLB 3AE3B 3RD2A 2RPQA 1WZ0A 3AEAB 3RN9C 4JQWC 1KH0A 1D4BA 3DHGC 3KW5B 2LHEA 1EWCA 4BKSA 1T3QA 4XGAB 1DYQA 2DYBA 4IC7B 1I7HA 3FILB 3OJ3A 2Y3AA 4A9AA 3MHSD 1KFYB 3EC8A 3ZJVA 2D5GA 3A1QA 1EF1A 2ZPNA 3NZUA 1TBEA 5EE9A 1XF5L 3KUCB 1MG4A 1SXTA 2IZVB 1IUEA 5GXGB 3MJWA 3N3KB 3DBHI 3JVZX 1FXAA 4DHZB 2REXA 3A9KB 1DOIA 2KC2A 3GS2A 1FIQA 4B0MA 2KWUB 4EUTA 1WMHB 2JWUA 2KDBA 4II2B 2FCQA 2I1KA 2OJRA 1T0YA 2JYEA 1SEBD 2QEJC 2AQ2B 5C1ZA 2WXJA 5E6JA 1V8CA 2KDEB 2LUEA 2C9WB 1VZ8A 4J3OD 1P0RA 2BQQA 1WH3A 1YNTE 4K7UA 2HDEA 3H8HA 2LJ5A 1VD2A 3DWMA 4ZYSA 1XEEA 4RH6A 1EU4A 3P4RB 2EKEC 4FADA 1WYGA 1N62A 3I63C 2LXCA 1QILA 5HKHA 2D3AA 3SR6A 4FJVB 2W3SA 1ROEA 1SBBB 1E10A 4YTMB 4ITKA 5T8IA 2NR2A 2FNJB 3PZ7A 2WQYB 2NCNA 2WXPA 2QIEB 3RZWC 1F0ZA 2LVQA 2OOBB 1L6VA 1UD7A 1WGHA 4A20A 3D32A 5IO9A 3X0WA 2GI9A
chains in the Genus database with same CATH topology
1RWSA 2I2YA 1YQ4B 2QILA 3RFZB 4AS1A 3I9V1 2Q5WD 3BVMA 2W82A 1WSPA 3AE1B 4KKIA 1JRPA 2PW9A 1C4CA 2WXOA 2V4IB 3W5UB 3P4QB 5D7GA 2PIAA 4JX1C 3KLSX 4RGMA 2B76B 2BTEA 1IGDA 1V97A 1E6EB 3MP9A 2W3RA 1SB3C 3O13A 1FNVA 4LK0M 3W5VB 4MH8A 4C7YA 1N60A 1TY0A 4EE2A 5C3JB 1QOAA 3HVDA 1UWMA 2DLBA 3Q8EA 2V3NA 4O1NA 3R8BA 1TKEA 1I4PA 1ZXIA 1YJJA 3AN1A 3WCQA 3BYYB 3IT6B 3ZYYX 1N61A 1ZUD2 5HI1A 3VR8B 2XN9C 4ZRQA 2EKIA 2KWDA 3TEYA 2LJIA 4A6QA 1NYRA 3LB8C 2JX5A 3B2FA 2G1EA 1MHXA 4L2YA 1B9RA 1BXTA 2N9LA 5HHDG 2W54A 4US8A 4XDCA 1L5PA 5C2TB 1NENB 2WXGA 3IAS1 5FKAC 1C76A 2WXNA 1FM0D 5HFYA 2BS4B 2NTTA 3AE6B 3FILA 1FRRA 1FEHA 4TQ0A 3R2IA 2WLBA 4US9A 3VRAB 3TUOA 1D6EC 1WGKA 3GB1A 1HXYD 3NVYA 4TQ1A 1C4AA 1YN5A 5LNK1 3EA6A 2JZPA 2IGGA 2XNAC 1UNSA 4IKGA 2QSDA 1GAQB 3L4PA 3RPFC 3ZJUA 1QT9A 2IGDA 4CQNA 4YSYB 1FFVA 2SEBD 3AMZA 2M56B 2MH7A 1TS5A 3HUIA 1ACCA 3J9CA 1V1PB 2FE8A 1E0ZA 4MM3B 4HKZE 1SE3A 4IOIE 4RNAA 1SE2A 4DXGA 2YEPB 4HEA1 3MFGA 2K3UA 1ZOYB 2EELA 2PLPA 1ZP0B 1QOFA 2M0AA 4ARCA 4JPSA 1ZXHA 3NVZA 2GB1A 1HA5A 2X38A 3AB5A 1NEKB 2ZW1A 1AN8A 1YN3A 3HVZA 4P6VF 3AEDB 2N9KA 1TY2A 4N6EB 1GPXA 1I4XA 4JE3B 4NJCA 2BS2B 2WXIA 2Y5CA 4FXCA 4LLGM 1L0YB 1L4DB 3TEXA 3AE2B 3VR9B 3N9YC 2PVOD 3AE7B 1QQRA 3ETRA 2ICIA 1VZ6A 5JXVA 3KWVA 4YTPB 3AE4B 1XLPA 1RYJA 1XXGA 2MJDA 2AX5A 4GLSC 4ZHOA 4XWTA 1ET6A 4HRSA 4C80A 3PZ8A 1TYGB 5BYQA 1M4VA 1ESFA 2BS3B 4HKQA 1TKYA 2WXMA 1SJED 3P42A 1R7SA 4XE0A 1JW9D 1QKZA 1PDXA 1YQ3B 1MVKA 1QOBA 1PYWD 2KMMA 2AQ1B 2DYMA 3Q8BA 2J42A 1XO3A 4L1BA 2BYTA 1FNUA 2J52A 2NMQA 2WXQA 4RFBA 1GB4A 1BMLC 1QLBB 1J7AA 3C8YA 3KWLA 2LMCA 4OZBA 2DBYA 2KDMA 1B1ZA 1JWBD 1YJIA 1C4PA 2WNMA 3CWIA 1DOYA 1F2RI 4WAFA 1VDVA 3IXSA 3T3NA 3P1MA 4RF0A 4YT0B 1TZOA 4TSSA 3U52E 2HTME 2L52A 4GDLB 2V3PA 1TS4A 2IGHA 3E56A 3IAM1 1FCLA 1KLUD 4MT5A 4REZA 3AE5B 4KGTA 2QJLA 1PUTA 1K50A 3Q8FA 4H2AA 2BT6A 2PTLA 5BMIA 2KQ4X 1SIJA 2PKOA 3BK2A 2LFIA 1OQRA 2PVGC 4OZAA 3TEZA 3BIID 1XCTL 4WH4A 1JWMD 1XCQL 2V0GA 5D3IB 2VZKB 1TS2A 1D5ZC 1DGJA 2WXLA 4AQ7A 3NVVA 2DWQA 1A70A 2INPE 1E7PB 2JYTA 2AQ3B 1MHHE 1TS3A 1Q10A 4DQOC 2RDGA 5BMGA 3MJ5A 1MI0A 1AYFA 2Z8LA 1C79A 4PT5A 3NVWA 1STEA 1T6BX 2G9HD 3PO0A 4R3DA 1J7BA 4NAWB 3ABVB 1JWSD 3AM9A 1IBXA 4JWUC 2SAKA 2KN4A 5HG2A 2LGIA 4KGRA 3U7ZA 2NTSA 3P4SB 2CJNA 1V1PA 5FR3A 1SE4A 1WXQA 3AECB 1JALA 3FC4A 3AE8B 2N7JA 3NS1A 1OFFA 1VR9A 4HJGE 5D3DA 2WXKA 2IJ0A 1NVID 1XLNA 3AV8A 2RDHA 1CQVA 2Y5PA 1PGAA 2K9XA 1EM7A 2WDRB 1ENFA 1ET9A 2ON8A 4UDUC 2PMVA 2INNE 2K22A 1I4QA 3BZDB 3NUHB 2KAJA 2IDYA 1VZ7A 1N5WA 1WWTA 4XDDA 2E3TA 2FBWB 2LHDA 1GB1A 2N0SB 4YSXB 3LYYA 5BMHA 1P7FA 1FXIA 3AEGB 4OW0A 2MEKA 4LTUA 1FCCC 2GRIA 3ZQ4A 4JWSC 3W9CB 1SF0A 2BB6A 3AEBB 1FFUA 1V1OA 2LEKA 3U2SC 3KQ4A 2W55A 1I4RA 4ZRPA 2JQRB 1PGXA 3BVGA 1GOZA 3NRZA 4C7ZA 3TSSA 1YN4A 2WP9B 1C9FA 4RGOS 1SSNA 1HEZE 1KTKA 3Q8AA 5TSSA 3VQIA 1NI3A 4USAA 1FMAD 4TMAB 2VZKD 3AE9B 1HZ5A 3Q69A 3UI3A 3NZ3A 3V3XA 1Y56A 3IT4B 5H92C 3AH7A 1J7CA 1TKGA 3V05A 4L23A 1NYQA 2YEPF 2J4XA 2FUG1 3AE3B 1RM6C 3E9SA 3OWEB 5EE0A 1AW7A 3SFEB 2R61A 3AEAB 3AEFB 3VRBB 1C77A 2BBCA 5EE3A 1KH0A 4OHJA 1D4BA 1AWDA 1L0VB 1FRDA 1JWAD 2RMMA 3Q8CA 3SEBA 1IBXB 5BYRA 4DXFA 2L32A 2LHEA 1EWCA 3GP7A 1T3QA 1PGBA 2K0PA 1DYQA 1D5XC 4Q2JA 4HROA 1I7HA 1N63A 1CJEA 2JU6X 1UGJA 2WU5B 3FILB 1I4GA 4OZCA 4B0EA 4RGTA 4ARIA 1CZPA 1F77A 1HQRD 2Y3AA 4ZHPA 2L83A 1K52A 1MPEA 3BK1A 4A9AA 1KRHA 1KFYB 4N58A 3ZJVA 2D5GA 1JWUD 4A8XC 1C78A 1HZ6A 1XLOA 1UWXA 3BVZA 2WS3B 5EE9A 1XF5L 4IDIA 1XLQA 2E6XA 2WDVB 3EUB2 4ZOHC 4M0WA 1WRIA 4WWMA 4KKJA 2TSSA 2DYOA 2CJOA 1SXTA 1K53A 1IUEA 1PFDA 1E9MA 2OEDA 2ZW0A 4C56C 3U4EG 1TJEA 1KLGD 5GXGB 1L4ZB 4A55A 1JROA 1P7EA 5I4DA 2IPKD 3W2DA 1FXAA 3SFDB 1VJKA 1YMHE 3ZGZA 3FAHA 1QOGA 3B2GA 1ZPSA 5FK9C 1DOIA 4WIPA 4A90A 2BB5A 1IGCA 3GS2A 4RGNA 4XWWA 3MHZA 1FIQA 2KACA 4OVZA 3HRDD 2OHFA 2LUMA 3I57A 4B0MA 2JWUA 2WXFA 1FO4A 3CIRB 1FNWA 1SJHD 1CK1A 1F2RC 2J53A 2JXTA 4P16A 2L1AA 4YSZB 2K5PA 1ZDVA 2H89B 3P4PB 5G5GA 5MPOA 4KGSA 4YTNB 2JYEA 1SEBD 2QEJC 3EGRA 2AQ2B 1N5XA 1VRAB 3AEEB 3B9JA 1D5MC 4RCOA 2WDQB 2ONQA 3LXFA 1KF6B 1EWYC 2WXJA 4NZLB 3MC0B 5AUKA 5G5HA 5E6JA 5EE1A 1V8CA 2CU3A 2JSVX 1I4HA 1JQ4A 4MACA 4WURA 1VZ8A 4GDKB 4J3OD 4NAMA 1L6UA 4RF1A 1T5XD 1UUPA 2WU2B 1YNTE 4YWGG 1ZDXA 1BUIC 2I38A 1VLBA 2HDEA 4D2KA 2M19A 3H8HA 5AUIA 3DWMA 4ZYSA 1JCKB 1XEEA 3P63A 1K51A 4RH6A 1EU4A 3P4RB 3ZJTA 5BYSA 3T3OA 1OQQA 1DOXA 1ZE3D 1WYGA 1N62A 2BW2A 2QMTA 1QILA 3BYTB 2MJEA 2RPVA 3SR6A 4N59A 2W3SA 3DWGC 1ROEA 1SBBB 2ACZB 1E10A 2WXHA 4YTMB 4ITKA 5T8IA 1RFKA 1LO5D 4YXDB 3PZ7A 3W1SA 4KX6B 1JMLA 2H88B 3URYA 2WQYB 3BWUD 2MJ3A 5H8YE 1FD6A 2WXPA 2QIEB 1F0ZA 4WQMA 3TEWA 1QF6A 1L6VA 1EU3A 1L0XB 3R2TA 2WXRA 2GI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I2Y A;  1HZ6 A;  1UWX A;  1XF5 L;  2N7J A;  5JXV A;  4HJG E;  2PW9 A;  4GLS C;  1K53 A;  2OED A;  2ZW0 A;  1PGA A;  1EM7 A;  1IGD A;  2ON8 A;  3MP9 A;  1P7E A;  1YMH E;  1QKZ A;  2LHD A;  1MVK A;  1GB1 A;  1IGC A;  5BMH A;  1P7F A;  2KAC A;  1FCC C;  2J52 A;  2LUM A;  2JWU A;  2NMQ A;  1GB4 A;  5HI1 A;  2JXT A;  2KWD A;  1F2R C;  2J53 A;  4OZB A;  2KDM A;  1MHX A;  2N9L A;  4KGS A;  5HHD G;  1F2R I;  1PGX A;  5HFY A;  2ONQ A;  3FIL A;  2IGH A;  1FCL A;  1C9F A;  1HEZ E;  2JSV X;  4KGT A;  4MAC A;  1K50 A;  2PTL A;  3GB1 A;  1HZ5 A;  5BMI A;  2KQ4 X;  3UI3 A;  3V3X A;  4OZA A;  1YNT E;  1XCT L;  4WH4 A;  2JZP A;  1XCQ L;  2IGG A;  2I38 A;  4IKG A;  4D2K A;  2QSD A;  2IGD A;  1KH0 A;  1K51 A;  1D4B A;  2RMM A;  1IBX B;  2QMT A;  2LHE A;  1MHH E;  2RPV A;  1Q10 A;  4HKZ E;  1PGB A;  2K0P A;  5BMG A;  4IOI E;  1MI0 A;  2EEL A;  2JU6 X;  2PLP A;  3FIL B;  1JML A;  1ZXH A;  2GB1 A;  4OZC A;  1FD6 A;  1IBX A;  2KN4 A;  2ZW1 A;  5HG2 A;  2LGI A;  4KGR A;  2N9K A;  1K52 A;  1MPE A;  2GI9 A; 
#chains in the Genus database with same CATH topology
 2AEH A;  3CMM B;  2I2Y A;  2QIL A;  1R4M B;  3HIZ A;  1EUV B;  5JH5 C;  2W82 A;  1WSP A;  2IBI B;  4KKI A;  1WM2 A;  2OJW A;  2PEA A;  3IFW B;  4LJO B;  4LNF A;  2BYF A;  2PIA A;  3KLS X;  4DWF A;  3A4S C;  1N60 A;  4EE2 A;  2FIF A;  2KDI A;  3TL5 A;  5C3J B;  2R2Q A;  1QOA A;  4HCN B;  3DBR I;  1UWM A;  5TR5 A;  3QQ8 B;  4OVU A;  1I4P A;  1ZXI A;  1YJJ A;  3BYY B;  4YL8 A;  3VHT C;  2XN9 C;  2EKI A;  2KWD A;  3TEY A;  1NYR A;  2JRH A;  2NPT A;  3Q2A C;  1MHX A;  3ZXR A;  1B9R A;  1YQB A;  4PK1 A;  2KFJ A;  2HE7 A;  2W54 A;  4US8 A;  2KN5 A;  2JPH A;  2CHX A;  3FIL A;  2KX3 A;  1FRR A;  1FEH A;  1PQS A;  2KAN A;  1WRD B;  2M8S A;  4US9 A;  1E90 A;  1HXY D;  3R7R A;  5LNK 1;  2ZCC A;  4IKG A;  3RPF C;  1UF0 A;  2BYE A;  2SEB D;  3AMZ A;  4WWN A;  2QHO A;  2MLB A;  1TS5 A;  2KYW A;  3M62 B;  2JVC A;  2FE8 A;  4J6I A;  3ZNI D;  3ZTD A;  2MSE D;  2NS5 A;  4C4V B;  4RNA A;  3UQA A;  3NJT A;  2BGF A;  4NNJ B;  4WQO B;  5LXI B;  2PLP A;  1QOF A;  2M0A A;  3DVG Y;  4JPS A;  3OAW A;  1ZXH A;  4XZ4 A;  2GBR A;  3NVZ A;  3UIO B;  1Z5S B;  2Z0D B;  3ZTC A;  1NEK B;  1YN3 A;  2JWZ A;  1P98 A;  4M02 A;  4AUQ C;  4DHJ D;  4BZA A;  4N6E B;  1E8X A;  4NJC A;  1GPX A;  4BFR A;  4IG7 B;  2Y5C A;  3VR9 B;  3TEX A;  1L0Y B;  4WJQ A;  3IG3 A;  2PVO D;  3ETR A;  2LXA A;  1XLP A;  2MJD A;  2AX5 A;  2IYD B;  3DHH C;  4HRS A;  1XD3 B;  3RT3 B;  1ZGU B;  3EFC A;  1ESF A;  2BS3 B;  2LZ6 A;  2IY0 B;  3DVN V;  3ECI A;  1R7S A;  3DHI C;  3Q3J A;  1JW9 D;  4XE0 A;  4DBG A;  2KFK B;  1QOB A;  1C3T A;  4B9K A;  5AZF A;  1V49 A;  2W9N A;  4HWI B;  3TJP A;  5G2N A;  1TT5 B;  4MGY E;  1BML C;  1QLB B;  3C8Y A;  4OZB A;  2LMC A;  2WX1 A;  3VUW A;  1U4A A;  4A3P A;  3RNF C;  1SE9 A;  3IXS A;  3T3N A;  4RF0 A;  1L7Y A;  5DPS A;  3E56 A;  2KQS A;  1KLU D;  4I6P A;  5CHV C;  4REZ A;  4M0W B;  2BT6 A;  2V3S A;  2KQ4 X;  3BK2 A;  3PT2 B;  1OQR A;  2KMA A;  3TEZ A;  1XCT L;  2MRP A;  2VZK B;  3WAN A;  1J19 A;  3N32 A;  4HK2 A;  2WXL A;  1NI2 A;  4AQ7 A;  3NVV A;  4FHJ A;  2JYT A;  1TS3 A;  4MGZ E;  1R4N I;  1V80 A;  2GOW A;  2RDG A;  1AYF A;  1K8R B;  3PLV A;  1ISN A;  2BPS A;  1J7B A;  3VTU A;  3Q3N C;  3ABV B;  2RDB C;  1IBX A;  2KN4 A;  3GZN I;  4KGR A;  3T8M A;  1OEY A;  1V1P A;  2LWP A;  1WXQ A;  1GC6 A;  2N7J A;  1VR9 A;  3ZNZ B;  1NVI D;  4B95 A;  1CQV A;  2K9X A;  4PS3 A;  2WDR B;  3DBH B;  4UDU C;  2PMV A;  2DEN B;  2KTF A;  1I4Q A;  2D11 A;  2K25 A;  1UGM A;  1N6Z A;  1VZ7 A;  1N5W A;  1GB1 A;  4CYE A;  2K8B A;  2MEK A;  1FCC C;  4BVU C;  3PLU A;  1ZW7 A;  3RNC C;  4E71 A;  2JF5 A;  4W9J A;  3SDL C;  1V1O A;  2LEK A;  3U2S C;  2KHW B;  4K7W A;  2MBB B;  1GOZ A;  3NRZ A;  1Z2M A;  3TSS A;  4KIK B;  4K3C A;  2WP9 B;  3VTW A;  1C9F A;  1SSN A;  5TSS A;  5J2R A;  2WDT B;  3PV1 A;  3MTN B;  1FMA D;  4NJ6 A;  4TMA B;  5G55 A;  3AE9 B;  1HZ5 A;  3Q69 A;  4RM8 A;  2K1F A;  2DZK A;  3VFK A;  2LRU A;  3V05 A;  3OWE B;  2YEP F;  3E9S A;  1AW7 A;  3SFE B;  3AEF B;  1C77 A;  1JWA D;  1WIA A;  2CKH B;  3V6C B;  5BYR A;  5L95 C;  1RFA A;  2JZ3 B;  1F9J A;  1PGB A;  1D5X C;  3RNE C;  4FUL A;  1N63 A;  2JU6 X;  2Y5B B;  1S3S G;  2XK5 B;  4ARI A;  1HQR D;  4ZHP A;  2KX0 A;  1K52 A;  4AJY B;  1KRH A;  2N7D A;  2LGY A;  2YVC A;  3BVZ A;  2NBU A;  2E6X A;  4ASW C;  4KKJ A;  2O2V A;  2DYO A;  2CJO A;  3DPD A;  1K53 A;  1PFD A;  4C56 C;  4BAX A;  4JIO U;  1P7E A;  5I4D A;  4MSM B;  2IND C;  3W2D A;  2MQJ A;  1YMH E;  3ZGZ A;  3FAH A;  4PS7 A;  1QOG A;  3PHX B;  2CS4 A;  3AU5 A;  2FUH B;  3MHZ A;  2KAC A;  4OVZ A;  1Q1O A;  3HRD D;  2WXF A;  4YSZ B;  1CK1 A;  1F2R C;  2JUO A;  2K5P A;  2KZR A;  2H89 B;  3NS8 A;  1WI0 A;  4HPL B;  3ML8 A;  1UBQ A;  2XBB C;  3B9J A;  3Q14 C;  1WFY A;  2IO3 B;  3CST A;  1UZX B;  5G5H A;  1WR6 E;  5EE1 A;  4KDL B;  4LNN A;  1JQ4 A;  4G50 A;  4WUR A;  1LM8 B;  4GDK B;  1L6U A;  3V60 A;  2L7R A;  4C00 A;  1UUP A;  4WJN A;  4IM2 A;  1ZDX A;  2M19 A;  4HXD A;  2KDF B;  1JCK B;  4LCD E;  5AZH A;  1X1M A;  1OQQ A;  1DOX A;  4M8N A;  3PTF C;  2BW2 A;  2QMT A;  2RPV A;  3DWG C;  2WXH A;  1RFK A;  1YJ1 A;  1LO5 D;  5JHA A;  4ANW A;  5GMV A;  5H8Y E;  1E7V A;  2CHW A;  3RZF A;  3NG0 A;  1QF6 A;  5CHW A;  1RWS A;  3TCA A;  3RFZ B;  4AS1 A;  2J0K A;  1UH6 A;  2Q5W D;  1V2Y A;  3BVM A;  3A9J B;  3A33 B;  2PW9 A;  4EZL A;  2V4I B;  3P4Q B;  1P3Q U;  3QIJ A;  3NZS A;  5D7G A;  4JX1 C;  2KTR B;  4RGM A;  3MP9 A;  2W3R A;  3O13 A;  2GMI C;  1FNV A;  2GBM A;  2N4F A;  1KJT A;  3W5V B;  1TY0 A;  2M1M A;  4LJP B;  3HVD A;  2DLB A;  2G3Q B;  2L8J A;  4MH0 E;  2K39 A;  3W1S C;  1M94 A;  4TKN A;  3IT6 B;  3ZYY X;  4IWP A;  4A6Q A;  2G1E A;  2N9L A;  3WA0 A;  1L5P A;  3IAS 1;  5FKA C;  1C76 A;  2JT4 B;  3N20 C;  3IVF A;  2BS4 B;  1VCB A;  2QC8 A;  1WJ6 A;  4EEW A;  2WLB A;  2B3A A;  2KT7 A;  2KVZ A;  3VRA B;  1F52 A;  4MJS A;  3TUO A;  4ICV A;  3A9J A;  2VH1 A;  3GB1 A;  3ZXV A;  4HDO A;  2VH2 A;  3EA6 A;  4EKU A;  3TBL D;  2IGG A;  4KDI C;  1UNS A;  2O6V D;  5IN7 A;  3L4P A;  1GAQ B;  3ZJU A;  4ZRI A;  3PRE A;  1FFV A;  2MH7 A;  3HUI A;  2WYQ A;  2NBV B;  3VVW B;  1E0Z A;  4MM3 B;  1SIF A;  3ZDT A;  3L17 A;  4IOI E;  1E5W A;  3VH4 B;  2YEP B;  4HEA 1;  3W1Y A;  3ZVV A;  2GB1 A;  4DXA B;  4FLH A;  3AB5 A;  3GE8 C;  2O6V B;  3AED B;  2N9K A;  1TY2 A;  4W9G A;  1IPG A;  3EEC A;  2BS2 B;  4X57 B;  4K3B A;  4FXC A;  1L4D B;  3N9Y C;  4IM0 A;  1LXD A;  3AE7 B;  1QQR A;  2ICI A;  5JXV A;  4GLS C;  4ZHO A;  2KK8 A;  4GB9 A;  1TYG B;  1M4V A;  2C7H A;  2WX0 A;  4JLC A;  1WXV A;  1FXT B;  4KSK C;  4BBN F;  2V9H A;  1MVK A;  1WJU A;  1PYW D;  3Q8B A;  1XO3 A;  2J52 A;  4MJS B;  4RFB A;  3PHW B;  3APF A;  2DBY A;  2KDM A;  5D94 A;  3Q6B A;  4S0R A;  2NVU I;  2WNM A;  3IBE A;  3L13 A;  1SGH A;  2LVO A;  1H4R A;  3P1M A;  5DPT A;  2C7M B;  2N9E B;  2KMC A;  2HJ8 A;  4PS8 A;  1FCL A;  4GOC A;  3P2B A;  4P1B C;  3A4R A;  4MT5 A;  2QJL A;  4II3 B;  1E8W A;  1OEY J;  3ZLZ A;  4H2A A;  3QAR A;  2D10 A;  2LFI A;  3WAP A;  3BII D;  4F7Z A;  4WH4 A;  4B6W A;  1H8C A;  1DGJ A;  3S2A A;  3RYT A;  5L83 A;  2FCN A;  2N7E A;  2INP E;  3RI7 C;  2LGS A;  4EFO A;  3ZIM A;  4DQO C;  2DZJ A;  1J0G A;  3MJ5 A;  2DZM A;  1YX5 B;  1STE A;  4ZDV A;  4R3D A;  1YX6 B;  2UYZ B;  4JWU C;  1XT9 B;  5HG2 A;  3HHM A;  2K6D B;  4FJY A;  4WWP A;  3K9O B;  3U7Z A;  3P4S B;  5DPW A;  4M00 A;  2CJN A;  1S1Q B;  1SE4 A;  2D2Q A;  2G4S A;  2HTH A;  1OFF A;  4HJG E;  3HM6 X;  5J17 A;  2AL3 A;  5D3D A;  2WXK A;  1T0S C;  3H7S A;  3VUX A;  2Y5P A;  1EM7 A;  1ENF A;  2INN E;  2DHZ A;  2K22 A;  2KQ7 A;  3BZD B;  2PE6 B;  3NUH B;  3RMK C;  2IDY A;  2J0M A;  5JZE B;  4M8M A;  2KJH B;  2D3G A;  2LHD A;  3L16 A;  3LYY A;  5BMH A;  1FXI A;  3UIN B;  2QDF A;  4JWS C;  3KYD D;  2V1Y A;  1SF0 A;  4KZ0 A;  3AXC A;  4EZK A;  2BB6 A;  1WM3 A;  1D3Z A;  1KOT A;  1G6J A;  1I4R A;  4ZRP A;  1QZE A;  2JQR B;  3BVG A;  4C7Z A;  4BOZ B;  3QAQ A;  4KZC A;  4HPM B;  3T9L A;  2UWQ A;  3N1X C;  1V9J A;  1NI3 A;  4USA A;  2BWF A;  3OG5 A;  3NZ3 A;  3V3X A;  1WGY A;  4IUM B;  2L0F A;  5EE0 A;  4RMA A;  2PPH A;  4K81 A;  2R61 A;  1GG3 A;  3UQB A;  3C19 A;  2YLM A;  5EE3 A;  4OHJ A;  1L0V B;  2NBW B;  1WXM A;  3EFU A;  4NAW A;  3GP7 A;  2I1J A;  2K0P A;  1TZ1 A;  2LRW A;  2ZPY A;  3QHT A;  1UGJ A;  3N1Y C;  1I4G A;  4OZC A;  2L83 A;  4P7I A;  1AAR A;  4W9L A;  2MCN B;  3BK1 A;  4N58 A;  1JWU D;  2KTR A;  3VXW A;  4W9C A;  1XLQ A;  3EUB 2;  4ZOH C;  1WRI A;  4WWM A;  4E3C A;  2TSS A;  3V62 A;  2N1W A;  2OED A;  2ZW0 A;  1TJE A;  1KLG D;  4F8C B;  1L4Z B;  1JRO A;  3APD A;  2IPK D;  1WX8 A;  1WGR A;  2JXX A;  1VJK A;  3B2G A;  3IHP C;  4WIP A;  4A90 A;  2BB5 A;  1IGC A;  2IY1 B;  3PRM B;  4RGN A;  1KLV A;  3CIR B;  1FNW A;  1SJH D;  2JXT A;  4P16 A;  4G11 A;  4CO7 A;  5MPO A;  4DHZ E;  4KGS A;  4YTN B;  3WAM A;  2DNF A;  1N5X A;  1VRA B;  3AEE B;  1D5M C;  3SHQ A;  3ZDM C;  4EZJ A;  3LXF A;  1KF6 B;  1R4M I;  3BIN A;  4NZL B;  2WHI A;  2KLC A;  3MC0 B;  3RNA C;  2CR5 A;  2JSV X;  4NY0 A;  1I4H A;  3PZD A;  4MAC A;  2MBE A;  2ZVO A;  2WWZ A;  3V6E B;  5AZG A;  4K1R B;  5KHO A;  2JRI B;  1BUI C;  3B1L X;  2I38 A;  4D2K A;  1UBI A;  3ZJT A;  4TV3 A;  2D3B A;  5C23 A;  1ZE3 D;  3UF8 A;  1KM7 A;  1TIF A;  3ZRC A;  1V81 A;  3SU8 X;  1P9D U;  3BYT B;  2MJE A;  4OVV A;  3FKY A;  2KO3 A;  4N59 A;  2LGX A;  3RCZ A;  2KVR A;  2ACZ B;  4YXD B;  3W1S A;  4KX6 B;  2H88 B;  3URY A;  2KWV B;  3BWU D;  2MJ3 A;  1FD6 A;  3QK0 A;  3TEW A;  1EU3 A;  1L0X B;  3R2T A;  3AUL A;  2WXR A;  3I9V 1;  3OLM D;  2FID A;  3ENE A;  2MWS B;  2WXO A;  2KJR A;  2Z59 B;  2BTE A;  2B76 B;  2INC C;  1V97 A;  2LI5 A;  1SB3 C;  1WE7 A;  1IYF A;  5E6N A;  4MH8 A;  4C7Y A;  3ONS A;  4CHK A;  1E8Z A;  3JSV B;  4O1N A;  3R8B A;  4W9H A;  3VH3 B;  4WJO A;  1T0R C;  5HI1 A;  4ZRQ A;  3QC8 B;  2JX5 A;  3B2F A;  4L2Y A;  1BXT A;  4W9I A;  3OJ4 B;  1BT0 A;  1IP9 A;  2WXG A;  1WE6 A;  2WXN A;  5HFY A;  2NTT A;  3AE6 B;  4N9F 4;  5KHQ A;  5CX3 A;  1WGK A;  2IO1 B;  3NVY A;  2Z0E B;  3MC8 A;  1TGZ B;  4TQ1 A;  4PYU A;  1F1H A;  4CQN A;  2KJ6 A;  1C1Y B;  3TIX A;  1OTR B;  4W9F A;  1A5R A;  2JZZ A;  1WXA A;  4BOS C;  4DXG A;  2FCM A;  4HVB A;  4ANV A;  1ZP0 B;  4ARC A;  1TTN A;  2L3Z A;  1HA5 A;  2FCS A;  2DAJ A;  2X38 A;  1AN8 A;  2GBN A;  3HVZ A;  1RAX A;  4P6V F;  4NQK E;  2K8C A;  4KIK A;  3I5J C;  3RUI B;  4KSL C;  4LLG M;  3AE2 B;  5DCN A;  1LGR A;  1WX9 A;  1VZ6 A;  3ZNH B;  1RYJ A;  4ANX A;  3QX1 A;  3I3T B;  2G4D B;  2LGD A;  4C80 A;  3WAL A;  5BYQ A;  4F1S A;  3NY5 A;  3PS6 A;  1QKZ A;  1PDX A;  1YQ3 B;  2KMM A;  2R2O A;  1WJ4 A;  2DYM A;  1WR1 A;  2BYT A;  2NMQ A;  1GB4 A;  1J7A A;  2ZEQ A;  3N1Z C;  4WJP A;  5IKC M;  1B1Z A;  2KD0 A;  2XK5 A;  1DOY A;  1F2R I;  4WAF A;  1VDV A;  2M4N A;  3R7Q A;  4FN2 A;  4YT0 B;  4TSS A;  3U52 E;  2HTM E;  2L52 A;  4GDL B;  1TS4 A;  3ZO5 B;  2BYV E;  3RNB C;  4K7S A;  1WYW B;  1K50 A;  1V5O A;  2N1V A;  2PTL A;  4MEL A;  2O2V B;  1SIJ A;  2PKO A;  2KOX A;  3PRZ A;  2VRR B;  2PVG C;  4OZA A;  2V4L A;  1Y8R C;  1EF5 A;  1JWM D;  1XCQ L;  2ZJD A;  3AU4 A;  2V0G A;  1D5Z C;  3LJ3 A;  3LDZ E;  1E8Y A;  2ASQ A;  2AQ3 B;  1EO6 A;  2DX5 B;  2BWE S;  2RD0 A;  5IP4 D;  4MGK E;  3U8Z A;  1C79 A;  4PT5 A;  2BVC A;  2IO0 B;  4ACF A;  4WWO A;  1T6B X;  5LLI A;  3DBS A;  2MBO A;  1JWS D;  3AM9 A;  4ZYN A;  3KH0 A;  1GNU A;  3KUZ A;  2NTS A;  3Q3O C;  2ZCB A;  3KYC D;  3FC4 A;  3NS1 A;  3KUD B;  1J8C A;  1E7U A;  3AV8 A;  4MDK E;  4MEM A;  1FPY A;  3QWZ B;  1PGA A;  1ET9 A;  2RR9 A;  3TMP B;  4GXB A;  3DBL I;  3VUY A;  2EMS A;  5LXH A;  2MA9 B;  2ZNV C;  1YIW A;  4XDD A;  2E3T A;  3NHE B;  5DPR A;  3O65 B;  2N0S B;  4YSX B;  4XC2 A;  3DVN U;  4BBN C;  3AEB B;  1FFU A;  2MP2 A;  3H7P A;  3KQ4 A;  2W55 A;  3AI5 A;  4DHJ B;  5IA7 A;  3Q3F A;  3PGE A;  1YN4 A;  2D07 B;  2PE9 A;  4RGO S;  1HEZ E;  1KTK A;  1ZKH A;  4I6N B;  2VZK D;  4AOF A;  3JYU A;  3U30 A;  3UI3 A;  1LFD A;  4W9E A;  1Y56 A;  5H92 C;  3AH7 A;  4E74 A;  4L23 A;  1NYQ A;  2KC1 A;  3A9K A;  2J4X A;  2FUG 1;  1RM6 C;  4HCP B;  1MFW A;  2D3C A;  3VRB B;  2BBC A;  3GE3 C;  2XEW A;  4LNI A;  1AWD A;  3PPA A;  1FRD A;  2RMM A;  3SEB A;  3Q8C A;  4P1C C;  1IBX B;  4DXF A;  2L32 A;  3NOB A;  2M17 A;  4AWJ A;  2RGF A;  5J18 A;  4Q2J A;  4HRO A;  1CJE A;  2WU5 B;  3R66 C;  4B0E A;  4RGT A;  1CZP A;  1F77 A;  2EMT A;  4JGH B;  4M01 A;  5EDS A;  1MPE A;  2L00 B;  4LNK A;  4NJ7 A;  4A8X C;  1Q0W B;  2JY6 A;  1C78 A;  3BY4 B;  1GUA B;  3VDZ A;  1HZ6 A;  1XLO A;  1UWX A;  3ML9 A;  2WS3 B;  4IDI A;  3ZUN A;  1I35 A;  2WDV B;  4M0W A;  3PRP B;  1V5T A;  1I42 A;  4S17 A;  1E9M A;  3HM3 A;  4NQL B;  3U4E G;  3H7P B;  4A55 A;  3DDC B;  3HK0 A;  2LVP A;  3UIP B;  4HLE A;  4MGI E;  3SFD B;  2UU7 A;  1ZPS A;  5FK9 C;  1OQY A;  4XWW A;  1HTQ A;  2OHF A;  2LUM A;  3I57 A;  4WAA A;  3SD5 A;  1FO4 A;  4ANU A;  2J53 A;  2L1A A;  1ZDV A;  3P4P B;  5G5G A;  2O6V A;  3EGR A;  1WX7 A;  3WIM A;  4RCO A;  2WDQ B;  2ONQ A;  1EWY C;  2LAS A;  5AUK A;  2CU3 A;  2AWT A;  3ALB A;  2K8H A;  4HDQ A;  4NAM A;  4IWO A;  4RF1 A;  5IAA C;  1T5X D;  4W9K A;  2WU2 B;  4YWG G;  1WXS A;  1YD8 U;  1VLB A;  2KNB A;  2AL6 A;  5AUI A;  3P63 A;  1K51 A;  3T3O A;  5BYS A;  1WJN A;  3JSV A;  2MP2 B;  3QCA A;  4A3O A;  1WGG A;  3L08 A;  4JL9 A;  1JML A;  3RUL A;  3N30 A;  4WQM A;  2L0T A;  2HD5 B;  2MBQ A;  2A4Z A;  2C60 A;  3DVG X;  1YQ4 B;  2N9P C;  3WAO A;  3AE1 B;  4PYZ A;  4IM3 A;  1JRP A;  4MSQ B;  1C4C A;  3B0A A;  3W5U B;  3A1Q B;  2MW5 A;  1LQB A;  1IGD A;  1E6E B;  1V6E A;  5E6P A;  1HE8 A;  4XX5 A;  4LK0 M;  2MHJ A;  1HTO A;  1L2N A;  2BF8 B;  5FR6 A;  2NPT B;  3Q3M C;  3Q8E A;  2V3N A;  1NDD A;  1WZ3 A;  1TKE A;  4QAY A;  2L76 A;  3V61 A;  3AN1 A;  3WCQ A;  4HJK A;  4KVG B;  1N61 A;  1ZUD 2;  3VR8 B;  2C7N B;  2LJI A;  3ZRF A;  2QCZ A;  3LB8 C;  4GN1 A;  3KVF B;  5HHD G;  4G3X B;  4FHK A;  5D6J B;  4BKG A;  4GDK A;  4XDC A;  5C2T B;  1NEN B;  3CF6 E;  4GIV A;  5CHF A;  1FM0 D;  1XQQ A;  2PJH A;  2J7Q B;  4TQ0 A;  3R2I A;  4FA6 A;  2CU1 A;  4FBJ B;  1D6E C;  3EHV A;  1C4A A;  1YN5 A;  2ZNV B;  3U7D A;  2J0J A;  2KFK A;  2JZP A;  2XNA C;  2QSD A;  1QT9 A;  2IGD A;  3X23 A;  4YSY B;  2CHZ A;  2M56 B;  2GLS A;  1UEL A;  1ACC A;  3J9C A;  4RM9 A;  1MG8 A;  1V1P B;  4HKZ E;  4HPP A;  2KKC A;  1SE3 A;  1MJD A;  1SE2 A;  3K9P B;  3MFG A;  4GGQ A;  4W9D A;  2EEL A;  1ZOY B;  1NBF C;  2K3U A;  2KXJ A;  1RRB A;  3L0W B;  3GZN B;  2ZW1 A;  4IWQ A;  2KLG A;  3RNG C;  3H1U A;  1I4X A;  4JE3 B;  2LD9 A;  4DK5 A;  2WXI A;  1WY8 A;  4XYC A;  1JRU A;  3QJZ A;  3KWV A;  4YTP B;  3AE4 B;  1XXG A;  3VAW A;  4XWT A;  1ET6 A;  4TUU A;  1CMX B;  3PZ8 A;  2MX2 A;  4GSW A;  3CSF A;  2DAF A;  4HKQ A;  4NPN A;  1TKY A;  4AP4 C;  2WXM A;  1SJE D;  1WF9 A;  3P42 A;  4BKT A;  3L54 A;  3M3J A;  5JHB A;  2AQ1 B;  2L05 A;  2J42 A;  4L1B A;  1FNU A;  2WXQ A;  1GJZ A;  3H6N A;  3QA8 A;  3KWL A;  3ZKJ C;  1JWB D;  1YJI A;  1C4P A;  2AYO B;  4LDT D;  1GC7 A;  1V86 A;  3CWI A;  3M63 B;  3DCG A;  3L10 B;  4BKS D;  1TZO A;  2V3P A;  2IGH A;  3IAM 1;  3AE5 B;  3GOE A;  4KGT A;  1PUT A;  3Q8F A;  5BMI A;  2ZVN A;  4ZRJ A;  3DOW A;  4FJZ A;  1Q5W B;  4IW0 A;  4DDG D;  2GBK A;  3ZNG C;  5D3I B;  1R4N B;  2WGS A;  2K6Q A;  1TS2 A;  4EOY A;  3H9D A;  2DWQ A;  1A70 A;  2RSU A;  1E7P B;  5AEK B;  1MHH E;  2M0X A;  3UGB B;  1Q10 A;  4KV2 A;  2KWC A;  5BMG A;  1RLF A;  1MI0 A;  2Z8L A;  3NVW A;  3MC9 A;  2G9H D;  3PO0 A;  4AJW A;  4GDL A;  4NAW B;  2BKR B;  2SAK A;  4GU2 A;  2LGI A;  5E6O A;  2ZZP B;  5BO4 B;  5FR3 A;  3AEC B;  3JW0 X;  5IOI A;  1JAL A;  4GMV A;  3AE8 B;  3APC A;  4I6L B;  2IJ0 A;  1XLN A;  3M95 A;  2RDH A;  2DZI A;  2ON8 A;  3ZW3 A;  2N9X A;  1P1A A;  2KAJ A;  4ICU A;  1WWT A;  2FBW B;  5D2M B;  2A5U A;  1P7F A;  5CTR C;  3B08 A;  3AEG B;  3PVL A;  4OW0 A;  4MM3 A;  3VTV A;  3PSE B;  4LTU A;  2GRI A;  2MBH A;  3ZQ4 A;  2GBJ A;  4URK A;  2G45 B;  3W9C B;  1WGD A;  2C5L C;  4DDI D;  3R3M A;  1YOV B;  1PGX A;  4LNO A;  3DQV A;  4G0N B;  4ZRK A;  3Q8A A;  4LDT B;  3VQI A;  2X8X X;  1WMH A;  2BKF A;  2FAZ A;  2HJ1 A;  4C4V A;  3DBR B;  1OGW A;  3IT4 B;  3C0R B;  1J7C A;  1TKG A;  1T0Q C;  2IO2 B;  3DBL B;  3AE3 B;  3RD2 A;  2RPQ A;  1WZ0 A;  3AEA B;  3RN9 C;  4JQW C;  1KH0 A;  1D4B A;  3DHG C;  3KW5 B;  2LHE A;  1EWC A;  4BKS A;  1T3Q A;  4XGA B;  1DYQ A;  2DYB A;  4IC7 B;  1I7H A;  3FIL B;  3OJ3 A;  2Y3A A;  4A9A A;  3MHS D;  1KFY B;  3EC8 A;  3ZJV A;  2D5G A;  3A1Q A;  1EF1 A;  2ZPN A;  3NZU A;  1TBE A;  5EE9 A;  1XF5 L;  3KUC B;  1MG4 A;  1SXT A;  2IZV B;  1IUE A;  5GXG B;  3MJW A;  3N3K B;  3DBH I;  3JVZ X;  1FXA A;  4DHZ B;  2REX A;  3A9K B;  1DOI A;  2KC2 A;  3GS2 A;  1FIQ A;  4B0M A;  2KWU B;  4EUT A;  1WMH B;  2JWU A;  2KDB A;  4II2 B;  2FCQ A;  2I1K A;  2OJR A;  1T0Y A;  2JYE A;  1SEB D;  2QEJ C;  2AQ2 B;  5C1Z A;  2WXJ A;  5E6J A;  1V8C A;  2KDE B;  2LUE A;  2C9W B;  1VZ8 A;  4J3O D;  1P0R A;  2BQQ A;  1WH3 A;  1YNT E;  4K7U A;  2HDE A;  3H8H A;  2LJ5 A;  1VD2 A;  3DWM A;  4ZYS A;  1XEE A;  4RH6 A;  1EU4 A;  3P4R B;  2EKE C;  4FAD A;  1WYG A;  1N62 A;  3I63 C;  2LXC A;  1QIL A;  5HKH A;  2D3A A;  3SR6 A;  4FJV B;  2W3S A;  1ROE A;  1SBB B;  1E10 A;  4YTM B;  4ITK A;  5T8I A;  2NR2 A;  2FNJ B;  3PZ7 A;  2WQY B;  2NCN A;  2WXP A;  2QIE B;  3RZW C;  1F0Z A;  2LVQ A;  2OOB B;  1L6V A;  1UD7 A;  1WGH A;  4A20 A;  3D32 A;  5IO9 A;  3X0W A;  2GI9 A; 
#chains in the Genus database with same CATH homology
 1RWS A;  2I2Y A;  1YQ4 B;  2QIL A;  3RFZ B;  4AS1 A;  3I9V 1;  2Q5W D;  3BVM A;  2W82 A;  1WSP A;  3AE1 B;  4KKI A;  1JRP A;  2PW9 A;  1C4C A;  2WXO A;  2V4I B;  3W5U B;  3P4Q B;  5D7G A;  2PIA A;  4JX1 C;  3KLS X;  4RGM A;  2B76 B;  2BTE A;  1IGD A;  1V97 A;  1E6E B;  3MP9 A;  2W3R A;  1SB3 C;  3O13 A;  1FNV A;  4LK0 M;  3W5V B;  4MH8 A;  4C7Y A;  1N60 A;  1TY0 A;  4EE2 A;  5C3J B;  1QOA A;  3HVD A;  1UWM A;  2DLB A;  3Q8E A;  2V3N A;  4O1N A;  3R8B A;  1TKE A;  1I4P A;  1ZXI A;  1YJJ A;  3AN1 A;  3WCQ A;  3BYY B;  3IT6 B;  3ZYY X;  1N61 A;  1ZUD 2;  5HI1 A;  3VR8 B;  2XN9 C;  4ZRQ A;  2EKI A;  2KWD A;  3TEY A;  2LJI A;  4A6Q A;  1NYR A;  3LB8 C;  2JX5 A;  3B2F A;  2G1E A;  1MHX A;  4L2Y A;  1B9R A;  1BXT A;  2N9L A;  5HHD G;  2W54 A;  4US8 A;  4XDC A;  1L5P A;  5C2T B;  1NEN B;  2WXG A;  3IAS 1;  5FKA C;  1C76 A;  2WXN A;  1FM0 D;  5HFY A;  2BS4 B;  2NTT A;  3AE6 B;  3FIL A;  1FRR A;  1FEH A;  4TQ0 A;  3R2I A;  2WLB A;  4US9 A;  3VRA B;  3TUO A;  1D6E C;  1WGK A;  3GB1 A;  1HXY D;  3NVY A;  4TQ1 A;  1C4A A;  1YN5 A;  5LNK 1;  3EA6 A;  2JZP A;  2IGG A;  2XNA C;  1UNS A;  4IKG A;  2QSD A;  1GAQ B;  3L4P A;  3RPF C;  3ZJU A;  1QT9 A;  2IGD A;  4CQN A;  4YSY B;  1FFV A;  2SEB D;  3AMZ A;  2M56 B;  2MH7 A;  1TS5 A;  3HUI A;  1ACC A;  3J9C A;  1V1P B;  2FE8 A;  1E0Z A;  4MM3 B;  4HKZ E;  1SE3 A;  4IOI E;  4RNA A;  1SE2 A;  4DXG A;  2YEP B;  4HEA 1;  3MFG A;  2K3U A;  1ZOY B;  2EEL A;  2PLP A;  1ZP0 B;  1QOF A;  2M0A A;  4ARC A;  4JPS A;  1ZXH A;  3NVZ A;  2GB1 A;  1HA5 A;  2X38 A;  3AB5 A;  1NEK B;  2ZW1 A;  1AN8 A;  1YN3 A;  3HVZ A;  4P6V F;  3AED B;  2N9K A;  1TY2 A;  4N6E B;  1GPX A;  1I4X A;  4JE3 B;  4NJC A;  2BS2 B;  2WXI A;  2Y5C A;  4FXC A;  4LLG M;  1L0Y B;  1L4D B;  3TEX A;  3AE2 B;  3VR9 B;  3N9Y C;  2PVO D;  3AE7 B;  1QQR A;  3ETR A;  2ICI A;  1VZ6 A;  5JXV A;  3KWV A;  4YTP B;  3AE4 B;  1XLP A;  1RYJ A;  1XXG A;  2MJD A;  2AX5 A;  4GLS C;  4ZHO A;  4XWT A;  1ET6 A;  4HRS A;  4C80 A;  3PZ8 A;  1TYG B;  5BYQ A;  1M4V A;  1ESF A;  2BS3 B;  4HKQ A;  1TKY A;  2WXM A;  1SJE D;  3P42 A;  1R7S A;  4XE0 A;  1JW9 D;  1QKZ A;  1PDX A;  1YQ3 B;  1MVK A;  1QOB A;  1PYW D;  2KMM A;  2AQ1 B;  2DYM A;  3Q8B A;  2J42 A;  1XO3 A;  4L1B A;  2BYT A;  1FNU A;  2J52 A;  2NMQ A;  2WXQ A;  4RFB A;  1GB4 A;  1BML C;  1QLB B;  1J7A A;  3C8Y A;  3KWL A;  2LMC A;  4OZB A;  2DBY A;  2KDM A;  1B1Z A;  1JWB D;  1YJI A;  1C4P A;  2WNM A;  3CWI A;  1DOY A;  1F2R I;  4WAF A;  1VDV A;  3IXS A;  3T3N A;  3P1M A;  4RF0 A;  4YT0 B;  1TZO A;  4TSS A;  3U52 E;  2HTM E;  2L52 A;  4GDL B;  2V3P A;  1TS4 A;  2IGH A;  3E56 A;  3IAM 1;  1FCL A;  1KLU D;  4MT5 A;  4REZ A;  3AE5 B;  4KGT A;  2QJL A;  1PUT A;  1K50 A;  3Q8F A;  4H2A A;  2BT6 A;  2PTL A;  5BMI A;  2KQ4 X;  1SIJ A;  2PKO A;  3BK2 A;  2LFI A;  1OQR A;  2PVG C;  4OZA A;  3TEZ A;  3BII D;  1XCT L;  4WH4 A;  1JWM D;  1XCQ L;  2V0G A;  5D3I B;  2VZK B;  1TS2 A;  1D5Z C;  1DGJ A;  2WXL A;  4AQ7 A;  3NVV A;  2DWQ A;  1A70 A;  2INP E;  1E7P B;  2JYT A;  2AQ3 B;  1MHH E;  1TS3 A;  1Q10 A;  4DQO C;  2RDG A;  5BMG A;  3MJ5 A;  1MI0 A;  1AYF A;  2Z8L A;  1C79 A;  4PT5 A;  3NVW A;  1STE A;  1T6B X;  2G9H D;  3PO0 A;  4R3D A;  1J7B A;  4NAW B;  3ABV B;  1JWS D;  3AM9 A;  1IBX A;  4JWU C;  2SAK A;  2KN4 A;  5HG2 A;  2LGI A;  4KGR A;  3U7Z A;  2NTS A;  3P4S B;  2CJN A;  1V1P A;  5FR3 A;  1SE4 A;  1WXQ A;  3AEC B;  1JAL A;  3FC4 A;  3AE8 B;  2N7J A;  3NS1 A;  1OFF A;  1VR9 A;  4HJG E;  5D3D A;  2WXK A;  2IJ0 A;  1NVI D;  1XLN A;  3AV8 A;  2RDH A;  1CQV A;  2Y5P A;  1PGA A;  2K9X A;  1EM7 A;  2WDR B;  1ENF A;  1ET9 A;  2ON8 A;  4UDU C;  2PMV A;  2INN E;  2K22 A;  1I4Q A;  3BZD B;  3NUH B;  2KAJ A;  2IDY A;  1VZ7 A;  1N5W A;  1WWT A;  4XDD A;  2E3T A;  2FBW B;  2LHD A;  1GB1 A;  2N0S B;  4YSX B;  3LYY A;  5BMH A;  1P7F A;  1FXI A;  3AEG B;  4OW0 A;  2MEK A;  4LTU A;  1FCC C;  2GRI A;  3ZQ4 A;  4JWS C;  3W9C B;  1SF0 A;  2BB6 A;  3AEB B;  1FFU A;  1V1O A;  2LEK A;  3U2S C;  3KQ4 A;  2W55 A;  1I4R A;  4ZRP A;  2JQR B;  1PGX A;  3BVG A;  1GOZ A;  3NRZ A;  4C7Z A;  3TSS A;  1YN4 A;  2WP9 B;  1C9F A;  4RGO S;  1SSN A;  1HEZ E;  1KTK A;  3Q8A A;  5TSS A;  3VQI A;  1NI3 A;  4USA A;  1FMA D;  4TMA B;  2VZK D;  3AE9 B;  1HZ5 A;  3Q69 A;  3UI3 A;  3NZ3 A;  3V3X A;  1Y56 A;  3IT4 B;  5H92 C;  3AH7 A;  1J7C A;  1TKG A;  3V05 A;  4L23 A;  1NYQ A;  2YEP F;  2J4X A;  2FUG 1;  3AE3 B;  1RM6 C;  3E9S A;  3OWE B;  5EE0 A;  1AW7 A;  3SFE B;  2R61 A;  3AEA B;  3AEF B;  3VRB B;  1C77 A;  2BBC A;  5EE3 A;  1KH0 A;  4OHJ A;  1D4B A;  1AWD A;  1L0V B;  1FRD A;  1JWA D;  2RMM A;  3Q8C A;  3SEB A;  1IBX B;  5BYR A;  4DXF A;  2L32 A;  2LHE A;  1EWC A;  3GP7 A;  1T3Q A;  1PGB A;  2K0P A;  1DYQ A;  1D5X C;  4Q2J A;  4HRO A;  1I7H A;  1N63 A;  1CJE A;  2JU6 X;  1UGJ A;  2WU5 B;  3FIL B;  1I4G A;  4OZC A;  4B0E A;  4RGT A;  4ARI A;  1CZP A;  1F77 A;  1HQR D;  2Y3A A;  4ZHP A;  2L83 A;  1K52 A;  1MPE A;  3BK1 A;  4A9A A;  1KRH A;  1KFY B;  4N58 A;  3ZJV A;  2D5G A;  1JWU D;  4A8X C;  1C78 A;  1HZ6 A;  1XLO A;  1UWX A;  3BVZ A;  2WS3 B;  5EE9 A;  1XF5 L;  4IDI A;  1XLQ A;  2E6X A;  2WDV B;  3EUB 2;  4ZOH C;  4M0W A;  1WRI A;  4WWM A;  4KKJ A;  2TSS A;  2DYO A;  2CJO A;  1SXT A;  1K53 A;  1IUE A;  1PFD A;  1E9M A;  2OED A;  2ZW0 A;  4C56 C;  3U4E G;  1TJE A;  1KLG D;  5GXG B;  1L4Z B;  4A55 A;  1JRO A;  1P7E A;  5I4D A;  2IPK D;  3W2D A;  1FXA A;  3SFD B;  1VJK A;  1YMH E;  3ZGZ A;  3FAH A;  1QOG A;  3B2G A;  1ZPS A;  5FK9 C;  1DOI A;  4WIP A;  4A90 A;  2BB5 A;  1IGC A;  3GS2 A;  4RGN A;  4XWW A;  3MHZ A;  1FIQ A;  2KAC A;  4OVZ A;  3HRD D;  2OHF A;  2LUM A;  3I57 A;  4B0M A;  2JWU A;  2WXF A;  1FO4 A;  3CIR B;  1FNW A;  1SJH D;  1CK1 A;  1F2R C;  2J53 A;  2JXT A;  4P16 A;  2L1A A;  4YSZ B;  2K5P A;  1ZDV A;  2H89 B;  3P4P B;  5G5G A;  5MPO A;  4KGS A;  4YTN B;  2JYE A;  1SEB D;  2QEJ C;  3EGR A;  2AQ2 B;  1N5X A;  1VRA B;  3AEE B;  3B9J A;  1D5M C;  4RCO A;  2WDQ B;  2ONQ A;  3LXF A;  1KF6 B;  1EWY C;  2WXJ A;  4NZL B;  3MC0 B;  5AUK A;  5G5H A;  5E6J A;  5EE1 A;  1V8C A;  2CU3 A;  2JSV X;  1I4H A;  1JQ4 A;  4MAC A;  4WUR A;  1VZ8 A;  4GDK B;  4J3O D;  4NAM A;  1L6U A;  4RF1 A;  1T5X D;  1UUP A;  2WU2 B;  1YNT E;  4YWG G;  1ZDX A;  1BUI C;  2I38 A;  1VLB A;  2HDE A;  4D2K A;  2M19 A;  3H8H A;  5AUI A;  3DWM A;  4ZYS A;  1JCK B;  1XEE A;  3P63 A;  1K51 A;  4RH6 A;  1EU4 A;  3P4R B;  3ZJT A;  5BYS A;  3T3O A;  1OQQ A;  1DOX A;  1ZE3 D;  1WYG A;  1N62 A;  2BW2 A;  2QMT A;  1QIL A;  3BYT B;  2MJE A;  2RPV A;  3SR6 A;  4N59 A;  2W3S A;  3DWG C;  1ROE A;  1SBB B;  2ACZ B;  1E10 A;  2WXH A;  4YTM B;  4ITK A;  5T8I A;  1RFK A;  1LO5 D;  4YXD B;  3PZ7 A;  3W1S A;  4KX6 B;  1JML A;  2H88 B;  3URY A;  2WQY B;  3BWU D;  2MJ3 A;  5H8Y E;  1FD6 A;  2WXP A;  2QIE B;  1F0Z A;  4WQM A;  3TEW A;  1QF6 A;  1L6V A;  1EU3 A;  1L0X B;  3R2T A;  2WXR A;  2GI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...