2J53A

Solution structure of gb1 domain protein g and low and high pressure.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
56
structure length
56
Chain Sequence
MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDAATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pressure-Induced Changes in the Solution Structure of the Gb1 Domain of Protein G.
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Immunoglobulin
molecule keywords IMMUNOGLOBULIN G-BINDING PROTEIN G
total genus 14
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2006-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2j53A00
3V3XA 1IGCA 2JSVX 2JZPA 1K50A 1JMLA 4WH4A 1PGBA 1HZ5A 4OZAA 4KGSA 2ONQA 5HHDG 1IBXB 2LGIA 2N7JA 2JU6X 2K0PA 2KACA 2I2YA 4IKGA 4OZCA 2PLPA 1YMHE 2PTLA 1MHHE 1C9FA 1QKZA 1MHXA 1FCLA 1F2RC 2JWUA 4IOIE 1IBXA 2KQ4X 2ZW0A 4OZBA 2N9KA 3MP9A 2ON8A 4KGTA 1PGXA 1XCQL 2RMMA 2KWDA 4KGRA 3GB1A 5BMGA 2RPVA 4MACA 1FCCC 5BMHA 1MPEA 2OEDA 2J52A 1HZ6A 1UWXA 1YNTE 2GI9A 1P7EA 1ZXHA 5JXVA 1IGDA 2J53A 1FD6A 2LUMA 1D4BA 4D2KA 1HEZE 2GB1A 2JXTA 1GB1A 4HJGE 2ZW1A 3FILB 5BMIA 2PW9A 1F2RI 2KDMA 2NMQA 5HFYA 4HKZE 1K51A 3UI3A 1GB4A 2LHDA 2LHEA 1K53A 1K52A 5HG2A 2KN4A 1KH0A 1P7FA 1EM7A 3FILA 1MVKA 2N9LA 1Q10A 1XCTL 2IGDA 2IGHA 1XF5L 2QMTA 1MI0A 2IGGA 2QSDA 4GLSC 2I38A 5HI1A 2EELA 1PGAA
chains in the Genus database with same CATH superfamily
1AN8A 1KFYB 1SJHD 2C7HA 3AU4A 2JZ3B 3N3KB 1L0VB 2BYTA 1WFYA 1NVID 3QWZB 1E0ZA 4KGSA 4C7YA 3LDZE 1WJ4A 2H88B 4DWFA 3NVWA 2O6VA 3A9KB 1DYQA 5AZGA 4IW0A 4BVUC 2FNJB 4IKGA 4TKNA 1N5XA 2K25A 2LVQA 2C60A 4HROA 2CU3A 2A5UA 2KN5A 2W82A 4LNFA 1PGXA 2IBIB 4LLGM 2KT7A 2FE8A 3AXCA 4W9EA 1SXTA 1SE3A 2QC8A 2WU5B 1C3TA 3RNBC 1EF5A 2KWVB 4B6WA 5BYSA 4ZHOA 3KQ4A 3WAMA 1JCKB 1A70A 2KX0A 1WMHA 1UNSA 1UD7A 2LUMA 5CTRC 5LLIA 1GUAB 5H92C 4ZRIA 2CKHB 2DYOA 2JXTA 3S2AA 2LFIA 3AE5B 3SU8X 4AOFA 4GU2A 1VLBA 3DWGC 4JQWC 1F2RI 5IKCM 1J7CA 1JWBD 3NZ3A 4TQ1A 2WYQA 2O2VB 2J4XA 4ANWA 1ROEA 3SDLC 3B1LX 4P16A 1EM7A 3ML9A 3X23A 2KMCA 2WQYB 3ZJVA 1L4DB 4C56C 2DZMA 2RDGA 3AV8A 3RNAC 1XF5L 1VDVA 2M0XA 4EUTA 2MRPA 2GMIC 3L54A 2I38A 3RYTA 4IM3A 3Q6BA 3TEWA 3JSVA 4XX5A 3IT6B 1OFFA 3RZWC 1FXIA 5FKAC 3ETRA 3PHXB 4QAYA 3B9JA 2ONQA 3OLMD 2VH2A 2I1JA 2AWTA 3KVFB 3MJ5A 2K3UA 4PS8A 3TEZA 3T9LA 1MHHE 3PV1A 3ZKJC 3MHZA 4HPLB 3X0WA 3HHMA 2MJ3A 1SB3C 2FCQA 2XN9C 4OZBA 4XYCA 2W9NA 3M3JA 1R4NI 3FC4A 4KSKC 1RRBA 1T0QC 2BS2B 2ZPNA 1PQSA 3Q3OC 4E71A 1WR1A 3UINB 5BMGA 4EZLA 2YVCA 1C76A 2KJHB 2KTRA 2G3QB 3NHEB 3WANA 4USAA 3ZIMA 3T3NA 4ASWC 4IDIA 5E6OA 4IC7B 2DZIA 4X57B 2LEKA 1IYFA 1B1ZA 4OW0A 3BVGA 4R3DA 4YTPB 3KUCB 4NNJB 4DHJD 4RF1A 2NPTB 3H9DA 2CJNA 2D07B 3PLVA 5IP4D 4L2YA 4RM9A 3TUOA 4HJKA 3P4RB 1L0YB 2KN4A 1SJED 1SE9A 4JLCA 4ZRQA 4BBNC 1XCTL 3NS8A 4LNIA 4ICVA 1ESFA 2NR2A 4DHJB 4F7ZA 3AE4B 3ONSA 4P6VF 3EA6A 4GLSC 4WWNA 4MM3B 4WQOB 2N7DA 4WWMA 4FBJB 2HJ8A 2KLGA 1ET9A 3Q3FA 3AU5A 5IN7A 1TGZB 2WDVB 2NBUA 1SSNA 4AP4C 1V49A 1TYGB 1S1QB 1UH6A 4FJZA 2D3CA 3AE1B 1LXDA 2WP9B 1RAXA 1YN3A 3RD2A 2HD5B 4XGAB 2BKFA 2N1VA 1DGJA 1FCLA 2LASA 2N0SB 5D6JB 1KOTA 3TL5A 2W3RA 4M01A 1C78A 1FNUA 2XBBC 3I63C 4A8XC 3EFUA 1YN4A 5I4DA 1DOIA 1GNUA 2MH7A 2JT4B 3P1MA 3HM3A 1KM7A 5DCNA 2PEAA 2WXNA 1KJTA 3ZRFA 3NG0A 4WJNA 4DXGA 3ZW3A 3T8MA 4ZRJA 2ZVNA 4PYZA 2LVOA 3VTUA 3WCQA 3B08A 1TY0A 5C2TB 5AZHA 4ZRKA 2Y5CA 1MFWA 4MEMA 3K9OB 2I1KA 3Q3JA 4G0NB 3K9PB 1FRRA 3VXWA 2K6DB 5G55A 4WIPA 2QMTA 2C5LC 4W9FA 1WXAA 2G45B 3R3MA 3W5UB 3W9CB 4YSXB 4XZ4A 2LVPA 3V05A 3VTWA 5JH5C 1K8RB 4MGZE 2FUHB 5BYRA 3Q3MC 4WWOA 1F52A 1F0ZA 3PSEB 4ZYSA 3JSVB 4DHZB 4AJWA 1FNVA 2PIAA 5LNK1 2A4ZA 2WDTB 1HTQA 3TEYA 1OQQA 2N9EB 4MJSB 4JGHB 4OZCA 2OHFA 2PTLA 2BYEA 3AEBB 3VAWA 4E3CA 4REZA 1C4AA 3H7PA 4ARCA 1UF0A 3L17A 1WIAA 1PFDA 4B9KA 3IHPC 3QIJA 1FPYA 3AEFB 5JHAA 3SFEB 2PMVA 2NBWB 3AEEB 1MPEA 2UU7A 2C7NB 2NTSA 1QOGA 3M95A 4RGOS 1J0GA 5D3IB 1IPGA 1F9JA 1V2YA 1XLPA 4NAWA 2V4LA 4XDDA 1EWYC 1HQRD 3U2SC 1FD6A 1GPXA 1ZPSA 1Q0WB 4FHKA 3E56A 3LXFA 4N9F4 3PTFC 4N59A 1I35A 5DPSA 3WAPA 1FFUA 4ZRPA 3Q14C 2XK5A 3ABVB 4MGKE 2MQJA 4DK5A 4DXAB 4US8A 3R7RA 4TQ0A 2VRRB 2KHWB 4YSYB 2WXGA 3AE7B 2WLBA 1XLQA 1FO4A 4JPSA 3L10B 4YXDB 4FLHA 1R7SA 4C4VA 2BF8B 2K8BA 3ZGZA 4K3CA 1XLOA 1EU4A 2LJIA 4IUMB 3ZQ4A 1QQRA 4HWIB 2REXA 2WX0A 3EUB2 4G3XB 4M0WA 4BKTA 2LUEA 1HA5A 1ENFA 4JE3B 4B0MA 2KDIA 2WXKA 1YJJA 3LJ3A 4EZJA 3MJWA 2MHJA 5KHQA 2HE7A 2Y3AA 1H8CA 3R2IA 1YN5A 1UWMA 4XWTA 1WM2A 3RNEC 1WYGA 5AEKB 1CK1A 3P4QB 3OG5A 1B9RA 2HTME 1V6EA 3DHIC 1UWXA 2DENB 2NVUI 3V60A 5BO4B 3WAOA 4BKSD 5HKHA 2M19A 3KUZA 5AUIA 2B3AA 3OAWA 2D3BA 2CS4A 5G5GA 4PK1A 2GB1A 2NBVB 3BYYB 4C80A 4NAWB 2O6VB 3UIPB 2LXAA 3LB8C 2BS3B 4IM2A 3FILB 1HE8A 1K51A 2J0JA 1PDXA 1CQVA 2CR5A 4CO7A 5EE3A 1P7FA 1ZE3D 3IXSA 4LDTB 1C1YB 2IDYA 2DX5B 1J8CA 1ZP0B 1VZ7A 4KIKB 4FHJA 2QJLA 5J17A 1WF9A 2Z0EB 3TEXA 4HKQA 2D2QA 1JWAD 2M17A 3IBEA 2KK8A 4YL8A 2GBRA 1VCBA 3VH3B 3CSTA 3EHVA 1JMLA 3KWLA 4IM0A 1QLBB 1XLNA 3PLUA 1GOZA 4M8MA 1OEYA 2L8JA 4MT5A 2QEJC 5D7GA 4J6IA 3HRDD 3MC0B 1KRHA 2AL3A 3VRBB 4LNOA 4ZYNA 2MCNB 3RZFA 3IVFA 5KHOA 3TJPA 2CU1A 4MJSA 2RR9A 4HRSA 1SBBB 2V0GA 2WXIA 4KGTA 1SIFA 2L76A 1JRUA 5EE1A 2LD9A 5EE9A 4ZOHC 2LGDA 3URYA 2WXLA 1SF0A 3H7SA 3V6EB 2ZCBA 2KC1A 2D5GA 1F77A 1T0RC 4KX6B 1IGDA 5D94A 4D2KA 4OHJA 1ZKHA 4HDOA 4AQ7A 1WXMA 2V4IB 1EO6A 1N6ZA 3PT2B 3W1YA 5T8IA 4YSZB 2DAJA 1FIQA 2QIEB 2M8SA 2JWZA 3DHGC 2X8XX 3UQAA 2CHWA 3UI3A 4JWSC 1Q1OA 1LQBA 2JXXA 1MG4A 4XC2A 1WMHB 1C4CA 2BGFA 3ZNGC 4WAFA 3VUYA 4AUQC 2G4DB 1SGHA 4CYEA 2KVRA 4PYUA 2GLSA 1ZXIA 1IUEA 1CMXB 1P98A 1TZOA 1WGKA 4GB9A 2V3PA 5IAAC 5FK9C 1YD8U 2BYVE 2JZPA 1HXYD 2QDFA 3UQBA 2IZVB 1FMAD 3QAQA 3RPFC 3H6NA 2J0MA 1P0RA 4FULA 1DOYA 1EUVB 1WJ6A 2DHZA 4WJOA 4OVZA 4PS3A 4H2AA 5L83A 2N7JA 3Q8FA 4ANXA 5D3DA 2ICIA 4M00A 2CJOA 4P1CC 1YOVB 4FXCA 2K8HA 4BZAA 3J9CA 2MEKA 2DLBA 5IOIA 3ZDMC 2KWDA 3DOWA 2ZEQA 4KKIA 1SEBD 2KZRA 3GP7A 2J52A 4KZ0A 1N62A 2WXMA 5CHWA 4YTNB 1TS4A 1L7YA 3ALBA 1KLGD 3BIID 1WWTA 2DZKA 3GE8C 3N9YC 2KJ6A 4A90A 2R2OA 4G50A 4GOCA 1NYQA 4WAAA 3W5VB 1Z2MA 3N1ZC 2MSED 1FNWA 2PVGC 1C79A 1K53A 2L1AA 3APCA 3NVZA 1BT0A 3O65B 4K7WA 4HPPA 2GBNA 2KX3A 4EEWA 3A9KA 3VQIA 5J18A 4LTUA 1Q5WB 1WX8A 1F1HA 4K7SA 4DHZE 1FRDA 3T3OA 4K3BA 3VR8B 4DQOC 1I4HA 3RULA 4US9A 2LXCA 3P4PB 1L6VA 3DBHI 3DVNV 1ZW7A 3BVZA 2GRIA 3QK0A 4MSQB 1G6JA 4NY0A 1R4MI 4MSMB 1Y56A 2Z59B 3MTNB 4EFOA 2FIDA 3SHQA 4NJ7A 3MFGA 2PVOD 1IBXB 4GDLA 1E7VA 5J2RA 4PS7A 4W9CA 3H8HA 4K1RB 3PZDA 2KDBA 1MHXA 3Q69A 1WXVA 3QHTA 1F2RC 2JWUA 3U4EG 4NQLB 4NAMA 3EC8A 1GC6A 4KKJA 1YIWA 4PT5A 4KIKA 1WGYA 4HCNB 1FXAA 3HVZA 3Q8AA 4WQMA 3DDCB 4EOYA 4ICUA 4K81A 4A9AA 1NI2A 1WRDB 4FADA 3QC8B 4F8CB 4KSLC 3RCZA 3RNGC 4C4VB 1V1PB 2O6VD 2G9HD 2WU2B 4Q2JA 2L3ZA 3DBLB 2WDRB 1U4AA 3AULA 4TMAB 1YJ1A 4NPNA 4AWJA 1ZOYB 3ML8A 4NJ6A 2FCNA 2PKOA 1YQ4B 1UBIA 2JRIB 3UF8A 4RMAA 2N9XA 4I6NB 4DDGD 1WSPA 1WGHA 1NENB 1TS3A 3P63A 4DDID 2INPE 3C19A 3QX1A 3PRMB 1E7PB 5BYQA 2EKIA 1EWCA 1MG8A 3VHTC 3W2DA 4LNKA 2L83A 3L0WB 1WZ0A 3NY5A 4L1BA 3Q8BA 1Z5SB 1JRPA 2FUG1 1D5ZC 4B95A 1C77A 4KVGB 5JZEB 3M63B 2C7MB 4LNNA 2WXOA 2VH1A 3MC8A 4MM3A 2RSUA 4WURA 2X38A 2ZNVC 1D6EC 3NZUA 1CJEA 1PYWD 3ZTCA 5GMVA 3Q2AC 4NJCA 1XO3A 4ANUA 2CHXA 3AE2B 3KLSX 1IBXA 2BB5A 3PRPB 1C4PA 3EFCA 3FKYA 4LJOB 4C7ZA 2W55A 1UZXB 4N58A 2QHOA 1I4RA 1P3QU 4IWOA 2V1YA 4AJYB 1WI0A 4HEA1 3O13A 3BYTB 3VR9B 2Z8LA 1WGGA 2LWPA 3KH0A 2LRUA 2N7EA 1HZ6A 2KC2A 3RNFC 3SEBA 1WR6E 4TSSA 2WXPA 3V62A 3BZDB 4E74A 5L95C 2QCZA 3HVDA 3PVLA 4L23A 1NDDA 1V97A 1I4PA 4JL9A 2DZJA 1E8YA 3UIOB 1V86A 2KQ7A 1FXTB 2KDMA 1WX7A 2NMQA 2IPKD 4NZLB 3AB5A 3R8BA 1ZGUB 1HTOA 3ZTDA 1WGDA 1KH0A 3I5JC 1TKEA 1TT5B 3ZUNA 1RWSA 5AUKA 2N1WA 2JY6A 2Q5WD 2IGDA 3PGEA 3L16A 4IWQA 1ZUD2 2WXRA 1JW9D 1GAQB 3B0AA 3V6CB 3I9V1 4M0WB 4I6PA 3TBLD 4BBNF 1JALA 2G4SA 1OTRB 1D5XC 4FJYA 1NYRA 1PGBA 5FR3A 1HZ5A 1I7HA 2LRWA 3AEAB 5HHDG 2FCSA 2JX5A 1T0YA 2KTFA 3MHSD 2NTTA 2AL6A 1MJDA 3NRZA 1RFKA 3RUIB 2JPHA 4IOIE 3V61A 1P1AA 2ZZPB 3MP9A 4W9LA 2LGXA 2KD0A 3OWEB 1RLFA 1RFAA 3BVMA 1OQRA 2RMMA 2RDHA 1ACCA 3DWMA 4KGRA 2VZKD 2RPVA 1FCCC 1AARA 1N5WA 1YNTE 2PPHA 2N9PC 2DBYA 2VZKB 2KTRB 4G11A 3AE3B 1TY2A 4JIOU 3VUXA 2EMSA 3AE8B 1D3ZA 3U7DA 1CZPA 1L5PA 2ZJDA 4I6LB 1V9JA 1KLUD 3AN1A 4UDUC 5C23A 3QA8A 1LFDA 4LJPB 3RT3B 4GGQA 5DPRA 2MBBB 1LM8B 3DBHB 1I4XA 2JRHA 3TIXA 2J0KA 4W9GA 3CMMB 1JQ4A 3H7PB 4BKGA 2YEPF 4GIVA 5IA7A 2KOXA 3TSSA 1IP9A 2PJHA 3DPDA 2DAFA 1UUPA 2EELA 2WX1A 2L05A 4BAXA 4J3OD 3W1SA 5GXGB 2M4NA 2J42A 4II2B 2RGFA 2UWQA 5LXIB 2MJDA 5G5HA 4YT0B 3VRAB 4WJQA 2RDBC 3DBRI 4CHKA 2AEHA 1V81A 2IY1B 2I2YA 2PLPA 1YMHE 1R4MB 4GMVA 4WWPA 5CHFA 2XNAC 3C8YA 2DYMA 2L00B 1H4RA 4WJPA 2ZW0A 1BUIC 3PS6A 2M1MA 2MJEA 1ISNA 3KWVA 1NI3A 1I4GA 2KDFB 1XD3B 4BOSC 1N63A 1E10A 5BMHA 2OOBB 4S0RA 3L13A 3ZDTA 1QF6A 3P42A 1TS5A 5JHBA 3VFKA 1WM3A 3OJ3A 4MELA 2NPTA 4K7UA 4M8NA 3BWUD 1I4QA 1AYFA 2BTEA 3AECB 2MBHA 5EE0A 3AI5A 3CSFA 2D3AA 2LZ6A 5HFYA 2EMTA 1QT9A 4M02A 1E8XA 2M0AA 2QILA 3DBLI 4MGIE 3ZNID 3JVZX 4EZKA 1MVKA 1KTKA 4C00A 1V80A 4YWGG 2W3SA 4MH8A 4MGYE 3AMZA 2JQRB 2GBKA 4W9IA 5EDSA 3N30A 2K5PA 2WS3B 5DPTA 4GN1A 1M94A 1OEYJ 3HM6X 2BYFA 1FM0D 1XXGA 3DBRB 3IFWB 4MH0E 1VRAB 4P7IA 4N6EB 2WXJA 2IO1B 4CQNA 2KFKB 3A1QA 2GBJA 3U7ZA 2E3TA 1QOAA 3KW5B 2XEWA 4YTMB 2SEBD 4FA6A 2KFKA 2K22A 3D32A 1J7AA 3RMKC 1TS2A 1UGJA 1RM6C 3QARA 3SD5A 1E8WA 3AE9B 3NJTA 4LK0M 2IJ0A 1XCQL 3GS2A 2BBCA 2AYOB 4O1NA 1L0XB 2KXJA 2HDEA 3N32A 2ACZB 2WXQA 4GDLB 3ZVVA 5MPOA 1LO5D 3A4SC 5H8YE 1GG3A 3IAS1 1QOFA 3BY4B 5JXVA 1T0SC 3DBSA 4KDIC 3N1YC 2K39A 5FR6A 4ZDVA 1STEA 4IG7B 1ET6A 2IO0B 4F1SA 4KDLB 2BS4B 1WX9A 1K52A 1V5TA 2ZCCA 1V1PA 2WHIA 3FILA 2B76B 2WWZA 1V1OA 2GBMA 1WXSA 2R2QA 4A3PA 1T5XD 2HTHA 2KVZA 2IO2B 4BKSA 2BQQA 4AS1A 4EE2A 3PZ8A 2J7QB 1UELA 2MBQA 2RPQA 2CHZA 4IWPA 5HI1A 4A20A 1PGAA 1YX5B 1VZ6A 1TZ1A 1K50A 1E8ZA 3QCAA 2EKEC 3APFA 4A55A 3DCGA 2LMCA 4OZAA 1JWUD 2D11A 2IO3B 4B0EA 2BB6A 3M62B 2BKRB 4RGMA 5E6PA 5G2NA 1ZDVA 2LGIA 1SE4A 2KACA 3BINA 1JROA 3RNCC 2INDC 4LDTD 1YQBA 4W9JA 4DBGA 4A6QA 1SE2A 2K9XA 1WJNA 1E9MA 2ON8A 4HDQA 2GOWA 2W54A 4HXDA 3EECA 1J19A 4HCPB 4FJVB 3VH4B 1ZDXA 3DHHC 4RM8A 2JUOA 2JZZA 2PE6B 2K8CA 1TKGA 2Y5BB 3Q3NC 2BWFA 1VR9A 3P4SB 2OEDA 2YLMA 2ASQA 1WYWB 4RNAA 3E9SA 2BW2A 4ITKA 3NS1A 2V9HA 2ZPYA 1P7EA 4RGTA 2INNE 5C1ZA 2BT6A 2FCMA 2FIFA 3ZNHB 1XT9B 3ZJTA 3HK0A 3R2TA 1D4BA 5TSSA 3FAHA 4OVUA 2H89B 1L2NA 4XDCA 1WGRA 2UYZB 3A4RA 1GB1A 4HJGE 1TKYA 2Z0DB 3MC9A 2KJRA 1SIJA 3Q8CA 2LHDA 2AQ2B 3OJ4B 5HG2A 4MDKE 2SAKA 3R7QA 3PHWB 2WXFA 3H1UA 1Q10A 1WRIA 3DVGX 2KANA 2IGHA 1JWMD 3CF6E 1I42A 2INCC 2IGGA 3PPAA 1JWSD 2QSDA 1D5MC 2KMMA 1J7BA 4ZHPA 3V3XA 3CWIA 1GC7A 1IGCA 2MX2A 1BMLC 3U30A 1X1MA 1E6EB 2IY0B 3P2BA 4EKUA 4XWWA 2KNBA 2L7RA 1S3SG 1Y8RC 3ZRCA 2G1EA 2DYBA 2N4FA 1WY8A 2JF5A 3GE3C 2JU6X 2K0PA 2KWCA 3R66C 4OVVA 2KQSA 3VDZA 3KYDD 3Q8EA 2KDEB 2KKCA 2FAZA 2O2VA 1EF1A 4GXBA 4ARIA 2L0TA 1YX6B 4RH6A 3A9JA 2E6XA 4ANVA 1N61A 2KMAA 2D3GA 3HUIA 2V3SA 2K6QA 4KZCA 3C0RB 1E7UA 2BWES 5E6JA 1BXTA 2C9WB 1P9DU 4URKA 2GI9A 3ZXRA 4W9HA 3WA0A 1ZXHA 2AX5A 1PUTA 2MA9B 5CHVC 1V5OA 2WDQB 1N60A 3AE6B 3U52E 1WE7A 1T6BX 3RN9C 1VZ8A 3PO0A 4HKZE 1OQYA 3DVNU 2HJ1A 3NVYA 3EGRA 3I3TB 3NOBA 2M56B 1VD2A 2LGSA 3NVVA 2PE9A 4GDKB 2KAJA 3ECIA 3GZNI 1NEKB 1WH3A 3I57A 3CIRB 1UBQA 3ENEA 5C3JB 4WH4A 2KLCA 1YJIA 1QILA 4KV2A 3W1SC 3AEDB 2K1FA 2MBOA 2LGYA 5IO9A 4W9DA 1R4NB 3JW0X 1GJZA 3WIMA 2LJ5A 1AWDA 1WXQA 1QKZA 1LGRA 2DNFA 2KQ4X 2N9KA 2MP2A 1AW7A 4RFBA 1T3QA 3IG3A 3QJZA 3GB1A 5D2MB 4P1BC 3ZXVA 4II3B 2NS5A 5E6NA 1NBFC 1E5WA 3LYYA 2MP2B 3IT4B 5TR5A 2AQ3B 3KUDB 3ZNZB 1KLVA 3ZJUA 2R61A 3VVWB 4XE0A 3IAM1 2KWUB 3N1XC 2V3NA 3A1QB 1TJEA 3JYUA 1QZEA 1E90A 1WZ3A 2ZW1A 1TTNA 2PW9A 3GZNB 2BPSA 2IYDB 2WXHA 3UGBB 2BVCA 2KYWA 1VJKA 3PZ7A 1FEHA 2Y5PA 4FN2A 3SFDB 4ACFA 3A9JB 4BFRA 2JYEA 4RF0A 1MI0A 2L52A 3NUHB 2LI5A 1YQ3B 3VTVA 1L6UA 4GDKA 3ZLZA 4HVBA 2JSVX 2DWQA 3RFZB 3BK2A 2WNMA 3BK1A 1WJUA 2KO3A 5CX3A 3NZSA 5DPWA 4RGNA 3TCAA 3WALA 3TMPB 1A5RA 4HK2A 4TV3A 1TIFA 3L4PA 4HLEA 2FBWB 3GOEA 3B2GA 5LXHA 3N20C 3KYCD 2MLBA 1XQQA 2AQ1B 1C9FA 2XK5B 2WGSA 2RD0A 2MBEA 3A33B 1M4VA 3APDA 1OGWA 2TSSA 4GSWA 1QOBA 2KFJA 2NCNA 3B2FA 4MACA 3AEGB 4LCDE 2L0FA 2OJWA 3ZYYX 4TUUA 3DVGY 2D10A 2OJRA 3AH7A 3ZO5B 3QQ8B 2J53A 4HPMB 1DOXA 1HEZE 2JVCA 1TBEA 2ZVOA 5BMIA 1RYJA 1KF6B 3PREA 4A3OA 1GB4A 4W9KA 2LHEA 2JYTA 2L32A 1XEEA 5AZFA 3L08A 1WE6A 1L4ZB 3AM9A 2N9LA 1UGMA 4BOZB 3DQVA 3PRZA 1FFVA 3VUWA 4JWUC 3SR6A 1EU3A 3U8ZA 3HIZA 4NQKE 4JX1C 1V8CA 2MWSB 4DXFA 3RI7C 4RCOA 2YEPB 2MW5A 2ZNVB 4S17A
chains in the Genus database with same CATH topology
1AN8A 1JRPA 1KFYB 1SJHD 1VZ6A 2FUG1 1D5ZC 4YXDB 1R7SA 1K50A 1C77A 3ZGZA 1L0VB 1XLOA 1EU4A 2BYTA 2WXOA 2LJIA 1NVID 4A55A 2LMCA 4OZAA 3ZQ4A 1JWUD 4KGSA 4C7YA 1E0ZA 4B0EA 2BB6A 4WURA 1QQRA 2X38A 2H88B 4RGMA 3NVWA 3EUB2 1D6EC 1ZDVA 1CJEA 1DYQA 1PYWD 2LGIA 4M0WA 1SE4A 2KACA 1HA5A 4IKGA 1ENFA 1N5XA 4JE3B 4NJCA 1XO3A 4B0MA 2WXKA 3AE2B 3KLSX 4HROA 1YJJA 1JROA 2CU3A 1IBXA 2BB5A 1C4PA 4A6QA 1SE2A 2K9XA 1E9MA 2W82A 2ON8A 4C7ZA 2W55A 2Y3AA 1PGXA 4N58A 2W54A 4LLGM 2FE8A 1I4RA 1ZDXA 3R2IA 1YN5A 1UWMA 1SXTA 1SE3A 4XWTA 1TKGA 2WU5B 1WYGA 1CK1A 1VR9A 3P4SB 3P4QB 2OEDA 4HEA1 3O13A 5BYSA 3BYTB 1B9RA 3VR9B 2HTME 2Z8LA 4ZHOA 4RNAA 3E9SA 2BW2A 3KQ4A 1HZ6A 1UWXA 4ITKA 3SEBA 3NS1A 1JCKB 1A70A 4TSSA 1P7EA 4RGTA 1UNSA 2INNE 2WXPA 2BT6A 2M19A 3BZDB 3ZJTA 3HVDA 5AUIA 2LUMA 3R2TA 1D4BA 5G5GA 5TSSA 5H92C 3FAHA 2GB1A 2DYOA 2JXTA 3BYYB 2H89B 2LFIA 4L23A 4C80A 3AE5B 1V97A 1I4PA 4NAWB 4XDCA 1VLBA 3DWGC 3LB8C 1GB1A 4HJGE 1TKYA 2BS3B 3FILB 1F2RI 2NMQA 2KDMA 2IPKD 4NZLB 3AB5A 1SIJA 3Q8CA 1K51A 3R8BA 1J7CA 1JWBD 2LHDA 1PDXA 2AQ2B 1CQVA 3NZ3A 4TQ1A 5EE3A 5HG2A 2SAKA 2J4XA 1ROEA 1KH0A 1P7FA 1ZE3D 2WXFA 3IXSA 4P16A 1TKEA 1EM7A 2IDYA 1RWSA 5AUKA 2WQYB 1Q10A 3ZJVA 1L4DB 1WRIA 4C56C 2Q5WD 2IGDA 2IGHA 2RDGA 1XF5L 3AV8A 1JWMD 1ZP0B 1VDVA 1VZ7A 2QJLA 1ZUD2 2WXRA 1JW9D 3TEXA 4HKQA 1GAQB 1JWAD 3I9V1 2IGGA 1JWSD 2QSDA 1D5MC 2KMMA 1J7BA 2I38A 4ZHPA 3V3XA 3CWIA 1IGCA 3TEWA 1JALA 1BMLC 1E6EB 1JMLA 1D5XC 3KWLA 3IT6B 1OFFA 1QLBB 4XWWA 1NYRA 1XLNA 1FXIA 1PGBA 1GOZA 5FKAC 3ETRA 5FR3A 1HZ5A 1I7HA 2G1EA 4MT5A 3B9JA 2ONQA 2QEJC 3AEAB 5D7GA 5HHDG 2JX5A 3HRDD 3MJ5A 2K3UA 3MC0B 1KRHA 2JU6X 2K0PA 3TEZA 2NTTA 3VRBB 1MHHE 3Q8EA 3MHZA 3NRZA 1RFKA 2MJ3A 4IOIE 1SB3C 4ARIA 2XN9C 4OZBA 3MP9A 4HRSA 1SBBB 4RH6A 3OWEB 2WXIA 3FC4A 4KGTA 2V0GA 2E6XA 2BS2B 3BVMA 1OQRA 2RMMA 1N61A 2RDHA 1ACCA 3DWMA 5EE1A 4KGRA 5EE9A 5BMGA 2VZKD 4ZOHC 1C76A 2RPVA 3HUIA 3URYA 2WXLA 1FCCC 1SF0A 4USAA 1N5WA 3T3NA 5E6JA 1BXTA 1YNTE 2GI9A 4IDIA 2D5GA 1F77A 2DBYA 2VZKB 1ZXHA 2AX5A 1PUTA 2LEKA 4KX6B 1IGDA 1B1ZA 3AE3B 1TY2A 4D2KA 4OHJA 4OW0A 3BVGA 4AQ7A 4R3DA 2WDQB 4YTPB 2V4IB 1N60A 3AE6B 3AE8B 3U52E 4RF1A 4L1BA 1CZPA 5T8IA 1T6BX 1L5PA 1FIQA 4YSZB 2QIEB 1VZ8A 2CJNA 3PO0A 4HKZE 1KLUD 3UI3A 4L2YA 3AN1A 4JWSC 4UDUC 3TUOA 3P4RB 1L0YB 2KN4A 1SJED 3NVYA 3EGRA 2M56B 1C4CA 1I4XA 3NVVA 4WAFA 4ZRQA 1XCTL 4GDKB 2KAJA 1ESFA 1JQ4A 3AE4B 2YEPF 4P6VF 1NEKB 1IUEA 1ZXIA 3EA6A 1TZOA 3I57A 1WGKA 3TSSA 4GLSC 2V3PA 5FK9C 4MM3B 3CIRB 1UUPA 2EELA 2JZPA 1HXYD 4WWMA 4J3OD 1FMAD 3W1SA 1ET9A 5GXGB 5C3JB 4WH4A 2J42A 1YJIA 3RPFC 1QILA 2WDVB 3AEDB 1SSNA 2MJDA 1TYGB 5G5HA 4YT0B 1DOYA 3AE1B 3VRAB 2WP9B 1YN3A 4OVZA 4H2AA 2N7JA 3Q8FA 2I2YA 2PLPA 1YMHE 1AWDA 1WXQA 5D3DA 1DGJA 1QKZA 2XNAC 2ICIA 1FCLA 3C8YA 2DYMA 2N0SB 2KQ4X 2CJOA 2ZW0A 2N9KA 1BUIC 4FXCA 2MJEA 3J9CA 1AW7A 4RFBA 2MEKA 2DLBA 2W3RA 1C78A 1FNUA 1T3QA 2KWDA 4KKIA 3KWVA 1NI3A 3GB1A 1I4GA 4A8XC 1SEBD 1N63A 1E10A 1YN4A 5BMHA 1DOIA 3GP7A 5I4DA 2MH7A 3P1MA 3LYYA 3IT4B 2J52A 2AQ3B 1N62A 2WXMA 1QF6A 3P42A 1TS5A 3ZJUA 4YTNB 1TS4A 2WXNA 2R61A 4DXGA 4XE0A 1KLGD 3BWUD 1I4QA 1AYFA 2BTEA 3IAM1 3BIID 1WWTA 2V3NA 3AECB 3N9YC 1TJEA 5EE0A 4A90A 3WCQA 2ZW1A 1NYQA 2PW9A 5HFYA 3W5VB 1TY0A 1QT9A 5C2TB 1FNWA 2PVGC 2M0AA 2Y5CA 2QILA 1C79A 1K53A 2L1AA 2WXHA 3NVZA 1VJKA 3PZ7A 1FRRA 1KTKA 1MVKA 1FEHA 2Y5PA 4YWGG 3VQIA 2W3SA 4MH8A 3AMZA 4LTUA 3SFDB 4WIPA 2JQRB 2QMTA 2JYEA 4RF0A 1MI0A 2K5PA 2WS3B 2L52A 3NUHB 1FRDA 3W5UB 3T3OA 3W9CB 4YSXB 3VR8B 4DQOC 3V05A 1I4HA 1YQ3B 1L6UA 4US9A 3P4PB 1L6VA 1FM0D 1XXGA 2JSVX 2DWQA 3BVZA 2GRIA 3RFZB 3BK2A 5BYRA 2WNMA 1VRAB 3BK1A 4N6EB 2WXJA 4CQNA 1F0ZA 1Y56A 4RGNA 4ZYSA 3L4PA 3U7ZA 1FNVA 2PIAA 5LNK1 2E3TA 2FBWB 3MFGA 2PVOD 1IBXB 3TEYA 3B2GA 1QOAA 4YTMB 1OQQA 2SEBD 4OZCA 2K22A 2OHFA 1J7AA 2PTLA 1TS2A 3AEBB 2AQ1B 3H8HA 1UGJA 1C4AA 4REZA 1C9FA 1MHXA 1RM6C 4ARCA 3Q69A 1F2RC 1M4VA 2JWUA 3U4EG 1PFDA 3AE9B 4LK0M 2IJ0A 2TSSA 4NAMA 4KKJA 1XCQL 4PT5A 3GS2A 2BBCA 3AEFB 4O1NA 1FXAA 1L0XB 1QOBA 3HVZA 3Q8AA 3SFEB 4WQMA 3B2FA 3AEGB 4MACA 4A9AA 2PMVA 3AEEB 2HDEA 1MPEA 3ZYYX 2ACZB 2NTSA 2WXQA 1QOGA 4GDLB 4RGOS 5MPOA 5D3IB 1LO5D 5H8YE 1XLPA 1V1PB 2G9HD 3IAS1 4XDDA 1EWYC 1HQRD 2WU2B 4Q2JA 3AH7A 3U2SC 1QOFA 5JXVA 2J53A 2WDRB 1FD6A 1GPXA 1ZPSA 1DOXA 1HEZE 4TMAB 1ZOYB 3E56A 3LXFA 4N59A 2PKOA 1YQ4B 1STEA 5BMIA 1FFUA 4ZRPA 1RYJA 1ET6A 1KF6B 2BS4B 1GB4A 2LHEA 2JYTA 2L32A 1K52A 1WSPA 1XEEA 3ABVB 1NENB 1TS3A 1V1PA 1L4ZB 3AM9A 3FILA 3P63A 2B76B 4US8A 2N9LA 1V1OA 4TQ0A 2INPE 1T5XD 1FFVA 2WXGA 4YSYB 1E7PB 5BYQA 2EKIA 1EWCA 3AE7B 3W2DA 2WLBA 1XLQA 4JWUC 4AS1A 3SR6A 1EU3A 2L83A 4EE2A 3PZ8A 1FO4A 4JX1C 4JPSA 1V8CA 4DXFA 4RCOA 2YEPB 5HI1A 1PGAA 3Q8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V3X A;  1IGC A;  2JSV X;  2JZP A;  1K50 A;  1JML A;  4WH4 A;  1PGB A;  1HZ5 A;  4OZA A;  4KGS A;  2ONQ A;  5HHD G;  1IBX B;  2LGI A;  2N7J A;  2JU6 X;  2K0P A;  2KAC A;  2I2Y A;  4IKG A;  4OZC A;  2PLP A;  1YMH E;  2PTL A;  1MHH E;  1C9F A;  1QKZ A;  1MHX A;  1FCL A;  1F2R C;  2JWU A;  4IOI E;  1IBX A;  2KQ4 X;  2ZW0 A;  4OZB A;  2N9K A;  3MP9 A;  2ON8 A;  4KGT A;  1PGX A;  1XCQ L;  2RMM A;  2KWD A;  4KGR A;  3GB1 A;  5BMG A;  2RPV A;  4MAC A;  1FCC C;  5BMH A;  1MPE A;  2OED A;  2J52 A;  1HZ6 A;  1UWX A;  1YNT E;  2GI9 A;  1P7E A;  1ZXH A;  5JXV A;  1IGD A;  2J53 A;  1FD6 A;  2LUM A;  1D4B A;  4D2K A;  1HEZ E;  2GB1 A;  2JXT A;  1GB1 A;  4HJG E;  2ZW1 A;  3FIL B;  5BMI A;  2PW9 A;  1F2R I;  2KDM A;  2NMQ A;  5HFY A;  4HKZ E;  1K51 A;  3UI3 A;  1GB4 A;  2LHD A;  2LHE A;  1K53 A;  1K52 A;  5HG2 A;  2KN4 A;  1KH0 A;  1P7F A;  1EM7 A;  3FIL A;  1MVK A;  2N9L A;  1Q10 A;  1XCT L;  2IGD A;  2IGH A;  1XF5 L;  2QMT A;  1MI0 A;  2IGG A;  2QSD A;  4GLS C;  2I38 A;  5HI1 A;  2EEL A;  1PGA A; 
#chains in the Genus database with same CATH topology
 1AN8 A;  1KFY B;  1SJH D;  2C7H A;  3AU4 A;  2JZ3 B;  3N3K B;  1L0V B;  2BYT A;  1WFY A;  1NVI D;  3QWZ B;  1E0Z A;  4KGS A;  4C7Y A;  3LDZ E;  1WJ4 A;  2H88 B;  4DWF A;  3NVW A;  2O6V A;  3A9K B;  1DYQ A;  5AZG A;  4IW0 A;  4BVU C;  2FNJ B;  4IKG A;  4TKN A;  1N5X A;  2K25 A;  2LVQ A;  2C60 A;  4HRO A;  2CU3 A;  2A5U A;  2KN5 A;  2W82 A;  4LNF A;  1PGX A;  2IBI B;  4LLG M;  2KT7 A;  2FE8 A;  3AXC A;  4W9E A;  1SXT A;  1SE3 A;  2QC8 A;  2WU5 B;  1C3T A;  3RNB C;  1EF5 A;  2KWV B;  4B6W A;  5BYS A;  4ZHO A;  3KQ4 A;  3WAM A;  1JCK B;  1A70 A;  2KX0 A;  1WMH A;  1UNS A;  1UD7 A;  2LUM A;  5CTR C;  5LLI A;  1GUA B;  5H92 C;  4ZRI A;  2CKH B;  2DYO A;  2JXT A;  3S2A A;  2LFI A;  3AE5 B;  3SU8 X;  4AOF A;  4GU2 A;  1VLB A;  3DWG C;  4JQW C;  1F2R I;  5IKC M;  1J7C A;  1JWB D;  3NZ3 A;  4TQ1 A;  2WYQ A;  2O2V B;  2J4X A;  4ANW A;  1ROE A;  3SDL C;  3B1L X;  4P16 A;  1EM7 A;  3ML9 A;  3X23 A;  2KMC A;  2WQY B;  3ZJV A;  1L4D B;  4C56 C;  2DZM A;  2RDG A;  3AV8 A;  3RNA C;  1XF5 L;  1VDV A;  2M0X A;  4EUT A;  2MRP A;  2GMI C;  3L54 A;  2I38 A;  3RYT A;  4IM3 A;  3Q6B A;  3TEW A;  3JSV A;  4XX5 A;  3IT6 B;  1OFF A;  3RZW C;  1FXI A;  5FKA C;  3ETR A;  3PHX B;  4QAY A;  3B9J A;  2ONQ A;  3OLM D;  2VH2 A;  2I1J A;  2AWT A;  3KVF B;  3MJ5 A;  2K3U A;  4PS8 A;  3TEZ A;  3T9L A;  1MHH E;  3PV1 A;  3ZKJ C;  3MHZ A;  4HPL B;  3X0W A;  3HHM A;  2MJ3 A;  1SB3 C;  2FCQ A;  2XN9 C;  4OZB A;  4XYC A;  2W9N A;  3M3J A;  1R4N I;  3FC4 A;  4KSK C;  1RRB A;  1T0Q C;  2BS2 B;  2ZPN A;  1PQS A;  3Q3O C;  4E71 A;  1WR1 A;  3UIN B;  5BMG A;  4EZL A;  2YVC A;  1C76 A;  2KJH B;  2KTR A;  2G3Q B;  3NHE B;  3WAN A;  4USA A;  3ZIM A;  3T3N A;  4ASW C;  4IDI A;  5E6O A;  4IC7 B;  2DZI A;  4X57 B;  2LEK A;  1IYF A;  1B1Z A;  4OW0 A;  3BVG A;  4R3D A;  4YTP B;  3KUC B;  4NNJ B;  4DHJ D;  4RF1 A;  2NPT B;  3H9D A;  2CJN A;  2D07 B;  3PLV A;  5IP4 D;  4L2Y A;  4RM9 A;  3TUO A;  4HJK A;  3P4R B;  1L0Y B;  2KN4 A;  1SJE D;  1SE9 A;  4JLC A;  4ZRQ A;  4BBN C;  1XCT L;  3NS8 A;  4LNI A;  4ICV A;  1ESF A;  2NR2 A;  4DHJ B;  4F7Z A;  3AE4 B;  3ONS A;  4P6V F;  3EA6 A;  4GLS C;  4WWN A;  4MM3 B;  4WQO B;  2N7D A;  4WWM A;  4FBJ B;  2HJ8 A;  2KLG A;  1ET9 A;  3Q3F A;  3AU5 A;  5IN7 A;  1TGZ B;  2WDV B;  2NBU A;  1SSN A;  4AP4 C;  1V49 A;  1TYG B;  1S1Q B;  1UH6 A;  4FJZ A;  2D3C A;  3AE1 B;  1LXD A;  2WP9 B;  1RAX A;  1YN3 A;  3RD2 A;  2HD5 B;  4XGA B;  2BKF A;  2N1V A;  1DGJ A;  1FCL A;  2LAS A;  2N0S B;  5D6J B;  1KOT A;  3TL5 A;  2W3R A;  4M01 A;  1C78 A;  1FNU A;  2XBB C;  3I63 C;  4A8X C;  3EFU A;  1YN4 A;  5I4D A;  1DOI A;  1GNU A;  2MH7 A;  2JT4 B;  3P1M A;  3HM3 A;  1KM7 A;  5DCN A;  2PEA A;  2WXN A;  1KJT A;  3ZRF A;  3NG0 A;  4WJN A;  4DXG A;  3ZW3 A;  3T8M A;  4ZRJ A;  2ZVN A;  4PYZ A;  2LVO A;  3VTU A;  3WCQ A;  3B08 A;  1TY0 A;  5C2T B;  5AZH A;  4ZRK A;  2Y5C A;  1MFW A;  4MEM A;  3K9O B;  2I1K A;  3Q3J A;  4G0N B;  3K9P B;  1FRR A;  3VXW A;  2K6D B;  5G55 A;  4WIP A;  2QMT A;  2C5L C;  4W9F A;  1WXA A;  2G45 B;  3R3M A;  3W5U B;  3W9C B;  4YSX B;  4XZ4 A;  2LVP A;  3V05 A;  3VTW A;  5JH5 C;  1K8R B;  4MGZ E;  2FUH B;  5BYR A;  3Q3M C;  4WWO A;  1F52 A;  1F0Z A;  3PSE B;  4ZYS A;  3JSV B;  4DHZ B;  4AJW A;  1FNV A;  2PIA A;  5LNK 1;  2A4Z A;  2WDT B;  1HTQ A;  3TEY A;  1OQQ A;  2N9E B;  4MJS B;  4JGH B;  4OZC A;  2OHF A;  2PTL A;  2BYE A;  3AEB B;  3VAW A;  4E3C A;  4REZ A;  1C4A A;  3H7P A;  4ARC A;  1UF0 A;  3L17 A;  1WIA A;  1PFD A;  4B9K A;  3IHP C;  3QIJ A;  1FPY A;  3AEF B;  5JHA A;  3SFE B;  2PMV A;  2NBW B;  3AEE B;  1MPE A;  2UU7 A;  2C7N B;  2NTS A;  1QOG A;  3M95 A;  4RGO S;  1J0G A;  5D3I B;  1IPG A;  1F9J A;  1V2Y A;  1XLP A;  4NAW A;  2V4L A;  4XDD A;  1EWY C;  1HQR D;  3U2S C;  1FD6 A;  1GPX A;  1ZPS A;  1Q0W B;  4FHK A;  3E56 A;  3LXF A;  4N9F 4;  3PTF C;  4N59 A;  1I35 A;  5DPS A;  3WAP A;  1FFU A;  4ZRP A;  3Q14 C;  2XK5 A;  3ABV B;  4MGK E;  2MQJ A;  4DK5 A;  4DXA B;  4US8 A;  3R7R A;  4TQ0 A;  2VRR B;  2KHW B;  4YSY B;  2WXG A;  3AE7 B;  2WLB A;  1XLQ A;  1FO4 A;  4JPS A;  3L10 B;  4YXD B;  4FLH A;  1R7S A;  4C4V A;  2BF8 B;  2K8B A;  3ZGZ A;  4K3C A;  1XLO A;  1EU4 A;  2LJI A;  4IUM B;  3ZQ4 A;  1QQR A;  4HWI B;  2REX A;  2WX0 A;  3EUB 2;  4G3X B;  4M0W A;  4BKT A;  2LUE A;  1HA5 A;  1ENF A;  4JE3 B;  4B0M A;  2KDI A;  2WXK A;  1YJJ A;  3LJ3 A;  4EZJ A;  3MJW A;  2MHJ A;  5KHQ A;  2HE7 A;  2Y3A A;  1H8C A;  3R2I A;  1YN5 A;  1UWM A;  4XWT A;  1WM2 A;  3RNE C;  1WYG A;  5AEK B;  1CK1 A;  3P4Q B;  3OG5 A;  1B9R A;  2HTM E;  1V6E A;  3DHI C;  1UWX A;  2DEN B;  2NVU I;  3V60 A;  5BO4 B;  3WAO A;  4BKS D;  5HKH A;  2M19 A;  3KUZ A;  5AUI A;  2B3A A;  3OAW A;  2D3B A;  2CS4 A;  5G5G A;  4PK1 A;  2GB1 A;  2NBV B;  3BYY B;  4C80 A;  4NAW B;  2O6V B;  3UIP B;  2LXA A;  3LB8 C;  2BS3 B;  4IM2 A;  3FIL B;  1HE8 A;  1K51 A;  2J0J A;  1PDX A;  1CQV A;  2CR5 A;  4CO7 A;  5EE3 A;  1P7F A;  1ZE3 D;  3IXS A;  4LDT B;  1C1Y B;  2IDY A;  2DX5 B;  1J8C A;  1ZP0 B;  1VZ7 A;  4KIK B;  4FHJ A;  2QJL A;  5J17 A;  1WF9 A;  2Z0E B;  3TEX A;  4HKQ A;  2D2Q A;  1JWA D;  2M17 A;  3IBE A;  2KK8 A;  4YL8 A;  2GBR A;  1VCB A;  3VH3 B;  3CST A;  3EHV A;  1JML A;  3KWL A;  4IM0 A;  1QLB B;  1XLN A;  3PLU A;  1GOZ A;  4M8M A;  1OEY A;  2L8J A;  4MT5 A;  2QEJ C;  5D7G A;  4J6I A;  3HRD D;  3MC0 B;  1KRH A;  2AL3 A;  3VRB B;  4LNO A;  4ZYN A;  2MCN B;  3RZF A;  3IVF A;  5KHO A;  3TJP A;  2CU1 A;  4MJS A;  2RR9 A;  4HRS A;  1SBB B;  2V0G A;  2WXI A;  4KGT A;  1SIF A;  2L76 A;  1JRU A;  5EE1 A;  2LD9 A;  5EE9 A;  4ZOH C;  2LGD A;  3URY A;  2WXL A;  1SF0 A;  3H7S A;  3V6E B;  2ZCB A;  2KC1 A;  2D5G A;  1F77 A;  1T0R C;  4KX6 B;  1IGD A;  5D94 A;  4D2K A;  4OHJ A;  1ZKH A;  4HDO A;  4AQ7 A;  1WXM A;  2V4I B;  1EO6 A;  1N6Z A;  3PT2 B;  3W1Y A;  5T8I A;  4YSZ B;  2DAJ A;  1FIQ A;  2QIE B;  2M8S A;  2JWZ A;  3DHG C;  2X8X X;  3UQA A;  2CHW A;  3UI3 A;  4JWS C;  1Q1O A;  1LQB A;  2JXX A;  1MG4 A;  4XC2 A;  1WMH B;  1C4C A;  2BGF A;  3ZNG C;  4WAF A;  3VUY A;  4AUQ C;  2G4D B;  1SGH A;  4CYE A;  2KVR A;  4PYU A;  2GLS A;  1ZXI A;  1IUE A;  1CMX B;  1P98 A;  1TZO A;  1WGK A;  4GB9 A;  2V3P A;  5IAA C;  5FK9 C;  1YD8 U;  2BYV E;  2JZP A;  1HXY D;  2QDF A;  3UQB A;  2IZV B;  1FMA D;  3QAQ A;  3RPF C;  3H6N A;  2J0M A;  1P0R A;  4FUL A;  1DOY A;  1EUV B;  1WJ6 A;  2DHZ A;  4WJO A;  4OVZ A;  4PS3 A;  4H2A A;  5L83 A;  2N7J A;  3Q8F A;  4ANX A;  5D3D A;  2ICI A;  4M00 A;  2CJO A;  4P1C C;  1YOV B;  4FXC A;  2K8H A;  4BZA A;  3J9C A;  2MEK A;  2DLB A;  5IOI A;  3ZDM C;  2KWD A;  3DOW A;  2ZEQ A;  4KKI A;  1SEB D;  2KZR A;  3GP7 A;  2J52 A;  4KZ0 A;  1N62 A;  2WXM A;  5CHW A;  4YTN B;  1TS4 A;  1L7Y A;  3ALB A;  1KLG D;  3BII D;  1WWT A;  2DZK A;  3GE8 C;  3N9Y C;  2KJ6 A;  4A90 A;  2R2O A;  4G50 A;  4GOC A;  1NYQ A;  4WAA A;  3W5V B;  1Z2M A;  3N1Z C;  2MSE D;  1FNW A;  2PVG C;  1C79 A;  1K53 A;  2L1A A;  3APC A;  3NVZ A;  1BT0 A;  3O65 B;  4K7W A;  4HPP A;  2GBN A;  2KX3 A;  4EEW A;  3A9K A;  3VQI A;  5J18 A;  4LTU A;  1Q5W B;  1WX8 A;  1F1H A;  4K7S A;  4DHZ E;  1FRD A;  3T3O A;  4K3B A;  3VR8 B;  4DQO C;  1I4H A;  3RUL A;  4US9 A;  2LXC A;  3P4P B;  1L6V A;  3DBH I;  3DVN V;  1ZW7 A;  3BVZ A;  2GRI A;  3QK0 A;  4MSQ B;  1G6J A;  4NY0 A;  1R4M I;  4MSM B;  1Y56 A;  2Z59 B;  3MTN B;  4EFO A;  2FID A;  3SHQ A;  4NJ7 A;  3MFG A;  2PVO D;  1IBX B;  4GDL A;  1E7V A;  5J2R A;  4PS7 A;  4W9C A;  3H8H A;  4K1R B;  3PZD A;  2KDB A;  1MHX A;  3Q69 A;  1WXV A;  3QHT A;  1F2R C;  2JWU A;  3U4E G;  4NQL B;  4NAM A;  3EC8 A;  1GC6 A;  4KKJ A;  1YIW A;  4PT5 A;  4KIK A;  1WGY A;  4HCN B;  1FXA A;  3HVZ A;  3Q8A A;  4WQM A;  3DDC B;  4EOY A;  4ICU A;  4K81 A;  4A9A A;  1NI2 A;  1WRD B;  4FAD A;  3QC8 B;  4F8C B;  4KSL C;  3RCZ A;  3RNG C;  4C4V B;  1V1P B;  2O6V D;  2G9H D;  2WU2 B;  4Q2J A;  2L3Z A;  3DBL B;  2WDR B;  1U4A A;  3AUL A;  4TMA B;  1YJ1 A;  4NPN A;  4AWJ A;  1ZOY B;  3ML8 A;  4NJ6 A;  2FCN A;  2PKO A;  1YQ4 B;  1UBI A;  2JRI B;  3UF8 A;  4RMA A;  2N9X A;  4I6N B;  4DDG D;  1WSP A;  1WGH A;  1NEN B;  1TS3 A;  3P63 A;  4DDI D;  2INP E;  3C19 A;  3QX1 A;  3PRM B;  1E7P B;  5BYQ A;  2EKI A;  1EWC A;  1MG8 A;  3VHT C;  3W2D A;  4LNK A;  2L83 A;  3L0W B;  1WZ0 A;  3NY5 A;  4L1B A;  3Q8B A;  1Z5S B;  1JRP A;  2FUG 1;  1D5Z C;  4B95 A;  1C77 A;  4KVG B;  5JZE B;  3M63 B;  2C7M B;  4LNN A;  2WXO A;  2VH1 A;  3MC8 A;  4MM3 A;  2RSU A;  4WUR A;  2X38 A;  2ZNV C;  1D6E C;  3NZU A;  1CJE A;  1PYW D;  3ZTC A;  5GMV A;  3Q2A C;  4NJC A;  1XO3 A;  4ANU A;  2CHX A;  3AE2 B;  3KLS X;  1IBX A;  2BB5 A;  3PRP B;  1C4P A;  3EFC A;  3FKY A;  4LJO B;  4C7Z A;  2W55 A;  1UZX B;  4N58 A;  2QHO A;  1I4R A;  1P3Q U;  4IWO A;  2V1Y A;  4AJY B;  1WI0 A;  4HEA 1;  3O13 A;  3BYT B;  3VR9 B;  2Z8L A;  1WGG A;  2LWP A;  3KH0 A;  2LRU A;  2N7E A;  1HZ6 A;  2KC2 A;  3RNF C;  3SEB A;  1WR6 E;  4TSS A;  2WXP A;  3V62 A;  3BZD B;  4E74 A;  5L95 C;  2QCZ A;  3HVD A;  3PVL A;  4L23 A;  1NDD A;  1V97 A;  1I4P A;  4JL9 A;  2DZJ A;  1E8Y A;  3UIO B;  1V86 A;  2KQ7 A;  1FXT B;  2KDM A;  1WX7 A;  2NMQ A;  2IPK D;  4NZL B;  3AB5 A;  3R8B A;  1ZGU B;  1HTO A;  3ZTD A;  1WGD A;  1KH0 A;  3I5J C;  1TKE A;  1TT5 B;  3ZUN A;  1RWS A;  5AUK A;  2N1W A;  2JY6 A;  2Q5W D;  2IGD A;  3PGE A;  3L16 A;  4IWQ A;  1ZUD 2;  2WXR A;  1JW9 D;  1GAQ B;  3B0A A;  3V6C B;  3I9V 1;  4M0W B;  4I6P A;  3TBL D;  4BBN F;  1JAL A;  2G4S A;  1OTR B;  1D5X C;  4FJY A;  1NYR A;  1PGB A;  5FR3 A;  1HZ5 A;  1I7H A;  2LRW A;  3AEA B;  5HHD G;  2FCS A;  2JX5 A;  1T0Y A;  2KTF A;  3MHS D;  2NTT A;  2AL6 A;  1MJD A;  3NRZ A;  1RFK A;  3RUI B;  2JPH A;  4IOI E;  3V61 A;  1P1A A;  2ZZP B;  3MP9 A;  4W9L A;  2LGX A;  2KD0 A;  3OWE B;  1RLF A;  1RFA A;  3BVM A;  1OQR A;  2RMM A;  2RDH A;  1ACC A;  3DWM A;  4KGR A;  2VZK D;  2RPV A;  1FCC C;  1AAR A;  1N5W A;  1YNT E;  2PPH A;  2N9P C;  2DBY A;  2VZK B;  2KTR B;  4G11 A;  3AE3 B;  1TY2 A;  4JIO U;  3VUX A;  2EMS A;  3AE8 B;  1D3Z A;  3U7D A;  1CZP A;  1L5P A;  2ZJD A;  4I6L B;  1V9J A;  1KLU D;  3AN1 A;  4UDU C;  5C23 A;  3QA8 A;  1LFD A;  4LJP B;  3RT3 B;  4GGQ A;  5DPR A;  2MBB B;  1LM8 B;  3DBH B;  1I4X A;  2JRH A;  3TIX A;  2J0K A;  4W9G A;  3CMM B;  1JQ4 A;  3H7P B;  4BKG A;  2YEP F;  4GIV A;  5IA7 A;  2KOX A;  3TSS A;  1IP9 A;  2PJH A;  3DPD A;  2DAF A;  1UUP A;  2EEL A;  2WX1 A;  2L05 A;  4BAX A;  4J3O D;  3W1S A;  5GXG B;  2M4N A;  2J42 A;  4II2 B;  2RGF A;  2UWQ A;  5LXI B;  2MJD A;  5G5H A;  4YT0 B;  3VRA B;  4WJQ A;  2RDB C;  3DBR I;  4CHK A;  2AEH A;  1V81 A;  2IY1 B;  2I2Y A;  2PLP A;  1YMH E;  1R4M B;  4GMV A;  4WWP A;  5CHF A;  2XNA C;  3C8Y A;  2DYM A;  2L00 B;  1H4R A;  4WJP A;  2ZW0 A;  1BUI C;  3PS6 A;  2M1M A;  2MJE A;  1ISN A;  3KWV A;  1NI3 A;  1I4G A;  2KDF B;  1XD3 B;  4BOS C;  1N63 A;  1E10 A;  5BMH A;  2OOB B;  4S0R A;  3L13 A;  3ZDT A;  1QF6 A;  3P42 A;  1TS5 A;  5JHB A;  3VFK A;  1WM3 A;  3OJ3 A;  4MEL A;  2NPT A;  4K7U A;  4M8N A;  3BWU D;  1I4Q A;  1AYF A;  2BTE A;  3AEC B;  2MBH A;  5EE0 A;  3AI5 A;  3CSF A;  2D3A A;  2LZ6 A;  5HFY A;  2EMT A;  1QT9 A;  4M02 A;  1E8X A;  2M0A A;  2QIL A;  3DBL I;  4MGI E;  3ZNI D;  3JVZ X;  4EZK A;  1MVK A;  1KTK A;  4C00 A;  1V80 A;  4YWG G;  2W3S A;  4MH8 A;  4MGY E;  3AMZ A;  2JQR B;  2GBK A;  4W9I A;  5EDS A;  3N30 A;  2K5P A;  2WS3 B;  5DPT A;  4GN1 A;  1M94 A;  1OEY J;  3HM6 X;  2BYF A;  1FM0 D;  1XXG A;  3DBR B;  3IFW B;  4MH0 E;  1VRA B;  4P7I A;  4N6E B;  2WXJ A;  2IO1 B;  4CQN A;  2KFK B;  3A1Q A;  2GBJ A;  3U7Z A;  2E3T A;  1QOA A;  3KW5 B;  2XEW A;  4YTM B;  2SEB D;  4FA6 A;  2KFK A;  2K22 A;  3D32 A;  1J7A A;  3RMK C;  1TS2 A;  1UGJ A;  1RM6 C;  3QAR A;  3SD5 A;  1E8W A;  3AE9 B;  3NJT A;  4LK0 M;  2IJ0 A;  1XCQ L;  3GS2 A;  2BBC A;  2AYO B;  4O1N A;  1L0X B;  2KXJ A;  2HDE A;  3N32 A;  2ACZ B;  2WXQ A;  4GDL B;  3ZVV A;  5MPO A;  1LO5 D;  3A4S C;  5H8Y E;  1GG3 A;  3IAS 1;  1QOF A;  3BY4 B;  5JXV A;  1T0S C;  3DBS A;  4KDI C;  3N1Y C;  2K39 A;  5FR6 A;  4ZDV A;  1STE A;  4IG7 B;  1ET6 A;  2IO0 B;  4F1S A;  4KDL B;  2BS4 B;  1WX9 A;  1K52 A;  1V5T A;  2ZCC A;  1V1P A;  2WHI A;  3FIL A;  2B76 B;  2WWZ A;  1V1O A;  2GBM A;  1WXS A;  2R2Q A;  4A3P A;  1T5X D;  2HTH A;  2KVZ A;  2IO2 B;  4BKS A;  2BQQ A;  4AS1 A;  4EE2 A;  3PZ8 A;  2J7Q B;  1UEL A;  2MBQ A;  2RPQ A;  2CHZ A;  4IWP A;  5HI1 A;  4A20 A;  1PGA A;  1YX5 B;  1VZ6 A;  1TZ1 A;  1K50 A;  1E8Z A;  3QCA A;  2EKE C;  3APF A;  4A55 A;  3DCG A;  2LMC A;  4OZA A;  1JWU D;  2D11 A;  2IO3 B;  4B0E A;  2BB6 A;  3M62 B;  2BKR B;  4RGM A;  5E6P A;  5G2N A;  1ZDV A;  2LGI A;  1SE4 A;  2KAC A;  3BIN A;  1JRO A;  3RNC C;  2IND C;  4LDT D;  1YQB A;  4W9J A;  4DBG A;  4A6Q A;  1SE2 A;  2K9X A;  1WJN A;  1E9M A;  2ON8 A;  4HDQ A;  2GOW A;  2W54 A;  4HXD A;  3EEC A;  1J19 A;  4HCP B;  4FJV B;  3VH4 B;  1ZDX A;  3DHH C;  4RM8 A;  2JUO A;  2JZZ A;  2PE6 B;  2K8C A;  1TKG A;  2Y5B B;  3Q3N C;  2BWF A;  1VR9 A;  3P4S B;  2OED A;  2YLM A;  2ASQ A;  1WYW B;  4RNA A;  3E9S A;  2BW2 A;  4ITK A;  3NS1 A;  2V9H A;  2ZPY A;  1P7E A;  4RGT A;  2INN E;  5C1Z A;  2BT6 A;  2FCM A;  2FIF A;  3ZNH B;  1XT9 B;  3ZJT A;  3HK0 A;  3R2T A;  1D4B A;  5TSS A;  3FAH A;  4OVU A;  2H89 B;  1L2N A;  4XDC A;  1WGR A;  2UYZ B;  3A4R A;  1GB1 A;  4HJG E;  1TKY A;  2Z0D B;  3MC9 A;  2KJR A;  1SIJ A;  3Q8C A;  2LHD A;  2AQ2 B;  3OJ4 B;  5HG2 A;  4MDK E;  2SAK A;  3R7Q A;  3PHW B;  2WXF A;  3H1U A;  1Q10 A;  1WRI A;  3DVG X;  2KAN A;  2IGH A;  1JWM D;  3CF6 E;  1I42 A;  2INC C;  2IGG A;  3PPA A;  1JWS D;  2QSD A;  1D5M C;  2KMM A;  1J7B A;  4ZHP A;  3V3X A;  3CWI A;  1GC7 A;  1IGC A;  2MX2 A;  1BML C;  3U30 A;  1X1M A;  1E6E B;  2IY0 B;  3P2B A;  4EKU A;  4XWW A;  2KNB A;  2L7R A;  1S3S G;  1Y8R C;  3ZRC A;  2G1E A;  2DYB A;  2N4F A;  1WY8 A;  2JF5 A;  3GE3 C;  2JU6 X;  2K0P A;  2KWC A;  3R66 C;  4OVV A;  2KQS A;  3VDZ A;  3KYD D;  3Q8E A;  2KDE B;  2KKC A;  2FAZ A;  2O2V A;  1EF1 A;  4GXB A;  4ARI A;  2L0T A;  1YX6 B;  4RH6 A;  3A9J A;  2E6X A;  4ANV A;  1N61 A;  2KMA A;  2D3G A;  3HUI A;  2V3S A;  2K6Q A;  4KZC A;  3C0R B;  1E7U A;  2BWE S;  5E6J A;  1BXT A;  2C9W B;  1P9D U;  4URK A;  2GI9 A;  3ZXR A;  4W9H A;  3WA0 A;  1ZXH A;  2AX5 A;  1PUT A;  2MA9 B;  5CHV C;  1V5O A;  2WDQ B;  1N60 A;  3AE6 B;  3U52 E;  1WE7 A;  1T6B X;  3RN9 C;  1VZ8 A;  3PO0 A;  4HKZ E;  1OQY A;  3DVN U;  2HJ1 A;  3NVY A;  3EGR A;  3I3T B;  3NOB A;  2M56 B;  1VD2 A;  2LGS A;  3NVV A;  2PE9 A;  4GDK B;  2KAJ A;  3ECI A;  3GZN I;  1NEK B;  1WH3 A;  3I57 A;  3CIR B;  1UBQ A;  3ENE A;  5C3J B;  4WH4 A;  2KLC A;  1YJI A;  1QIL A;  4KV2 A;  3W1S C;  3AED B;  2K1F A;  2MBO A;  2LGY A;  5IO9 A;  4W9D A;  1R4N B;  3JW0 X;  1GJZ A;  3WIM A;  2LJ5 A;  1AWD A;  1WXQ A;  1QKZ A;  1LGR A;  2DNF A;  2KQ4 X;  2N9K A;  2MP2 A;  1AW7 A;  4RFB A;  1T3Q A;  3IG3 A;  3QJZ A;  3GB1 A;  5D2M B;  4P1B C;  3ZXV A;  4II3 B;  2NS5 A;  5E6N A;  1NBF C;  1E5W A;  3LYY A;  2MP2 B;  3IT4 B;  5TR5 A;  2AQ3 B;  3KUD B;  3ZNZ B;  1KLV A;  3ZJU A;  2R61 A;  3VVW B;  4XE0 A;  3IAM 1;  2KWU B;  3N1X C;  2V3N A;  3A1Q B;  1TJE A;  3JYU A;  1QZE A;  1E90 A;  1WZ3 A;  2ZW1 A;  1TTN A;  2PW9 A;  3GZN B;  2BPS A;  2IYD B;  2WXH A;  3UGB B;  2BVC A;  2KYW A;  1VJK A;  3PZ7 A;  1FEH A;  2Y5P A;  4FN2 A;  3SFD B;  4ACF A;  3A9J B;  4BFR A;  2JYE A;  4RF0 A;  1MI0 A;  2L52 A;  3NUH B;  2LI5 A;  1YQ3 B;  3VTV A;  1L6U A;  4GDK A;  3ZLZ A;  4HVB A;  2JSV X;  2DWQ A;  3RFZ B;  3BK2 A;  2WNM A;  3BK1 A;  1WJU A;  2KO3 A;  5CX3 A;  3NZS A;  5DPW A;  4RGN A;  3TCA A;  3WAL A;  3TMP B;  1A5R A;  4HK2 A;  4TV3 A;  1TIF A;  3L4P A;  4HLE A;  2FBW B;  3GOE A;  3B2G A;  5LXH A;  3N20 C;  3KYC D;  2MLB A;  1XQQ A;  2AQ1 B;  1C9F A;  2XK5 B;  2WGS A;  2RD0 A;  2MBE A;  3A33 B;  1M4V A;  3APD A;  1OGW A;  2TSS A;  4GSW A;  1QOB A;  2KFJ A;  2NCN A;  3B2F A;  4MAC A;  3AEG B;  4LCD E;  2L0F A;  2OJW A;  3ZYY X;  4TUU A;  3DVG Y;  2D10 A;  2OJR A;  3AH7 A;  3ZO5 B;  3QQ8 B;  2J53 A;  4HPM B;  1DOX A;  1HEZ E;  2JVC A;  1TBE A;  2ZVO A;  5BMI A;  1RYJ A;  1KF6 B;  3PRE A;  4A3O A;  1GB4 A;  4W9K A;  2LHE A;  2JYT A;  2L32 A;  1XEE A;  5AZF A;  3L08 A;  1WE6 A;  1L4Z B;  3AM9 A;  2N9L A;  1UGM A;  4BOZ B;  3DQV A;  3PRZ A;  1FFV A;  3VUW A;  4JWU C;  3SR6 A;  1EU3 A;  3U8Z A;  3HIZ A;  4NQK E;  4JX1 C;  1V8C A;  2MWS B;  4DXF A;  3RI7 C;  4RCO A;  2YEP B;  2MW5 A;  2ZNV B;  4S17 A; 
#chains in the Genus database with same CATH homology
 1AN8 A;  1JRP A;  1KFY B;  1SJH D;  1VZ6 A;  2FUG 1;  1D5Z C;  4YXD B;  1R7S A;  1K50 A;  1C77 A;  3ZGZ A;  1L0V B;  1XLO A;  1EU4 A;  2BYT A;  2WXO A;  2LJI A;  1NVI D;  4A55 A;  2LMC A;  4OZA A;  3ZQ4 A;  1JWU D;  4KGS A;  4C7Y A;  1E0Z A;  4B0E A;  2BB6 A;  4WUR A;  1QQR A;  2X38 A;  2H88 B;  4RGM A;  3NVW A;  3EUB 2;  1D6E C;  1ZDV A;  1CJE A;  1DYQ A;  1PYW D;  2LGI A;  4M0W A;  1SE4 A;  2KAC A;  1HA5 A;  4IKG A;  1ENF A;  1N5X A;  4JE3 B;  4NJC A;  1XO3 A;  4B0M A;  2WXK A;  3AE2 B;  3KLS X;  4HRO A;  1YJJ A;  1JRO A;  2CU3 A;  1IBX A;  2BB5 A;  1C4P A;  4A6Q A;  1SE2 A;  2K9X A;  1E9M A;  2W82 A;  2ON8 A;  4C7Z A;  2W55 A;  2Y3A A;  1PGX A;  4N58 A;  2W54 A;  4LLG M;  2FE8 A;  1I4R A;  1ZDX A;  3R2I A;  1YN5 A;  1UWM A;  1SXT A;  1SE3 A;  4XWT A;  1TKG A;  2WU5 B;  1WYG A;  1CK1 A;  1VR9 A;  3P4S B;  3P4Q B;  2OED A;  4HEA 1;  3O13 A;  5BYS A;  3BYT B;  1B9R A;  3VR9 B;  2HTM E;  2Z8L A;  4ZHO A;  4RNA A;  3E9S A;  2BW2 A;  3KQ4 A;  1HZ6 A;  1UWX A;  4ITK A;  3SEB A;  3NS1 A;  1JCK B;  1A70 A;  4TSS A;  1P7E A;  4RGT A;  1UNS A;  2INN E;  2WXP A;  2BT6 A;  2M19 A;  3BZD B;  3ZJT A;  3HVD A;  5AUI A;  2LUM A;  3R2T A;  1D4B A;  5G5G A;  5TSS A;  5H92 C;  3FAH A;  2GB1 A;  2DYO A;  2JXT A;  3BYY B;  2H89 B;  2LFI A;  4L23 A;  4C80 A;  3AE5 B;  1V97 A;  1I4P A;  4NAW B;  4XDC A;  1VLB A;  3DWG C;  3LB8 C;  1GB1 A;  4HJG E;  1TKY A;  2BS3 B;  3FIL B;  1F2R I;  2NMQ A;  2KDM A;  2IPK D;  4NZL B;  3AB5 A;  1SIJ A;  3Q8C A;  1K51 A;  3R8B A;  1J7C A;  1JWB D;  2LHD A;  1PDX A;  2AQ2 B;  1CQV A;  3NZ3 A;  4TQ1 A;  5EE3 A;  5HG2 A;  2SAK A;  2J4X A;  1ROE A;  1KH0 A;  1P7F A;  1ZE3 D;  2WXF A;  3IXS A;  4P16 A;  1TKE A;  1EM7 A;  2IDY A;  1RWS A;  5AUK A;  2WQY B;  1Q10 A;  3ZJV A;  1L4D B;  1WRI A;  4C56 C;  2Q5W D;  2IGD A;  2IGH A;  2RDG A;  1XF5 L;  3AV8 A;  1JWM D;  1ZP0 B;  1VDV A;  1VZ7 A;  2QJL A;  1ZUD 2;  2WXR A;  1JW9 D;  3TEX A;  4HKQ A;  1GAQ B;  1JWA D;  3I9V 1;  2IGG A;  1JWS D;  2QSD A;  1D5M C;  2KMM A;  1J7B A;  2I38 A;  4ZHP A;  3V3X A;  3CWI A;  1IGC A;  3TEW A;  1JAL A;  1BML C;  1E6E B;  1JML A;  1D5X C;  3KWL A;  3IT6 B;  1OFF A;  1QLB B;  4XWW A;  1NYR A;  1XLN A;  1FXI A;  1PGB A;  1GOZ A;  5FKA C;  3ETR A;  5FR3 A;  1HZ5 A;  1I7H A;  2G1E A;  4MT5 A;  3B9J A;  2ONQ A;  2QEJ C;  3AEA B;  5D7G A;  5HHD G;  2JX5 A;  3HRD D;  3MJ5 A;  2K3U A;  3MC0 B;  1KRH A;  2JU6 X;  2K0P A;  3TEZ A;  2NTT A;  3VRB B;  1MHH E;  3Q8E A;  3MHZ A;  3NRZ A;  1RFK A;  2MJ3 A;  4IOI E;  1SB3 C;  4ARI A;  2XN9 C;  4OZB A;  3MP9 A;  4HRS A;  1SBB B;  4RH6 A;  3OWE B;  2WXI A;  3FC4 A;  4KGT A;  2V0G A;  2E6X A;  2BS2 B;  3BVM A;  1OQR A;  2RMM A;  1N61 A;  2RDH A;  1ACC A;  3DWM A;  5EE1 A;  4KGR A;  5EE9 A;  5BMG A;  2VZK D;  4ZOH C;  1C76 A;  2RPV A;  3HUI A;  3URY A;  2WXL A;  1FCC C;  1SF0 A;  4USA A;  1N5W A;  3T3N A;  5E6J A;  1BXT A;  1YNT E;  2GI9 A;  4IDI A;  2D5G A;  1F77 A;  2DBY A;  2VZK B;  1ZXH A;  2AX5 A;  1PUT A;  2LEK A;  4KX6 B;  1IGD A;  1B1Z A;  3AE3 B;  1TY2 A;  4D2K A;  4OHJ A;  4OW0 A;  3BVG A;  4AQ7 A;  4R3D A;  2WDQ B;  4YTP B;  2V4I B;  1N60 A;  3AE6 B;  3AE8 B;  3U52 E;  4RF1 A;  4L1B A;  1CZP A;  5T8I A;  1T6B X;  1L5P A;  1FIQ A;  4YSZ B;  2QIE B;  1VZ8 A;  2CJN A;  3PO0 A;  4HKZ E;  1KLU D;  3UI3 A;  4L2Y A;  3AN1 A;  4JWS C;  4UDU C;  3TUO A;  3P4R B;  1L0Y B;  2KN4 A;  1SJE D;  3NVY A;  3EGR A;  2M56 B;  1C4C A;  1I4X A;  3NVV A;  4WAF A;  4ZRQ A;  1XCT L;  4GDK B;  2KAJ A;  1ESF A;  1JQ4 A;  3AE4 B;  2YEP F;  4P6V F;  1NEK B;  1IUE A;  1ZXI A;  3EA6 A;  1TZO A;  3I57 A;  1WGK A;  3TSS A;  4GLS C;  2V3P A;  5FK9 C;  4MM3 B;  3CIR B;  1UUP A;  2EEL A;  2JZP A;  1HXY D;  4WWM A;  4J3O D;  1FMA D;  3W1S A;  1ET9 A;  5GXG B;  5C3J B;  4WH4 A;  2J42 A;  1YJI A;  3RPF C;  1QIL A;  2WDV B;  3AED B;  1SSN A;  2MJD A;  1TYG B;  5G5H A;  4YT0 B;  1DOY A;  3AE1 B;  3VRA B;  2WP9 B;  1YN3 A;  4OVZ A;  4H2A A;  2N7J A;  3Q8F A;  2I2Y A;  2PLP A;  1YMH E;  1AWD A;  1WXQ A;  5D3D A;  1DGJ A;  1QKZ A;  2XNA C;  2ICI A;  1FCL A;  3C8Y A;  2DYM A;  2N0S B;  2KQ4 X;  2CJO A;  2ZW0 A;  2N9K A;  1BUI C;  4FXC A;  2MJE A;  3J9C A;  1AW7 A;  4RFB A;  2MEK A;  2DLB A;  2W3R A;  1C78 A;  1FNU A;  1T3Q A;  2KWD A;  4KKI A;  3KWV A;  1NI3 A;  3GB1 A;  1I4G A;  4A8X C;  1SEB D;  1N63 A;  1E10 A;  1YN4 A;  5BMH A;  1DOI A;  3GP7 A;  5I4D A;  2MH7 A;  3P1M A;  3LYY A;  3IT4 B;  2J52 A;  2AQ3 B;  1N62 A;  2WXM A;  1QF6 A;  3P42 A;  1TS5 A;  3ZJU A;  4YTN B;  1TS4 A;  2WXN A;  2R61 A;  4DXG A;  4XE0 A;  1KLG D;  3BWU D;  1I4Q A;  1AYF A;  2BTE A;  3IAM 1;  3BII D;  1WWT A;  2V3N A;  3AEC B;  3N9Y C;  1TJE A;  5EE0 A;  4A90 A;  3WCQ A;  2ZW1 A;  1NYQ A;  2PW9 A;  5HFY A;  3W5V B;  1TY0 A;  1QT9 A;  5C2T B;  1FNW A;  2PVG C;  2M0A A;  2Y5C A;  2QIL A;  1C79 A;  1K53 A;  2L1A A;  2WXH A;  3NVZ A;  1VJK A;  3PZ7 A;  1FRR A;  1KTK A;  1MVK A;  1FEH A;  2Y5P A;  4YWG G;  3VQI A;  2W3S A;  4MH8 A;  3AMZ A;  4LTU A;  3SFD B;  4WIP A;  2JQR B;  2QMT A;  2JYE A;  4RF0 A;  1MI0 A;  2K5P A;  2WS3 B;  2L52 A;  3NUH B;  1FRD A;  3W5U B;  3T3O A;  3W9C B;  4YSX B;  3VR8 B;  4DQO C;  3V05 A;  1I4H A;  1YQ3 B;  1L6U A;  4US9 A;  3P4P B;  1L6V A;  1FM0 D;  1XXG A;  2JSV X;  2DWQ A;  3BVZ A;  2GRI A;  3RFZ B;  3BK2 A;  5BYR A;  2WNM A;  1VRA B;  3BK1 A;  4N6E B;  2WXJ A;  4CQN A;  1F0Z A;  1Y56 A;  4RGN A;  4ZYS A;  3L4P A;  3U7Z A;  1FNV A;  2PIA A;  5LNK 1;  2E3T A;  2FBW B;  3MFG A;  2PVO D;  1IBX B;  3TEY A;  3B2G A;  1QOA A;  4YTM B;  1OQQ A;  2SEB D;  4OZC A;  2K22 A;  2OHF A;  1J7A A;  2PTL A;  1TS2 A;  3AEB B;  2AQ1 B;  3H8H A;  1UGJ A;  1C4A A;  4REZ A;  1C9F A;  1MHX A;  1RM6 C;  4ARC A;  3Q69 A;  1F2R C;  1M4V A;  2JWU A;  3U4E G;  1PFD A;  3AE9 B;  4LK0 M;  2IJ0 A;  2TSS A;  4NAM A;  4KKJ A;  1XCQ L;  4PT5 A;  3GS2 A;  2BBC A;  3AEF B;  4O1N A;  1FXA A;  1L0X B;  1QOB A;  3HVZ A;  3Q8A A;  3SFE B;  4WQM A;  3B2F A;  3AEG B;  4MAC A;  4A9A A;  2PMV A;  3AEE B;  2HDE A;  1MPE A;  3ZYY X;  2ACZ B;  2NTS A;  2WXQ A;  1QOG A;  4GDL B;  4RGO S;  5MPO A;  5D3I B;  1LO5 D;  5H8Y E;  1XLP A;  1V1P B;  2G9H D;  3IAS 1;  4XDD A;  1EWY C;  1HQR D;  2WU2 B;  4Q2J A;  3AH7 A;  3U2S C;  1QOF A;  5JXV A;  2J53 A;  2WDR B;  1FD6 A;  1GPX A;  1ZPS A;  1DOX A;  1HEZ E;  4TMA B;  1ZOY B;  3E56 A;  3LXF A;  4N59 A;  2PKO A;  1YQ4 B;  1STE A;  5BMI A;  1FFU A;  4ZRP A;  1RYJ A;  1ET6 A;  1KF6 B;  2BS4 B;  1GB4 A;  2LHE A;  2JYT A;  2L32 A;  1K52 A;  1WSP A;  1XEE A;  3ABV B;  1NEN B;  1TS3 A;  1V1P A;  1L4Z B;  3AM9 A;  3FIL A;  3P63 A;  2B76 B;  4US8 A;  2N9L A;  1V1O A;  4TQ0 A;  2INP E;  1T5X D;  1FFV A;  2WXG A;  4YSY B;  1E7P B;  5BYQ A;  2EKI A;  1EWC A;  3AE7 B;  3W2D A;  2WLB A;  1XLQ A;  4JWU C;  4AS1 A;  3SR6 A;  1EU3 A;  2L83 A;  4EE2 A;  3PZ8 A;  1FO4 A;  4JX1 C;  4JPS A;  1V8C A;  4DXF A;  4RCO A;  2YEP B;  5HI1 A;  1PGA A;  3Q8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...