2J55A

X-ray reduced paraccocus denitrificans methylamine dehydrogenase o- quinone in complex with amicyanin.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMICYANIN
publication title Tracking X-Ray-Derived Redox Changes in Crystals of a Methylamine Dehydrogenase/Amicyanin Complex Using Single-Crystal Uv/Vis Microspectrophotometry.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 20
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2j55A00
1NDTA 3CVDA 1BQRA 5I26A 2YXVA 3AW5A 4G72B 4KO7A 4E9SA 4HHWA 2I7OA 1KCBA 4QLWA 1NIEA 4A67A 1BXAA 3RYMA 1XB3A 1J9QA 1JZJA 2JXMA 1QHQA 1TU2A 2ZXWB 2FQGA 4KNTA 3L45A 3SBRA 3H4HA 3NJIA 3TASA 4CSPA 3X1NA 5AFAA 1WA1X 2B3IA 1ILSA 1BYOA 3V9EA 1KDJA 2CBPA 2CJ3A 2HRGA 1JZEA 1NINA 2EIKB 4N8UA 2NRDA 1GS8A 3NP4A 2PCFA 3NSDA 3U25A 2VM4A 1BYPA 2HXAA 3UAAA 1EZLA 3QJVB 3OMAB 5A7EA 4NAJA 1CYWA 2E86A 4AZUA 1X9UA 1ZIAA 1A4BA 1UATA 5AKRA 4JHVA 1GSKA 3AG3B 1JVOA 4F2FA 2J5WA 1KBVA 1TEGA 3GXUB 1DYZA 2XYBA 2UX6A 1E65A 1QNIA 4EF3A 2EIMB 3X1BA 5I5IA 4PCYA 4UF7C 2WO2B 2PPCA 2ZWNA 3S3DB 4HCGA 5B1BB 2IWFA 4AKOA 4BDVB 4YSPA 1IBYA 1SDDA 4HCIA 3TBCA 2XUWA 2CUAA 3FSZA 2DWSA 1WA0X 4BDVA 1E67A 4E9XA 2H47C 4G7RB 2UX7A 2X87A 4W1TA 3WKQA 3S8FB 3NJGA 1PZBA 1NIFA 2FNWA 2AZUA 1J9RA 1SFHA 2TSAA 4GP8B 2X88A 3FU9A 5I6PA 1FA4A 3NSYA 2IDQA 3WNIA 2DV6A 3AY2A 1ASPA 2I85A 1PLCA 2FT6A 4F2EA 2XV0A 3EH3B 1KGYE 2B08A 3PAVA 3IN2A 4UAHA 4G71B 2ZONA 5I6KA 2BO0A 4DPAX 2AVFA 2EIJB 1JXDA 4G70B 2HZHA 5ANHA 1GR7A 2CAKA 6PAZA 3IEAA 1OCOB 1JERA 1PLBA 1PCSA 4DP0X 4YSDA 1A8ZA 4BWTA 3TU6A 2JKWA 5B1JA 1ID2A 1AG0A 2BW4A 1FFTB 2TSBA 3WKPA 7PAZA 1BQ5A 5B1KA 2W88A 3QQXA 1L9SA 3ABGA 3PAUA 2PPEA 4BWUA 3PPSA 4MFHA 4HHGA 2PLTA 4KO9A 1JZIA 2DY2A 2QDWA 2ZOOA 2AFNA 4E9TA 3ZIYA 1PAZA 4BXSV 2W8CA 4HAKA 5PAZA 1L9OA 3FQ1A 3FPXA 2A3TA 3AG1B 5FC9A 1AZNA 5IY5B 2YARA 2N0MA 1N68A 2YXWA 4AKQA 1F56A 4P5RA 3EH4B 1AZCA 3QJUB 2YAFA 1MG3C 1HAWA 2BP8A 1L9RA 1OE1A 1AQ8A 1W8EA 2FT7A 4YSQA 1NTDA 1PNDA 1A4AA 1PNCA 3EHBB 3FYIB 3TBBA 2DYRB 2PCYA 1RZQA 5E9NA 5I5JA 1L9PA 1RCYA 5EHFA 1QLEB 3NJLA 3QJSB 5B7MA 4KOCA 2JFCA 1T5KA 4E9QA 5I6MA 4F7KA 1SFDA 2Y69B 5B7EA 2BZCA 1BXUA 2P80D 2Q9OA 3OD3A 5D4IA 3CVCA 1PZCA 3FPYA 2UXTA 2BWDA 4W9ZA 2LLNA 4WTQA 2IDFA 2XWZA 6PCYA 3FT0A 1JZHA 3V9CA 2XVBA 1GS6X 4NERA 2VW4A 3TA4D 1CYXA 2QDVA 1CC3A 5D4HA 2IH8A 3AG4B 1PLAA 1AS6A 2GHZA 3T71A 1DZ0A 3CG8A 1ET8A 4DP5X 2XV3A 4YSSA 3AZUA 1XB8A 2FT8A 3S3CB 9PCYA 1BQKA 2YAEA 1WS8A 3NT0A 1SJMA 5I6OA 1E30A 1SDDB 2CCWA 3FSAA 2IAAC 1NIBA 1ZIBA 3MBWB 2H3XC 5TK2A 1J9SA 4BK5C 1GS7A 1L9QA 3MX0B 8PAZA 3FU7A 1ET7A 3FQYA 4X4KA 1JVLA 3OMIB 5F7AA 3EH5B 3UABA 4WKXA 3NJFA 1ZPUA 1OOWA 2XX0A 2VW7A 4AKPA 4KNSA 1AANA 1TEFA 4ZK8A 1E5YA 5F7BA 4NB7A 1AR1B 2AZAA 1A4CA 3UGEA 4M3HA 2BP0A 2YAOA 1NIAA 4A2DA 2BZ7A 4YSOA 1X9RA 1M9WA 4DP2X 4ENZA 1NPNA 3UAEA 1NPJA 2VSMB 4HIPA 4A2EA 4YSEA 4Q89A 2DYSB 3FSWA 1W6WA 1PZAA 4YSRA 3KW7A 3AG2B 2XXFA 1KDIA 1V10A 1J9TA 1E5ZA 1RKRA 1OCRB 3WG7B 4YL4A 1V55B 2GC4C 4RH4A 3N2JA 3NJNA 1SHWA 1EHKB 3IBOA 2PPFA 1MZZA 1PF3A 2I7SA 2VW6A 2H5UA 2VM3A 4HALA 2PP8A 1IBZA 2XU9A 1AAJA 1NIDA 3NJJA 4G7SB 1TKWA 1WA2X 2UXGA 3HB3B 3S3BB 2J55A 4DP6X 2VN3A 1PY0A 2GSMB 3ZBMA 2MTAA 2FQDA 3PXLA 1GW0A 4A2FA 1GY2A 3T6XA 3OMNB 3CVBA 1IUZA 2HX7A 4DP8X 4A68A 3NJMA 3NJHA 4Q8BA 2UXVA 2BP8B 2VMJA 5B1AB 2QPEB 2XXGA 4YSCA 1ZDQA 3QJQB 1IKOP 1AACA 2AANA 1VLXA 1OE2A 2BHFA 2YAMA 1OE3A 3NJKA 3JTBA 1URIA 1J5CA 2BW5A 5I6LA 3X1EA 1AS7A 2OV0A 4BXVA 4N4YB 4JHUA 7PCYA 3ASNB 2R7EB 2XV2A 4M4RB 2GBAA 2MRYA 4KNUA 1JZGA 4P5SA 3SBPA 4DP1X 3PCYA 3FYEB 3NP3A 3X2QB 3G5WA 2PPDA 1GY1A 2R7EA 2XLLA 5I5MA 3GYRA 4YSAA 3NSCA 5LDUA 1OCCB 2Q5BA 1WAEA 2VSKB 2WSDA 2YAHA 3T9WA 3CDZB 3SQRA 4GP4B 1AZRA 5D4JA 3FU8A 1AIZA 3ZX1A 4QKTA 1BXVA 3EF4A 4A2HA 2HRHA 3ERXA 3CDZA 4A66A 4E9RA 3CZUB 3S8GB 2OCCB 2HX8A 4JKNA 2IWKA 1FWXA 3QJRB 4K9JA 4GY4A 4FAAB 3PLYA 3KW8A 3HEIB 1AS8A 3QPKA 4KO6A 1ADWA 1SF5A 2FQEA 1SNRA 3IE9A 4AI7A 5I6NA 3T6ZA 3FU7B 1SF3A 1I53A 4DPBX 4E9YA 5B3SB 3ABLB 3H4FA 1NICA 1HFUA 1ASOA 1JXGA 2IDSA 2GI0A 2IH9A 1AZBA 3DTUB 2EILB 2RACA 3OQRA 1ZDSA 2J56A 2BWIA 2J57A 3QJTB 1CURA 2PP7A 3GDCA 1A3ZA 3BVDB 1M57B 2BP0B 4HCFA 5B7FA 1MDAA 1ASQA 4YVNA 1OF0A 2FQFA 3WNJA 2IWEA 1KV7A 1B3IA 2UXFA 2HX9A 1BAWA 3C75A 4UANA 1IC0A 3NSFA 5PCYA 2YAPA 4KOBA 5TK4A 3PAZA 1R1CA 5AZUA 2GB2A 2YQBA 4HZ1A 3SBQA 4YSTA 2P80A 3T6VA 2FTAA 3FSVA 4KO5A 1SHXA 3UACA 3DKHA 3H56A 1GYCA 3X1GA 2IDTA 1MZYA 4L0PB 4YVUA 4PAZA 1BEXA 4DP7X 1M56B 2WO3B 4GP5B 5B1JC 3WI9A 2GC7C 3ASOB 4YSUA 2DWTA 1WS7A 2HLEB 1ILUA 1KCWA 4FA7B 1V54B 2EINB 4DP9X 1AZUA 1NZRA 4GYBA 1OV8A 3JT2A 1KYAA 3BQVA 1RZPA 2YAQA 3D12B 3ABKB 3N55A 1HAUA 3IN0A 3ABMB 3FQ2A 2OJ1A 4G7QB 1XB6A 4CSZA 1MG2C 1ZV2A 1L9TA 4E9VA 5I28A 2IDUA 1NWPA 3T6WA 3NYKA 1PMYA 1AOZA 4A2GA 1JOIA 2QT6A 2GIMA 3ZDWA 2FJSA 3WIAA 1JZFA 1ETJA 4GXFA 2XX1A 3FS9A 4DPCX 1N70A 2CALA 3OM3B 1KBWA 1XMEB 2FWLB 1JXFA 4AX3A 2PPAA 1CUOA 1AG6A 4BWWA 2QPDB 3UADA 2PP9A 4DP4X 1W6LA 4E9WA 4TXVB 1NWOA 1ET5A 1OCZB 2Y1AA 1YLBB 3X1FA 3DIVA 1A65A 1J5DA
chains in the Genus database with same CATH superfamily
1WQVT 4O51A 1BQRA 4NS0A 3RHWF 3QEQB 1CDYA 4HKXB 4U1SB 2ZT9C 5GHWH 5AOIA 4LGSB 3PNWA 4Z3TA 3LKRA 4OLEA 1THCA 5C7XL 3BN9D 4K71B 5AVWB 3P3TA 4JPKH 1P9MC 5IIEA 3V4LA 4M8RA 2KS0A 3QXTA 2DQCH 2NY5L 2WINB 3LKNB 4Z3GA 4CW1A 4W9LC 1EXHA 3B2UC 2HT4D 4MNHB 5H37A 4RGNE 4N8VG 3QNYA 1MFCL 1VA9A 5AAMC 4K8RH 4TVPD 3UAAA 3QJVB 4F9LA 4Q9QH 3RKDD 3ULUE 1M6OB 2ENPA 4LEOA 1A4BA 4EI6A 2IVFC 2FNBA 3H2QA 4M8QB 1TOXA 2SODB 4TRPH 3EBIA 2Y06H 4MMYB 4XPAL 5G4OA 4XP1H 5IJVB 5KOVC 4ZMOA 1HOEA 3RIKA 1MCNA 4Z7QE 1HINL 1HYRC 2XYBA 1XIWD 1GYUA 4LLUA 1AY1H 4GLRH 2YKLL 4TLUA 1U21A 4TQHA 1OARH 4LSSH 4JUSA 1NUDA 1ED3B 3H6AA 4HLZH 2NZ9D 5F72S 3HHSA 2R69H 5HDQH 4XVSH 5C0CE 4QRUA 5JHDB 1SDDA 1QEXA 1NL0H 2CUAA 1JI2A 3FSZA 3MBWA 4QY8B 3W57A 3V0GA 4L05A 4OFYD 2DWSA 1CLOH 2IQ9H 4G5AA 4IOIB 4R7NB 1A6VL 4OBRA 3TPUB 1RJZB 2AQTA 2J4WH 1LO0H 3NFNA 3BDBA 4CMHC 5I15L 5JPNA 1HHKB 1B2WL 4U4IA 5D9SB 2WBJB 4F3FB 3Q8AA 4WTZG 1U8KB 2JI1A 2XQYA 5HDBB 2TSAA 5C0RH 2FWOA 4JZJA 3CUPA 3IFPA 3FU9A 3MLXL 3OGOE 2FEEI 4CBZA 3OLDA 3OLEA 4ZFZB 1PZ5B 1ZXKA 2EXYC 4OI9A 4TUJB 4F2EA 5JTWA 2ZUQB 3KWTA 5KJRL 3D0VB 2VKXA 1UA6H 2H7WA 4I4WA 4B3EA 4Z7OB 5A2CA 4Y4FB 1IC7L 2JE8A 2APXA 2AABH 2NSQA 3CXDL 1FHNA 3HAEH 4JKPL 2C1OB 4Y2OA 3VXTB 2G5BB 3MV8A 3U30C 4ZNEA 2RQ8A 1NGYA 2FEEL 3UTSD 1FC2D 3UPRB 3DECA 1XGZA 5GRUL 4L9LC 4FTVD 1YECL 2VO8A 3PV7A 4YSDA 1BW8A 1XAKA 2GIXA 3KGRA 4R3SA 4MA3A 1OTTC 2R1XB 4X7SH 2XFGB 3P9WB 5I23A 3I6GB 5SX5H 3WKPA 1RZIB 1YJDH 5LGYA 3I02B 3QQXA 4WZ9A 1GGIH 4RFEA 1IAIH 3DO7A 3UO8B 1E50A 4PUBL 1T21A 2R0LH 1N5YH 5ACMA 1FRGL 4Z77A 5I1KH 2C4FT 5DMYA 4TNVF 4M7JH 1J8HE 4HWBA 4Q0XL 1ROCA 3R18A 4WW2B 1RD6A 2HSIA 4HKBB 2C4XA 4ODVH 4OLWH 4XO4A 3VB9A 1F4XL 1FL3B 3F7LA 4L4TB 5IHUL 2HH0L 4OIBA 4YDJA 4JG1L 2BP8A 1L9RA 1O6SA 3BAEH 1UKSA 3QUZD 4JFYB 4PSRA 5D7SL 4BKLA 2AXHA 4FKKA 4JPIA 1U3HA 2W07A 3DRQA 4FQJL 3RVVC 3OBAA 4UOJA 1FZKB 2NY3B 4WSJA 1ZSHA 3UZEA 5HI4C 4QT5B 1KJ2B 2XA3A 5D2NE 4D9QD 3EXJA 5B7EA 3AUWB 3KXFB 4XXDA 3WKML 2P49B 3HC0B 4RAUA 4HG4K 4PRHD 5D4IA 3KBHE 3L4UA 2XI9A 3LQAH 3O3EA 1BVKB 2X6UA 3BVNB 4U3SA 3RZCA 3B3IB 3FONB 3BZDA 3GLEA 4WTQA 4YHPB 3WJMA 1SQ2N 2EVJA 3ECUA 4HBQA 1CTMA 1CZ8L 1EHLH 5FYKD 4HH8A 2DL2A 5ISZB 4X8JB 5AW9B 5DT1H 5LXVA 5IB2A 3KPSE 4G8FA 1C08A 2NTSP 4HU2A 4JDTL 2FB4H 4OLYL 1FAIL 1EJ6A 1ZLUK 5IMMB 4HVBA 4QHKJ 4L8BA 3C6LA 4DN4L 2ENSA 1TVHB 3LN5B 4KU1A 2R2EA 2HKFH 1JPFB 4BSWA 3NIDE 2X6MA 2W91A 1JE6A 4JFDD 3FFCB 1TJHH 5CP3H 1KNOA 3U2JA 5HHPA 3FSAA 4P2YA 4PJ9D 1U8QB 1I9RL 4KPHL 1S7WB 5GGSY 2VN7A 4KITB 5ITBL 4PS3A 5TK2A 3LH8A 1ZT1B 3KLAB 5EG6C 2DQJL 3H53A 2IXQA 1OGAE 4WKXA 4WHCA 1ZPUA 2BZDA 2QVMA 5EU3A 1P7QA 5KSAB 2KDGA 3NBNA 1HTYA 1KYDA 1LL1A 4AKPA 1RK1A 2HVBA 1PKQB 3IVKA 2YFOA 3ZE1B 1MVFA 5F7BA 1C16A 2ILLA 1CDBA 4XMZA 4ZUVB 1OGTB 3PP3H 2N7AA 2R39A 2YAOA 1IC1A 2A77H 2P9RA 4QJ4B 1MI5B 2XKNB 4U4BA 4N8CH 4KZCA 1T1WB 4TMPA 3D25B 4Y7OC 5DQJB 3QORA 3GK8L 4EQ2A 2V9RA 2OMWB 3TN0C 2RTTA 1NEUA 4ONFH 4HZAA 3M1CA 3APNA 2KZWA 3K4ZA 3GHEL 3OKNA 1H8LA 5I8CA 2CRIA 4ZS7L 4GS7C 4U6XA 3X11A 4NQCD 3BKML 1J9TA 4HZLB 4EN3B 1U30A 2K1MA 1KIUB 5IVXB 4M5TA 3QEUA 1TQCB 4ZMNA 4M48L 3EJPA 4V1DA 4EIZC 1CFBA 1FZMA 4Y1TA 4JQIH 5HI5D 2N59A 5LG6A 2HTKD 5IBTH 3UBFA 4CN6A 4DUWA 1BOGB 2X7LB 4J5VA 5BVPH 2VQTA 2WTPA 4WI6A 1LO5A 3WIIH 3HZ3A 4KY1H 1TKWA 1J7VR 1KIRB 1QTYT 4HC1A 4JRXE 2MNWA 3LEVL 4R4FH 3S3BB 5L8KB 5K9KB 4JFPB 1YNTF 1NDMA 3OXRA 1LJMA 3GB7B 3OMNB 4W93A 4X2UA 4DP8X 5DK3A 1GJUA 1OAJA 5H37G 2K78A 3CFKB 4R7LA 4JLRA 4L3ED 5DD1L 1RPKA 3OF6A 1XX9C 5EIVA 1EXUA 2DMCA 3T2PA 1NFIA 3EYOA 4NPYA 5C86A 1HHJA 1K6QH 2BNRB 4MRCA 1EJOL 3E3QC 5IFHL 4DKAA 2NT1A 5TQ2H 2DQDL 4FFYH 4U1NB 1JNNH 1DN2A 1URIA 3EHBC 5CU9A 5I6LA 1M2VB 2V7HA 2BX5A 1CL7H 3D48R 1SEBA 2B1HH 1BQUA 3MV01 2NR6C 3CFQA 7PCYA 2ZKMX 1HEZA 5E23A 3HPLB 2CUHA 2A6JA 1N3NA 1ZSDB 5BRZE 1SHMA 2HKAA 3P0YL 1BZEA 4MWFA 1VEMA 4WTXA 3SBPA 1UWGH 3PHQA 5CJXC 2AJXL 1MREH 3G6JA 4OLZH 3UG4A 1AGDA 2WVTA 4H25A 4WCYH 4BFOA 3IGLA 1CR9L 3V6ZA 2W9DH 3RVUC 1EJFA 1ERNA 4A7VA 1DEEB 2WQAA 4GRMA 2APVA 2D7QA 3MA9H 3NPSB 3S8WA 4RNRA 2PWDA 4BFJA 2CK2A 5DRNB 3LCYA 1DUYB 1MIEH 2QLVB 3L5XL 1D6EA 2DICA 1D3CA 4W9HC 3VCLA 4AGMA 3SQBB 1YQVH 3VG0L 2HX8A 2I9LA 3QNXB 1V7ML 2XQYG 3SQOH 3OXSB 3DROA 1N6UA 4M8UA 1A0QL 3PHOB 2V5TA 1OP3K 1FZOB 1T89A 3GMNA 4ZQKA 5BS0B 2DH2A 4LFHG 4UQEA 1S3KH 1LXMA 2HFGH 2CO3A 4O9HH 5JHLH 2V2XB 3FNKA 3ES6B 3I85A 5KYWA 4YHKH 3C5ZA 3UO1H 3WL9B 3WNKA 3CFNA 3IGKA 4RIRB 5FM8A 1MHHB 4PW4A 4LCCC 3LV3B 3GXDA 1HSAA 1D5MB 3BPOC 1DQJB 1CURA 5T3ZD 1CFQA 3BWUF 4YX2H 5D96C 3GMLB 4XVOA 3LIZA 1JIBA 2JKSA 5D93C 1YY9C 1ZTXL 3BJLA 3MRJA 2PUQT 5FW6A 5EMYA 4IRSA 3ZMRA 2VH5H 3D05A 2YD4A 1IEBA 4UIKL 5KVGE 1XXDC 5JXEC 1E27A 1J5OH 5EU6B 2A4CA 5E0QA 2DWYA 5FW7A 2G0KA 3LNEA 3BWAB 4Z7UA 5MENB 5DA0B 4KDTC 2VUYA 1DCEA 2JKXA 1BP3B 1U8OB 2GB2A 4JR9L 4J3OH 3NCCB 2FBOJ 2EEBA 4LOUC 3VA6A 4XN1A 2CM6A 1GYCA 4GFXA 4P2QB 4Z7NE 4XMVA 2HJKB 2UYLB 3EFFB 3V52L 3MLUL 3Q6GH 4GMSL 4GEIA 3FO9B 3C60B 3ECVA 3GWJA 2HLEB 4FULA 2AS5M 2J73A 2WTOA 1PD6A 1GJIA 4HWEH 1G7LB 3MGAA 1AZUA 2A9NH 4ZW7A 2QL1A 1WCQA 4YDZA 4Q97A 3BQVA 1XSOA 3N1PC 2GSGB 4XP4L 1CDUA 2ITCA 3AROA 3D12B 4NQDD 2VN6A 1EHXA 4GUQA 5HHME 1B6UA 3TO4C 1ZHNA 4DZ8A 5C0GA 4EOWH 1OD9A 3TNMA 3ABMB 3DMMC 1RI8A 2LR4A 4CSZA 1KCSL 3FFDB 1IGTB 4F7PB 1VDGA 5GIRB 5C07A 5KYYB 3QXVA 5IR1A 4BM7A 5GJSL 3I75B 3H9SE 4FCAA 4TN9A 5KVEL 2AXJA 1CDJA 3CC5A 3FT1A 4PJ7A 2BP5M 4N0FA 2NSMA 5GPRA 1F6AA 3SJVA 1J8SA 1NOAA 2BOBA 2LQRA 1ZLSH 4A55A 5HGBA 3ZL1A 1NKOA 4NP4L 1C5DB 2XX1A 1NGPH 1ZGLM 1N70A 3OM3B 5C0BB 1QZ1A 2ZCZA 2FWLB 4KKCC 5GS3A 1N64L 3QJFA 4TVPE 4BWWA 3OB0K 3DRTB 4P9HC 4KRMB 2A9CA 4W6WB 2MOVA 1F4HA 1DBBH 4OZGF 1KEMH 4GKZB 1R3IL 3D50A 3D4YA 5C2BL 3Q44A 3G04B 4K3DH 3UYRL 2V17L 1OK0A 3VRIA 2VDPB 4D9LH 2EVGA 3RBGA 3ULUL 3CLWA 2FWSA 4PGDB 1NMCB 1X9LA 2AQ3A 1NIEA 3AVEA 1UM5L 1XB3A 3VDBA 1A66A 3TBWB 4XB8A 2PTTA 1CXFA 3GMMB 4MQTB 4RAHA 4LDOB 3JWOH 4PGZA 1CXEA 3CX2A 2YOAA 1RZKL 2FJFB 2PWFA 2UY7A 3ML9A 2PCFB 4W6XB 2VITB 3SGJC 4KHTH 3EXLA 4H8HA 1U6AH 3CPLA 4N20A 4CRPA 1FNSH 4QOKE 2CDEA 5DLLA 4BV1A 4NOBA 2CJUL 1BYPA 4AMKH 2VDPH 4MQXC 2WMPB 3BSZH 3N06B 1N7MH 1KTDA 5E4EB 4Y9BA 4R90H 4CDHA 4HUWA 2DYPB 3WE1A 1DO5A 4JRLA 3LH2L 4JHVA 2A7BA 5D1XE 2X3BA 5B1CA 5FA3A 1ZE3C 3WELA 2J6EL 1S7SA 3D3VB 3D8MA 3MNZA 2DI7A 3AITA 4CSSA 4Y16D 3ZTJH 1YVLA 4ODWB 3X1BA 2FJGA 3RI5K 4GW5B 4ZOBA 4BK8A 4P9ML 2ARJA 3RY4A 1AHMA 1LLAA 5HJ3B 5CN3A 4Q6IB 1A7OL 2C5DC 4OTXH 3UTSE 2ERJB 1JGDB 4HCIA 4EN2A 1PAMA 1QHOA 3W56A 2D2CC 3H3PL 5DVOA 3A4AA 1HZHH 2H2PC 5EORH 1KN4L 4HF5H 1Q9LB 1VPOL 2FO8A 5DYOB 1GGUA 2IAND 1QA9A 4QXGL 3WKQA 5EN2A 2HFEB 3RIAK 3DPDA 2DQGL 3GBNH 2ZOKA 4EEEA 3OKYA 2WPGA 3MBEC 2OL3H 3WY2A 4NAQA 5B8CB 3MXWL 4MAYC 4KJWC 3V6OC 3VMPA 1UZ6F 3OJMB 4OGXL 4R84A 4IDLA 4ZX4A 1I9EA 3EYFA 2P5WE 4I3SL 4JO3H 2LFEA 4JGNA 1EVUA 2JJUA 3DXAE 5IFJB 4R4BB 2DTSA 2IH1B 4H88H 3FUFA 1MVUB 2ADFL 3DJZA 5DHYB 1ORSA 2HZHA 5KS9F 2XY2A 4U33A 3WU1A 2V8MA 4XCEB 5IROC 3QEQD 2UUDK 5AVZB 4NI6A 4OIIH 3ARTA 4BFNA 2ADGB 2CUMA 4IRZH 1ID2A 1F58H 3KYAA 4CC4C 3DDGA 1QFWL 2BW4A 5LO7A 2VDNL 4BD4A 5BXFA 5AYUL 4D9QE 3NTCH 2KL6A 3PJNA 4KVCL 4PRHE 5CSZB 2H1LM 4MS6A 4TM9A 4ZDHB 3LZFH 1AMXA 1MHCB 4JFXB 2BSSB 3SYCA 2W0LA 5AW6B 3WCYA 3TTYA 3GMRB 3IS0X 3O3BA 3P3SA 1EHNA 3I6KB 3V8CA 3HNTH 4V2CB 5DGRA 5DVKA 4GRWB 3V0HA 5BJTB 5FC9A 2UZIH 4F8PA 3VTAA 2HMID 1MFNA 3C9NA 4NZUL 4XPFL 5GZNA 1CDHA 3EH4B 4F5CE 4HXBL 4I2XE 5GS1C 2I07B 4I1PA 3FO2B 3DX3A 2JIXB 5E99H 1A6AA 3FYIB 1GGBL 3MGOB 1Y18B 2D31A 5F88A 1V3JA 3HN3A 4J8QA 5ALCH 4JFDE 3TBVA 2X0UA 2IBZX 5IW3A 1BEYL 2N0KA 5JLZB 3EOAA 4YMPA 3HE6C 4HJEA 4GRWH 3QPQD 4HS3B 2EICA 5JHDD 4W9JC 4P2OB 1OSEA 2EVFA 3MRNA 1INDL 1G94A 5GGTA 2BINA 2WQ8A 1PQZB 4E42B 5IK3B 4W9ZA 4OU3A 3JVFC 2PCPB 1ZLWH 1Q0YL 4F20A 3RWHA 1T0PB 1JZHA 2V5MA 2WBJD 5E6RB 1LDSA 3QG6B 4XO5A 1RUKH 2VW4A 2WVUA 1NEZB 4PB0H 5E8DH 4FQXA 4L8CA 3BI9X 4QAMB 4LLQA 5J9PB 2Z9TA 2CR0A 2X70A 3FOLA 3AWGA 2EDOA 3A4DA 4OZGE 4UT9L 5TE4H 3KPMA 1AQMA 4L37A 4P4KC 4DP5X 1NCBL 2VDKB 1GJWA 4PRPB 5FYLH 2ZSWB 3MNMA 1KC5L 3QCUH 3QZNA 5JDSB 1KLGB 4A04A 2NZIA 1E30A 1EMTL 1A7NH 4Y4FD 3VI3A 5F7WC 4AMWA 4KX8A 3VXUA 2EECA 4TSAL 1F2XK 4JHWL 2XG4B 4N0UB 3MRRA 4XMWA 3SB3A 1T04B 2DBLL 1S7XB 2AGJH 2DLEA 3GLZA 3L2NA 3MLTA 5HGDB 2R2BA 5ICYA 3M1OA 5DZOA 1I8LA 1I4FB 4NP9A 4GXVL 2VDKH 4GEJA 2FYVA 5E9DB 1IL1B 2UZPA 4X9HA 3EDKA 3L95B 4MA7L 4Z7VA 4KNSA 5CN2A 1IB5A 4XMUA 3EO0A 3BDYH 3CNKA 1QFOA 4XBMA 3UGEA 2IQAA 1INQB 2YBRB 4FLSA 3ARFC 2Y6SD 2Z4TA 3GHBL 1MFBH 5IREA 3HLAA 4OLVL 3S35H 3S7GA 3MRCA 3DTDA 4NWTH 1DLFH 4HK0B 1TMQA 2DKSA 6FABL 4ONOA 1JYXA 1DLHB 3T08A 1UCTA 3EDFA 2CHNA 4H8PA 4L3EE 4GAGL 2YFNA 3CMOH 4L4TD 1MFEH 1I3GL 4HGWB 2WLNA 4B7IA 1HHIB 1PZAA 5KYUA 4AIOA 1JDDA 4XWGH 5F8RC 3APCA 1A4JB 1CYGA 5AKSA 3OAYK 4ONGL 3VXSA 2F68X 3SKOB 2NY3D 5J13C 4NKIH 3AREB 3KHQA 4YWGL 4DTGH 4F91B 1IBZA 3KXFD 2IWGA 5K9QG 1R5WB 4J6RH 2OMVB 3O6LL 1MCLA 1T80A 4C47A 1PY0A 1S5IL 1SY6L 1YDPB 2FYYB 3GI8L 4L29B 4G1MB 1KXTB 5G55A 3S48A 2GSIA 4A2FA 2AITA 3QDJA 5EH1A 3MRIA 1QNZH 3NJMA 5ISZD 4Z8FL 1HT6A 3V7AE 1IILE 1P4IL 2EKSA 1I1CA 3TIDA 4B50A 5A2JH 2F0CA 4BH8A 5J1AB 1N6QL 1JDAA 1ZDQA 4B9IA 4FNLH 4NJ9H 1WGVA 3FB6B 2ENYA 5E2UH 4F58H 3QUYB 1GC1C 4F8QA 3V0FA 2BSCA 2ZX9A 2NNFA 5EDSA 5AW4B 4A6YH 1D9KB 3AWFA 3BIKB 3FFCD 1VGKA 2QHRH 4HJ0D 1YC7A 2W65B 4YDNA 3FN0H 1HQ4B 4ELMB 1GVIA 3V0IA 1IC4H 4A7GA 4X99A 5I8EA 2VT0A 5EF1A 1AC0A 3QIBA 3T09A 4PRIB 1FHGA 1IFHH 4U3CA 2A9ML 1YYML 3G5VB 4MA8H 2FJUB 3AAZB 5KSUB 1UUSA 5E6IB 1OT4A 3QFJB 2ATPA 1X7SA 3MUJA 3ZJAA 3MREA 1JL8A 1J18A 3TT1H 1AZRA 1VADA 2PYEB 4K94H 1NFDA 3WTSA 4X6BA 3REWA 5D1QB 2AKRA 4PMFA 4R97C 3ZZ1A 4Z7WF 3OAZK 4PU2A 4FFWD 1P5UC 2FECL 4JM2B 4PN6A 5IVNA 1MI5D 3IRCA 2YLHA 1U8MB 3VFWA 2VSCA 3FQXB 1OP5K 2GK0B 3IJSA 3PLYA 2D0FA 3BCFA 3HZKA 1BAFL 2R29H 3KW8A 3E8VA 4KGJA 7FABL 2YPKB 1ADWA 3Q01A 4IJ3C 2EVIA 4MCYB 5KVGL 4LASL 1ACCA 3UDWC 4TNGA 4EN3D 3WKNA 1ICTA 4U1HB 2XTJC 3D08A 5L2KA 3GO1H 3HE7A 4I85A 4RLDA 2QKIC 3EH1A 3ZVVA 2QQKL 2X2UA 2X2IA 1E9OB 2PP7A 3BWSA 3AS0A 4TSCL 3CBRA 3CHQA 4PWIA 5EU4A 4IBSA 4GB9A 4X6DE 2A6IB 3O41A 5EC1B 4NQDE 4WUUE 5LVEA 2EYTA 4N8VB 3WLBA 4NM8L 3ATFA 3QO1B 5C0EB 1BM3L 1M7XA 5FOBB 1YCSA 1X5JA 3ZY7A 3AS3A 5AOLA 4BK5A 3U36A 4E41E 1BFVH 2EUXA 5T33H 3WLWD 2C7UA 4YDLB 4HZ1A 2FJHB 2PCXA 3UGUA 3C2AL 1R17A 1DBMH 3EO9H 3H7BB 5TF0A 2B39A 4W6YB 1YMHB 3GDBA 1DQLH 2BNRD 1G5AA 2X4QA 2B77A 3ULSA 2A5UA 4PJ9C 1ITBB 1JV5B 3ATEA 4BEIA 2C8NA 4XNQA 4EPSA 1FL6A 1F4WL 4JE0A 3V79C 1QR4A 1T4KA 3P2BA 3MXVH 2FEDC 3D4CA 1QUNB 3NA9L 4J2XA 2WNGA 2B4CH 3QR0A 5EBLA 5HYQA 2VLRE 3VQLA 1T5WA 5EO1A 3KYNB 4AW4A 2NW2B 3LS5H 4GSQA 4HV8B 1FVCA 1FGNH 2OXGA 2E3VA 1I3RB 3GSWA 4EE2A 5A2KH 1MCKA 3N55A 1CTNA 2LGNA 3IN0A 1FYTB 5F3FA 5IW1B 4G7QB 2GJZA 1I1AA 4TVPL 2BIQA 1QFUH 5CR8A 5FCUL 4JJHA 1KGXA 4PS4L 4HPOH 1MQKL 2IFFH 1Z9MA 1S5HA 4LLVA 2DN7A 3ZTJG 4MB5A 4PWGA 5IGXH 3BEVA 3RGVB 2E8YA 3RNQA 2IC2A 2Y9RT 1KG0A 1FI8C 2K9FB 2UWEA 1ZA6B 4X4XB 4WRLA 1ZV5A 1JAEA 1H8OA 3DX8A 3MRBB 5BS0D 5IEHA 3U9UA 4AX3A 3TVMB 1WBZB 5B22A 5LG1A 1JF1B 2O6EA 1WUNT 4GINA 2C3GA 4RFNC 43CAA 2K3HA 4XWOC 3OVUB 5CHNA 3W39B 4XBEH 4TLTA 4J3OD 1W72A 2M26A 4L3CA 4PI0A 1GTNA 1ZWIB 4IOSD 1QATA 1MRFL 2WUBL 1JHTA 3FB8A 1QEWB 4AQ1A 2LU4A 1RZ8B 1CD9B 3FUKA 4MDIB 3LNIA 4LSUH 5F9DC 3TA3A 3TH2T 4BH7A 5IKCB 1HEJC 2FL5A 3RNKB 3GSQA 2AEIT 4QLWA 4Z5RB 5EZOH 1KXQE 3RVWC 3NJXA 4NI3A 2V37A 1PZDA 1H3PH 3G6AB 4WNQA 4CMMA 5EU6D 4NIKB 2JB6B 2X4PA 4H20H 4HUMB 2KERA 1T2QL 4L1TA 5MEND 1JYWA 1ILSA 1RHFA 3KPOB 4EVNA 1UM4L 2OJZL 1Z0NA 4LSPH 3ZRSA 4OD3L 5TDOA 4N8UA 1B9KA 4FI7A 1G7QB 3FQNA 3NP4A 3U25A 3SBWA 3KPNB 4P2QD 2OMYA 4WNSA 2VTFA 1C8QA 2D9QB 5EEUA 5KBKA 4FADA 4WFFD 2ODHA 4NPKA 4MNGE 1RPUA 5IQMA 1FH5L 2DJUA 2GK2A 4HXAH 5GGRA 1YUHA 5KSVB 3C60D 4NWUH 1MLCA 4S1SL 2D3NA 4NO5B 4XNDA 1BIIB 1JI1A 1UOVA 1ZOXA 2VC2H 2X4UA 3Q7JA 3JVGC 4GUCA 3VWJB 3KD4A 1IX2A 2C9VA 2EIMB 3RGHA 3ZKXC 1NKRA 3MZTA 1IJ9A 2B59B 4N1CA 3MLSL 4HCGA 2Q1EA 3H9HB 3JV0A 3ULVC 3RL1B 1I7TB 5FDWB 3ZKMD 1DANU 1P2CA 2IFGA 1IGML 3MRFA 3N44B 3DUSB 3NCXA 4WFEE 4DO6A 1S8DB 1M1XA 4Y4KB 2FAUA 2UZXB 4QYAA 2ZD0A 4FOMA 1UH2A 5KAQG 4CVXA 1CGYA 4OGZA 3MR9A 1OPGH 4KUZH 4F37K 3WKYA 4WJG3 6TAAA 1QSEA 3N85L 5C0BD 1ADQL 3IJHB 1NAMH 2R4RH 3UTTB 3UXFA 2IIJA 5C09A 3C8DA 3OKDA 4OKDA 3QRBA 5H2BA 2FT6A 1JD7A 3DNKA 1I9JL 5E2WL 1NCWH 1QWHA 5E2TH 1YY8A 2YUZA 5H4ZA 4XAWH 1KELL 4LPXA 4DPAX 1U91B 3MODH 5KJ4A 5ANHA 4JDEB 5HVFB 4KVNL 3SE8L 2ZF9A 1IQWL 3HIZA 3MA7A 5B38G 4M7LT 2X6AA 3QRGH 1Z5YD 5T5FL 1YEWA 3MJGX 2RAMA 1KPUB 3CQFA 3HMWH 1T0NA 3T0EB 2NT0A 4PGBA 4ISVB 3PAUA 4HBCL 1FNGB 1IKNC 3IMWA 3IJ7A 3QIWA 4HHGA 4Q56A 4TTDD 1NBZB 3NIFB 1G6VK 2QQQA 5AZEL 3MJ9L 3WDJA 1AOHA 4OKVB 4WTWA 5E4AA 3U7YH 3L3OB 3BIAX 2DYPD 2Y7MA 3W9EA 3QZOA 5DJYB 1N68A 4QHNB 4P5MB 4P5RA 3AJ7A 2IPKA 4O51B 3E38A 4D9RD 2AXWA 3D3VD 2BHUA 4HS8L 4XNAA 4PJ8A 1W8EA 3PNWB 4FFZH 3WOVA 1VF5C 2M2DA 3BP7B 2EDHA 3TBBA 3WXVH 4CGTA 5E94A 5E9NA 1GPOH 5CKAA 1LK3H 3EFDL 4S2SA 5IIEB 4Y2DA 3K2IA 2XETA 3QJSB 4JHAH 3GSOB 3QWRD 2OJEA 5ACZA 1R5VA 1WICA 3TYGL 4B0MM 4CW1B 2R15A 5EUOE 4IKKA 2FBRA 1UH3A 3WGVB 5DJ6A 2E7LA 3IDJA 1PZSA 4ODXA 1Z9SB 2HTLD 5D4QA 2KQMA 4I48A 4LL1A 3SSGA 4JO1H 3B7SA 4KWUA 3F8UB 3OWEA 3QNYB 4M4RA 1NMBL 4KKAD 2XHNA 4DQOH 3MV9E 4NQEA 2GITB 2LVCA 2R9HD 2Y23A 2YQ3A 1TVDA 3E1F1 1BCIA 4NC2B 5JO5B 3UYOD 4LEOB 4AGOA 3FTUA 1XZ0B 3EZ8A 2GUOA 3V9CA 1JPSL 1PIGA 1YN7B 2DOCA 4HAGA 1KBGL 1N19A 4DEPB 2WYHA 3LDBC 4BFEA 4ZUTB 4NSKB 1MCDA 2XQYK 4OD1H 4LLUB 1WWCA 3IJEA 1FNEB 1G7PA 2ZAGA 1RFDL 1HS6A 3JV4B 2J6EA 1KGCE 4PR5A 4S1RH 5BZXA 4O5LH 2D4FA 4N5UA 3IMUA 5IHBA 4BUHA 2JJTC 4ZFGL 5F7DA 1KCUH 5I6XB 2VOTA 1JK9A 2WB7A 3F3HA 1SVBA 1SDDB 2O5YL 4HJTA 4JPVH 4OLXH 4QRUB 3STZA 3MBWB 2OMUB 3T8XA 5BW7A 4FLOA 1NOFA 5A1AA 3VSTA 3NFNB 2J8HA 3D85A 1ET7A 3FQYA 2VDOL 4PG9B 5F70A 3F7RA 4OB5H 1Q94A 1QBBA 3NZUA 2FWOB 3CHSA 1G9NC 3VSVA 4ZMWA 1EEZA 4PTTB 1AANA 5EF3A 4P23C 2JQMA 5C0JA 2VLJE 2WBXA 4IIQA 3ZHKA 1AR1B 4YAQA 2DIBA 4YZFF 4B53A 3WFBH 2ARWA 1NANI 2DJSA 3KZ8A 4EI5A 4BSJA 5F1IA 1X9RA 1M9WA 4Y2OB 1IE4A 4FI6A 1N59A 3ZZSA 5KVDH 5AG8A 1NPJA 1FBIH 1JVKA 4ABQA 5EBGA 1JMXA 4XPTL 4I3GA 1SUHA 2ZKHH 3FSWA 3LEYH 1L6XA 3T2NH 4R3SB 3AG2B 2JIXD 4APQC 3A0OA 3VFUA 1HCZA 3L2LA 3O81A 2LFGA 1J8HA 3FFCE 3NJNA 5J89A 4UU9B 1FP5A 1HQRA 4P2CG 4ALAH 3P30L 4AJVA 3MAWA 4D3CH 3CSPA 4L9DA 4XZUA 2AERT 1T21B 5FYLD 4P2OD 1K8DA 1N0LA 4RISH 2P4AB 4CC0A 3ZPDA 4Z77B 4YHIB 3AXLA 3LKOA 2G2NA 3SDCA 3HB3B 2Z3FA 5F6HI 4MXQC 1GW0A 5B3JF 1U4EA 3EZJB 2JSFA 1T22A 4YC2C 2ZXCA 4Q8BA 5I71C 4YDJB 2BP8B 1O6SB 3IF1A 5FGCB 4M5YL 2BJMH 4ZNCD 2VDMH 3FW6A 4JPIB 3U4AA 2VDLB 2WWKT 1U3HB 2W07B 4Y19E 5FA4A 3DRQB 3PABA 3C5XA 4PRPD 4I9WE 5HPMA 3VRLF 1D6VH 3ATDA 4XVTH 3K1DA 4S1QL 2YAMA 3PYCA 3X3FH 1EEQA 2DMGA 4EZJA 3UZEC 2WXQA 4K8RC 4XXDB 4RAUB 1B9ZA 5T3XH 1UD3A 4XNXL 3O3EB 2B7DT 3KCWA 3RZCB 3NJVA 1DDHA 1ZPLA 4NRZB 1QD0A 4P3DB 4PJGE 4HX1B 3WJMB 5A43C 4J3BA 3VD9A 3ME0B 1HCYA 2E4TA 3FH8A 4LESA 5EZIL 1T0MB 5E9DD 1F8TH 4OQTL 3GRWA 2YSTA 3NZHH 1U92A 1CGXA 1MJJA 1C08B 1K2DA 2P24A 1RUQL 4XMKL 2P47B 3LH9A 1BZ9A 4UT6L 4L8BB 1OLZA 3C6LB 3VFRA 5FO8A 4YXHH 2R2EB 2JKJA 1QLEL 3KLHC 3LZOA 4UT9A 3GIZL 1EQWA 3QUHA 2HMIC 3U4BL 1OGAA 3CH1B 2H6PA 4PJEE 3VXRD 2G3ZA 2GFBA 1KACB 4N5ED 4NT6A 5AW2B 3RB5A 1BZDA 1SXBA 2BS71 3I6LD 2DEWX 4I8DA 3UZVA 4A7QA 4AI7A 3E3QE 4G6JL 2A1WH 3FCBA 4P5KA 2IXQB 4KTGA 5SX5K 2DLHA 3TL5A 3W81A 5HP5A 4UQBA 1P7QB 5DU7A 3IVKB 1RK1B 1ZDSA 4G8GE 2J57A 4L48A 2B9BA 1ECYA 2D3VA 3ARED 5EFIA 3UJTH 4R83A 2E59A 3IRPX 1OF0A 2H2SC 1KV7A 3VFTA 1V27A 2J88H 4FNSA 1KULA 3AXIA 4MBOA 2DWDB 3QORB 5DS8A 3GTTA 4AUUA 5IB1A 3GUTA 2OMTB 5F1KC 3CXFA 4G3YL 1FO0L 2F19L 2FX9L 4U6XB 3X11B 3V4VL 2P80A 4FG6D 4GG8B 1NUNB 3DTXB 1YJDC 2A4EA 3K80A 3QEUB 4JRXA 3RURA 2IDTA 2Z93A 4KROC 5IFAH 3QUYD 3V0AC 3RWFB 2G5UA 3BGMA 1D9KD 1U8NA 1VZGA 1DSFH 1LO5B 3L9RA 3P4NB 4YUEH 2C1PA 1IIKA 1A6WH 2KH2B 3IAPA 4NJAL 5FDYA 2YN3A 3VU2A 2VDQB 4PRID 3FU0A 2DLFH 1KYAA 1Q1PA 3RU8L 1NLDH 3CZJA 2ZP0T 2A83A 2V9QA 1NDMB 4L3AA 4PRDA 5DUPL 4P46B 5E6ID 3QFJD 4CADA 1CF8H 2ZE0A 4ZO8A 3ZQWA 4D7PA 4LSRH 2ICEC 4XP6L 1QSVA 4PJHE 1SY6A 4AQ8C 1IGFH 4JLRB 1XB6A 2YS4A 2PYED 2X9YA 2X4RA 1FN4A 5D1QD 1SMOA 4HEMA 1XFPA 3EYOB 3WY4A 4NPYB 4GPVA 1EGJH 4NO0A 3NMEA 2VWEC 1QSFB 4JM2D 2HG5A 2X89D 4U05A 4D0DB 2Q8BH 1L5GB 3LQAC 2VE6B 4ZW5A 2V7HB 4JFZL 2EDXA 1P1ZA 1ETJA 2GJ6E 2H32A 3PQYE 2A6JB 1DQVA 1N3NB 2OZ4H 2XWBA 1J5IA 1P6WA 4QTHA 4MWFB 3O11A 3PHQB 4LE8A 5HHXH 3G6JB 5KSBE 1AGDB 1FVDA 1AG6A 4WWNA 5KW9H 3S96A 4F2MB 2G75A 3V6ZB 2VZUA 5IBUB 2HPTA 4XCFH 1G7HB 5J11C 4GRMB 2FX8L 2XJLA 2LHAA 3BSGA 4RNRB 1ZTMA 5I1HL 1F90L 1YLBB 3O6ML 2MHAB 1D6EB 2YXVA 3IGAA 3EGXB 3VCLB 3GSVA 2HUHA 5BQ7B 2I7OA 3L16A 2I9LB 4FQLH 2E7DA 3RTQB 5ID1A 3ZR6A 4WV1B 2WYTA 4KJYA 1RHHA 4ENED 4GIAA 2AEOA 4HPHA 1KYUA 2R0ZL 1B0GA 2WWKO 3L45A 5D7JB 3Q2WA 3VRLE 4ZQKB 9CGTA 4AGLA 3MN8A 2H26B 1OZUA 5DEGB 2NY6C 1AZVA 2Y07L 1T89C 1IC5L 1XL4A 1SBSL 4UB0H 3IJYB 4YR6A 1TJGL 3KMDA 2BSEA 2P8PB 4YGAB 4JFSA 5EOQL 3C5ZC 2DAVA 3E2HB 4FXGC 2OM5A 3GSRA 1CFQB 3WMSA 3QYMA 5EEZA 5CAYB 3TXAA 1JVOA 1HNYA 3B7UX 4KHXH 2BCMA 5C0NC 1A6ZA 1CG9A 3MRJB 1CT8A 2DD8H 3T3PB 2EXSA 4IRSC 1WFIA 4Z76A 2H3NA 4JS7A 4R7DA 4QNPF 5E6ZA 4BELD 4DFHA 2IPUK 5ADPH 1FYTD 4Q6YA 4BYHA 5DEZA 4BFBD 4XGZA 4UIMB 3VYOA 3H85A 1BREA 2V5RA 3VFNB 2ZUXA 4XE5B 1UKQA 2RJMA 3K6SA 3SDXE 3MX0A 1KUMA 1FFOB 2EYRA 3O0RH 4WWKA 3RGVD 5JZ7C 4YBQD 3OAUL 3CQQA 1M7IB 2O5ZL 2V8LA 2WXMA 5LWYH 3WBDA 2E7HA 2FWUA 2Z31A 3OKEA 2XPYA 4K5PA 2H3KA 4JM4L 3TVMD 3H9SA 4Y9FA 2ITCB 3UPCA 1F1DA 3H6JA 4E36A 4JL2A 2Y24A 1OB1A 4DZ8B 1ZHNB 5C0GB 3TNMB 1N8ZA 5HYSA 2AVFA 2O4EA 4L4JA 5C07B 4MAZA 1JTOA 2YHGA 5IR1B 2MNJB 1H8SA 1E2ZA 3CN4A 4KI1A 2OYPA 2W60A 2D7OA 3DIDA 3CFJA 4PJ7B 3CC5B 2KZKA 4HMEA 4Y4HA 4LCUB 4YQXL 3AQYA 1MCSA 2WWMC 1DVFA 1SDYA 1YNLL 2BOBB 4OUUA 4PRNA 1A9EA 4M1GH 5JIMA 4TLSA 7PAZA 4AEFA 4NO2A 5GRJL 3S34H 4H0HB 4MD5A 5AUMA 4KZEH 5J6HA 2PPEA 1YNTA 2QZQA 5DMGD 3QJFB 5I1AA 2QDWA 4OJEH 3LVEA 4E9TA 3KGSA 3WSQL 4IKNA 3UZQA 3EG9B 4CDGC 5CEZE 2QFPA 2NDFA 3GFUA 5IY5B 2DZEA 4XT1C 3RA7H 2ZG3A 3VRIB 1PD0A 3QJUB 2JCCF 3UBXI 5SV3A 4WEUD 1PZ3A 1RULL 1BMWA 5DS2A 2V3EA 4QOKA 1IM3A 1PNCA 3BE1L 3VWJD 4AJWA 5AENA 3DX6B 4QRAA 4O00A 4UBDD 2DYRB 1RCYA 5FF6A 4HQQL 3ATAA 4M6OL 5L9DH 3QXUA 2JFCA 4WSKA 4F7KA 1SFDA 3WHXB 3CPLB 4O4YH 3RVXC 4KKBC 3T65A 3TP4A 1QABA 2OFQA 3JWNE 4JG0H 4K9EH 3D18A 5DHDA 4F57L 3QXAA 4R0LB 4LLWA 4BQ8A 3B56A 5INCA 1CE6B 1FNFA 3SKJH 4HUWB 1XWVA 5CD3A 4N0YL 3GTNA 1XGYH 3Q8BA 4Y4KD 3W37A 5HSFA 4LP8A 1P0SE 1ZHBA 3GPEA 1IGCH 1NBVH 5FA3B 5D4HA 2XWRA 3CZEA 3MNZB 1DUZA 3ZTDC 3ROLA 4S1DC 3U2IA 2QADD 1TETL 5JUEH 4ERSL 4PVNA 3L2MA 3UTTD 1N4XL 2O61B 2NY1C 4OCWH 5AVQB 1KJ2L 2QPFA 2ARJB 2DMKA 5BPPA 2NY4C 1LMIA 5CU5A 4J3OC 2DIEA 1BQKA 2VIRB 3NT0A 1QTSA 4J4PD 1WEJH 3K8KA 4OD2A 4X5XA 4IOFD 5FO2A 3U83A 4F1SA 3BRFA 2CCWA 3WS6A 4BK4A 3C5SB 5E8NB 1RK7A 1MJ7L 2VGLM 1GS7A 1IAIM 3KL5A 4PJDE 5C8JA 3TNNA 8PAZA 1QA9B 4M7LH 2ZP9A 5D8JH 5EN2B 3L3KA 5LCVH 4MXWH 3CFCL 2QQNL 4HD9A 2WQWA 5DC0A 5E2JA 1GZPB 3P0GB 1WG3A 3DXAA 4NN6C 5C6TH 1QAWA 3PREA 4TQ8A 5HDWA 2ZWYA 5IQ7L 3MKGA 2F7QA 3T0ED 3WD5H 5JQ6H 1GW6A 3HC3H 3SD5A 2FBJL 2JB5L 5I1DA 1TQBB 3E8UL 3P73A 4HLEA 2ICWB 3OG4B 5ENWA 2CDGB 3PRZA 3WFHA 3OPZL 1ORSB 3THML 1TO5A 3BPLB 5DFTA 5LN4A 2IPTL 1UWEL 2EDWA 4FHKA 1AQHA 1BYNA 3O8XA 4PRPE 3KW7A 4FF9A 2E27H 2EDFA 3GEFA 3I2CL 1E5ZA 1IGIH 4K3JH 5JW4N 2IG2H 1V55B 1DJIA 5BXFB 1G0XA 4RH4A 5I1CH 1KB5H 1T03L 1V3LA 3LZPA 3HMXA 5CM1A 2VW6A 1W80A 3EH2A 4Q7DA 4JO8A 3VGGA 2P8MB 4U6HB 1X7QB 4OZIB 4WFHD 5T5FA 1WZKA 1NIDA 3O3BB 3SDDA 3B8SA 4O02H 4DN3H 5F6IB 4AXWA 5IB3B 4G7YH 1A6TA 4GSDL 3A3YB 3KPLA 2ADIB 5FYJD 4LCWA 2CBQA 3ARDA 4X7FC 2MCG1 3C9NB 3EFOA 5LJYH 4GAFB 1PJ9A 5EOCL 1EK3A 3MJ9A 3QISA 4MASA 4H1LH 4HCRA 5E51A 3FTWA 1WITA 1HU8A 3B6SA 3IMRA 3L6FA 4QR7A 4HEPA 5AWNL 5F88B 2D31B 3GJFH 3FTSA 4OR1A 4PTUA 4TQEH 3TBVB 5DQDL 1DL7L 4YDIL 4NCC2 4XB7A 5FOJA 2Z35A 3EOAB 4DETA 1UWXH 2K9UA 1ZANL 3KWUA 3EJZD 5MHSE 3D07A 3FCGA 4HGKC 4N2GA 5AW1B 2A74A 4OZFA 2Q3AA 3BKJH 2Q7YA 2QQLH 1EZSA 4KKLD 4JFWA 3RDTA 5GISL 4OZGA 3M1BA 2GBAA 1U8PB 5E5LA 2IAMB 4GO8A 1JFHA 3FYEB 4QRTA 4M43H 4X5RA 5K5YA 2XACC 3RWHB 2XNAA 3SOBH 3EBHA 1HXYA 1G6RL 4JG5A 2AV7B 5B21A 3SDAA 3H42L 4X83A 1GIGH 4L0YA 2WSDA 3B3BA 5I1LA 2X70B 2WBWB 1JN6B 3FOLB 3QI9C 1MH5A 3RBSA 4PLJD 3KPMB 4QKTA 5E5MA 4L37B 2HRHA 3N42B 1WRFA 4P2RE 1AR1D 2X9XA 3ILDA 4H2CA 4LFHD 5FV1L 2J8OA 2DDQL 5HGGS 5AOKA 4F92B 2JCCE 1BBDL 1K5NA 2J5LC 3NZ8A 3BGFC 1QI4A 5L7XL 4MJ5A 3VI3B 2GCYA 4NOFA 4M6AA 5KEZA 3VXUB 2R59A 1VZIA 1MFCH 3Q1SL 1RPQA 3QUMH 1GGCL 2YSSA 1LWHA 4OCRL 3DHUA 5KVFE 4NDMA 1SOXA 3MLTB 1OWRM 2QELA 4E9YA 4LCYA 3QRFM 4P5TA 3NIGF 3LPWA 4XPAH 5LNEA 1I8LC 5HYSG 4XP9L 1AZBA 4Z7VB 1WZAA 1XGRB 2WIMA 3QEGL 4JAMA 5HD8C 5FGBC 2HTLC 3OQRA 3QAZB 4OSUL 1BG9A 2NYYC 3IPBA 3DK2A 3KNBB 4LVNC 3DYPA 3QT2A 2WBKA 4PYHA 5AZ2H 3OHXA 2YPVH 3LPFA 3MRCB 2RCSH 3LRLA 2OP4H 4I13B 3WNJA 3HB3D 2KHAA 4U1MB 2XBDA 4OZHE 5I0ZA 1MXDA 4LLDA 3ZU8A 2VERA 4MZRA 1PS3A 2X6VA 4XMTA 4EZLA 1M71A 2PYEE 3F7QA 3PAZA 4E5XA 5K1VA 3IFLH 4NN7C 3TIEA 5CILL 4ACPA 3GXIA 3RWEB 1IM9B 1B2WH 3ULVF 1RJYB 4QWWD 4YSTA 3FSVA 1SUJA 4XNYL 1CPUA 4ZD3L 1P4BH 2XWCA 4HDIA 3VXSB 1KJ3H 4PPTA 2AJ3A 2MPAH 3PWNA 4ZW6A 1AMYA 1FC1A 4O02A 4S11A 1MRDH 5IBLD 3SPCA 4NGHH 1R3JA 5FHBL 2CK0H 2DWTA 6CGTA 1WAAF 5KJRH 4HUKB 1ZLWK 2QJDA 4LQ1A 4DEWA 1Q38A 2XTJE 1IC7H 4MNQE 3FTZA 3CXDH 4JFOA 1NGQL 4LHJB 3DX4A 4JKPH 5CZVH 4Z23A 3ZTEA 1ZY9A 5D1ZI 5KS9A 1AO7A 2HLFC 2EE2A 3BH9B 2XZQH 4UV7H 4N2EA 1MCWM 3ZE2B 3J8F7 4N2KA 3QDJB 2CKBA 2CO7A 3GJFA 5GRUH 2J43A 2A73A 2XICA 2PO6B 1PPIA 4IBQA 3Q06A 3K6DA 5IMKA 3LNFA 5JHAA 2XJKA 3CFDB 3MNWA 1JGVL 3QW9A 4E9VA 1MCBA 3C6LD 4PJIE 3ZOAA 1RSYA 1VJSA 4MSWB 3WO4C 4BSVA 5I73C 1EFXA 3KPRE 4WU7B 1NJ9A 2FK9A 3LD8C 4FNUA 1GXEA 4ODTL 4PUBH 2BY1A 4PJBE 4ABUA 1NBYA 4GXFA 3ZL2A 1FRGH 4PJXF 4DPCX 3HNSL 4X99B 2XN9A 5FECB 3GT6A 3QIBB 3QQ3A 4DAGL 5CLWA 5LGKA 1F1GA 4CVZA 4UM9B 3B9KC 2E9IA 2QPDB 4A1RA 3OHMB 4YLCA 2ATPB 1EZUA 1EUUA 2WXJA 3BIBX 2HH0H 2PP9A 5IHUH 4JG1H 5D7SH 1P7QD 1Z66A 2K45A 1XD0A 1ETB1 1VADB 3ARBA 2FD6H 3DSFL 1NFDB 3REWB 4U0RB 3MJ7A 3T77A 3ILQD 5DJZB 4FQJH 5FYJU 4OQTA 1WWAX 4Y1AE 3POCA 5JIIA 3RWCA 4E9SA 4JQXC 3ZDYB 3CE1A 5EWIH 2OCFD 2EC8A 5E1QA 4DUXA 2BH0A 3VFWB 1RQ5A 2XRAH 1J9QA 4UT6A 3WKMH 5I16A 2D03L 2XQBL 5JXAL 3ETBF 2WLIA 3HZKB 1FYTE 3QORD 1JXJA 2GIYA 1XF5A 5TQ0L 3UYPA 3H4HA 4FNQA 35C8H 1WA1X 4X5WA 1TENA 1CZ8H 3EJSA 3MYZA 3TFBA 3HE7B 1VZHA 5A7BA 1F41A 4JDTH 2J8UE 3ISYA 4OLYH 4XO9A 3HFML 4AIEA 3CZKA 1BVNP 4DN4H 3GMOA 4YBLB 4E41A 2KZBA 1UD5A 5EU4B 4AQOA 4Z7AA 1GOFA 2F8VA 3O41B 3IGFA 4GBXA 2AQPA 5INDA 2EYTB 4MZIA 1THAA 3KLKA 2CIIB 2RIKA 1I9RH 5L4JA 3A21A 4X98A 5ITBH 4LEXH 1FCGA 1UGNA 2W94A 4P46D 2FGZA 5C0AE 1QFPA 4OGYL 1OM3L 1IBDA 2C7UB 2R83A 3KYOA 3K6OA 5FXCH 4LQFL 3BUQA 3OF6D 1HYSD 1OPOA 2GKIA 4X7TB 4HH9A 1JZDC 3ULSB 1FNLA 2X4QB 3QDGA 4KGLA 1PSKL 4BCXA 1QSFD 4ZUSA 1Z3GL 4I0PA 1YMME 3DV4A 3GZOA 1Y0LA 1JTTA 1TZAA 2FNWA 1KIPA 1T3FA 4FXKC 1KBBA 4HEPG 2Q76A 4O2CB 4YO0A 3DIFB 4YH6A 5E1AA 1H5BA 1T5WB 5FV2A 1HHGB 2BCKA 4MJJA 3GK8H 1P5VA 1L6ZA 1FVCB 2OXGB 1ASPA 1ZT4A 3P77B 4K2UL 3UL4A 5C08E 3B1UA 5D7LA 5B39B 3GHEH 3ALWA 2PW2A 3APDA 4OZFG 2Z0BA 2GJZB 2JLLA 3QNFA 2VXSL 3BKMH 3CDYA 5A2FA 4G70B 3HG1B 4QJ3B 3V4PH 1I1AC 3D87B 1N18A 3RIFF 5I19H 2X09A 2MPVA 4HIEA 1K3ZA 2BOCA 2EH8H 4HUXA 4M48H 4ZXBC 4F7EA 4LLVB 4PJCF 1S5HB 4CBPA 5CEZL 3FCUB 3X14B 5FO7A 3BEVB 5HHQA 3HFFA 4XC1L 3RNQB 1WFJA 2AVGA 3I9IA 3IU3A 4MD4A 4NAMA 5DO8A 3RTQD 1MJ8L 1KG0B 4OT1L 1K4DB 2HLAA 2UWEB 4HOZA 4A2LA 4AK2A 2B1AL 4XNBA 5D7JD 4LBEA 1J0HA 5ETUA 3ILPA 3LEVH 4AH2B 5IEHB 3C5JA 3OZKA 4NBZB 2JJVA 3ABGA 4F1ZA 1SYSA 4MFHA 3CVHL 3LJ3A 3K7UA 4KO9A 1JZIA 1T0OA 2YRLA 3EJUA 1SJHA 2A9DA 3T6QC 3PWPB 4K94C 1PAZA 5IZ7A 3L13A 1WAAE 4HJJL 3AGVA 5LUMA 4WWOA 2GY5A 5FGRA 5AVYB 2W8CA 1QTPA 3UMNA 2A3TA 5CHNB 2LLGA 4LIQH 3LZRA 3AMKA 2AQSA 4PVMA 5I75C 3VXME 4B5ZA 1JHTB 2QHLA 3BGAA 5TDNA 5IFHH 1EJOH 3T3MB 3TBYB 2I60L 1DFBH 3TA3B 4BH7B 2FL5B 5D7KE 4AQ1C 3GSQB 2GPZA 5LGHL 1IEHA 4LF3A 4PP1D 1RIVH 4KK5D 4D8PB 3QRLA 1VRSA 3QR1A 1SN5A 3O6FA 2F08A 3FB5A 4CMMB 3HR5A 5HGHA 4ZSOE 1UASA 5BZDB 5IHZB 3FSOA 4O58L 4YPGA 4MNGA 5B7MA 1LE9A 1QACA 2AJXH 1LP9F 3O2DA 4ZFOL 4XMXA 4LDCA 5TDOB 1CR9H 4LO9A 4ZO6A 1KXVA 5KBNC 2MEJB 2OMYB 4RMUA 3N43F 2Y7SA 5CLZA 4E5XG 4Z7WA 3UPAA 4K4KA 1HWWA 2ICCA 2X41A 1ITCA 3E6HB 5K93A 3TA4D 3T0EE 4HJUA 3SD2A 1FNAA 1VEOA 4J3VA 3VG0H 1V7MH 2X4UB 3P9LA 1BVZA 3I3EA 1A0QH 1UB5B 4M6ML 1P9MA 2WOYA 4UTBA 1X6LA 2IALA 3KVQA 3S97C 4PJAE 3FAWA 3FUJA 4H2AA 1WWBX 3U46A 5I6OA 4LB8A 4JFFA 5ESQA 2XN1A 2CWRA 4BHUI 2IAAC 2IMNA 3AMLA 4PY7A 1E43A 2BK8A 5C07D 5AAMA 3TJPA 2IBBA 2O26U 1J9SA 5FFGA 5JMRA 1T66D 3CH8A 3Q0HA 1KPVA 3CFBA 4DK5A 3DYMA 4CVXB 1WK0A 3MR9B 1FCCA 4KI5D 4N6RA 3S9DB 1ZTXH 2AQQA 2WVVA 4K3GA 5F44A 1QSEB 3G5ZA 1D2OA 1OKEA 3HI5L 4GMTL 3TEZA 2ESVB 5JA9A 1IGJB 4X7DC 1WFUA 3OKDB 4M1DL 4WK0B 4AJYV 1X3DA 3V4PA 4A2DA 5DJ2A 2IBZY 4QDGA 1OAYH 4P0DA 1K72A 1YY8B 3D2UB 2P44B 3R7RA 1ZLDA 5K39A 4FS0A 4JRYE 1EBPA 3UAEA 5DHXB 5HDBF 4HIPA 2H0PA 1P53A 4Z3HA 4DKFL 3NG5A 2OAAA 5JPMC 3OMZA 1F97A 2C9RA 5F9OL 4YSRA 4LXFA 2WN2A 3V52H 2CGRL 3IDYC 1RKRA 3D51A 4QRPE 1K9TA 1TJIH 4DERA 2NNAA 2C3HA 3IBOA 3GM8A 3N5AA 4Z7OF 3S37X 3SCMD 5EO9A 3QIWB 2PP8A 4XP4H 3TGXA 4PVBA 2J21A 1D7DA 4Z95L 3GGWB 3AS2A 4GXUM 4L4VA 1EV2E 1WTLA 3B5HA 3RGVC 3HBGA 2JK5A 4JKLA 2QGEA 2J55A 2K7PA 1C1EL 1KCSH 3LZQA 3MMEB 4WO4A 5GJSH 4UTAL 2IPKB 3ZKSD 1IUZA 3BEWB 4L9LA 1CLVA 2APBA 2PYFB 4DO5A 5KVEH 4PJ8B 4RGNB 2QPEB 1O9VA 2VL4A 3NPZB 2DQUL 4NP4H 3DOSA 4Y2DB 1PY4A 4DKDC 2OJEB 2CXGA 3MV8E 1R5VB 4KQ4H 2DEYX 5ACZB 1BM7A 1J8RA 2VN5A 1N64H 4GQZA 2Z6FA 5DJ6B 4ODXB 5MERB 4I48B 1E7UA 3DO4A 4BXVA 1U8IA 4Z7QB 1A1NA 3LNGA 4M4RB 1JG9A 3UBXA 1ZHLB 1JZGA 5K59E 5GGVH 1FPTL 1R3IH 3PCYA 5C2BH 4BA8A 2XA8L 3S37H 3NEEA 2GUOB 2RGSA 2HFFB 3UYRH 1PG7X 4POZD 4U7MA 1PY9A 2Q5BA 5KVFL 2OMZB 3DYOA 5C0CB 3CDZB 3SQRA 4K3HA 5EOTA 4AYSA 1AHWA 3VFVB 3TEWA 3F7VB 2VLKA 1UM5H 1KPRA 1NCAH 3FN9A 3Q1EA 2CR6A 3HW7A 1UFUA 2YD9A 3TEYA 4PR5B 1NLBH 3UROR 1H9VA 1U8LA 4MDJA 5DMKB 2SEBA 3LRKA 4U1GC 4ZMLA 1DJGA 5F7DB 2EIZA 2RMNA 5T1DL 4MXVF 2CJUH 5AD0B 3QJHA 1UCBH 1ZGLA 1F3RB 5CEYB 2VLJA 5MEQA 3AQXA 5BW7C 4LSQL 3T6ZA 1NSNL 5AW0B 1LP9E 1KGUA 1A7RH 2D7MA 3IMSA 3LH2H 2AQNA 1ASOA 1Q94B 2AK1L 3DLQR 4RA0C 1EDQA 3PJSB 4ZX5A 1EEZB 1FFPA 2J56A 4O2EA 2BWIA 3D4ZA 3QJTB 5C0JB 4IIQB 3MU3A 4YAQB 1OTSC 3MLRL 4NXKA 2QVTA 2GJJA 4IRJB 3UJIL 4N3TA 4XTRC 1QSZA 2PMZA 4EI5B 3DC0A 4WSGA 1CQYA 1SLUA 2R51A 5GRYA 2HX9A 2WWNA 1BAWA 3IDNB 4M29A 4G6AC 3BQUA 3OZ9L 5HPOA 3DJ9A 2V7NB 1MHEB 2QADC 3FT4B 2XVLA 1VPOH 4M03A 3ZE1F 3OX8A 2VXQH 1SXAA 2B20A 4LDEB 2FX7L 2H0JA 4RWYL 2O72A 4MAUL 4LLAA 3BLBA 3RX5A 1JPST 4LP5A 3RWIA 5GZOC 4J4PC 4WY7L 1J8HB 4IOFC 4PAZA 3OJDA 4PREA 4ZMZA 1HQRB 4TNEA 5GGRY 3QXDA 4K7PX 1YSOA 2KLSA 5CFAA 1WBXB 3IFOB 3QWQB 1T20A 4GKNA 3US9A 3W11D 2VDNB 2NY0B 3MV7E 1K8DB 1N0LB 4LOFA 5ESAB 4KZDL 3AXLB 5K9JL 3LKOB 3HBPA 2IAMD 4Y19A 3BKCL 1I8KA 3S2AA 3SDCC 2DMHA 5IVXF 2N1TE 3TN0A 2Z4QB 3I50H 5ES4B 1T22B 4U3XA 1J0ZA 1BZ7A 1RUAH 1GKEA 3HNVH 3QG7L 3L3HA 4WU5A 2Q2LA 4HWZA 3G6DH 2XIBA 5DA4A 3EJYC 4X5QA 1QFWH 3B4NA 2VDNH 5AYUH 1A5FL 5LQBL 5HPMB 5LXGL 1MNNA 3BWZA 5DJ8A 1XF4B 2YLKA 4YXKL 4X80L 4ZMVA 4KVCH 4IGBB 2JJSA 4U6TA 5TH2B 2CRZA 2WANA 3TWCH 2QT6A 3P4OA 5GS0H 4LARL 1QQDA 2CA3A 3VGDA 3KPSB 3VXUD 3FS9A 5ILTL 2ITEA 2XV6B 3PUUA 3WUWA 2ZAIA 2VDRB 1DDHB 3H9ZA 2WXOA 3EJTA 3QZWA 5FUZL 4NZUH 2PR4L 4V1DE 4XPFH 1LO3H 1QRNE 3PF2A 3IS1X 3NIDB 2YD8A 5DFVC 3MSPA 1U92B 1BWMA 4IU3B 1MJJB 4KUCF 4XP5L 1GGBH 1G6RA 2BNQA 1OF2B 1PL3A 4MZ2A 3VFRB 3Q3GB 4KO7A 2B0SH 4N6QA 1BEYH 1OGAB 4F8NA 2GFBB 4ZTPL 3DURA 3FRPA 2JXMA 1QHQA 2NR6A 3SY6A 3F58L 3QHZL 1INDH 2AK4A 3QXWA 3UZVB 1FE8L 5FIEA 3RLSA 2Z91B 4EBQH 4KK9C 4QRRA 2AEWA 5CJXA 3IDIA 1B0IA 1Q0YH 3CLFL 4LPTA 1IM9D 2NXZD 3N6YA 3NN8B 2Q10A 2VWEE 2F58H 1JZEA 4P5KB 2VXVL 3IAQA 2NSXA 2WZPA 5IJCC 2EDJA 5T1MA 4Y5VB 1RZFL 2AV1B 2X0WA 5LAXB 1YC8A 3L3JA 3VXSD 2APSA 5I6XC 4MYPA 3MI6A 4OJFL 1NCBH 1T83A 1XF3A 2ALAA 1B4JL 1KC5H 1JRHI 3I9GH 2QGDA 1S7UB 3OSKA 4HFUL 5FM5O 1OEZW 3G6JE 4F2FA 2J5WA 1TTCA 4LRIC 3U4KA 3FRUB 3SY0A 1EMTH 2YA1A 4WK4B 2F8IA 2VXQA 4YXLL 4TSBL 1TCRA 5DS8B 1YEEL 2H1PL 1L0QA 2X4OA 3DV6A 5J0BA 2L3BA 3QDJD 4NZJA 3FTGA 1JRHL 2IWFA 2YD7A 4AKOA 1AR1C 2PO6D 4J27A 4J3OF 4NFBA 1BBJA 4HHAA 4YSPA 4HIHA 1AJ7L 3VU1A 3T8MA 1BQLL 4BGDA 3VI4B 4MXVE 3DX7A 5A3IC 1CFVL 4JRXB 2WUCL 5FGSA 4BDVA 1W0WB 4LCCA 5E6UB 3WY1A 2H47C 1W15A 2Y1ZA 3NJGA 5CGYD 1U8NB 4FG4A 5SWSA 4N0CD 3WFZA 1JK8A 2VYRE 1AKPA 3GSNA 2AZUA 1KT2A 4MS8C 3FZUC 2C1PB 4UDUA 5K1NA 3QIBD 4APXA 3H0TA 6FABH 2HN7A 2XZZA 5HHOE 1S7VB 4N90D 5JXEA 2A83B 4PRDB 4UM9D 3UGXA 4GAGH 3IDGA 3TX4A 4CADB 5F9AC 1INEL 2ID5A 4NUMA 4KDTA 2B08A 4UMSA 1MRCH 1QBMH 4WUKL 3DVGB 3UBXG 1FN4B 1MN4A 1OHQA 3PQYA 3R1GL 1MAJA 4HKJA 5BRZB 3L5IA 4ONGH 4F8TA 5CWSB 1OCOB 1NCTA 1BZQK 1JERA 3QIUB 1PCSA 4NO0B 4Z0BL 4QGYA 3N50A 1UWFA 4YWGH 1BZOA 2C9XA 1AKJB 3FBQA 5D1ZA 5A2LH 4RMSA 2KC0A 1P1ZB 3EJCA 3EO1A 4Z7UE 2J72A 2H32B 4L1BA 3O6LH 2XWBB 4HJSA 3ZDZE 4QTHB 1UYWL 3DPBA 2WSKA 3O11B 2DQFA 1S5IH 4YHOL 4UQCA 3PPSA 3ZMEA 4FJ6A 1FVDB 2ZKXA 5I9QC 2AFNA 3ARZA 1Q0XH 3O4OC 2FZ3B 3N9GL 5CD5C 5TPWL 1JDCA 4TVSa 4AENB 3WFEL 3HE7D 2EP6A 3DMMA 4R2GC 3EOBA 2WGXA 1N6QH 3ZKNC 1AZNA 4EAEA 2DM4A 5E95B 1UA7A 3M7FB 1IIIA 1QW8A 3A4FA 2YAFA 5LAPA 5F0MB 2WLLA 3MGTB 4KJYB 1X4ZA 4LVOC 5I17A 2XVGA 2AJYL 4YFLF 1B0GB 1MWAL 5I1GH 2ZQKA 1VB9A 2YMTA 2EYSA 4DF9A 1KLUB 5KBLA 3TJHD 2A9MH 1YYMH 1GHFH 1KMGA 4YR6B 1MFAL 4HUVB 1WAPA 1E4WL 5IG7A 3SJVE 3BXNA 4GW1A 4ZJ9A 5JYMA 2TAAA 1YEDB 25C8L 3MKKA 6PCYA 3WENA 3GSRB 1BQSA 5AB1A 3II1A 3L8QA 3NFPB 2EVHA 3PL6B 1GMEA 1UZ8A 1HI6B 3VD2A 8FABB 1EAPA 5L4FA 5F1SA 3IJ8A 1PLAA 1A6ZB 3GXTA 1LEGA 5L2JB 4M7ZC 1CT8B 1MKFA 5EIIA 4PWJA 3KVPA 4PB9L 4Z7NB 3ZRFC 1BAFH 1FQ9C 4HSCX 3KWXA 4KKPA 4Z76B 2H3NB 2B1OA 4N2HA 2EEXA 7FABH 2EO7A 4I87A 3RUGF 1JPGB 1YEJL 1USZA 1H0DA 4NUQA 3SGJA 4LOVA 4A38A 4LASH 4PG2C 5CMAA 4XGZB 4ZMTA 4H0LC 4XODA 3L3GB 2NTFA 3HG1D 4JFQA 1HDMA 1Z9OA 4AGQA 1UWYA 3TWYA 3MX0B 3GIVB 3O6KH 4OJAA 4XN8A 2QQKH 4JEGB 4YHLH 2EYRB 1WIOA 4OM0L 5DZNA 1JVLA 4UZGA 3UABA 5J7CC 4AQZA 3GXFA 5HHMB 1X44A 2R27A 3K72A 5E7BA 5EF0A 4LGRB 4CSTA 1P6FA 4KK6D 4GOSA 2WZ6A 3LPOA 1WFNA 4NM8H 4YIQB 5E6YA 4XXWC 2Z31C 1BM3H 1DBAH 3H9SB 5DDHA 2YMOA 1WD9A 4N2FA 1A4CA 5EEWA 1XSKA 4WK2B 3BAXA 4NKDA 3ELQA 3PWPD 1OB1B 1F4AA 3AB0B 1N8ZB 2DLGA 3QJZA 4C55A 2CNYA 3PGCB 4DP2X 5A2AA 3C2AH 1NPNA 4NEHB 2WC7A 4K73A 5DJCB 3RWJB 3WUWG 2DEXX 3QZWG 1LNUA 3R0NA 3VFMB 15C8L 3CZFA 5F7FA 3TA3D 1F4WH 4Y4HB 1V10A 2EJ1A 4PRNB 4OUUB 3VGEA 1A9EB 1TQVA 3MBEA 2X42A 1DVFC 4MAYA 3MLWH 2GTWA 3NA9H 1SHWA 3P11L 3UG3A 3V6OA 4DVRL 5BNXD 2YGPA 4NO2B 5J3HD 4QIRA 1KIQA 5HVHB 1HYSC 5KANG 4MD5B 1QVOA 2HKHL 5J6HB 5I1AB 4G8IB 3CHRA 2NXYD 3GEWB 3EUDA 4PCSA 5FR3A 1PBYA 3PDDA 3CLEL 3TT3L 3ZL4H 3S88L 3WYRA 3FRPG 4PJ5E 3W9DA 3SOTA 4TVPH 4FKHA 4PS8A 4Y5XB 5FFOA 5FCUH 3X3GL 2FQDA 3WHE0 3SE9H 4FA6A 2YGQA 4DT2A 5IROA 1JGUH 3IXAB 4PHZA 4BZYA 3NJHA 1RZJH 3FUIA 3MCKA 2BSTA 2FIKA 4QOKB 1IM3B 2WCPA 3QE5A 5JNYA 1DVUA 1JWUA 5HGAA 2PXYA 4JPQA 4CC4A 1YEFL 4ETYA 2BC4B 1UXWA 1OE2A 2KMWA 1CFNA 4RAVB 5ECGA 4H40A 4GRWF 3S5LA 3QPXH 5D1XB 2A6KB 3IDXL 2BW5A 4KRPB 4RSYA 3MOAL 1AS7A 4DGYL 3ARGC 1TPXC 5CZKA 4PBVC 5GHWL 2WKOF 3T65B 2LW3A 1WCBB 5KBDA 1ND0B 3V6BR 2L7EA 1R3LB 2CIKA 2F1AA 4LLWB 2E9BA 4HK3J 1AQKL 3O45A 4WV1C 4ZFOA 5CD3B 4DK6A 4NNPL 1KOAA 2C3VA 4JPKL 4LNRA 4G9FA 5GSVB 5I74B 1YAIA 5IW6A 3HRZC 1ZHBB 2WUBH 3GYRA 2DQCL 2VDLL 5GS1A 1DUZB 2XN2A 4G5ZL 1QSED 4EXPX 3KH4A 1BXVA 4U49A 4AVHA 5J12C 1JFQL 5GJTH 2WLKA 4K8RL 2ESVD 4PJDA 5AAPA 3CZUB 3O2WL 2Y5QA 1T2QH 3R06B 4GLRI 4EIGB 3FKUS 5ICUA 2QLYA 2P26A 2YK1L 3HE6A 2OJZH 3D2UD 1FWXA 4OD2B 4TRPL 5IM7B 3NCYS 5IMOB 1I8MA 1U33A 5H4YA 1UOWA 5KG9B 1A3RL 2XC8A 1JMZA 4KO6A 1SF5A 4TNFA 4UAOC 5F9WB 3CCHA 5I18H 4KK5C 4OH2A 1RH8A 2DQTH 3M86A 3OKMB 5GGUB 1CVSC 1SJEB 2P5WB 3L3KB 1XGUB 3DSNA 1JXGA 3DXAB 4YHNA 1NFKA 2Z7WA 2ZCHL 4XVSL 2J6WA 1XBDA 3FQTA 2YPLA 3EYVB 1DQIA 1L7IL 3HVDA 4P4KA 1DZBA 4HKZA 1OOAA 3QIWD 4BHUA 1A14H 5I1DB 3AU1B 2CE6A 2MKLC 3P73B 4UINL 1MPAH 1A2YA 1GL4B 1ASQA 1RU9L 4B95C 5ENWB 2JJWA 1CK0L 5DRWB 2OTUA 1UOLA 4JKMA 4KMLB 4RMWA 4W9IC 3T0AA 3WFHB 1IC0A 1XH2A 5T1KB 1T1XA 3VGAC 1UD4A 4GAAA 1LEKB 4WI9A 1BFSA 1MLBA 4PJ8D 4QAWA 4RGND 1WDAA 3FDWA 4AW7A 3KHOA 3O8XC 1LK2A 1FORH 3KR3L 1A6UL 3D30A 4GJTB 2QVKA 2BRRH 3LVTA 4ZAKB 1M53A 4Y2DD 5DMJB 3ULUD 2MIZA 3N85H 4PIBA 3MRLB 3LRMA 4MJ6B 1D5IH 1BX2A 3U6RA 2RR3A 1E6OH 4I2XB 1QRKA 1ANUA 5E2WH 3WTWA 1IAII 4DW2L 3PWVA 3JWDH 3SDDB 3RGBA 1P1VA 3BFWA 2GHWB 2K6YA 2VLLA 3FT3B 5FUOL 2V2TB 3KPLB 1IAOB 4NRXA 4X7SL 5EOCJ 2DWEA 4JFHD 1E7VA 1HESA 3ARDB 4XRCA 3EFOB 4Z7VE 1FVEA 5FKPA 4YHYB 5DZLA 1YJDL 2LTQC 2Y5TA 4KVNH 2MCMA 2XPGA 4UV4H 5JOFA 1GGIL 5C0CD 3DGGA 1IAIL 1IQWH 1MAKA 2F1EA 1S7TA 2OJ1A 2VL5A 3F12A 4XNZC 3B6SB 3U6XS 3MYJA 4H8WH 1L9TA 3MLYL 3TH4T 4KFMA 5GSRB 4PTUB 4PD4K 4EKJA 4M7JL 4PCTA 4LKXA 5FHAL 2VZOA 4JL1A 1VCBC 4FG2A 3MCLL 4HBCH 4OLWL 5TDPA 1KCLA 4HC1L 4N2IA 2A74B 4K9EC 4X4MA 5DHVA 3W2DH 2Q7YB 2VDQL 1CFMA 3BAEL 3BH8A 5EIIG 2WXNA 5AZEH 1CQKA 4OZGB 3M1BB 1XF2A 4X9BA 2ADJB 4UTCA 3RDTC 3VTTA 3TC9A 4QRTB 4C56A 1YZZA 4FL4B 4YEFA 2JCCA 5KJ7E 4QXUL 1HXYB 1TZIA 3SDAB 3SCMC 4FRWA 3RILA 1CD8A 4UOQA 4TXVB 5I8KH 5AKTA 1NWOA 2JELL 3WV0A 3ZDXF 5E5MB 3LQAL 4ELMF 1NDTA 3L1OH 1KTKE 2ZYHA 4R0LC 3LKQA 4IRJD 2EDBA 2X4NB 1JWMA 1SEQH 4XHJC 3LB6D 3NZ8B 1TNMA 3TYGH 1EXGA 3AU0A 1KCBA 5F7EH 4EI5D 1L7TL 4OF0A 3WFDL 3MRDA 1TDQA 4FTVA 4NUGH 3FHAA 3VYPA 1TU2A 1DANT 2G3NA 2FQGA 1Q9WB 5AQ0A 1HKLH 2QR0A 2YSSB 4NDMB 3X1NA 2EE9A 1KDJA 4KV5F 2HRGA 3KJ4B 1JPSH 2EIKB 3CDFA 4P5TB 1OD7A 4JFUA 1HH6B 3UCRA 4D0CB 4L2LA 4B97A 1J8HD 1NC4A 1TJHL 4NAJA 4OZHA 4TL5A 2VDOB 3HVNA 1X5ZA 1JGEB 3B2VL 1CFSA 3EYSL 1KBPA 4XN7A 1B90A 2Z8SA 3JV6B 2FRGP 2NY0D 4OCNC 1RJCA 1P5UA 1ETZA 1TEGA 2CM5A 5F96H 2CCVA 4YN3A 3KPPA 3GXUB 4NNYA 3OHXC 1R0AL 2GEQA 2O5YH 4FQIH 2V0AA 2YWYA 4LLDB 5DWUH 3S36X 2BDNL 1SLVA 1ZS8A 1YEGH 4E5XB 3KYMA 3TIEB 4RGMC 2ZX6A 3V10A 3WEXB 1I85C 1WF5A 3KCPA 2K6ZA 3GJFK 1IBYA 3VH8A 1MCWW 3Q6FB 2A77L 1GAFL 2VSDA 1L0YA 3P69A 4HDIB 2OSLB 3T4AC 2AJ3B 4HP5A 4PV8A 2QKIA 1NGZB 2CXKA 3LIZL 2X3AA 3EYUL 4IGBD 2NYKA 1PZBA 1MNUH 5GQBA 5LBSA 1TXKA 4ONFL 1KEGH 1R3JB 4GAJL 2HJFB 3LTVA 2G0LA 3Q48A 5FAAA 1W8OA 3KPSD 3SE4A 4GP8B 3WFCL 2JNZA 4RZCA 1EERB 3GJEB 3MUUA 2ITDB 1I8AA 2ALWA 3J7HA 3NSYA 3CWGA 5JW5A 4B27A 5L2KE 2Q7AA 3S5LG 1KJMB 4G59C 3CN0A 2CO7B 2NY2B 2ZOTA 4XPTH 4HOMA 2CDFB 5LNGA 2A73B 4AQAA 2P8LA 1QLFA 4IMKA 1NANH 5LGJA 5FFLA 5IMKB 1XGTA 1FNHA 4NQXA 5BVPL 3U0WH 1N2RB 2VMDA 1B6DA 1JXDA 1VAHA 3MNWB 3WIIL 3NCFB 3US0A 3QQ9D 1JZ6A 4R4FL 3LRSA 2HT3D 4BSVB 1PLBA 1VKXA 2G2RA 3L48A 3SEPA 3ZO9A 4PJ9A 1KFGA 3P30H 1Q9OB 1OGAD 4G6KH 3QQDA 2JKWA 4WI4A 2YR3A 3GZPA 2DTML 3KDMA 3BX7C 3WIFB 1U2HA 2XN9B 1CL7I 2Z92A 4KKRA 3VD7A 1ZK9A 3GMPB 4YFEA 3QQ3B 2QZ5A 4M1CC 2NCEA 4R4ND 4CVZB 2YRBA 5TQ2L 4OM1H 3LMJL 2A0LC 1R3KA 3U6XA 4PRAA 5LB1A 1XT5A 3VWKC 1U2YA 2BIOA 2K3TA 3QDME 4M5YH 5PAZA 1EA9C 3OB8A 2A2QT 3MJ7B 3WMQA 5E00B 3ARBC 2VLME 2RFXA 3V0VB 2G2PA 2ZYIA 3RWCB 5F1OB 3IYLW 4S1QH 1H15A 1OE1A 3US1A 5LNDA 4WCYL 1G1YA 2WCSA 4UDTA 3APFA 1L9PA 2D0HA 2WLIB 4XNXH 1QLEB 3FQWA 3LYRA 1AXSA 3PU7A 3UYPB 4NQCA 1ECZA 1O5PA 2WXRA 3P3RA 2W80C 4UILL 3WIHA 4E9QA 4X5WB 3MVSA 5DS1A 2Y69B 5EZIH 2P80D 3ARYA 4Q6KA 4X6DB 5DMIL 3TCTA 3H8NA 1YQVL 4WUUB 4RDBA 5C92A 3MNVA 4JRXD 3M7OA 1CXHA 3SQOL 4H44C 4LLMB 2IDFA 4F93B 3FOMB 4FQQA 4XMKH 4AIZA 4TTGA 1BFOB 4JREB 5SWQB 2QFRA 3GMOB 4FLQA 2FDBP 1X4XA 4E41B 3FT2B 4WI7A 4FMVA 2HFGL 1LWRA 3U4BH 4GBXB