2J55A

X-ray reduced paraccocus denitrificans methylamine dehydrogenase o- quinone in complex with amicyanin.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tracking X-Ray-Derived Redox Changes in Crystals of a Methylamine Dehydrogenase/Amicyanin Complex Using Single-Crystal Uv/Vis Microspectrophotometry.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords AMICYANIN
total genus 20
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2j55A00
1BXUA 1SDDA 1ZDSA 2CCWA 3AG2B 1MG3C 3QJSB 2A3TA 3RYMA 3FU8A 2PPEA 1TEGA 1PCSA 3ZDWA 3CVBA 5AFAA 3IN0A 3PAUA 3QPKA 3OD3A 4A2GA 4GY4A 2VW4A 5F7BA 1GS8A 2FJSA 4YSDA 3WG7B 1JERA 1A65A 1M56B 1NDTA 3TBCA 4G70B 1PLCA 2VMJA 1J5DA 1RCYA 1BYPA 2W88A 1R1CA 1W6WA 1KCWA 2BWIA 2PP9A 4JHVA 1AG6A 1AZRA 2OV0A 2XX1A 3X1FA 3EF4A 1PZBA 3UACA 3QJRB 3DIVA 2MTAA 2AVFA 3OM3B 1W8EA 3QQXA 3KW7A 4EF3A 1EZLA 4MFHA 5I6MA 2GIMA 2VSMB 1IC0A 3GDCA 4HZ1A 4A2FA 3ZIYA 3S8GB 1ASQA 4ENZA 4DPBX 1E67A 1KV7A 2XV0A 2UXFA 1JXGA 1OE3A 1XB8A 5I5JA 2AANA 4P5RA 4YSCA 2YAMA 2XUWA 5F7AA 5I6LA 1MZYA 4N8UA 1NIFA 4G72B 2Q9OA 1BYOA 1KGYE 4DP4X 4DPAX 2DYRB 2PPFA 2UXTA 1DYZA 1FFTB 2XU9A 2Y69B 3FQ1A 2QPEB 1AZCA 1PF3A 3CVCA 3TA4D 4WKXA 1JZIA 4BWWA 3DTUB 4YSAA 3QJTB 4AKOA 3ASOB 1SFHA 1UATA 6PAZA 4HAKA 4BWUA 2J57A 1KBVA 5B1BB 2I7SA 1L9QA 4E9VA 1L9SA 1OE2A 4GP4B 4FA7B 1ETJA 4YSSA 1A4BA 2JKWA 4F2FA 1N70A 1X9RA 2PP7A 1BQRA 2EIKB 1QHQA 1SJMA 2FQFA 3OMIB 4HHGA 4Q89A 3T6XA 3WKPA 4HCFA 1MDAA 5B7FA 2WO2B 1RKRA 2XYBA 4M4RB 1FWXA 5D4IA 2H47C 2TSBA 3SQRA 3ASNB 3H4FA 3UABA 2QT6A 4JHUA 2WO3B 3NSFA 4YVUA 5B1AB 3QJUB 2XVBA 1M57B 2FQGA 2CUAA 2JFCA 1RZQA 3S3BB 1A8ZA 2QDWA 1JZJA 2RACA 3X1NA 1M9WA 3S3CB 2DYSB 2GI0A 4YSOA 5EHFA 5LDUA 1QNIA 2UX6A 4YSRA 1EHKB 3WNJA 2BP0A 1ILUA 1SHXA 1NPNA 2P80A 2YXWA 4PCYA 4G7RB 3FU9A 2HX7A 3QJQB 4M3HA 4KOCA 2IWFA 3ABKB 3EH5B 3PPSA 2VW6A 1IKOP 2XV3A 3ABGA 1SF3A 1WA2X 4HCIA 3KW8A 1AANA 1NWPA 1QLEB 3PXLA 2IDQA 1J9RA 1PY0A 1ZPUA 3MBWB 1ID2A 3AW5A 8PAZA 1HFUA 4RH4A 4L0PB 5B7MA 4NAJA 1GW0A 1CC3A 4F7KA 1L9PA 3NSDA 1IBYA 1CYXA 4X4KA 5B1JA 1AS6A 3U25A 3GXUB 4DPCX 1GSKA 1WS8A 1AACA 1L9OA 1AR1B 1HAWA 3PLYA 3IBOA 2ZWNA 3MX0B 2FT8A 2EIJB 4Q8BA 3JTBA 2YAHA 2IWEA 1GS7A 1DZ0A 1L9RA 3TBBA 3AG1B 1NZRA 1TEFA 2YARA 1SDDB 2AZAA 2J56A 2DWTA 3BVDB 1KCBA 2BWDA 2XXGA 3NP3A 3X1BA 3FQ2A 4E9WA 1JOIA 3QJVB 4G71B 1B3IA 5A7EA 1AZBA 3G5WA 1AIZA 4DP9X 9PCYA 2FQDA 2YAQA 2QPDB 3H4HA 3FSAA 1CYWA 3NJJA 5PCYA 1GY1A 3SBPA 2CALA 3GYRA 1W6LA 1NIAA 4A68A 4UF7C 2IWKA 1AQ8A 4AX3A 2HRHA 2UXVA 1NICA 3FSZA 3ERXA 3C75A 4NB7A 3X2QB 4TXVB 4A66A 4E9YA 3N2JA 4KO9A 4W1TA 1BEXA 1BQ5A 2XX0A 2PCYA 3UADA 4F2EA 1PMYA 2DV6A 1NIBA 3AG4B 3OMNB 4AI7A 3ZBMA 3AY2A 4DP8X 1GS6X 2DY2A 1OV8A 5I5IA 2BO0A 2X88A 5ANHA 2AFNA 5B1KA 2XLLA 2B08A 1XB6A 1PZCA 3NYKA 2BP8B 3NJKA 1XMEB 1JZGA 2GC7C 1GYCA 5AZUA 1AAJA 1E5YA 3CZUB 3T9WA 4E9TA 3ABLB 4A2DA 3FYIB 2FTAA 1KYAA 3UAEA 1CURA 4BDVA 5AKRA 4GP8B 2R7EA 1ADWA 2YAPA 1JZFA 1KBWA 4YSEA 4DP1X 3FU7B 3FSVA 2CBPA 2LLNA 3NSYA 3AZUA 2YAEA 2FWLB 3HEIB 2UXGA 1JVLA 3TU6A 1XB3A 2HX9A 1A4AA 1ASPA 1AZUA 4DP0X 2J5WA 4CSZA 2HXAA 2YQBA 4A2HA 2I7OA 3NP4A 4QKTA 3FT0A 2ZXWB 2PP8A 1WA0X 2GBAA 3IEAA 2EINB 1KDIA 3EH4B 4KO7A 1A4CA 1AZNA 1JXFA 1OCZB 4GP5B 1RZPA 2GHZA 2IDUA 4BK5C 1PAZA 4DP2X 3WI9A 3NJHA 2BP0B 2IH8A 4GYBA 1PNDA 2W8CA 2J55A 2JXMA 4BWTA 2TSAA 3ABMB 1NINA 3FYEB 2GB2A 1ET5A 2BZ7A 4N4YB 5D4HA 4AKQA 4BXSV 1V10A 1OCRB 3DKHA 3NT0A 1AS8A 1JVOA 2ZONA 3PAVA 3OQRA 1N68A 4YSUA 4BXVA 1JZHA 4DP7X 2BZCA 2OCCB 1J9SA 3EH3B 1JZEA 1OOWA 3NJMA 1NWOA 1J9TA 2P80D 3NSCA 2PLTA 3V9EA 4YSTA 3UAAA 3PAZA 2NRDA 3FSWA 1SNRA 4KNTA 2OJ1A 3UGEA 5TK2A 2FNWA 1BQKA 1OCCB 3SBQA 2EIMB 3S3DB 1X9UA 5I6OA 3D12B 4WTQA 3WIAA 4HHWA 2XWZA 1IUZA 4NERA 2PPCA 1BXAA 2H3XC 2BHFA 4UANA 1ET7A 1L9TA 1PLBA 4DP5X 4JKNA 3X1GA 3SBRA 3NJIA 2HZHA 3IE9A 4YL4A 5D4JA 1J5CA 2CJ3A 2HX8A 2IAAC 1WS7A 4P5SA 3NJNA 2AZUA 2YXVA 1PNCA 3CDZB 1JXDA 3EHBB 1ZIAA 1SFDA 5FC9A 2HLEB 3T6ZA 1A3ZA 1KDJA 4G7SB 3NJLA 2BW5A 5B3SB 1E30A 4KOBA 1WA1X 4K9JA 1I53A 3X1EA 2WSDA 5E9NA 4A2EA 3CVDA 1ILSA 4AKPA 4QLWA 1WAEA 2ZOOA 3V9CA 2IDSA 4GXFA 2GSMB 1VLXA 1HAUA 4YSQA 4FAAB 2PPAA 2Q5BA 2VSKB 1NIEA 2MRYA 3BQVA 3CDZA 2XXFA 1NPJA 2X87A 1T5KA 2H5UA 2R7EB 3PCYA 5PAZA 2VW7A 3N55A 4A67A 1ZV2A 4KNSA 1NTDA 4HALA 4E9XA 3NJFA 1BAWA 4YVNA 4E9QA 1V55B 1FA4A 2FT6A 1OE1A 1PLAA 2PPDA 4KO5A 1TKWA 4PAZA 1SHWA 4HIPA 1ZDQA 5I26A 1MG2C 1OCOB 2PCFA 4UAHA 4CSPA 4E9RA 2HRGA 1OF0A 2VM4A 4KO6A 3WNIA 1ET8A 1E5ZA 1AG0A 5I6PA 4E9SA 5I5MA 3AG3B 2UX7A 4ZK8A 5IY5B 3FQYA 2QDVA 1BXVA 4KNUA 2VM3A 2N0MA 3ZX1A 2IH9A 2Y1AA 4W9ZA 1F56A 4BDVB 7PCYA 5TK4A 2E86A 1V54B 2IDTA 3FPYA 2XV2A 1ZIBA 4G7QB 3CG8A 5B1JC 1J9QA 3L45A 3IN2A 3OMAB 1GY2A 2GC4C 7PAZA 4YSPA 2IDFA 1AS7A 3FPXA 3FU7A 3JT2A 4AZUA 1GR7A 3T6WA 2B3IA 2FQEA 2EILB 3TASA 1CUOA 2YAFA 3S8FB 1PZAA 2VN3A 1TU2A 1IBZA 3T6VA 2BW4A 2FT7A 3NJGA 3WKQA 1ASOA 1NIDA 1E65A 1YLBB 5I28A 4DP6X 3T71A 2BP8A 3HB3B 6PCYA 1URIA 4HCGA 1MZZA 1SF5A 5I6NA 2I85A 1AOZA 2DWSA 2YAOA 3H56A 5B7EA 2CAKA 3FS9A 5I6KA
chains in the Genus database with same CATH superfamily
1BXUA 5HHXL 1P7QD 4XMTA 1WBZA 1MFEL 3AG2B 1TETH 3KM2A 5K9KB 1UQSB 5E8EA 3VW3H 1IGMH 4UTBH 3P4OA 3CFQA 3CSGA 4XP6H 3SYCA 4UOW1 4YXHL 2WXLA 1GYAA 2WLMA 4YHZH 1XFPA 4HUWA 4UINL 4F8OA 1TQBC 5HDRA 1XCWA 5FYKL 4YDLB 2R1YA 5ILTH 1CWVA 4HAFA 4R7DA 1PLCA 4JANA 5IF0A 5FLUA 4R7NA 1LLAA 15C8H 1PZUB 4LSRL 5DR5H 1D5MA 1IGCL 1U6AL 4HU8A 4JQXC 4Z7IA 3LZOA 3IAQA 3T4YB 1BZ7A 4MZ3A 1JNHA 2K1MA 2CGRH 5ANME 5FK9A 4NZUL 5I6MA 3CDCA 1N5YL 1B0RA 2QHRL 3ZKXC 2O26U 1Q1PA 1YDPB 4LSRH 1C08A 3EYVA 4Z9KB 3DX6B 4MJIE 4PJAA 5E9DD 2XV0A 3K80A 2PWFA 3O3UN 2H45A 5TQ2L 2AANA 1AO7B 4H0IA 2B7DT 4NRYA 4TLUA 1R9FA 3SDAD 1QFHA 1NC2A 1N6UA 3N5AA 1NIFA 4MXQD 2L04A 4BKTC 2C4XA 3CVCA 5ITFA 5SWZE 1GKEA 2HT4C 1I1AC 3N1MC 3OAWA 4IS6B 2BVEA 5H37G 3ME0B 3RPIB 2PWHA 5E23A 4J4PA 3BUTA 4LEOB 4N5UA 2GEQA 3VU1A 5ESQA 4K5MA 3VGHA 4Z7VE 3GTNA 3IJHB 2NY2C 4UQ2A 2DM2A 3F64A 3O3BB 4RWHA 2V5TA 4YSSA 1KFAH 1BBJB 1G7PB 1JGVH 1BQRA 1LK3L 4HX1B 3NFNB 1NAKL 5I75C 3T6XA 4F7CA 1DDTA 3IU3A 3B2UD 3BQUB 1Y6NR 4MXQC 1N12A 3TWCH 4M4RB 4OF7A 4XN4A 3JWDC 5DJZA 3UBXA 1XH3A 3G6JA 4J8RA 1ESOA 4W9HC 1XTMA 3W57A 2WO3B 4M7LL 4RAUA 4YVUA 3VRLF 3SY0A 4U2YA 2CUAA 1I9EA 5KS9E 1W72L 1P4IH 1MNUL 2X89D 1NDMA 3C6LC 2X4PB 1P84K 4UQIM 1MCSA 4PTUB 5C0GA 2QMKA 5EU6A 2MHAA 3NCBB 5JHDB 2D3NA 2LTQB 3MNMA 1TJXA 5AOLA 2LAAA 4EIGB 4IGBD 3B2DC 4JGMA 4JFPA 4PVMA 1YNTF 3FAWA 4WY7H 4A38A 1JYNA 4HSAC 4GW1B 3BKCH 5DD6B 2IAMA 3VFTB 3KWVA 1TVBA 1XZ0B 3OAUH 4NJAL 2OM5A 1WE5A 3LXBA 2ZP0T 1YEKH 4K3GA 4ODUB 4KJYB 3RUGE 3TJHC 1GC1C 1VPOH 1WPCA 3OKOA 5DRNA 1QHOA 3QDJD 3P9MA 2OI9C 4KVCL 1NWPA 5D1ZB 3SKNA 2ARWA 3MLVH 5AKSA 2EO1A 2KI6A 3DMMD 1XBRA 5ANMA 1ID2A 4X8JB 4GAYA 3CSPA 2Z6FA 5GRJL 2BRRL 4FQXD 2CLRB 1XF3B 3KM1A 1PX4A 3AGVA 5C6WH 2WSPA 3L3JB 4AG4L 5C0IB 1B2WL 1QNZL 4JZOB 4PJBE 3UTSE 4PWHA 1SM3L 2YWYA 4XXWC 4F92B 1YUHB 2JK5A 4BSWB 3MLYH 3H2WA 1KLGA 2ARJB 4JY4B 1A1NA 2YD7A 1J12A 3OKNA 5E8PB 3L3DA 3D2UD 2LTQC 4TVUA 4QCIA 3S9DB 4J3VA 5CHNB 2BJML 1JFQL 4HBQA 2BINA 3OKLB 4JPIA 4X0KA 1X5IA 5HHVH 3T4AC 1N26A 2OMBA 3OKDA 3VCLA 4D7BA 4J3UA 5L4IA 5ANMB 1MI5E 4N2FA 5C0CB 3TURA 2DAVA 5K9KA 1MCBA 1YJDL 2CLRA 1DSFH 1GZHC 4GAFB 1E6OH 3FT4B 4W9FC 3HMWH 3NTCL 3S88H 2XTJE 3BUQA 4BKSC 1ZA3A 1W2KT 2DLTA 2XHNA 3O6FA 4DVRL 5F9JB 1YMHA 2IANA 1RZGA 1CYWA 3FCSB 3FT2B 4BD4A 4WTXA 3L3DB 4KKZA 3IYLW 5EC2A 5AW2B 2DQJH 4NC0B 5E8DL 3CU7A 1T20B 2IWKA 1KNOA 3FQWB 2O61A 2HRPL 1AQKH 1N67A 4NAMA 4UV4L 3QB7C 4P2QE 5FF6A 2FWOA 4L2YA 5CIPB 1QSFD 4P49A 5EH1A 3SBWC 4HYTB 3TBYB 4ZSOA 4RLDA 4YR6B 1G5GA 2CE6A 3VI4E 4PV9B 5F70A 2YEVB 4DZBB 3NJXA 4X8CA 5TFSL 3SKMB 3T0ED 4IOFC 5LCVA 1JGDA 2OYMA 5ISZB 2D9CA 4N9OB 2YWZA 2EDLA 3HS0B 3ZL4H 3ZE0B 1XF2A 4H26A 1KSRA 4UV4H 1DJIA 1LWHA 3ZDYF 4J39A 1ZSDB 5C0AE 1AJ7L 2ZCKH 3POHA 4FD0A 1U3HA 1SEBB 3LPGA 3OZ9L 1UD2A 1EZSA 5GGRA 5C08A 1SRDA 3WLWC 4BHUA 4Z7WE 1J18A 1TQUA 2COVD 1JS4A 1A8JH 4GRMA 4HLEA 3NDYE 3LOWA 2QVIA 3UYRL 1S3KL 1SN5A 5IB5B 2DI7A 5GZNA 4L4TE 5HYIA 4BDVA 4X9GA 4BSVA 1IKNC 4N0UE 4KNQA 4X5WA 1PS3A 4PRNA 4L23A 4KKCC 1QZ1A 1X44A 2EDBA 4HS3A 5KW9L 2YAPA 1QYGH 3K2MC 2FSDA 3IJHA 3N44B 4KUZH 4CU7A 5C9KA 5IZ7A 4GAGL 1A22B 4ZX4A 1USZA 1JP5A 3CVHL 4LCWE 3RDTD 4NQVB 2X4SB 4EJ1C 1YAZA 3A21A 4OCMC 1MY7A 1UOVA 1RZ8A 3GDBA 4Z23A 1K2DB 2ZOKA 4WU5B 4GI8A 4XNUH 1AZUA 2NY7L 1D9KD 4X6FB 4LVHB 4A2HA 5C08B 2KBGA 4RRPM 2I7OA 3S5LG 3FT0A 1E28B 4CNIA 3MLZL 1R24B 4FXKB 3CLWA 2EINB 5GGTH 4JRYE 4QJ5B 1CBVH 3U0WH 3O8XD 3OGOE 3OPUA 4RFOH 4WFGD 3H0TA 4M6OL 2Q7NA 4V33A 3BWUF 4OBSA 4DP2X 1E5BA 4Z3EA 3D0VB 3PL6D 4FTVE 1NC4D 4NQSB 3K7UA 1UVQB 4WHTB 4F93B 4JREC 3O2WH 3EZJB 1D3CA 5EN2B 1QRND 2DLEA 2EIDA 1S7SB 5CWSA 2EZ0C 4AKQA 4IEFB 4WSJA 4XNYL 1OCRB 3NT0A 2EDKA 1NCJA 1AS8A 4Z7QB 4UM9A 3L7EB 4YSUA 2O93L 3V4LA 1MQKL 5E2VL 4K55A 1G6RB 3K2UH 3KPSE 3BVVA 2C8NA 3KLSA 2XTSA 3QIWD 1T7VA 2OYLA 1U8LA 1XT5A 1ZHBB 1DEEA 2YGQA 5GRUH 3MMEB 4LARL 2DPKA 5DK2B 2VR4A 3KEDA 4OIFA 3SBQA 2YXFA 2ZYSA 4ZNEA 2ICCA 5SV3A 2XWZA 4WGVB 4PS7A 4YQXL 3K6FA 2FHFA 4R8WL 3RKDD 2AQRA 3W2DH 3RTQB 4PJ6A 2VABB 3C60D 3SBRA 4L4TB 5IQ9A 2A9ML 4MRBA 1OARH 2B16A 2KC0A 4N9GB 4KQ4L 4R7NB 4U05A 3FQTB 4MJHA 4IBWA 2EQDA 4PJ5E 3P3RA 4HWNA 3UMNA 3PGDA 5CMAA 3O6ML 4U31A 5BQDA 3PL6A 5C0RH 1HHGA 5IFAL 3MRCA 3NA4A 3OAYK 5AEAA 2XBDA 5JR1L 1ZHBA 3QUZC 3LNGA 5C0DB 4MRCA 2WCGA 4M1GH 4PRPD 5C0EA 1L5GB 3SEPA 3ZPDA 1KDJA 1FNEB 4Y5YC 3WFCL 6FABL 3DJTA 3K71B 4DGUA 3QUKA 4YPGA 3HZMB 1ORQA 2GTZB 1KYOK 1RERA 1KCSH 5B39A 2G2PA 4A6YB 2Z0BA 1FE8L 4GQZA 2EXYC 1BM3H 3QEQD 1BBDH 2ORBH 2GSMB 5EBLA 1XGYL 1CICB 4YOKA 3OB0H 4MBRA 5E6RB 2BSBA 4GO6B 3BQVA 5IGXL 1J8HA 1YYMH 2WOBA 3UZVB 1IAMA 2CO7B 3MRGB 2VW7A 4R5VA 3S48A 4FEIA 4P5TB 4PGCB 1H3VA 4KI5F 2ZX9A 2Z92A 1AHWB 5KYWA 1EHLH 2PR9A 1ZS8B 3SDCC 2BNQD 3GMPB 2GYSA 4LEXL 4OZHE 2XBTA 3L3OA 3NQKA 4URKA 4YHIA 1I8IA 1ZDQA 1JZ3A 1NBYB 3KNBA 1ECYA 1MHEB 3IDGB 1A7RH 3NAAH 1V27A 2GAZA 2X4NA 4XRCB 4Q58C 3ZU8A 4KWUA 2Z8WC 1CDIA 1GZHA 2C1OA 1F4YH 1FNAA 1VF5C 3HE7A 2VXUH 2YJLA 2N0MA 4HIIA 7PCYA 2V8MA 2Y6SC 1X5ZA 4K2UL 4QRAA 1VRSA 1Y7VA 2EYTA 1BPVA 3H0TB 3MCG1 5KOVC 1S6NA 2CIKA 5BW7A 3Q5YA 5A16B 2ICEB 4EUPB 4IKIA 4R0LC 4JHBA 5KANI 2DWEA 3B7RL 4YX2H 3HFMH 2R83A 1N19A 4H26B 1MJ8L 1IGFL 1FFNA 3QUYD 3WSQH 1R5IB 4G9FE 4KROD 5J3HD 2FB4L 1U3HB 2MSPA 1V3MA 1RUMH 2VN3A 4XRCA 3H9HA 5LGHH 2CO6B 4BSJA 5HI4D 4EUPH 4NKMA 3TYFA 4GW1A 5L7XH 3BGFC 1J5IA 1YLBB 2DQUL 4ZO6A 3KXFD 4L3EA 3TPUB 5LBGA 2PF6A 2GSIB 4W70A 2V3FA 3RVXD 4RRPG 2DI8A 5EZOH 4KAQL 4WGKA 2WUBL 3K6NA 1H3PL 4JDVB 3VSUA 4KKPA 3T2NL 5C97A 5E00A 1NFDE 2PPEA 1EUTA 4FABL 2HSIA 1IAOA 2IALB 6FABH 2PYED 1ETB1 2JKSA 2CRIA 2W60A 5IVXF 5FUZL 1ZY9A 3K3QA 3G7TA 2VUOA 3AWFA 4S2SB 3SE3A 4ZMWA 1G7JA 2JJSA 2J5LC 2VDMB 1HEJC 1N3NA 2DQEH 4ZMQA 4C83B 3BPNB 4FC3E 3WBDA 1HL5A 1CE1H 3P9LB 5A43C 4S1QL 1M53A 2E7LC 3EFOB 3AAZB 2X2IA 3DURA 2Y3AA 3V4VL 3AS2A 1TFPA 4HIEA 1W8EA 4XCFL 1VENA 4WI0A 3ZXAC 3N42B 4FQJL 3SQOH 3OKDB 4JEGB 3X12A 1YUKB 5IJCC 2YD9A 2WBJD 5SX4I 2VSMB 5CLYA 5E8EB 5BZDB 1RK1A 3ZIYA 5CM1A 1DP0A 1N8OE 2DICA 3GHPA 4Z7VF 4BFEA 4ODXB 1TSRA 1YC8A 2Z34A 3QIWA 1FYTB 1O6TA 3JWNH 3H9SB 1Y1DA 3LS5L 4IOSD 4QXTA 4R7DB 4YSCA 1OB1A 1MZYA 4AK1A 1G7QB 5EOQL 3AT8A 4AEFA 1O9VA 1QLEH 2IGTA 1ITCA 3WD5L 1W0YT 1JGEA 2D7QA 2R69H 3O8XA 3US9A 3W1ZA 2A6DA 1PKQE 5TE4H 3NCEB 2AXWA 4FTDA 3L2LA 4RMVA 2MPAH 4OTXL 3WY4A 2YD6A 4EDWH 1QFUH 3I02A 2RH0A 2BK8A 3QJTB 4WUUE 5DLLA 5I17B 3P69A 3MMEA 3ETTA 3RBSA 2EC8A 4I3SL 5CGYD 1I1AA 5ICXB 4MA7L 4XVOA 1AKJB 4FLQA 4M5YH 4ZAKD 2GUYA 1XZWA 3TLRA 3DROA 2V33A 2ZOLB 4HIHA 2VJ0A 1A4BA 4LAJH 3QIWB 1ETA1 2UZIL 3NFPA 4UQ2B 2VZ3A 4A6YA 3WKPA 3VG0H 2EDXA 5DO2C 5A3ID 4IRZL 1B4TA 4QHUA 1RUML 5TDPA 2J73A 2E7CA 4AK2A 2XPYA 2Q6WB 4NO0B 4AUJA 3UPRB 1RL1A 4LCVA 3D3VA 2BC4B 3QG6B 1NGXB 4ZPTA 1S2EA 2EE6A 3BGAA 3V4PB 1OK8A 4YNYB 5ID1B 2FQGA 2V37A 2GI7A 4TLSA 1XGTB 3FT9A 4G1EA 3PL6B 3S3BB 4HK3J 5CGBA 1QO3A 2MQCA 3C2AL 4CN1A 3I50L 2F6AA 4OBRA 4XAKE 1EHKB 1EERB 4XHJD 2WQUA 3DRTA 1S5HA 3QEHB 4YHLH 2WWMD 1NEZA 5I30L 5CEYB 3E8VA 1MPAL 5TQ0H 1ZANH 5CCKH 3BP5B 4DGWC 1HINH 2WKOA 1RZ8B 2BHZA 2WZAA 4H0HB 4B7IA 3NA9L 3EH5B 1B4JH 4FQLH 4FG0A 3D4GA 3O4LB 1NC2D 2NLJA 2JKNA 4QRPD 3QCVL 3HI1A 1D7DA 1CGVA 4WKZA 1PY0A 5CP7B 3INUL 5I1HL 1KB3A 4FNRA 1WHOA 4JCLA 1I9RL 4FQHA 5IHZA 1X7QA 4P23C 4MCYB 4BGDA 4WF7A 4JM2A 1Z1WA 2CJUL 3QUMH 5F44A 3QZLA 4X4KA 4JK0D 1R5IA 3JWNE 5DFVC 1EQWA 3PWNB 2OKMA 5EO9A 1I8IB 1FC1A 5E0FA 4EBQL 1C08B 3EYVB 2LFEA 3TH4T 1XSKA 2AXGB 1XSIA 4M8VA 3IS0X 5EN2A 2B3RA 2H2SC 5CKGA 1MFDL 4CKVX 1BMWA 1OP4A 3T6QC 1CGYA 1DANU 1YMME 3M88A 3UJJH 3VD0A 2YGVA 1LILA 2EYTB 2VLRB 2IPUK 3AG1B 5EU4B 4HIIB 5A16A 1CK0L 2AZAA 2NT1A 4Q9RH 3FFDA 4BQCA 5C6TH 4Q14A 4JO3L 5CCGE 3MRFB 3QDJE 4CC4A 4ZMVA 3BCDA 3TN0C 1XR9B 2IANE 3PWNA 3PWUB 4PBVC 5BV7H 4ZTEA 1KCRH 2NDGA 2ZUWA 2CO6A 4Z0XB 4EI6A 3CN2A 1I4FA 1MFAH 3F6LA 1JIBA 1YPZA 2VN7A 1U8KA 4KX9A 4JFFB 3QUYA 3BUBA 5BV7C 4GRLC 3GYRA 3MYZA 1LE5A 4BELD 5FA3A 3D07A 2HJFA 1KGIA 4DZ8A 5IJBC 5KSBA 4PRBB 5L4JA 4HF5L 4F3FA 1MCLA 2VE6B 4JFQB 3C75A 4Q56A 2ATPB 4NC1C 4X5PA 3KCPA 2NY5C 3GLAA 1K5NA 3LS4H 4LSDA 1S9XB 5DJ2B 1T1WA 5HPMA 4GOSA 2O5YL 3BKMH 2VDOL 5IOPA 4X4MA 5D72H 1EO8H 3B34A 3TBTB 5L2KB 1T0NB 2PXYD 2E27H 4GSXA 4ZSOE 3S35H 3ULUC 1T03L 1GS6X 1CJYA 3LZNA 1UXWA 1B90A 2X88A 2AC0A 2F54A 4NHCL 4PJ9A 4DGVL 4ESKA 1DBJH 1CQKA 1I7UA 4C4KT 3MCLH 3NYKA 4Z7OE 4GUOA 4OFKA 3TNMB 4BH8B 4C47A 4UT9A 2APBA 3LZPA 1GYCA 3KYNB 5EN3A 4PY7A 3T9WA 3REWA 4WUKL 4JFZH 2K3HA 3QULB 1MWOA 1I8LC 1FFPB 5B38B 1UCBH 3LQZB 4GP8B 1JTPA 4JY6B 2XY1A 4GAYB 4YDZA 3G08B 5F7EL 2N0KA 1ADWA 5DQJA 3OVUB 2NXZD 4YXLL 3MZTA 2K6YA 3ETBF 4DP1X 3AXIA 1DFXA 1FO0H 1YG9A 5L2KA 2VC2B 5ECJE 5D1ZD 3EOYG 1E8XA 1DVFC 4ABQA 2OJEA 1D7BA 1XB3A 4GBXD 3WNNA 1PYWB 2EZ0D 1HEZB 3STZB 3L4XA 1U8OA 3FN9A 3PP3K 3TBVB 4QRPE 3NP4A 4LPYA 5HTSA 4NS0A 1Q72L 2R29H 3DETC 5IW3A 1IC7L 1A2YB 3V0GA 2W9DH 2IWGA 5E2UL 1H15A 3O45B 1P1VA 4ZS7H 5JHDD 1KDIA 1I8LA 2B8OT 5DJ6A 3W81A 1E8YA 1YYCA 3MRCB 4NENB 2F8OA 1FVDA 4Y4FC 3HLAA 5KVDL 1MIEL 1PAZA 3D6GA 5CJBA 3NEEA 1GJWA 1HKLH 4TLKA 2CHNA 4DVBB 5IJKA 5D7HA 1DHKA 1LP9E 4EDXA 5HYQA 5D4HA 4WW2F 5K1NA 4BXSV 4OZGA 3NZ8A 4DN4H 2M1KA 4HPOL 4I0PD 5ADPL 2XKSA 4X8GA 3SE9L 2CDEB 1D5ZA 5E4OA 2LT9A 4BXVA 4ZBJA 1Q0XH 1RI8A 3O4LA 4Z7WF 2E7DA 5BOPA 4YIQA 2VUYA 1Q8MA 4D9QD 3L1OH 4WWNA 4X4YB 2P80D 2PLTA 1JGUH 2NOYA 2EXSA 2IAND 3D09A 4M48L 4UMGA 3JVGC 4GFXA 3IDYC 3HG1E 2JH2A 1NPUA 3VQMA 2WZPD 2TRHA 1SBBA 2AXHA 4LLDB 3ZKMD 4BFKA 4AQ8A 4GLRI 4L1HA 1UUSA 3N3EA 4JO4H 1IAOB 5AAWC 1JGIA 4JFHE 5AAPA 5ISZA 2YQ3A 2R15A 5EA0L 3U9UB 2ENPA 1WAAE 4CN6A 4PW3A 4YC2C 4N20A 2PR4H 2RFXA 5F6IB 5IB5A 2XIBA 3V0WL 4UDUB 4JS7A 5LXGH 3MCLL 1UACH 5I1AA 3NRFA 1YEEH 4ZXBB 3OF6A 1QATA 2XKNB 5E2WH 2HMID 1S7QB 3N04A 2ZUTA 1N6VA 5GS2H 4POUB 5EOTA 1D6VL 2IBBA 2YPKB 2BMKA 2HT3D 2OL3A 3LIZL 3HG2A 2CMRH 1W8OA 1K2DA 1PCXA 2ZOKB 3ARYA 1WFUA 3IDYB 4K3DL 4EN3D 4Y2DC 5JO5A 1R3IH 2X6VA 3NFNA 1QPXA 4YHMH 3Q43A 2NNXA 5AZ2H 1U4FA 4A63A 2ZWYA 3EJYD 4M3KB 4Y4KC 1QSED 4XN1A 3O3AB 3WJMB 4PY7B 5E2WL 4RISL 3QUXA 1G7IA 3V10A 5IGXH 3Q7JA 5EZLA 2Q3XA 5JLZA 5LXGL 1UURA 4EQ2A 1U8CB 1SUHA 1G43A 3L95B 2YUXA 3N1GC 1DQDH 5I9QC 4GEJA 1RJZA 4FQ1H 4KNSA 3SIKA 4FEMA 4CW1B 1KEGL 1UOKA 4LCIH 3T2PA 3B8YA 4YVNA 4N8CL 2FT6A 2E76C 1ZCRA 4NWUL 3QS3A 3JTTA 1OAKH 5JXEA 2R1WB 2IOMA 2GJZA 2PCFA 1A6VL 2A77L 2PXYB 5I1GH 43CAB 2JCCF 5F9AC 4C4BA 1TTUA 2AS5M 3OAYH 1U8MA 5IMKB 4QO1B 1MCKA 4Z77B 3OTTA 1Q38A 3ILDA 4PJDE 3QORD 3UG5A 1QEWB 3HC0B 2IVFC 4TSBH 4ZDHA 2OJZL 2HT2D 3ARGB 1S9WB 2QGBA 2OK0H 3D3VB 3MV9A 5FWQA 4L8SB 3QFDB 3S5LA 3AM8C 2X40A 3U1SL 4M48H 2AVGA 4P9ML 3WS3B 2X3BA 4CKQA 3GK8L 7PAZA 3GXNA 4LAQH 3LN9A 3FPXA 4XO9A 1Q94B 3H54A 1EZVY 1MJUL 2MH4A 3DBSA 1KXVC 2P8LA 1NCAL 4OLYH 5DGQA 5K5YA 1YUHA 2JK5B 3GIVA 4R2GD 4QTIL 5BRZB 1RAMA 2N3JA 3O6LH 4WNQB 1FZMA 1NIDA 5JHLH 5IK3A 3UEZA 1FLRH 1QI5A 2NX5E 3T3PF 1SF5A 5CMAB 3ARGA 1JV5B 4I1NB 1YEIL 4AL8H 5C0CA 4PP2A 1YZZA 5KOMC 1P5VB 3MGTB 1NCAH 3VCLB 4OCSL 1KTCA 5KVFH 1M6OA 5DFTA 4LLMB 1OP5K 3BGMB 5KUKA 1FDLL 3QT2A 4PJ5B 2VDOB 4BE5A 3ULUL 5T3ZH 1ZT1A 4C8XA 5CFAA 1OAZH 3I6LD 5KTEL 3F5WB 3KDMA 3WG7B 1NDTA 4TSAH 4P2QA 5JPNC 1N5YH 2A6IB 5HHMD 2QVKA 5D2NC 1N0LA 5I74B 2GSGB 1RJLA 1HOEA 3MGOB 1J8HD 1HHHA 2AK1L 2K78A 3H3PH 5ICUA 2QQKH 4U1NB 3V0AC 4Y9BA 3WJJA 1KJMB 1U2CA 3PHQA 3N9GL 1DVYA 3QJRB 3D9AH 3NCJL 3K6DA 1B6UA 3B9KB 5AW6B 5KSVA 2F5AL 1KENH 2D4DA 4EF3A 1BOGA 3INOA 4U1HA 5D7SH 1OF2A 2C9VA 2DEYX 3A4DA 5F1SA 2J7LA 1A9EA 2WN2A 3A3YB 4XP6L 1R3HA 3TBWB 4F57H 3BXNA 4I9XA 1MXDA 1J1OL 3GUTA 2FUTA 4HEPA 3QA3B 2VDMH 3BKJL 2B5IC 3P4MA 3MLYL 1HSAA 1A1MB 2Q7AA 3HC3L 4JFYB 4JKLA 1AY1L 1NUNB 3KPNB 2WNKA 5BUGA 1BZ9A 4R7XA 1M71B 3GJFA 4GMTH 3S2CA 2QPEB 3AACA 3HE7B 3TO4D 4QRFA 2JMRA 1NAKH 3CN0A 4HGKC 1MHPL 4PJEA 2G2RA 3HE6D 1UWGL 3LNIA 4M7ZB 2K45A 3U7YH 1FGNH 3FUHA 1USQA 5FO2A 5I74C 3F7VB 3TGXA 1P9MA 4DO4A 2QSVA 2FR4B 1CLCA 5IHLB 3PGCB 4BRJA 4CUCA 1AY1H 3QFJA 3QWOA 5JPMA 2JXMB 2HFEA 4HPOH 4CMMA 3GWJA 5C09D 1M2VB 2JI2A 3ZTCC 4F2FA 2EDEA 3SQBA 3S35X 3NJVA 4AJYV 2QQNH 1ZHNA 4F24A 3RVVD 1ADQA 3DA0A 1QLFA 3PJLA 5AW3B 2TSBA 3KPQB 1MJUH 4BGLA 2Y7QB 5E6IA 2AEQH 3VGFA 2ZXEB 1G9NH 2OQJB 3EJRA 4GKSB 2RBLA 3T8MA 1WK0A 2I5YL 4UQ3B 1S46A 1E5UI 2YXMA 3W0WB 1ACYH 1JWMA 1IM3D 3OR6A 1DO5A 1YEDB 4N0UB 1JZJA 5ALCH 1P0SE 5GSVA 3QIUA 4U6HB 2GI0A 2N1KA 4ORGA 3I6KA 1D7CA 4UILH 4JM0A 3UO1H 2L7JA 2JWYA 4MNHA 1Q94A 3QRFM 3RZCB 3GRWL 2VLJD 1J7VR 2O1AA 4N8VA 3ARGD 2ADJA 4MD5A 1TKWB 3NUKA 5AOZA 1TQTA 5GS0D 3EYSH 1A6ZA 1N4XL 4P4KD 5E9DA 2WBJB 4YS4A 3AS0A 1Z9SB 3J27A 4MDJB 4L29A 2Q76A 2Q6WA 5A2IH 2DJSA 4GUCA 4LKCA 4F7TA 5J4MA 3OF6D 3WY2A 4UQEA 2J1YA 5D6DC 5KAQF 4MMXC 3P9MB 3LNFA 4EO5A 1YEDA 4N0UA 5F1IA 1J9RA 1JWMB 2VDLB 3D51A 3CZKA 4PM1A 2HUEA 4RH4A 3NPZB 3CJJA 1KCUH 5FKPA 4BM7A 3JTTB 1TTBA 2GY7B 3FQXB 3CMOL 3GRWH 1GW0A 4EXPX 2I69A 3CFBB 1IBYA 4D9RD 4HJSA 1WF5A 4JFPB 2J88L 1KGUA 3U6XA 4H8PA 1HN1A 4RISH 1I9IL 2DLIA 1GGCH 4XAKD 3MLVL 3FN0L 1G9NC 1A7NL 3NK4A 4Q8BA 2AXFA 4U1SA 1CXFA 4LKCB 4FA6A 2ALWA 4AMWA 1BYNA 3U6XS 4XVTH 1RMFL 2XN1A 1DZ0A 5ICYB 1UFUA 4UT6H 2BSTB 4QEGA 4MLIA 3VE0A 3QORC 4J7RA 2RGSA 1KG0B 5FM8A 4DIXA 5HJDA 2MFNA 2W0KA 4KUCF 3ZTEA 5I1KH 1XEDA 3U36B 2YUWA 1KZQA 2EXTA 1JHTA 4N0CD 1EAPB 1UA7A 1AGDB 4OIBA 4UT9H 4PLJD 2NX5B 3QJVB 3KBHE 4YHNB 3K8MA 3WNKA 1AZBA 4JJHA 1AIZA 4RDQF 3OXRB 3P11H 3NCYP 3QJFB 3OGCA 3QNZA 4MD4A 4JLRA 2ZTBA 1TO5A 1M71A 5PCYA 3BKYL 1I9JH 5EA0H 2V2WB 3UTZB 1U91A 4XP1H 5I71B 3KPSA 4GRMB 1Q9KA 4JFUA 3UTSA 2WQXA 1MFCL 4HLZG 2NNAB 1AQHA 3AXLA 3QJZA 5HD8D 5LB1A 3HN5A 4M7LH 1NICA 1F6AA 5J11C 1NC4A 1Y18A 2WCSA 3MA7A 2EEDA 3PGCA 1BQ5A 1GZPB 1BX2A 4JKMA 1QVOA 5F88A 3BAXA 1XR9A 3QWNA 4HJ1A 3BVNB 1HH9A 3MOQA 5JOPE 5DUMH 1WISA 1NOFA 5B1KA 1TZHA 3DX6A 4PJAB 3ATAA 4JGNA 3MHZA 1QW8A 5EF1A 4WO4C 1P1ZB 5JR1H 1K4CA 2WP3T 2CRYA 3QJHA 2BP8B 4FG4A 4I0PB 4HULB 1WUNT 3B2PA 1PDKA 1BZEA 4MQTB 1RHHA 2A73B 4N1CA 5D7JC 2P5WE 2OLDA 2YRLA 4A2DA 2H8PA 2RCSL 1KBGH 4KKRA 1FLTX 1GOHA 4OGYH 5AKRA 4Y4FB 4BFRA 1RVFL 4LSVL 1HNFA 4FNTA 3ZIMA 4E36A 1B6DA 1JZFA 2BRQA 4U1HB 4Y7OC 5TF1H 2CBPA 2QVMA 4N5EC 3C09B 3V4VH 2WXHA 4OCWH 3HJ0A 1X7QB 2I25N 4AGQA 3C6EA 4O02B 3UTTB 1N0XL 3GLDA 3O3BA 3B3IB 2ESVE 3KPSD 1GIGH 4ZPVB 1FL6A 2XC8A 5I1JH 2F53E 2JJTC 2IMMA 4KRPB 1GGYA 1K8IB 2X10A 3QUMA 5CJXC 2XJKA 2WLYA 3V4VB 4WZ9A 2X6AA 3E2HB 3NFSL 5F7KC 3QZWB 3F12B 3VD2A 1J86A 3K2UL 1EEZB 3MOBL 1FSKC 4K7PL 2A9NH 2ZX8A 4K3EH 5CCJA 4HS8L 1AZNA 4LPTA 2VXVL 1GTNA 2B1OA 4Y4HB 3E9TA 3VVWA 1Q1JL 1PZ5A 3NCCB 5GRZA 2Y5EA 5SWZB 3UIZA 4FYTA 3FOMB 2DKUA 4AQZA 1JTOA 2DQ6A 2VLME 2ZSVA 3FYEB 3WJLC 3T65B 3WFEH 3QWRD 4PJGA 1T0MB 2ADYA 3MKKA 1V10A 2MJWA 5BUAA 4HHAA 5AUMB 5EMYA 2B9BA 2R0KL 4MB1A 3P9WB 3Q06A 4NQQA 1Z9SA 2WLZA 4UV7L 1BMGA 4XMVA 1LE5B 4F9PC 3QARA 3MACL 1LE9A 3I9IA 4KJYA 2R56H 4PRPE 4WNQA 2CBQA 5D1XE 1R6VA 2R23A 5L2KD 3L95A 1Q1JH 2YEZB 1YSOA 1OQOA 1JF5A 2Q8BL 5T3XE 4Q6YA 1MAMH 3ARXA 4TV3A 5C0IA 3NIFE 1MJ8H 1T6VN 2ZKWA 4WI2A 3B9KC 1M1XA 3QNFA 1R75A 3SGEH 2ICWA 2QADD 1O7DC 3HZ3A 4FS0A 1YNTB 2YEQA 1AGEA 2DTSA 3GMMA 3GUFA 3L6FB 5EDSA 1QEWA 3O8XB 4AWJC 2BS9A 5DVPA 2AZUA 4UOZA 3QI9A 2VLKB 1SQMA 2X2JA 3VXPB 4JHAH 3D1MC 3I3DA 3UIYA 5F3FA 32C2A 4P2OA 5I0XA 4IRJD 5GGSB 4MJIB 2BW5A 3FQRB 4N86A 3FFCB 3I6GB 2YPLD 3UYRH 2OR9L 2R69A 3Q8AA 4TUKH 2VDPB 2N1TE 4KY1H 4L1TA 5IB4A 5FUZH 1VIWA 4XC3L 5JW5B 1MLBA 3HNSL 2O4EA 4NWTH 2VL5B 3B7SA 1UB5A 4KMTH 4MB4A 3POCA 2A6IA 1FN4A 3SGEI 2ZNXA 4GG6E 4FHJA 5FYJL 2IBZX 2BSRB 1TLKA 3MA9H 2XXFA 3DGGA 3M1BB 3P2BA 3WFCH 1MNNA 3D4ZA 3BE1H 1T5KA 3OXSA 5D7KD 2H6OA 4NIKB 5LN8A 4XPFL 1NTDA 3CC1A 5I8OH 2WQVA 1J8SA 3HZYB 4LIQE 1NCWL 1F4XH 2OL3H 4HIPA 4DZBA 3JYBA 4G3YL 25C8H 2NY6B 1IGFH 5IB3B 1ZGLA 4UCFA 3U48A 4B0MB 1T5XA 4Q9CA 1JV2B 3OXRA 5KSAC 2YZ1A 3T0DA 4NUPA 5GS0H 1X5XA 1KJ2H 4E9SA 5JYMA 3C6LA 3LCYA 1PX8A 4LE8A 4O2EB 3AY4C 4W9ZA 1NCDL 4FE9A 4M5SA 4CJ0A 1E6OL 1NCWH 2CSPA 4IS6A 2WN3A 3ASWA 2YBRA 1IAKB 4OIIL 2MQ0A 4JPWL 3T0WA 1UASA 2AKRB 2VLMD 4WO0A 4XPBH 3IKCA 1BQLH 4LLDA 1CFNA 5BXFB 1AS7A 2EECA 1S9KC 2FECL 1H6EA 1HHKB 5B3JE 2N56A 2P48B 2MKWA 3MFGB 1J8KA 1BBJA 1G7PA 1U2YA 4P59H 3F04A 3FF8A 1ECZA 4G6JH 4O4YL 4OSUL 2Y1ZA 3FK3A 5D1XD 3DGDA 1KT2A 5DJCB 1LP9A 1NM4A 3NJGA 1OALA 3PWLA 4AZ8A 2C34A 3VDCA 3UROR 1PLGL 3CLEH 3U4AA 4NKQB 3BHBB 5HDQH 1BZ7B 1YEKL 3TCTA 2XQYG 4F58L 4AW7A 1DJZA 4Z95L 4AQ1A 5B7EA 1A64A 2YKLL 3QAZC 2WMPA 5I6KA 3V6ZB 1C5BL 1PIGA 5D1QB 5D2NA 1LO0L 5JORA 1BG1A 1MG3C 3CZNA 4ZO8A 3HFML 3UTPD 1XGRA 4NRXB 5C3TA 4HKJA 4JHAL 1BJ8A 4A2GA 1E4KA 2NTFA 2O5ZL 4LVNC 3D4YA 5IMLA 5E6UB 5C9JB 2GPZA 1A65A 1HSBB 3Q05A 5SWZD 4HHAB 5AUMA 1VZGA 1H3GA 3L8QA 3LS5H 2V9TA 5F71A 1BYPA 3RI5F 2KHAA 2W80C 3TBSB 4Y4HD 5JO5B 4FQXB 1TUPA 3LEXB 3WXWH 4JREB 2F8VA 1NKOA 4LRNH 4Z3IA 2BS8A 3N9GH 2VERN 4A7GA 4RQQB 2HJKB 1ND0A 4NNXA 4UT6L 2MTAA 1KMGA 1NM9A 3KW7A 5F1IB 2GJ6D 3W0WA 4NZ8A 1M3JA 4P8QA 3IFLL 1KENL 5AQ0A 1NBVL 4XPAL 3MRQB 1WWWX 2H0JA 1K5NB 1X6NA 1DEEB 5AB2A 1NKGA 1MFBL 4L3EE 2NY0D 4ZMPA 3B6SA 4ZTPL 5GISL 2HP4A 4XCEB 3BAKA 3DSNB 3JXAA 3PFUA 3SGJA 3KPPB 4QHKI 5FCSH 3U4KA 5CZVH 3AVEA 5C2BL 1EFXD 1JPFA 2DIAA 4LRIC 5CLZA 2Q9OA 3OV6A 1KOAA 4LLYA 4JUSA 4PJEE 3WENA 3BAEH 1XH2A 2J8OA 4N5ED 3RIFF 2EVFA 4Z7UE 2FL5B 3TA4D 3LH8A 4GSRA 3TNMA 3IGKA 2W0FA 2J25A 1FL3A 3ZTJH 2EH8L 1FH2A 4FRWA 1NCDH 3MRHA 1CI3M 5T1KA 3ASOB 1DVZA 5BRQA 4BK8A 2NNAA 3GSXB 4HJJL 3B1TA 2FX9H 4TUJB 3VH8G 1KJ2L 4GQ9L 4KXDA 4H5SB 4JQVA 1J1XH 3KPOB 2GUOA 3BQUD 2Y36L 1N6QL 3MXVH 1KYUA 1FZJA 2UZPA 5CEXA 4JPVH 4LP4A 2CNYA 2RIKA 3QQ4A 3JT0A 3PUUA 1EV2E 4RGND 1EMTH 2OP4H 2MCMA 5IVNA 2WO2B 3LRSA 1HXMB 2XYBA 3DVGA 3WIIH 1HDMA 3EF7A 3UABA 3H4FA 1B0GA 2ZYRA 1T83A 3ALXA 3F83A 3M45A 4KXAA 2IPUG 3E7JA 4PWIA 4O2CB 5KVDE 1UXSA 4JM2C 4NPYA 4LLUA 1ACYL 4E9LA 1FAIH 2C4FT 4Q6IB 1GZQA 2JFCA 4LLWA 4O00A 1R3LB 5INCA 1Y18B 4GRWE 5KVGH 1F41A 4FQHB 2WUCH 4WNJA 2WQRA 1L7IH 2UX6A 3U0PA 2NYYD 3FB7B 4OVVA 4NZDA 2R4RH 1ILUA 2WBWB 2VL5A 1IGTB 4LVEA 5TH2B 5KBKA 2PW2B 1NGWB 4RMQA 5HXMA 4PRID 3V52H 3IRZA 3GEWB 4IIQA 1A9VA 1KIUB 3L3OC 2F08A 4L3AA 3MO1B 4LDCA 4X5QA 4POZC 3BRGC 1RP8A 2Z31B 3GS0A 1DVSA 3VO0A 2HVJB 3GHEL 5BS0D 4KQ0A 1TTAA 3KW8A 4JDTH 3NBNA 3GSNL 2OAAA 1TETL 4WEUD 3T0EA 1QLRA 3DBXA 4KH9A 2ESVB 3OXSB 4GKLA 4ADJA 4ZUUB 1RZ7L 1A9EB 3HG0A 4AQEB 1D6EB 3C2AH 4J3WA 5JW3L 4OLXH 1NBVH 4I8DA 4AH2B 4QHPA 5EEYA 2N7SA 4KDTA 4F8TA 4DESA 2Z9TA 3U25A 4F9LA 1CYXA 3KGSA 4PIRF 5HY9B 2EABA 2WPGA 4H0GA 1L9OA 1G0YR 3UJIL 1HAWA 3EJJX 3FTSA 1Q9OA 1KTDA 3D08A 4R0LB 4XMLL 5EEXA 3BT0A 2EVIA 4WW1B 5E56A 3BSZL 3RWIB 2ED9A 3A4EA 4TOYH 3SYPA 5EZJB 5ITFB 4M61B 5LAXB 1CGSL 1UXLA 3M7OA 3DPBA 1DVFD 1KWKA 3P02A 4M6NH 4ZD3L 4HQQL 2CNZA 5AVTB 3WIFB 5AB9A 3TC9A 5DZPA 2MCPH 1CICC 1LMKA 2KYIA 3MV7E 4NRZA 2Y7MA 4J3TA 2UV3A 1P7HL 3PWPE 2MEJB 3GMNB 4LU5L 2UWEF 3KCPB 3RWEA 1A4JB 3CFCL 3MBEB 1KCBA 4XMLH 3T09A 3DUHA 4M5YL 4MXVE 2F0CA 3F7RA 4U33A 3P3YA 1JOIA 3M17A 2ATKB 2XSKA 4L5FH 4NGHH 1CFNB 5BXFA 3ULVF 4G71B 3P4NA 2V7NA 1IU1A 5DFWH 4Y5VB 4ZS6C 3EO1B 5BMFL 5IVZB 4AIZA 1YPZB 4XC1H 1DN0B 1IC4L 5IIEB 4A55A 1QMUA 5E8PA 3U0TB 2EKSA 1Q0XL 2X09A 1FVCB 3ZK0A 3RL1A 4A68A 5T1LA 3WE6A 1CG9A 1LD9A 3L1OL 4P06A 1H3TA 2NCEA 5L4FA 2XG5B 5DRXB 3S4SG 3TEUA 1A3RL 2APWA 3CFUA 4A66A 4U7MA 4KQ3L 1SN0A 5F9OL 1RK1B 3HTLX 5FW6A 4JRYA 1OLZA 4Z3TA 5HPMB 2DV6A 3OAZK 1NIBA 2C26A 2QV2A 3AG4B 4MQ7A 5AYQA 4C58B 5D7IB 4EPSA 4XP4L 4MDIB 3QH3A 4DP8X 2OR9H 5H4YA 3U4EB 4ETYA 4FTVA 1YPZF 2F9BT 2XLLA 2K0RA 2X0WA 4G6AC 3LVEA 5J1AA 1JHLL 1U8MB 3RWGB 1OB1B 2E47A 4BCYA 3AUWB 5KSBE 3FQNA 3CZUB 3HAEA 4E9TA 1I75A 1BFVH 1XCQB 2I32A 4K9EH 1CTNA 3U4BL 1OWRM 1ZOXA 1MHCA 2FTAA 5ALCL 3APMA 3V0DA 1DL7L 3HRZC 1L0YA 3CXDL 1E4XI 4OGYL 3E3QC 2KKQA 1U8HA 4BEIA 5LGJB 5I76B 3BUYA 5LG1A 3LEYL 2NUPA 3MN8A 2D3LA 1BZQK 5EOCH 1HNYA 3ULVH 4X9YA 4HAGA 1XH0A 1O9WA 4KDTC 5FYKE 3MLPA 5AWNH 2BNQE 2XICA 1SXAA 4QR7A 4EQ3A 4XVJH 2N4IA 1HWGB 3SE4A 1KPRB 5GGRB 1E2ZA 3MLSL 2FECI 3LB6D 4MJ5A 1GGBH 4NC2B 1RJYA 4HOMA 1BLIA 4LCIL 4QRUB 5CBAB 1NMBL 5J57B 4UB0L 3DGGB 1SY6L 3BMWA 2F54E 1RD6A 4KO7A 4RCAA 5LQBL 5IUSA 1Z0MA 2HKFH 4Z5RB 1B2YA 1MOEA 3ARTA 4X99B 3BUDA 4JFHD 5KJRH 1NFDF 2BP0B 5HHMB 3FB7A 3AGWA 4L1SA 1AIFA 1LDSA 4QUOA 5T1DH 1OQXA 1NGWA 2W9LA 4QPEA 3AREA 4Y8AA 1MLCB 4PJ5D 4JB9L 1KCVL 5D2LB 3NZ8B 3L7FA 4OLZL 2KZWA 1IEAA 1JDAA 4HKXA 4NO3A 2Y5TA 2OMXB 2VDRH 3C87A 3V6FB 3VFRA 4O2FB 4PJ9D 4F8QA 1TSHA 4UB0H 3AXLB 3NSJA 2YHGA 2R2HB 1Q9KB 4DK5A 1DANT 3T0EB 4LF3A 1DQML 3FTYA 4S0HA 3NCFB 4J28A 3SD5A 2Z92B 2ZPKL 5FXCH 3K0WA 5I1EH 1FZKB 2AABH 2EUWA 4RDQG 4HOWA 5BO1H 4K5NA 2DWEB 2WV3A 3BCFA 2WZ5A 4HHWA 4RMRA 2AQQA 1IUZA 2O6EA 4R2GC 1DSWA 1P4IL 1L9MA 2BCMA 5F1KC 3VFGH 1I1FB 3FF7A 3QO0B 4IU3A 4ODHH 1QWHA 1A6UH 2A1WL 4YGVB 3X1GA 2CDEA 5E94A 1EJOH 2F15A 4X7DC 5LNEA 3DARA 3KYKH 9CGTA 1MH5B 4OZ4A 5D4JA 1LD9B 1WTGT 3G9VA 1C1EH 4JFVA 1BIIB 5DRXA 4LASL 5JLZB 4JW3A 4CU8A 4BINA 1PQZA 2OMTB 1QPPA 3QORB 4ZFOA 1Z66A 1BVNT 2AERT 1BSIA 3B8SA 1BP3B 4PJFB 1O6SB 4M1GL 3O4LE 3QCTH 3ML8A 4J5VA 3GGWA 3OB8A 3FTGB 5ICZA 4Z3FA 4UQBA 2VXTH 3L3KA 4QHMB 2CG9X 1MSPA 2FLBT 1RUPL 3HNSH 5IJKC 2ZOOA 4TRPH 3U2SB 3MDJA 4KMTL 4Z76B 2QSQA 3S37H 3VXOB 3I3EA 5AG9A 1K72A 2F19H 1HAUA 4YSQA 4DF9A 4OZIE 4FAAB 4IK7A 1A6TA 1CXHA 1IARB 5LAXA 1G6VK 3TZVA 4JPKH 4JHWH 3FMGL 1UYWH 3WL9A 4LCWD 4D9LL 1F3DH 5IB2B 1MIMH 4JFQA 2VDRB 4ACPA 4KKBD 4UT6A 3U1SH 3TVMD 3BEWA 3X12B 5K9QG 1OT1A 5CJOL 4HC1H 2XBZA 1IBBA 1OE1A 1XGRB 1J1XL 1TKWA 3FC8A 1BF2A 5FO9B 1OP3H 2ZE0A 4Y5XC 5CJQL 3TJEL 3KPPA 2YPLE 3H9HB 1EIBA 3KG5A 3UPCA 2KPWA 4KO6A 5HBBA 3ELQA 2FSEB 2EEBA 1IM9B 2OX5B 4N2OA 5I6PA 3UBXB 3TFKC 3GRWA 3VFVB 3FQTA 3APCA 4ZMZA 1LL1A 4XMZA 3VTMA 3RWJA 3PXJA 5TK4A 4I1PA 4JAMB 1SHMA 4NWUH 3K74B 1ACZA 4FTVD 1DQDL 2X6UA 3WCYA 1ZA6B 3MLWH 4U1JB 3CTTA 5E4EB 2PYEE 4A37A 1ORSA 5DD5L 1J9QA 1T83C 3L45A 5E00B 4FQQA 3ARFD 2ADGB 1WFIA 1T7XA 4PS4L 2Y22A 5D7KE 3HE6C 3VXUB 3Q6FA 2RALA 3VG9C 5D70L 1B9ZA 1ZHLA 4B9KC 4HOZA 3C5JA 3TASA 5TH2A 4JFEB 4HCRH 3WTXA 2VN6A 4UV7H 4QIRA 3GHBL 3QZWG 2OXGA 2WIIB 2FEDD 5I8KH 3VE0B 3VFRB 3CZSA 2Q2EB 5ITBH 1KELH 4PWFA 1WYJA 1K6QL 2F1BA 4P46B 3RL2B 4QYAA 4LLUB 3HUJF 1VEOA 3CCHA 2FJUB 2YAOA 3VFMB 2IQ9H 2CAKA 2O30A 3KPRE 1JZ5A 2EEFA 2AK1H 1KXQA 4FQQB 4X6CE 2PR4L 3BKCL 1DBAH 3FU3A 3U1PA 5CR1A 4LASH 1YCSA 4Y16D 3QJFA 4TQIA 1ADQH 3E6HA 4R3SA 3HN3A 2QMJA 3U1QA 2PW2A 1UA6L 3NVQA 2VL4A 1QYGL 4ZX3A 1CI5A 1F97A 2ZAIA 4JR9L 5DJAB 2DYPB 4FFZA 1ZWIB 4JFZL 2ERJB 3EBAA 2X6CA 3HS0A 1XF2B 3UPAA 3FB6B 5B39B 5CSBA 3JV5A 2OSLA 1UXMA 2QHLA 3AB0C 2A2QT 5IESH 3T0BA 1JPST 5GGTA 5SWSE 1NGPH 3SCMD 1KJMA 3WKNA 3C5ZD 3LB6C 4OFYD 4NO2A 4XR8C 3M1CA 4YHLL 1UD6A 1OLLA 3DOIA 3LKQB 5IVXA 5E08L 3KWWA 4G8GB 1ZS8A 4J2XA 4AGNA 5E2TH 5CILH 4MHHI 4UIMA 5KSUA 3KCWA 3PABA 4OGXL 5EULV 3VJ6A 3AQDA 4GBXB 2VR5A 1U6AH 4AIEA 4MMYB 1RV6X 1KUMA 2FYYB 2W07B 4ENED 4FQ2H 3UAJC 3UTQB 3VYNA 5F9JA 5JXEC 2IQAB 1XGUB 4N8UA 2WQSA 4G72B 3B56A 1SEBA 3RGVA 1DYZA 4LNRB 1TQBB 5K69A 5JOFB 1S7UB 5KVDH 3EFFB 4C54A 4BIKA 4PRIA 4QMEA 2WVUA 1HKLL 5J13B 1KLUB 1T66C 2PYFA 4MA1B 1KBVA 2WNWA 5J1SC 2OJZH 4JVPA 2GBTA 3IJ9A 4ZMXA 3FTGA 1LEGA 5IHBA 5HGHA 1M2VA 2AHIA 1SYSB 3U46B 3BP7A 2MOGA 2FBOJ 3NH7L 4ZXBC 3GT6A 3OMIB 3R0NA 4F37K 5FHBH 5EBMA 4EAEA 4AY0A 3N41B 4BQ8A 4TNFA 4KI5D 1Z9MA 4ELKA 2O5ZH 3DUSA 2I60L 3NPSC 4YN3A 4K2UH 5T1LB 2WLLA 4RFEA 3CDGA 4B9JA 2F7IA 1XIWC 3Q5TA 1UZ8A 3OHXB 4NN7C 2MOVA 3GHBH 4TVPD 3O0RL 4NP4L 2VMCA 4M29A 4PJGE 5DUML 4LRNL 4WENB 3RWDB 3DI3B 2ATPA 1UC6A 2KPNA 2ZNWA 1ZLUK 5LAPA 1YEGL 1M4KA 4MJJA 5B3NA 3HS0C 3O0LA 4K94H 3VGGA 2VDPH 1CCZA 2R1WA 1OAJA 3V55A 3CH1A 1DBKH 2P80A 3Q8EA 4QXTB 1SZNA 4IDJL 1BQHB 4M5ZL 1SOSA 5CN3A 1I9IH 5IREA 3QJQB 1EXGA 4M3HA 3UDWA 3APNA 4F1SA 4ZOEA 1YEEL 3NA9H 4NFDA 1QTSA 3RGHA 2R4SL 3DX4A 3IU4H 2F53D 1EFXA 3ZTNL 3EJUA 3X11B 3OKYA 5I23A 3V4PH 3ECBA 2Z35A 3UTPE 5AB0A 1EHAA 4AVHA 4PJBF 4YLQT 2KS0A 4G8IB 2CMRL 3KJ4C 1GH7A 2IOIA 2XWTA 5D7JD 4EE2A 4KZEL 4XVSH 2MNUA 2NY7H 4KVPA 4WI5A 5IW1B 2JCCA 5F8RC 3C5ZA 2NSXA 3ZQ9A 2YSSA 3EYSL 3NFSH 3QIWC 4FULA 2UVEA 5HGAA 1G4MA 2XQ0A 4MAZA 3ZMEA 5BOJA 4JPKL 2BM3A 3N0AA 4MA3A 4KXBA 3JV4B 2IAMB 3VFTA 4YC2B 1OSZA 4GIOA 4NQCA 1F2XK 1LEKA 1AC6A 3U79A 1EMTL 2CK0H 5CJOH 4GEIA 3V4PA 2EJ1A 5FB8B 2ZAGA 4N2CA 2BX5A 3OKMA 3VRIB 1S78D 5CP7A 3VFPA 4PB0L 5GJSL 5GS1C 3ZR6A 4D9QE 1GRWA 4LU5H 5LGJA 5IBUG 4E9WA 3Q0HA 4DKFL 5CZXD 2I24N 3D30A 5IQ7L 3I84A 3WTVA 1RUAH 1OAUH 4ERSH 3F5WA 3KDMB 2VITB 5GJTL 5J6GA 3C8KB 3PFQA 4DP9X 3J07A 4KXZI 1RZGB 3LPOA 4ODBD 4FQCL 1RK7A 1MHEA 1LEKB 1HXMA 5DZJA 1FZOB 1GY1A 1BM7A 1A14L 4KZDH 2JTDA 4ELME 1GW6A 3MLXH 1AQ8A 1IFGA 3FQUA 2R0LL 3IXAA 1UWXK 4PU2A 5D93B 1R3JA 2GJPA 2NZ9D 4M56A 1FH5L 1Y0LB 3H42H 3I6SA 2FX9L 4L8DA 4AUUA 1MDTA 3DV6B 4LLQA 1M9SA 2BVOB 5CN1A 2XNAA 1INQA 4PJGF 4I4WA 1PMYA 2ZUQB 4FI7A 3OMNB 4V1DE 3H7LA 3ZBMA 3RWFA 4QGYA 3BWAB 1B4RA 3JQOB 4IU2A 1LNUB 5F6HJ 4YDKL 5HYJA 3K6SA 3KVPA 3OJVC 3C08L 4ELKB 1AKJD 3U0TA 2QR0A 4N2BA 1ZVSA 3I75B 1YMMB 1CG9B 1ZEAL 2Y06L 5DUPL 1ETZA 2ZUUA 3LRMA 3ZSTA 2DQIH 4JCWA 2AABL 1O0VA 1VJSA 3FYIB 3QQ3A 1KTBA 4WUKH 3WTYA 2CO7A 1ADQL 4Y16A 3TFBA 4NI6A 4RFOL 3CNKA 1CB4A 3W11C 1AD0A 4DEPB 4FYQA 5DK3A 2BMKB 2OL3B 2YPKA 2BVUA 3PF2A 4KKBC 2H1XA 4H8QA 3FOMA 4WCYL 3SDDB 5AD0A 4E68A 5DR5L 3EGXB 1JRHL 2QJDA 1JVLA 3H3PL 3HIZA 3TU6A 5DF0A 4PG2A 1A4AA 3DHJA 4APXA 1ASPA 4LNRA 4FX5A 1K5WA 3RY4A 4M61A 2YQBA 3FN0H 2UZYB 3HZVB 2J4WH 1L0XA 1SHSA 2CU9A 1HJBC 3EHBD 3AJ7A 4X42A 1AGFB 3CVHH 3SYOA 5LQBH 3MTXA 4IK6A 1EEZA 3FCUB 5EEUA 2OFQA 4KY2A 1NEPA 4Y4HC 3DSFL 5J8OA 1V3KA 3UG4A 4QRSA 4R6UA 4K73A 1VA9A 5MEQA 5KZCB 4PBXA 3M17B 4GYBA 1PNDA 4LPVA 1M7XA 1IZJA 3I6KB 4I89A 4Z0XA 3RVVC 2ADJB 1A6PA 4EI6B 4UTAH 3O2VH 4ERSL 1ET5A 2FWSA 2EDTA 4HPYL 4M03A 2APFA 4PW4A 1MJJA 3MCKB 4DN4L 1BXXA 2FZ3A 1OM9A 4LMQI 1GYWA 2LAGB 4QOKA 2PCPA 3TV3L 4P57B 3GJFK 1ED3A 2G75B 1GC1H 2BZCA 5EO1A 3APFA 4K7PH 4Q9RL 3EH3B 2NSQA 4DOHE 1NGQH 1SXZA 3D52A 5C6TL 4PVBA 5I1AB 3PAZA 4M7ZC 4NKOB 4H25A 3PJSA 4YMPA 3CCHB 2J12B 5DK2A 5T33H 1AP2A 5GGUB 1G7LA 2O5NA 1V7ML 4GKZB 4XXWA 3RUGA 4JRXB 1AQDA 3BOVA 3WMQA 2YA0A 3D12B 1X5MA 4ZW8A 3SZ6A 1CFVL 1CF8H 4DN3H 3P0GB 3QDJA 3HR6A 1IE4A 4JX0A 3K91A 2AJXH 1VERA 3ZDXB 4D0DB 1PLBA 1VHPA 4OCLC 3LPPA 5IBLC 4UDTA 3CFKA 2HUHA 2WIIA 2BHUA 5TDOB 1BG9A 1BBDL 1YY9D 2ORBL 5JYLA 4OCXL 3V52L 3CZJA 3NJNA 3RHWF 1U3JA 2OBGA 3HRZA 5CSZB 4DCQB 2BLFA 5DZLA 4HJUA 1J8HE 3PJSB 4G8FB 4NKOA 4APQC 1ZA6A 5JZ7D 3P4LA 3OJDA 4LRIA 5AVXB 3SE6A 3ZOAA 1FZKA 4LXFA 4K9JA 1A25A 5EFIA 5HVWA 4M6ML 3TOPA 1E8ZA 1ODAA 4ATWA 2FH6A 2HT4D 3GMQA 3HI5H 1R3IL 1I9RH 4UTCA 3V6OA 4H20L 4B3VA 3VXRD 1U3YA 1SYVA 3O9WD 3GMOB 3ARZA 2CCVA 5HGAB 4JANB 1FZOA 3QQNA 3ARFA 4ZUVB 3VRJA 1UXSB 1A7OH 3NDZE 5DZAA 1E9PB 1HHHB 2PPAA 2VSKB 4AV4A 1MWAH 3IDJB 5J06A 2C9AA 5MENA 4CGTA 1JYWA 4P3CH 2GIXA 2UY7A 5FM4A 3ZYZA 3V5HA 5E7BA 1AIFB 1CDGA 3IMSA 2NY4C 1V55B 4DK6A 4PJ5A 4OZFB 1F1DA 1O75A 3BH9B 3C60A 1P7BA 3KPNA 3O6FC 3QZOA 3B7UX 4WJ5A 2F53B 5IHUL 1MWAL 3QAQA 4APXB 35C8L 4E9RA 1KTLB 1T6BX 2VM4A 1YAIA 1NCIA 2G5RA 1ET8A 5DO2D 5KSAB 3QYNA 1OPOA 4TNEA 2GJ6A 4WFGE 3MRJB 3M1BA 3KZ8A 1HVXA 4WHYG 1Z5YD 1JV5A 3PV7A 3BZEB 2D0FA 2IDTA 4MJ4A 4D0BA 4JO2H 3D25A 4JY5H 2PTVA 1YC7A 2LU5A 1EZVX 1RZJH 3C9NA 2VDML 3BKJH 4ZUTA 3TA3A 3CLFL 3ZDYB 1M05B 4YDNA 4N24A 1QP1A 5E8OA 4ZYKB 2VXQH 4YDLC 4W9JC 4NRXA 3U82B 2QADB 4U1KB 2X0UA 3LQMA 4MMZB 1NFDB 1RIHH 2X7LA 3UAJD 3DHMA 4YGVA 1LO3L 3OPZL 4EXKA 3SE9H 3K5RA 3V4UH 2VO5A 3O6LL 4PJAE 5SWQA 1LNUA 2VLJE 2GK0A 2FT7A 5DJCA 2OQJA 1DUZA 4ETQA 4KMLB 2XACC 4WW2B 2NNFA 2Y7QA 1ZLDA 3W39A 3DTDA 2VCOA 4PS8A 3TEXA 4K7PX 2LABA 4GKSA 1Q0YH 1R3KB 4FXKA 4Q2ZB 1I82A 2DQCH 3F7PC 4OAWA 4XCFH 1ZDSA 4WI3A 3B7YA 3DV4A 4JM4H 4PP1C 2WINA 3ZQXA 4HJIA 2LQRA 3GGWB 4Y2OB 1PKQA 3IN0A 5C0RL 1PZ5B 2V9RA 4KK5C 1DJSA 1T7YA 1EGJH 1TIUA 3EXJA 1NCNA 2Q1EA 1M42A 1RIUH 3ZDXE 3SJVB 3KYKL 1QI3A 1TR7A 3ZE1E 3MX0A 1BVKB 1H8LA 3GPEA 4JKPH 1G0DA 1TTGA 3MOAL 4TF4A 2OYKA 4CC4C 5IFHH 4JO1L 4DKAA 1KTKE 3AU1B 4CVUA 4WWKD 3STBA 1JPSH 5T5FA 5I1IL 3QUXC 5C0BB 4A7UA 4Z7NE 2GSIA 2CH8A 4R90H 2LU3A 1JFQH 3IDIA 4APQB 1RZFL 2CUHA 4XNMB 4LDLB 3MV9B 3B5HA 2ZKHL 3OJDB 3PGFL 1SJVA 1NOAA 5FYJH 1WH0A 3NK3A 1XEUA 1S78C 3GKZA 3GDCA 3MVSA 4OJFL 5DTFB 3VXRE 2NZ1A 2A83B 2APXA 1ASQA 3HHMA 5C07B 3TN0B 2W60B 3WN5C 2DQTH 4M43L 3C5ZB 4N8PA 3CBKB 4PG9A 2HLAA 4EIZC 1FL5B 1MIEH 4P5RA 2WBKA 5I5JA 5DJAA 5FR3A 3OWRA 3JWDL 3C8KA 4I18C 4U3XA 4BH7A 5GS0L 1IGIL 2Y69B 2ZQKA 3CXHJ 3QPXL 4JFDD 3B4NA 1N2RA 5TF0A 1JDDA 4V11A 1AR1D 3CE1A 4NO0A 4ZMTA 4DKEL 1HC1A 1MFBH 3VXME 5HHNA 1A1OB 4AKOA 3VI4A 3WOVA 3GXPA 3W0WE 2EIEA 3HAEH 3L1FA 2AQTA 4MWFA 4GKOA 2QL1A 4LCYB 2SEBA 2ZP9A 1DQQB 4E9VA 5FEBA 1FV1A 1ZE3H 1MW2A 4P2OB 1ORSB 1EBPA 5IB4B 5I8EA 4HJGB 5MP6H 2J6WA 4PG9B 2JELH 3FQRA 4GUPA 4NO5A 5TE4L 3P4MB 1ZA3B 1DJWA 4MQSB 5CINL 3G6AB 5EOQH 4JM2D 2WUCL 3V95A 5FYLD 2XN9B 3RJDA 5IFJB 1EAOA 4M1CC 4M9OA 4BCXA 5I0VA 5CEZD 2YD5A 3ILQC 5KVGE 3C08H 1G1YA 3HKZA 4QAWA 1R5WA 1KTRL 5IQNA 3JUZA 1JHKH 4JQIL 3QDMD 4XN7A 4FNLH 4B3EA 4A7GF 3KPOA 4E42A 4DTGL 4OD3L 4JFOA 1RVFH 2DYSB 3N85H 4LSVH 4WHDA 4YR6A 5LDUA 2WKGA 2D31A 2F5BH 3S35L 1QZNA 4K3JH 1T2QH 3BLPX 3PDGA 4DVBA 4LMQE 1NPNA 2GAZB 2X4NB 4QTIH 4W4NA 4NRYB 2OA9A 4EZJA 5DLML 2N7BA 2E6JA 4KI5C 1NBYA 1RURL 3VH8B 4BQ6A 1A02N 4QDGA 1M7DA 2CJUH 5CBEB 5MHSD 3TTSA 5L88H 2YS4A 5DHEA 3DX7B 3GSRA 4JO1H 4FLHA 5MEPB 4HJ0D 2WVTA 4UIKH 4HXBL 2VT0A 4OAWB 2VXSH 4NT6B 3VW3L 4F5CA 2K6WA 3T3PB 3MRDA 4X9BA 1G94A 2UWEE 1N8ZB 4JMNA 1YYLH 4R4NC 2QBWA 4RX4D 1JWSB 2HJLA 3KPRA 2C9UA 4JN1L 1T80A 4WJ5B 1SOXA 3L9EA 4M9PA 1AS6A 3FN3A 4KFZC 5CCKL 5IOKA 3T3MB 1IBHA 1OSEA 2BSCA 3TEZA 4UAOC 4LSQL 3KHOA 2FYYA 5LUMA 2WBJA 5IEHA 2R0KH 3QUXB 1YQVH 4ENEC 4XPTH 5KJ4A 2FAUA 4G59C 3M86A 4HXBH 4E5XA 3SY0B 3C6SA 1UB6B 4JBSA 2K6ZA 2JCWA 1G7IB 4ZUUA 3DNKA 1TZOA 4P4KC 5JHAA 1RH8A 4QXUH 4AH2A 4PJ9C 2B59B 3DX8A 3MBEA 4YFLI 1I3RB 5E95B 3V6ZA 3LRLA 4X4ME 4MNHB 1F4WL 4YE4H 2JJSC 3IM1A 1RUKH 4PJFF 4S2SA 2V8LA 4NQEB 5HI3C 5SWQB 4HQQH 4A6YL 4AMXA 4LSUH 2FQDA 4ZFOL 4OLZH 4UM8B 3SJVE 5FV2A 4ZTOL 3I9AA 2XYCA 5HGBB 5AYUL 1J9CT 1K4CB 1YEFL 3BH8B 1W6LA 4IMKA 1ZHNB 3EJYC 5DEZA 5MI0C 4DZ8B 4KV5E 1HH6A 1RHHB 2A73A 3PE9A 5I18H 3OKEA 4XP1L 4OQTA 2VKXA 5EZLB 3H3BC 2ZP8A 3UZQB 1BMZA 1FFPA 1T0OA 3VFPB 4D94A 3ROLB 2OMWA 1DR9A 1HTYA 4KO9A 2VAAA 4FI8A 1QFWI 2XTJB 4AOFA 5F3BB 5CP3A 1VPOL 4IKNA 1XIWB 4GG8A 4G6JL 4I85A 4O4YH 4OSUH 4X9FA 2A0LC 1N5AA 2ZJSH 1K3IA 4UMSA 1P7KB 1TCMA 3WEOA 3ESOA 4IMLB 1TQSA 4C57C 3CMGA 5FA4B 5C0ND 2IH1A 5DC0A 2FGZA 5AWNL 1C5DA 3V0WH 3RFZB 3VXTB 1UWEH 3MROA 3ECQA 3WO4B 4GINA 2W9EL 2C3VB 1MHHB 4NN6B 4JPQA 3S6CA 4R5XA 2KZ1B 1A7OL 4ANVA 2BSEA 5IROD 2FX7L 1N64L 3HRZB 5CSZA 5I71C 5C6PB 1MNUH 4GW4A 1RLWA 1ZT7B 3PHOA 1ZKAA 4J23A 4TUJA 3BUPA 5DS2A 2DQIL 3ARFC 4G8IA 4OZGE 3TO4B 3IDMB 3K1KC 2DWDA 5T1KB 4Q4EA 1QRNE 2XXMB 5I76A 4ZZKA 4Z8FL 2C1PA 3GZOA 3SY6A 4FJZA 1TEYA 1XTLA 3TIDB 2VDQL 2YAEA 3K71A 3V0VA 4IMLA 5MHSE 3N1QC 2UXGA 1UWXH 3CVIH 2AF2A 1AD9A 4RWYH 4XMPL 5G4NA 1IIIA 2HX9A 4NJ9L 5C0CE 1SYVB 2DDQH 5F0JB 5ADOH 4U1SB 4H40A 3NABH 4U1NA 4O2CA 2AJYH 3PGFH 4AMKH 1G7MB 1U91B 5HHNB 3MGOA 2WVVB 3L4VA 4IOFD 3D39D 3L2NA 4CILA 4J27A 3OKMB 5F8QC 4M7JH 1Q4NX 3HI6H 3MOBH 3L13A 3QWQB 5T3ZD 3CVIL 4GW5B 4KKNA 4P5TA 3ARSA 4NUJB 1JXFA 3MFFA 4OF3A 3LEYH 3ZUNC 4Z5RA 2GHZA 4L4VE 3WI9A 1AQKL 2X4RB 3KH4A 4JZJA 3VTTA 4GSDH 5DT1H 2NPLX 1UGNA 2L7UA 1UD3A 3DOHA 4NJ9H 5HJBA 3RU8L 3DRTB 4N4YB 4C56E 3WSQL 2IGFL 4BFJA 3BWUC 3MNWB 1M7UA 3CVHB 1EEYA 1JZHA 4B53A 5MEOB 2O6FA 4ZAKC 1UJ3A 4DP7X 4QRRE 2W9DL 4HH8A 1UB6A 3IFNH 1A2YA 3QHTC 2ZCLH 4ZNCD 3NJMA 1U2HA 2ZIDA 2J8UF 4MAUH 4IJ3B 4PTTB 2EXYD 4YSTA 4HIJB 4J3OG 3ARBA 5DRWA 3QEQA 3LZRA 4LHUA 4HDIA 3QRBA 4FOMA 5GRUL 3I6GA 4HFUH 3VXSE 1JWSA 2C7FA 2YQGA 3EOAB 1JN6A 1K4DA 2EDFA 2OMVA 1JI1A 1KN4L 4N87A 4O51A 5GGVY 1OPGH 2Y72A 4IW4C 5KS9B 3RG1C 4UOQA 3UTQA 3LX9A 3NIGE 4K5LA 2EDRA 2OULB 4KBPA 5AZ2L 4YL4A 2CWRA 3RWIA 4XNQA 3ALPA 1BJ1J 2PO6C 2R2HA 2WLJA 4M5ZH 4PWGA 1L3NA 2CDGB 1CXKA 1ETZB 1JXDA 2DQFB 3IPEA 4U0QB 1G4RA 2R4SH 3Q44A 4KPHL 4DQOH 3GM0A 4JRWA 1OD9A 3PWUA 1UZ6E 2X4SA 4HBCH 2B0SL 3N1FC 5BZDA 2DM7A 1I4FB 4R4ND 1QRKA 5GRJH 5GZND 3S34L 1LYQA 4NIYE 2FO4A 2IDSA 3QRGH 3UMTA 1G1CA 1LP9B 3VDAA 2A4EA 4M8QA 4U6XB 4LB8A 3ARED 1HHIB 2WP3O 3WJMA 1N18A 4MDRA 2VISA 5D1ZA 3SKNB 1G0XA 2VE6A 5D2LF 3S3PA 2Q7YA 4LSSL 1NCHA 2X87A 5JHMA 1ZV2A 2AEOA 3IFPA 2GCYB 5E2TL 3S37X 1D9KA 5AAMC 4LEXH 1KJVB 2EUXA 1B88A 2ICWI 4PPTA 1T4KB 3DXAB 1GVIA 3LXCA 5F1NB 3S37L 1N0XH 4NZRH 4Z7OB 5L2JA 3V5DB 5F3HB 3TEYA 2DIJA 1RUPH 3B37A 3MJWA 4JPVL 4CSPA 3RU8H 1D5BB 2UZIH 4JHWL 5EUOB 3LDBB 2PWGA 1AZVA 5FUOL 2WLIA 4XNDA 1G7HB 2DI9A 1GOFA 4RZKA 2QEJA 5E7FA 1N2RB 1ZT4B 3ZX1A 3QIBC 2VM3A 4OCRH 3ILQD 4OM1H 3X11A 5A2JH 4PLJC 2WQAA 3ILEA 2IADA 5D6CA 5KVEH 4XWOD 1JBJA 4UI2A 4G1MB 1BZOA 2OTUA 3D0LA 3MLUH 3E1ZA 4NX0A 1HI6A 2BFVL 1GY2A 1M6OB 1W0WA 1BF5A 5F2FA 5F1NA 1DVQA 2NSMA 4P5MB 4L1BA 2VXQL 4GUPB 2G3XA 4GI6A 1DDHB 2B39A 5D1QC 4LP8A 1CN4A 2CPUA 5H8DA 1IBDA 5SWSD 2RAMA 4HETA 2XZCL 2YUVA 2YGOA 1KPRA 5DLMH 1WEJL 3RHWK 2SODB 4MQXC 4PCKA 3DGCR 3HB3C 5T1MA 4X4XB 1E65A 3UPRA 4B6ZA 4RGNB 4DCQA 1DQVA 4PB9H 5FF6B 5J12B 2I5YH 4XMXA 2VR6A 3NIFF 2O61B 3TBYA 5AYTA 1H3UA 3VFMA 2AK4B 3FS9A 5GRXG 1CGTA 2CGRL 1XO8A 4I0PC 2FWOB 1XF1A 4U6YB 4QI3A 3QJSB 3F62A 4TQ8A 4NN7B 2ZKMX 4DW2H 4ELMB 1H8OA 1KTJA 3RIKA 2DLGA 1GS8A 2NQCA 3LYRA 2FJHA 3KLKA 5EPMB 4UWQB 1AO7A 2Z8SA 3IWUA 2YD3A 4Z7OF 1J5DA 1WZLA 3P73B 4R26L 2NW3A 5AVZB 1PU0A 3VSQA 1MFEH 3FKUS 3IJ8A 2E7MA 4GMTL 5JXAH 3FO2A 3DX7A 3X1FA 1UOLA 3KJ6H 5A3IC 2AVFA 4YE0A 1UWGH 3U7YL 3UFIA 3WEAA 3E80A 1BLNA 4QJ3B 2WXJA 1IC0A 1LEIA 1LO4L 4JG1L 5GISH 2WXRA 3CFNA 4PLKC 2NX5A 5BJTA 3BH9A 2D7NA 4JY5L 2J88H 1HCFX 2EDQA 3KLLA 5M95B 3RX9A 3F05A 5EEVA 3RWFB 5K59F 1T1XA 5E94B 3D9AL 3NCJH 2D7TH 1EEYB 1HWHB 1A7QH 3B3IA 4KJWD 3V4VA 1WCBB 4DP4X 2UXTA 1SY6H 1JK9A 4YHPB 2MPAL 4OTXH 4HSCX 4NQUA 1O7VA 1L6XA 4DFHA 3AY4A 1XV8A 3KYOB 4XO4A 4PGCA 3MNDA 1UGKA 2ED8A 3P0VH 2COQA 3GSWA 3LN4B 2ESVA 3BJ91 2JF1A 5LBSH 1JN6B 2I7SA 2YA1A 3KGTA 2VSDA 4OF0A 4U4IA 3RVTC 1TQVA 3UC0H 5GXBB 2AKRA 3EH1A 3LSOA 4F7EA 4XVUC 2DQGL 1S7QA 1NFDA 3QZNA 4MZ2A 1K4DB 2FQFA 1YVLA 4N1HB 3U7AA 1KTDB 1WIPA 4IIQB 3L3KB 1RKRA 1PZ2A 4UQCA 1QLFB 2EDDA 3TBSA 5EZJA 3GBEA 4PCTA 3QQ9D 1NGZA 2WXGA 5FA3B 4TULH 4L29B 5DZ9A 3MJGX 3L7EA 3DO3A 4L8BB 2AEPH 5BO1L 1JGVL 1YEIH 5EV7A 3ZRFC 1AXSB 3N43F 2IQ9L 1BF8A 2A6JA 3MV7A 3HE7C 1CD8A 2CUMA 2WYZA 4XMWA 3O4OB 2YD8A 1K6QH 1FFNB 2HLFC 1YNLL 5CD5D 3V8OA 1A4KB 3IDUA 3CQPA 4JO5A 2MMXA 2AEWA 5I8CA 5HDBB 3V79C 4MNQD 4H8VA 5CUSH 3MLTA 6TAAA 1IKFH 1I8KA 3DOSA 1TJIH 4XC3H 4BFOA 3AU0A 2D2CC 1VB9A 3FTUA 1E50A 1MI5D 1QX1A 1CIUA 4XBGA 2XWJA 1NUFA 3MJ6A 4YHOH 4YXKH 3FONA 2NY6D 2WTOA 1EO8L 3B2XA 1JZ8A 4MQXD 1U8HB 4DK3A 4MAYD 4H1LB 1XGPA 3PPEA 2KLTA 3ENEA 3GSXA 1PTZA 4OR1A 2VIRB 4HIXH 4RMSA 4G1MA 4WUUB 3EOTH 2KT6A 2L3BA 1JHTB 4X6EA 1AE6H 3D4CA 3K4AA 4ADIA 1L0PA 3PS6A 5D2NE 3UERA 5CEXB 3T04D 1T4KA 4DGYH 5LWYL 1GSMA 3V0VB 4HISA 3NIGB 2AV7A 5I8OL 4Y19B 5CU5A 1HCVA 4P23D 1S7SA 3RDTA 3P11L 3WKYA 2P28B 3H9SE 3D3VE 2QKIB 3DLQR 4S0TD 4P4RA 5MP6L 2ZF8A 1E2WA 3G5ZA 1E90A 1MHHA 2MCPL 5E5RB 3UTZA 2EAEA 3VG0L 1D5ZB 3ARDB 5EBLB 1WT5A 3QDGA 4X9HA 5C0NC 3ULVL 2BY2A 1YN7A 1FGNL 1U93A 1UWYA 2D3VA 4DH2A 5IBLD 2ZUXA 3FULA 4B9YA 5CLXA 3BGMA 3MRHB 2UVFA 4WEMB 4N6RA 3KYMB 3MV8B 5FKPB 3GMRB 3WEMA 4KK8C 3VD4A 1FVEA 3KHQA 1T1ZB 4I5BB 2BSED 1NAMH 5EZPA 3EYOB 4AVIA 2V2TA 4BBWA 3L3OB 5IF0B 3IDXH 4PWJA 5D7LA 4P2OC 2RB8A 2H0PA 3GTTA 1FN4B 3BP6A 3VXMD 2BOCB 4M7JL 2K3TA 4HUXA 4NHUB 3V7MA 1U95B 1BVLB 2BVQB 2W95A 2Z31C 1G6RL 4A1RA 4Y5YB 4F15B 3CX5J 5IQMA 4MA7H 4CMHB 5CJ8A 4UT7L 3X2QB 5HGGS 3LNEA 4F27A 3N2JA 2A4CA 1BEXA 1C16A 4XHQA 1LEIB 2RJMA 2BNRB 2LV4A 2PCYA 4F7EB 4GAGH 1P69B 1RUAL 1YECL 2P9RA 5AVUB