2J55H

X-ray reduced paraccocus denitrificans methylamine dehydrogenase o- quinone in complex with amicyanin.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
382
structure length
382
Chain Sequence
EAETQAQETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMICYANIN
publication title Tracking X-Ray-Derived Redox Changes in Crystals of a Methylamine Dehydrogenase/Amicyanin Complex Using Single-Crystal Uv/Vis Microspectrophotometry.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 96
structure length 382
sequence length 382
chains with identical sequence J
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2j55H00
3UVMA 4IMMA 3UR4A 2H14A 4J8BA 3NVNA 2TRCB 2CN3A 3AFCA 4AOWA 3B7FA 1N6EA 3J81g 2Z2PA 3DSMA 2H3XA 3RLMD 4BH6A 3EG6A 2PM6B 5C2VB 3ZWLB 2P9KC 4GGDA 3AL9A 4CI3A 5TEFA 2P9SC 3I89A 5EMKB 3I7PA 5FKTA 2PM9A 5IJ7E 4KFMB 5HE2B 4FA9D 5AMSA 4HDJA 4A0AA 2IWFA 4GM3A 2P9PC 2HESX 2YNNA 3UVOA 4A2LA 3L4OD 5GXIA 2PM9B 5SXMA 4D6VA 5CYKA 1FWXA 5FQDA 4U7AA 4X61B 3NVXA 3SJLD 2G9AA 2G99A 3SMRA 4CY5A 3IJ1A 4A0AB 1K8KC 3DWLC 4GGCA 3ULEC 3F3FA 3PXSD 4FA1D 2Z2OA 1NEXB 3BWSA 5EAPA 5CYKB 1L0QA 2I3SA 3C5MA 3RFHA 1VYHC 4AEZA 4A7JA 2H13A 4E54A 2CO0C 4JSNC 1SQ9A 2HJBA 5EAMA 2UZXB 4X63B 3IJ0A 4ES0A 3SWSD 3W15A 3F3GA 4QQEA 4LGNA 5THAA 5IGQA 3UVKA 2GC4A 4CC9A 1MG3A 3VGZA 2EBSA 2IWKA 4O45A 4E54B 4O9DA 4BL0A 4J87A 5K19A 2HJ4A 2AH0A 4A08A 3MKQA 3JROA 3GREA 1S4UX 4QRJA 1JMZB 4L9OA 4OWRA 2GC7A 2IUVA 2H9MA 4UI9R 5KDOB 4GQ2P 3GFCA 5FKSA 4GQBB 2H6NA 4ZOXA 2QC5A 4GM8A 2H9LA 4JSVC 4J73A 3N0DA 4JT5C 5I5MA 4FB1D 4JSPC 3SBPA 3RN0D 4J84A 3EI4A 3IIWA 4GMBA 3C75H 4CY3A 4A08B 2OJYA 5HYNB 1N6FA 2H68A 2CNXA 2HXCA 2P9NC 3JZNA 1XKSA 3JRPA 4LG8A 4J78A 1Q47A 3P4FA 4MK0B 1PBYB 4L3GD 2IAAA 5GSAA 3CIKB 1K32A 4YVDA 2IUQA 4TZ4A 3PVUB 1GXRA 4X60B 4CI8A 4J82A 2OVRB 4PC0A 3K27A 1B9XA 1GOTB 3JZHA 4H5JA 1PEVA 3SN6B 2OVPB 2PBIB 3I2NA 4OZUA 1OLZA 3IJCA 2XL3A 4ERYA 4CZVA 4L1QD 4GZ8A 5H17A 2OK4A 2O9KA 4ZOVA 3RN1D 1XIPA 4G56B 5H1MA 4FAND 1GG2B 3IIYA 4Y7RA 3K26A 4ZOZA 4A0BA 3EMHA 4K3JB 2CO0A 3JB9L 4FHLA 4LG9A 4J79A 3NVQA 1PI6A 5EARA 1U4CA 4JSXC 4ESGA 4O1QD 4PBZA 3JZGA 4ZN4A 2B5MA 3V7DB 4A0BB 3I7OA 1A0RB 5CXCA 2H47A 2I0TA 2I0SA 4CY2A 4R7AB 5A2Qg 2CN2A 5B4WA 2IUPA 4QT8A 5IC7A 2HKMA 3EU7A 1U2VC 4PBYA 4XYHA 3RSEC 2H9NA 2AGZA 5IJ8E 3RFGA 2OVQB 4J81A 5C9ZB 5CXCB 5TF2A 2H9PA 2XL2A 2J56H 4H5IA 1NR0A 3RRMC 2AH1A 1N6DA 2YNOA 2YBAA 3L4MD 3EI2A 3CFSB 2AGLA 4Z8LA 3EWEA 4EWRA 3MMYA 3DXMC 3OKWA 4PNKB 2YMUA 2CE8A 3I7NA 4I79A 3IKOA 5C2WB 3SHFA 3UKUC 3RMZD 1YFQA 5I5IA 2YNPA 4PSWB 5EMJB 3PVWB 5EMLB 2AQ5A 5AFU3 3OL2A 4GGAA 3EI2B 3SVWD 2W18A 2XYIA 3EI4B 4FA4D 3PE7A 3N0EA 2J55H 3UVLA 1JOFA 4J0WA 4Y5RD 3I8EA 5IGOA 3MZKA 2CE9A 2OK6A 2OIZA 2QXVA 3DXKC 4PSXB 2XU7A 4QL1A 4E5ZA 3OL2B 3C9CA 2P9LC 1PGUA 2B5NA 5FKQA 2BCJB 4ERQA 5IT9g 1B9YA 1TYQC 2GNQA 5FKRA 3JAMg 3AH8B 4D0KA 1R5MA 4CI2A 4CZXA 3F3PA 2AGWA 3MXXA 3SXTD 4CY1A 4E5ZB 2P9UC 1QNIA 3V9FA 3BG1A 3OKYA 3SBQA 4A2MA 5GMKn 4CZYA 5CXBA 5I5JA 3AL8A 4PXWA 5HQGA 5TDHB 2P9IC 1RI6A 3SBRA 5FLXg 1P22A 4FAVD 3VA6A 4XEIC 4FA5D 1JMXB 2PM7B 4L3HD 4XYIA 3HFQA 3OKYB 3C99A 3DM0A 2HKRA 5CXBB 1GP2B 3AL8B 3FGBA 3A0FA 5H14A 3VH0A 5AJAA 3I7KA 4GM9A 2B5LA 2J57G 1MDAH 4X3EA 3SLED 2I3TA 5JWZA 4A09A 3FRXA 1SHYB 3PXWD 3UVNA 3FM0A 3I7LA 3PXTD 2Z2NA 1TBGA 3J80g 3OKTA 5GXHA 3I8CA 4U1EI 4K3ID 3UKRC 1JJUB 2IURA 5HE0B 4BUJC 4A09B 5EALA 4IA9A 1SQJA 3CFVA 4N14A 5FXYA 1ERJA 3PSCB 4JD2C 2I0RA 4A11A 5EMMB 4JXMA 4ZOYA 4JT6C 4GQ1A 4ERZA 2MTAH 3BG0A 4J77A 3OW8A 3EI3A 3EI1A 4O3TB 3MZLA 2Q7QA 1XHMA 3MKSB 1MG2A 3E0CA 5K1CC 3I7HA 5EM2A 2AGYA 1OMWB 3OTTA 4NSXA 3KRWB 3PSLA 5HE1B 2UZYB 2H6QA 3V5WB 5TEEA 4J8GA 4A11B 2AGXA 4J86A 5FA5B 3JPXA 3EI3B 3EI1B 2B4EA 4CI1A 3ODTA 5EM2B 2BBKH 3ORVD 5HE3B 2H6KA 3KRXB 2YB8B 3U4YA 4J0XA 3SCYA 2HYEA 4O3UB 3SFZA 4FWWA
chains in the Genus database with same CATH superfamily
3UVMA 4IMMA 3UR4A 2H14A 4J8BA 3NVNA 3IURA 2TRCB 2CN3A 3AFCA 5E6RA 3B7FA 4AOWA 1N6EA 3J81g 2Z2PA 3DSMA 2H3XA 3RLMD 4BH6A 3EG6A 2PM6B 4BCDA 5C2VB 3ZWLB 3T3MA 2WQ8A 1O6GA 2P9KC 2EIBA 4GGDA 3AL9A 4CI3A 5TEFA 2P9SC 3I89A 1VZ2A 5EMKB 3I7PA 5FKTA 2PM9A 5IJ7E 3IUNA 4KFMB 3O4IA 5HE2B 4FA9D 4G1EA 5AMSA 4HDJA 4A0AA 2IWFA 2HU7A 4GM3A 2P9PC 2VDRA 2HESX 2YNNA 3UVOA 4A2LA 3L4OD 1UTCA 5GXIA 2PM9B 5SXMA 4Z7OA 4D6VA 5CYKA 1FWXA 4NENA 5FQDA 4DNUA 4U7AA 1H2WA 4X61B 3NVXA 3SJLD 2G9AA 3VI4A 2G99A 5FFOA 3SMRA 4CY5A 5M5RA 3IJ1A 4A0AB 1K8KC 3DWLC 4L1MA 4GGCA 3ULEC 3F3FA 3PXSD 5M5UA 4FA1D 2Z2OA 3MVDK 1NEXB 3BWSA 5EAPA 1UOPA 5CYKB 1L0QA 2I3SA 3C5MA 1I2MB 1GOFA 2EICA 3RFHA 1VYHC 4AEZA 4A7JA 2H13A 4E54A 3MUNA 1BPOA 2CO0C 2XZGA 1VE6A 4JSNC 4NAAA 4WK2A 1SQ9A 1QFSA 2HJBA 2UZXB 5EAMA 4X63B 3IJ0A 4WK4A 1L5GA 4ES0A 4AN0A 3SWSD 3W15A 3F3GA 4QQEA 4LGNA 5THAA 5IGQA 2VZ3A 1QFMA 3UVKA 2GC4A 4CC9A 1MG3A 3VGZA 4MMXA 2EBSA 2IWKA 4O45A 4E54B 4O9DA 4BL0A 4J87A 5K19A 2HJ4A 2AH0A 3GC3B 3FCUA 4A08A 3MKQA 3JROA 3GREA 1S4UX 4WJKA 4QRJA 1JMZB 4L9OA 4OWRA 2GC7A 3K72A 2IUVA 2H9MA 4UI9R 5KDOB 4GQ2P 3GFCA 5FKSA 4GQBB 2H6NA 4ZOXA 2HU5A 2QC5A 4GM8A 2H9LA 4JSVC 4J73A 3N0DA 4JT5C 5I5MA 5FFGA 4JSPC 3SBPA 4FB1D 3RN0D 4J84A 3EI4A 3IIWA 4GMBA 3C75H 4CY3A 5C86A 4A08B 4AN1A 2OJYA 5HYNB 3ZDYA 3ZE2A 2VDKA 5M5VA 1N6FA 2H68A 2CNXA 2HXCA 2P9NC 3JZNA 1K3IA 1XKSA 3JRPA 4LG8A 3T3PA 4J78A 1Q47A 3P4FA 4MK0B 1PBYB 5HDBA 4L3GD 4Z7QA 1T2XA 2IAAA 3CIKB 5GSAA 1K32A 4IRZA 4YVDA 1UOOA 2IUQA 4TZ4A 3PVUB 1GXRA 4X60B 1E5TA 4CI8A 4J82A 2OVRB 1A12A 5E6SA 4PC0A 3ZDXA 3K27A 1B9XA 1GOTB 3JZHA 4H5JA 1VE7A 1PEVA 2VDPA 3SN6B 2OVPB 4AMYA 2PBIB 3ZDZA 3I2NA 3MUOA 4OZUA 1OLZA 1M1XA 2XL3A 3IJCA 4ERYA 4CZVA 4L1QD 4GZ8A 5H17A 2OK4A 4O2WA 2O9KA 1JTDB 4ZOVA 3RN1D 1XIPA 4G56B 4DNWA 4RE6A 4RE5A 3KCIA 4UM9A 5H1MA 4FAND 1GG2B 3IIYA 4Y7RA 3K26A 4ZOZA 4A0BA 3EMHA 4K3JB 1U8CA 2CO0A 2QR5A 3JB9L 4FHLA 4LG9A 4J79A 3O4JA 3NVQA 1PI6A 5EARA 1U4CA 2VDOA 4JSXC 4ESGA 4O1QD 4PBZA 3JZGA 4ZN4A 2B5MA 4BCBA 3V7DB 4A0BB 3I7OA 1A0RB 5CXCA 2H47A 2I0TA 4MMZA 2I0SA 4CY2A 4R7AB 3IVMA 2EIEA 3OF7A 5A2Qg 2CN2A 5B4WA 3GD1I 2IUPA 4QT8A 3NIDA 2HKMA 3EU7A 5IC7A 1U2VC 4PBYA 4XYHA 4D9SA 2HU8A 4NBMA 3RSEC 2H9NA 2AGZA 5IJ8E 3FCSA 3RFGA 2OVQB 4J81A 3O4HA 5C9ZB 5CXCB 5TF2A 3ZE0A 2H9PA 2XL2A 3DDUA 2J56H 5M5SA 1E8MA 4H5IA 3QI0A 1NR0A 3RRMC 2AH1A 4MMYA 1N6DA 2YNOA 2YBAA 5M61A 3L4MD 3EI2A 3CFSB 2AGLA 4Z8LA 3EWEA 4EWRA 3MMYA 3DXMC 3OKWA 4JHNA 1C9IA 4PNKB 3EQ9A 4BCCA 2YMUA 2CE8A 3I7NA 4I79A 3IKOA 5C2WB 4UM8A 3SHFA 3UKUC 3RMZD 1YFQA 5E6UA 5I5IA 2YNPA 4PSWB 5EMJB 4AX4A 3PVWB 5EMLB 2AQ5A 5AFU3 3OL2A 4GGAA 3EI2B 3SVWD 2W18A 2XYIA 3EI4B 4DNVA 1YR2A 4FA4D 3PE7A 3N0EA 2J55H 3UVLA 1JOFA 4J0WA 4Y5RD 1GOHA 3I8EA 5IGOA 3MZKA 2CE9A 2OK6A 2OIZA 2QXVA 3DXKC 3NIGA 4PSXB 2XU7A 4QL1A 4E5ZA 3OL2B 3C9CA 2P9LC 1PGUA 2B5NA 5FKQA 2JKXA 2BCJB 2XE4A 4ERQA 4BP9A 5IT9g 1B9YA 1TYQC 2GNQA 5FKRA 3JAMg 3NIFA 3AH8B 4D0KA 1R5MA 4CI2A 4CZXA 3V4PA 3F3PA 2AGWA 3MXXA 3SXTD 4NC4A 4CY1A 2VDQA 3IULA 4E5ZB 2P9UC 1QNIA 3V9FA 3BG1A 3OKYA 4G55A 3SBQA 2VDNA 4A2MA 3IJEA 5GMKn 4CZYA 2VDLA 5CXBA 5I5JA 3AL8A 4PXWA 5HQGA 5TDHB 2P9IC 1RI6A 3SBRA 5FLXg 1P22A 4FAVD 3K71A 3VA6A 3O4GA 4XEIC 4FA5D 1JMXB 5C92A 2PM7B 4L3HD 4WK0A 4XYIA 3HFQA 3OKYB 2XDWA 3C99A 3DM0A 2HKRA 5CXBB 1GP2B 4QAMA 5M5TA 3AL8B 3FGBA 3A0FA 5H14A 3VH0A 3IUJA 5AJAA 3I7KA 4GM9A 2B5LA 2J57G 1MDAH 4X3EA 3SLED 2I3TA 5JWZA 4A09A 2QZPA 1H2ZA 3FRXA 1SHYB 3PXWD 4BP8A 3UVNA 3FM0A 3I7LA 3QHYB 3PXTD 2Z2NA 1TBGA 3EQ8A 3J80g 2VC2A 4G1MA 3OKTA 5GXHA 4AMZA 1H2XA 3I8CA 4U1EI 2VZ1A 4K3ID 3UKRC 1JJUB 2IURA 5HE0B 4BUJC 4A09B 5EALA 4IA9A 1SQJA 1GOGA 2EIDA 3CFVA 4N14A 1ERJA 3PSCB 5FXYA 3IUMA 4JD2C 2I0RA 4A11A 4Z7NA 5EMMB 4JXMA 4O02A 3VI3A 4ZOYA 4JT6C 4GQ1A 4ERZA 2MTAH 3BG0A 4J77A 3OW8A 3EI3A 3EI1A 4O3TB 3MZLA 2Q7QA 1XHMA 3MKSB 1MG2A 3E0CA 5K1CC 1UOQA 3I7HA 5EM2A 2AGYA 1OMWB 3OTTA 3ZE1A 4NSXA 3KRWB 3PSLA 4JHPC 5HE1B 2UZYB 2H6QA 3V5WB 5TEEA 3K6SA 4J8GA 1C9LA 2BKLA 4A11B 2AGXA 4J86A 1TYEA 5FA5B 3JPXA 2VDMA 1O6FA 3EI3B 3EI1B 2B4EA 4CI1A 1JV2A 3ODTA 5EM2B 1H2YA 2BBKH 3ORVD 5HE3B 1E8NA 2H6KA 3EQ7A 1VZ3A 2YB8B 3KRXB 3U4YA 4J0XA 3SCYA 3IUQA 2HYEA 3V4VA 4O3UB 3SFZA 4FWWA
chains in the Genus database with same CATH topology
3UVMA 4IMMA 3UR4A 2H14A 4J8BA 3NVNA 2TRCB 2CN3A 3AFCA 4AOWA 3B7FA 1N6EA 3J81g 2Z2PA 3DSMA 2H3XA 3RLMD 4BH6A 3EG6A 2PM6B 5C2VB 3ZWLB 2P9KC 4GGDA 3AL9A 4CI3A 5TEFA 2P9SC 3I89A 5EMKB 3I7PA 5FKTA 2PM9A 5IJ7E 4KFMB 5HE2B 4FA9D 5AMSA 4HDJA 4A0AA 2IWFA 4GM3A 2P9PC 2HESX 2YNNA 3UVOA 4A2LA 3L4OD 5GXIA 2PM9B 5SXMA 4D6VA 5CYKA 1FWXA 5FQDA 4U7AA 4X61B 3NVXA 3SJLD 2G9AA 2G99A 3SMRA 4CY5A 3IJ1A 4A0AB 1K8KC 3DWLC 4GGCA 3ULEC 3F3FA 3PXSD 4FA1D 2Z2OA 1NEXB 3BWSA 5EAPA 5CYKB 1L0QA 2I3SA 3C5MA 3RFHA 1VYHC 4AEZA 4A7JA 2H13A 4E54A 2CO0C 4JSNC 1SQ9A 2HJBA 5EAMA 2UZXB 4X63B 3IJ0A 4ES0A 3SWSD 3W15A 3F3GA 4QQEA 4LGNA 5THAA 5IGQA 3UVKA 2GC4A 4CC9A 1MG3A 3VGZA 2EBSA 2IWKA 4O45A 4E54B 4O9DA 4BL0A 4J87A 5K19A 2HJ4A 2AH0A 4A08A 3MKQA 3JROA 3GREA 1S4UX 4QRJA 1JMZB 4L9OA 4OWRA 2GC7A 2IUVA 2H9MA 4UI9R 5KDOB 4GQ2P 3GFCA 5FKSA 4GQBB 2H6NA 4ZOXA 2QC5A 4GM8A 2H9LA 4JSVC 4J73A 3N0DA 4JT5C 5I5MA 4FB1D 4JSPC 3SBPA 3RN0D 4J84A 3EI4A 3IIWA 4GMBA 3C75H 4CY3A 4A08B 2OJYA 5HYNB 1N6FA 2H68A 2CNXA 2HXCA 2P9NC 3JZNA 1XKSA 3JRPA 4LG8A 4J78A 1Q47A 3P4FA 4MK0B 1PBYB 4L3GD 2IAAA 5GSAA 3CIKB 1K32A 4YVDA 2IUQA 4TZ4A 3PVUB 1GXRA 4X60B 4CI8A 4J82A 2OVRB 4PC0A 3K27A 1B9XA 1GOTB 3JZHA 4H5JA 1PEVA 3SN6B 2OVPB 2PBIB 3I2NA 4OZUA 1OLZA 3IJCA 2XL3A 4ERYA 4CZVA 4L1QD 4GZ8A 5H17A 2OK4A 2O9KA 4ZOVA 3RN1D 1XIPA 4G56B 5H1MA 4FAND 1GG2B 3IIYA 4Y7RA 3K26A 4ZOZA 4A0BA 3EMHA 4K3JB 2CO0A 3JB9L 4FHLA 4LG9A 4J79A 3NVQA 1PI6A 5EARA 1U4CA 4JSXC 4ESGA 4O1QD 4PBZA 3JZGA 4ZN4A 2B5MA 3V7DB 4A0BB 3I7OA 1A0RB 5CXCA 2H47A 2I0TA 2I0SA 4CY2A 4R7AB 5A2Qg 2CN2A 5B4WA 2IUPA 4QT8A 5IC7A 2HKMA 3EU7A 1U2VC 4PBYA 4XYHA 3RSEC 2H9NA 2AGZA 5IJ8E 3RFGA 2OVQB 4J81A 5C9ZB 5CXCB 5TF2A 2H9PA 2XL2A 2J56H 4H5IA 1NR0A 3RRMC 2AH1A 1N6DA 2YNOA 2YBAA 3L4MD 3EI2A 3CFSB 2AGLA 4Z8LA 3EWEA 4EWRA 3MMYA 3DXMC 3OKWA 4PNKB 2YMUA 2CE8A 3I7NA 4I79A 3IKOA 5C2WB 3SHFA 3UKUC 3RMZD 1YFQA 5I5IA 2YNPA 4PSWB 5EMJB 3PVWB 5EMLB 2AQ5A 5AFU3 3OL2A 4GGAA 3EI2B 3SVWD 2W18A 2XYIA 3EI4B 4FA4D 3PE7A 3N0EA 2J55H 3UVLA 1JOFA 4J0WA 4Y5RD 3I8EA 5IGOA 3MZKA 2CE9A 2OK6A 2OIZA 2QXVA 3DXKC 4PSXB 2XU7A 4QL1A 4E5ZA 3OL2B 3C9CA 2P9LC 1PGUA 2B5NA 5FKQA 2BCJB 4ERQA 5IT9g 1B9YA 1TYQC 2GNQA 5FKRA 3JAMg 3AH8B 4D0KA 1R5MA 4CI2A 4CZXA 3F3PA 2AGWA 3MXXA 3SXTD 4CY1A 4E5ZB 2P9UC 1QNIA 3V9FA 3BG1A 3OKYA 3SBQA 4A2MA 5GMKn 4CZYA 5CXBA 5I5JA 3AL8A 4PXWA 5HQGA 5TDHB 2P9IC 1RI6A 3SBRA 5FLXg 1P22A 4FAVD 3VA6A 4XEIC 4FA5D 1JMXB 2PM7B 4L3HD 4XYIA 3HFQA 3OKYB 3C99A 3DM0A 2HKRA 5CXBB 1GP2B 3AL8B 3FGBA 3A0FA 5H14A 3VH0A 5AJAA 3I7KA 4GM9A 2B5LA 2J57G 1MDAH 4X3EA 3SLED 2I3TA 5JWZA 4A09A 3FRXA 1SHYB 3PXWD 3UVNA 3FM0A 3I7LA 3PXTD 2Z2NA 1TBGA 3J80g 3OKTA 5GXHA 3I8CA 4U1EI 4K3ID 3UKRC 1JJUB 2IURA 5HE0B 4BUJC 4A09B 5EALA 4IA9A 1SQJA 3CFVA 4N14A 5FXYA 1ERJA 3PSCB 4JD2C 2I0RA 4A11A 5EMMB 4JXMA 4ZOYA 4JT6C 4GQ1A 4ERZA 2MTAH 3BG0A 4J77A 3OW8A 3EI3A 3EI1A 4O3TB 3MZLA 2Q7QA 1XHMA 3MKSB 1MG2A 3E0CA 5K1CC 3I7HA 5EM2A 2AGYA 1OMWB 3OTTA 4NSXA 3KRWB 3PSLA 5HE1B 2UZYB 2H6QA 3V5WB 5TEEA 4J8GA 4A11B 2AGXA 4J86A 5FA5B 3JPXA 3EI3B 3EI1B 2B4EA 4CI1A 3ODTA 5EM2B 2BBKH 3ORVD 5HE3B 2H6KA 3KRXB 2YB8B 3U4YA 4J0XA 3SCYA 2HYEA 4O3UB 3SFZA 4FWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UVM A;  4IMM A;  3UR4 A;  2H14 A;  4J8B A;  3NVN A;  2TRC B;  2CN3 A;  3AFC A;  4AOW A;  3B7F A;  1N6E A;  3J81 g;  2Z2P A;  3DSM A;  2H3X A;  3RLM D;  4BH6 A;  3EG6 A;  2PM6 B;  5C2V B;  3ZWL B;  2P9K C;  4GGD A;  3AL9 A;  4CI3 A;  5TEF A;  2P9S C;  3I89 A;  5EMK B;  3I7P A;  5FKT A;  2PM9 A;  5IJ7 E;  4KFM B;  5HE2 B;  4FA9 D;  5AMS A;  4HDJ A;  4A0A A;  2IWF A;  4GM3 A;  2P9P C;  2HES X;  2YNN A;  3UVO A;  4A2L A;  3L4O D;  5GXI A;  2PM9 B;  5SXM A;  4D6V A;  5CYK A;  1FWX A;  5FQD A;  4U7A A;  4X61 B;  3NVX A;  3SJL D;  2G9A A;  2G99 A;  3SMR A;  4CY5 A;  3IJ1 A;  4A0A B;  1K8K C;  3DWL C;  4GGC A;  3ULE C;  3F3F A;  3PXS D;  4FA1 D;  2Z2O A;  1NEX B;  3BWS A;  5EAP A;  5CYK B;  1L0Q A;  2I3S A;  3C5M A;  3RFH A;  1VYH C;  4AEZ A;  4A7J A;  2H13 A;  4E54 A;  2CO0 C;  4JSN C;  1SQ9 A;  2HJB A;  5EAM A;  2UZX B;  4X63 B;  3IJ0 A;  4ES0 A;  3SWS D;  3W15 A;  3F3G A;  4QQE A;  4LGN A;  5THA A;  5IGQ A;  3UVK A;  2GC4 A;  4CC9 A;  1MG3 A;  3VGZ A;  2EBS A;  2IWK A;  4O45 A;  4E54 B;  4O9D A;  4BL0 A;  4J87 A;  5K19 A;  2HJ4 A;  2AH0 A;  4A08 A;  3MKQ A;  3JRO A;  3GRE A;  1S4U X;  4QRJ A;  1JMZ B;  4L9O A;  4OWR A;  2GC7 A;  2IUV A;  2H9M A;  4UI9 R;  5KDO B;  4GQ2 P;  3GFC A;  5FKS A;  4GQB B;  2H6N A;  4ZOX A;  2QC5 A;  4GM8 A;  2H9L A;  4JSV C;  4J73 A;  3N0D A;  4JT5 C;  5I5M A;  4FB1 D;  4JSP C;  3SBP A;  3RN0 D;  4J84 A;  3EI4 A;  3IIW A;  4GMB A;  3C75 H;  4CY3 A;  4A08 B;  2OJY A;  5HYN B;  1N6F A;  2H68 A;  2CNX A;  2HXC A;  2P9N C;  3JZN A;  1XKS A;  3JRP A;  4LG8 A;  4J78 A;  1Q47 A;  3P4F A;  4MK0 B;  1PBY B;  4L3G D;  2IAA A;  5GSA A;  3CIK B;  1K32 A;  4YVD A;  2IUQ A;  4TZ4 A;  3PVU B;  1GXR A;  4X60 B;  4CI8 A;  4J82 A;  2OVR B;  4PC0 A;  3K27 A;  1B9X A;  1GOT B;  3JZH A;  4H5J A;  1PEV A;  3SN6 B;  2OVP B;  2PBI B;  3I2N A;  4OZU A;  1OLZ A;  3IJC A;  2XL3 A;  4ERY A;  4CZV A;  4L1Q D;  4GZ8 A;  5H17 A;  2OK4 A;  2O9K A;  4ZOV A;  3RN1 D;  1XIP A;  4G56 B;  5H1M A;  4FAN D;  1GG2 B;  3IIY A;  4Y7R A;  3K26 A;  4ZOZ A;  4A0B A;  3EMH A;  4K3J B;  2CO0 A;  3JB9 L;  4FHL A;  4LG9 A;  4J79 A;  3NVQ A;  1PI6 A;  5EAR A;  1U4C A;  4JSX C;  4ESG A;  4O1Q D;  4PBZ A;  3JZG A;  4ZN4 A;  2B5M A;  3V7D B;  4A0B B;  3I7O A;  1A0R B;  5CXC A;  2H47 A;  2I0T A;  2I0S A;  4CY2 A;  4R7A B;  5A2Q g;  2CN2 A;  5B4W A;  2IUP A;  4QT8 A;  5IC7 A;  2HKM A;  3EU7 A;  1U2V C;  4PBY A;  4XYH A;  3RSE C;  2H9N A;  2AGZ A;  5IJ8 E;  3RFG A;  2OVQ B;  4J81 A;  5C9Z B;  5CXC B;  5TF2 A;  2H9P A;  2XL2 A;  2J56 H;  4H5I A;  1NR0 A;  3RRM C;  2AH1 A;  1N6D A;  2YNO A;  2YBA A;  3L4M D;  3EI2 A;  3CFS B;  2AGL A;  4Z8L A;  3EWE A;  4EWR A;  3MMY A;  3DXM C;  3OKW A;  4PNK B;  2YMU A;  2CE8 A;  3I7N A;  4I79 A;  3IKO A;  5C2W B;  3SHF A;  3UKU C;  3RMZ D;  1YFQ A;  5I5I A;  2YNP A;  4PSW B;  5EMJ B;  3PVW B;  5EML B;  2AQ5 A;  5AFU 3;  3OL2 A;  4GGA A;  3EI2 B;  3SVW D;  2W18 A;  2XYI A;  3EI4 B;  4FA4 D;  3PE7 A;  3N0E A;  2J55 H;  3UVL A;  1JOF A;  4J0W A;  4Y5R D;  3I8E A;  5IGO A;  3MZK A;  2CE9 A;  2OK6 A;  2OIZ A;  2QXV A;  3DXK C;  4PSX B;  2XU7 A;  4QL1 A;  4E5Z A;  3OL2 B;  3C9C A;  2P9L C;  1PGU A;  2B5N A;  5FKQ A;  2BCJ B;  4ERQ A;  5IT9 g;  1B9Y A;  1TYQ C;  2GNQ A;  5FKR A;  3JAM g;  3AH8 B;  4D0K A;  1R5M A;  4CI2 A;  4CZX A;  3F3P A;  2AGW A;  3MXX A;  3SXT D;  4CY1 A;  4E5Z B;  2P9U C;  1QNI A;  3V9F A;  3BG1 A;  3OKY A;  3SBQ A;  4A2M A;  5GMK n;  4CZY A;  5CXB A;  5I5J A;  3AL8 A;  4PXW A;  5HQG A;  5TDH B;  2P9I C;  1RI6 A;  3SBR A;  5FLX g;  1P22 A;  4FAV D;  3VA6 A;  4XEI C;  4FA5 D;  1JMX B;  2PM7 B;  4L3H D;  4XYI A;  3HFQ A;  3OKY B;  3C99 A;  3DM0 A;  2HKR A;  5CXB B;  1GP2 B;  3AL8 B;  3FGB A;  3A0F A;  5H14 A;  3VH0 A;  5AJA A;  3I7K A;  4GM9 A;  2B5L A;  2J57 G;  1MDA H;  4X3E A;  3SLE D;  2I3T A;  5JWZ A;  4A09 A;  3FRX A;  1SHY B;  3PXW D;  3UVN A;  3FM0 A;  3I7L A;  3PXT D;  2Z2N A;  1TBG A;  3J80 g;  3OKT A;  5GXH A;  3I8C A;  4U1E I;  4K3I D;  3UKR C;  1JJU B;  2IUR A;  5HE0 B;  4BUJ C;  4A09 B;  5EAL A;  4IA9 A;  1SQJ A;  3CFV A;  4N14 A;  5FXY A;  1ERJ A;  3PSC B;  4JD2 C;  2I0R A;  4A11 A;  5EMM B;  4JXM A;  4ZOY A;  4JT6 C;  4GQ1 A;  4ERZ A;  2MTA H;  3BG0 A;  4J77 A;  3OW8 A;  3EI3 A;  3EI1 A;  4O3T B;  3MZL A;  2Q7Q A;  1XHM A;  3MKS B;  1MG2 A;  3E0C A;  5K1C C;  3I7H A;  5EM2 A;  2AGY A;  1OMW B;  3OTT A;  4NSX A;  3KRW B;  3PSL A;  5HE1 B;  2UZY B;  2H6Q A;  3V5W B;  5TEE A;  4J8G A;  4A11 B;  2AGX A;  4J86 A;  5FA5 B;  3JPX A;  3EI3 B;  3EI1 B;  2B4E A;  4CI1 A;  3ODT A;  5EM2 B;  2BBK H;  3ORV D;  5HE3 B;  2H6K A;  3KRX B;  2YB8 B;  3U4Y A;  4J0X A;  3SCY A;  2HYE A;  4O3U B;  3SFZ A;  4FWW A; 
#chains in the Genus database with same CATH topology
 3UVM A;  4IMM A;  3UR4 A;  2H14 A;  4J8B A;  3NVN A;  3IUR A;  2TRC B;  2CN3 A;  3AFC A;  5E6R A;  3B7F A;  4AOW A;  1N6E A;  3J81 g;  2Z2P A;  3DSM A;  2H3X A;  3RLM D;  4BH6 A;  3EG6 A;  2PM6 B;  4BCD A;  5C2V B;  3ZWL B;  3T3M A;  2WQ8 A;  1O6G A;  2P9K C;  2EIB A;  4GGD A;  3AL9 A;  4CI3 A;  5TEF A;  2P9S C;  3I89 A;  1VZ2 A;  5EMK B;  3I7P A;  5FKT A;  2PM9 A;  5IJ7 E;  3IUN A;  4KFM B;  3O4I A;  5HE2 B;  4FA9 D;  4G1E A;  5AMS A;  4HDJ A;  4A0A A;  2IWF A;  2HU7 A;  4GM3 A;  2P9P C;  2VDR A;  2HES X;  2YNN A;  3UVO A;  4A2L A;  3L4O D;  1UTC A;  5GXI A;  2PM9 B;  5SXM A;  4Z7O A;  4D6V A;  5CYK A;  1FWX A;  4NEN A;  5FQD A;  4DNU A;  4U7A A;  1H2W A;  4X61 B;  3NVX A;  3SJL D;  2G9A A;  3VI4 A;  2G99 A;  5FFO A;  3SMR A;  4CY5 A;  5M5R A;  3IJ1 A;  4A0A B;  1K8K C;  3DWL C;  4L1M A;  4GGC A;  3ULE C;  3F3F A;  3PXS D;  5M5U A;  4FA1 D;  2Z2O A;  3MVD K;  1NEX B;  3BWS A;  5EAP A;  1UOP A;  5CYK B;  1L0Q A;  2I3S A;  3C5M A;  1I2M B;  1GOF A;  2EIC A;  3RFH A;  1VYH C;  4AEZ A;  4A7J A;  2H13 A;  4E54 A;  3MUN A;  1BPO A;  2CO0 C;  2XZG A;  1VE6 A;  4JSN C;  4NAA A;  4WK2 A;  1SQ9 A;  1QFS A;  2HJB A;  2UZX B;  5EAM A;  4X63 B;  3IJ0 A;  4WK4 A;  1L5G A;  4ES0 A;  4AN0 A;  3SWS D;  3W15 A;  3F3G A;  4QQE A;  4LGN A;  5THA A;  5IGQ A;  2VZ3 A;  1QFM A;  3UVK A;  2GC4 A;  4CC9 A;  1MG3 A;  3VGZ A;  4MMX A;  2EBS A;  2IWK A;  4O45 A;  4E54 B;  4O9D A;  4BL0 A;  4J87 A;  5K19 A;  2HJ4 A;  2AH0 A;  3GC3 B;  3FCU A;  4A08 A;  3MKQ A;  3JRO A;  3GRE A;  1S4U X;  4WJK A;  4QRJ A;  1JMZ B;  4L9O A;  4OWR A;  2GC7 A;  3K72 A;  2IUV A;  2H9M A;  4UI9 R;  5KDO B;  4GQ2 P;  3GFC A;  5FKS A;  4GQB B;  2H6N A;  4ZOX A;  2HU5 A;  2QC5 A;  4GM8 A;  2H9L A;  4JSV C;  4J73 A;  3N0D A;  4JT5 C;  5I5M A;  5FFG A;  4JSP C;  3SBP A;  4FB1 D;  3RN0 D;  4J84 A;  3EI4 A;  3IIW A;  4GMB A;  3C75 H;  4CY3 A;  5C86 A;  4A08 B;  4AN1 A;  2OJY A;  5HYN B;  3ZDY A;  3ZE2 A;  2VDK A;  5M5V A;  1N6F A;  2H68 A;  2CNX A;  2HXC A;  2P9N C;  3JZN A;  1K3I A;  1XKS A;  3JRP A;  4LG8 A;  3T3P A;  4J78 A;  1Q47 A;  3P4F A;  4MK0 B;  1PBY B;  5HDB A;  4L3G D;  4Z7Q A;  1T2X A;  2IAA A;  3CIK B;  5GSA A;  1K32 A;  4IRZ A;  4YVD A;  1UOO A;  2IUQ A;  4TZ4 A;  3PVU B;  1GXR A;  4X60 B;  1E5T A;  4CI8 A;  4J82 A;  2OVR B;  1A12 A;  5E6S A;  4PC0 A;  3ZDX A;  3K27 A;  1B9X A;  1GOT B;  3JZH A;  4H5J A;  1VE7 A;  1PEV A;  2VDP A;  3SN6 B;  2OVP B;  4AMY A;  2PBI B;  3ZDZ A;  3I2N A;  3MUO A;  4OZU A;  1OLZ A;  1M1X A;  2XL3 A;  3IJC A;  4ERY A;  4CZV A;  4L1Q D;  4GZ8 A;  5H17 A;  2OK4 A;  4O2W A;  2O9K A;  1JTD B;  4ZOV A;  3RN1 D;  1XIP A;  4G56 B;  4DNW A;  4RE6 A;  4RE5 A;  3KCI A;  4UM9 A;  5H1M A;  4FAN D;  1GG2 B;  3IIY A;  4Y7R A;  3K26 A;  4ZOZ A;  4A0B A;  3EMH A;  4K3J B;  1U8C A;  2CO0 A;  2QR5 A;  3JB9 L;  4FHL A;  4LG9 A;  4J79 A;  3O4J A;  3NVQ A;  1PI6 A;  5EAR A;  1U4C A;  2VDO A;  4JSX C;  4ESG A;  4O1Q D;  4PBZ A;  3JZG A;  4ZN4 A;  2B5M A;  4BCB A;  3V7D B;  4A0B B;  3I7O A;  1A0R B;  5CXC A;  2H47 A;  2I0T A;  4MMZ A;  2I0S A;  4CY2 A;  4R7A B;  3IVM A;  2EIE A;  3OF7 A;  5A2Q g;  2CN2 A;  5B4W A;  3GD1 I;  2IUP A;  4QT8 A;  3NID A;  2HKM A;  3EU7 A;  5IC7 A;  1U2V C;  4PBY A;  4XYH A;  4D9S A;  2HU8 A;  4NBM A;  3RSE C;  2H9N A;  2AGZ A;  5IJ8 E;  3FCS A;  3RFG A;  2OVQ B;  4J81 A;  3O4H A;  5C9Z B;  5CXC B;  5TF2 A;  3ZE0 A;  2H9P A;  2XL2 A;  3DDU A;  2J56 H;  5M5S A;  1E8M A;  4H5I A;  3QI0 A;  1NR0 A;  3RRM C;  2AH1 A;  4MMY A;  1N6D A;  2YNO A;  2YBA A;  5M61 A;  3L4M D;  3EI2 A;  3CFS B;  2AGL A;  4Z8L A;  3EWE A;  4EWR A;  3MMY A;  3DXM C;  3OKW A;  4JHN A;  1C9I A;  4PNK B;  3EQ9 A;  4BCC A;  2YMU A;  2CE8 A;  3I7N A;  4I79 A;  3IKO A;  5C2W B;  4UM8 A;  3SHF A;  3UKU C;  3RMZ D;  1YFQ A;  5E6U A;  5I5I A;  2YNP A;  4PSW B;  5EMJ B;  4AX4 A;  3PVW B;  5EML B;  2AQ5 A;  5AFU 3;  3OL2 A;  4GGA A;  3EI2 B;  3SVW D;  2W18 A;  2XYI A;  3EI4 B;  4DNV A;  1YR2 A;  4FA4 D;  3PE7 A;  3N0E A;  2J55 H;  3UVL A;  1JOF A;  4J0W A;  4Y5R D;  1GOH A;  3I8E A;  5IGO A;  3MZK A;  2CE9 A;  2OK6 A;  2OIZ A;  2QXV A;  3DXK C;  3NIG A;  4PSX B;  2XU7 A;  4QL1 A;  4E5Z A;  3OL2 B;  3C9C A;  2P9L C;  1PGU A;  2B5N A;  5FKQ A;  2JKX A;  2BCJ B;  2XE4 A;  4ERQ A;  4BP9 A;  5IT9 g;  1B9Y A;  1TYQ C;  2GNQ A;  5FKR A;  3JAM g;  3NIF A;  3AH8 B;  4D0K A;  1R5M A;  4CI2 A;  4CZX A;  3V4P A;  3F3P A;  2AGW A;  3MXX A;  3SXT D;  4NC4 A;  4CY1 A;  2VDQ A;  3IUL A;  4E5Z B;  2P9U C;  1QNI A;  3V9F A;  3BG1 A;  3OKY A;  4G55 A;  3SBQ A;  2VDN A;  4A2M A;  3IJE A;  5GMK n;  4CZY A;  2VDL A;  5CXB A;  5I5J A;  3AL8 A;  4PXW A;  5HQG A;  5TDH B;  2P9I C;  1RI6 A;  3SBR A;  5FLX g;  1P22 A;  4FAV D;  3K71 A;  3VA6 A;  3O4G A;  4XEI C;  4FA5 D;  1JMX B;  5C92 A;  2PM7 B;  4L3H D;  4WK0 A;  4XYI A;  3HFQ A;  3OKY B;  2XDW A;  3C99 A;  3DM0 A;  2HKR A;  5CXB B;  1GP2 B;  4QAM A;  5M5T A;  3AL8 B;  3FGB A;  3A0F A;  5H14 A;  3VH0 A;  3IUJ A;  5AJA A;  3I7K A;  4GM9 A;  2B5L A;  2J57 G;  1MDA H;  4X3E A;  3SLE D;  2I3T A;  5JWZ A;  4A09 A;  2QZP A;  1H2Z A;  3FRX A;  1SHY B;  3PXW D;  4BP8 A;  3UVN A;  3FM0 A;  3I7L A;  3QHY B;  3PXT D;  2Z2N A;  1TBG A;  3EQ8 A;  3J80 g;  2VC2 A;  4G1M A;  3OKT A;  5GXH A;  4AMZ A;  1H2X A;  3I8C A;  4U1E I;  2VZ1 A;  4K3I D;  3UKR C;  1JJU B;  2IUR A;  5HE0 B;  4BUJ C;  4A09 B;  5EAL A;  4IA9 A;  1SQJ A;  1GOG A;  2EID A;  3CFV A;  4N14 A;  1ERJ A;  3PSC B;  5FXY A;  3IUM A;  4JD2 C;  2I0R A;  4A11 A;  4Z7N A;  5EMM B;  4JXM A;  4O02 A;  3VI3 A;  4ZOY A;  4JT6 C;  4GQ1 A;  4ERZ A;  2MTA H;  3BG0 A;  4J77 A;  3OW8 A;  3EI3 A;  3EI1 A;  4O3T B;  3MZL A;  2Q7Q A;  1XHM A;  3MKS B;  1MG2 A;  3E0C A;  5K1C C;  1UOQ A;  3I7H A;  5EM2 A;  2AGY A;  1OMW B;  3OTT A;  3ZE1 A;  4NSX A;  3KRW B;  3PSL A;  4JHP C;  5HE1 B;  2UZY B;  2H6Q A;  3V5W B;  5TEE A;  3K6S A;  4J8G A;  1C9L A;  2BKL A;  4A11 B;  2AGX A;  4J86 A;  1TYE A;  5FA5 B;  3JPX A;  2VDM A;  1O6F A;  3EI3 B;  3EI1 B;  2B4E A;  4CI1 A;  1JV2 A;  3ODT A;  5EM2 B;  1H2Y A;  2BBK H;  3ORV D;  5HE3 B;  1E8N A;  2H6K A;  3EQ7 A;  1VZ3 A;  2YB8 B;  3KRX B;  3U4Y A;  4J0X A;  3SCY A;  3IUQ A;  2HYE A;  3V4V A;  4O3U B;  3SFZ A;  4FWW A; 
#chains in the Genus database with same CATH homology
 3UVM A;  4IMM A;  3UR4 A;  2H14 A;  4J8B A;  3NVN A;  2TRC B;  2CN3 A;  3AFC A;  4AOW A;  3B7F A;  1N6E A;  3J81 g;  2Z2P A;  3DSM A;  2H3X A;  3RLM D;  4BH6 A;  3EG6 A;  2PM6 B;  5C2V B;  3ZWL B;  2P9K C;  4GGD A;  3AL9 A;  4CI3 A;  5TEF A;  2P9S C;  3I89 A;  5EMK B;  3I7P A;  5FKT A;  2PM9 A;  5IJ7 E;  4KFM B;  5HE2 B;  4FA9 D;  5AMS A;  4HDJ A;  4A0A A;  2IWF A;  4GM3 A;  2P9P C;  2HES X;  2YNN A;  3UVO A;  4A2L A;  3L4O D;  5GXI A;  2PM9 B;  5SXM A;  4D6V A;  5CYK A;  1FWX A;  5FQD A;  4U7A A;  4X61 B;  3NVX A;  3SJL D;  2G9A A;  2G99 A;  3SMR A;  4CY5 A;  3IJ1 A;  4A0A B;  1K8K C;  3DWL C;  4GGC A;  3ULE C;  3F3F A;  3PXS D;  4FA1 D;  2Z2O A;  1NEX B;  3BWS A;  5EAP A;  5CYK B;  1L0Q A;  2I3S A;  3C5M A;  3RFH A;  1VYH C;  4AEZ A;  4A7J A;  2H13 A;  4E54 A;  2CO0 C;  4JSN C;  1SQ9 A;  2HJB A;  5EAM A;  2UZX B;  4X63 B;  3IJ0 A;  4ES0 A;  3SWS D;  3W15 A;  3F3G A;  4QQE A;  4LGN A;  5THA A;  5IGQ A;  3UVK A;  2GC4 A;  4CC9 A;  1MG3 A;  3VGZ A;  2EBS A;  2IWK A;  4O45 A;  4E54 B;  4O9D A;  4BL0 A;  4J87 A;  5K19 A;  2HJ4 A;  2AH0 A;  4A08 A;  3MKQ A;  3JRO A;  3GRE A;  1S4U X;  4QRJ A;  1JMZ B;  4L9O A;  4OWR A;  2GC7 A;  2IUV A;  2H9M A;  4UI9 R;  5KDO B;  4GQ2 P;  3GFC A;  5FKS A;  4GQB B;  2H6N A;  4ZOX A;  2QC5 A;  4GM8 A;  2H9L A;  4JSV C;  4J73 A;  3N0D A;  4JT5 C;  5I5M A;  4FB1 D;  4JSP C;  3SBP A;  3RN0 D;  4J84 A;  3EI4 A;  3IIW A;  4GMB A;  3C75 H;  4CY3 A;  4A08 B;  2OJY A;  5HYN B;  1N6F A;  2H68 A;  2CNX A;  2HXC A;  2P9N C;  3JZN A;  1XKS A;  3JRP A;  4LG8 A;  4J78 A;  1Q47 A;  3P4F A;  4MK0 B;  1PBY B;  4L3G D;  2IAA A;  5GSA A;  3CIK B;  1K32 A;  4YVD A;  2IUQ A;  4TZ4 A;  3PVU B;  1GXR A;  4X60 B;  4CI8 A;  4J82 A;  2OVR B;  4PC0 A;  3K27 A;  1B9X A;  1GOT B;  3JZH A;  4H5J A;  1PEV A;  3SN6 B;  2OVP B;  2PBI B;  3I2N A;  4OZU A;  1OLZ A;  3IJC A;  2XL3 A;  4ERY A;  4CZV A;  4L1Q D;  4GZ8 A;  5H17 A;  2OK4 A;  2O9K A;  4ZOV A;  3RN1 D;  1XIP A;  4G56 B;  5H1M A;  4FAN D;  1GG2 B;  3IIY A;  4Y7R A;  3K26 A;  4ZOZ A;  4A0B A;  3EMH A;  4K3J B;  2CO0 A;  3JB9 L;  4FHL A;  4LG9 A;  4J79 A;  3NVQ A;  1PI6 A;  5EAR A;  1U4C A;  4JSX C;  4ESG A;  4O1Q D;  4PBZ A;  3JZG A;  4ZN4 A;  2B5M A;  3V7D B;  4A0B B;  3I7O A;  1A0R B;  5CXC A;  2H47 A;  2I0T A;  2I0S A;  4CY2 A;  4R7A B;  5A2Q g;  2CN2 A;  5B4W A;  2IUP A;  4QT8 A;  5IC7 A;  2HKM A;  3EU7 A;  1U2V C;  4PBY A;  4XYH A;  3RSE C;  2H9N A;  2AGZ A;  5IJ8 E;  3RFG A;  2OVQ B;  4J81 A;  5C9Z B;  5CXC B;  5TF2 A;  2H9P A;  2XL2 A;  2J56 H;  4H5I A;  1NR0 A;  3RRM C;  2AH1 A;  1N6D A;  2YNO A;  2YBA A;  3L4M D;  3EI2 A;  3CFS B;  2AGL A;  4Z8L A;  3EWE A;  4EWR A;  3MMY A;  3DXM C;  3OKW A;  4PNK B;  2YMU A;  2CE8 A;  3I7N A;  4I79 A;  3IKO A;  5C2W B;  3SHF A;  3UKU C;  3RMZ D;  1YFQ A;  5I5I A;  2YNP A;  4PSW B;  5EMJ B;  3PVW B;  5EML B;  2AQ5 A;  5AFU 3;  3OL2 A;  4GGA A;  3EI2 B;  3SVW D;  2W18 A;  2XYI A;  3EI4 B;  4FA4 D;  3PE7 A;  3N0E A;  2J55 H;  3UVL A;  1JOF A;  4J0W A;  4Y5R D;  3I8E A;  5IGO A;  3MZK A;  2CE9 A;  2OK6 A;  2OIZ A;  2QXV A;  3DXK C;  4PSX B;  2XU7 A;  4QL1 A;  4E5Z A;  3OL2 B;  3C9C A;  2P9L C;  1PGU A;  2B5N A;  5FKQ A;  2BCJ B;  4ERQ A;  5IT9 g;  1B9Y A;  1TYQ C;  2GNQ A;  5FKR A;  3JAM g;  3AH8 B;  4D0K A;  1R5M A;  4CI2 A;  4CZX A;  3F3P A;  2AGW A;  3MXX A;  3SXT D;  4CY1 A;  4E5Z B;  2P9U C;  1QNI A;  3V9F A;  3BG1 A;  3OKY A;  3SBQ A;  4A2M A;  5GMK n;  4CZY A;  5CXB A;  5I5J A;  3AL8 A;  4PXW A;  5HQG A;  5TDH B;  2P9I C;  1RI6 A;  3SBR A;  5FLX g;  1P22 A;  4FAV D;  3VA6 A;  4XEI C;  4FA5 D;  1JMX B;  2PM7 B;  4L3H D;  4XYI A;  3HFQ A;  3OKY B;  3C99 A;  3DM0 A;  2HKR A;  5CXB B;  1GP2 B;  3AL8 B;  3FGB A;  3A0F A;  5H14 A;  3VH0 A;  5AJA A;  3I7K A;  4GM9 A;  2B5L A;  2J57 G;  1MDA H;  4X3E A;  3SLE D;  2I3T A;  5JWZ A;  4A09 A;  3FRX A;  1SHY B;  3PXW D;  3UVN A;  3FM0 A;  3I7L A;  3PXT D;  2Z2N A;  1TBG A;  3J80 g;  3OKT A;  5GXH A;  3I8C A;  4U1E I;  4K3I D;  3UKR C;  1JJU B;  2IUR A;  5HE0 B;  4BUJ C;  4A09 B;  5EAL A;  4IA9 A;  1SQJ A;  3CFV A;  4N14 A;  5FXY A;  1ERJ A;  3PSC B;  4JD2 C;  2I0R A;  4A11 A;  5EMM B;  4JXM A;  4ZOY A;  4JT6 C;  4GQ1 A;  4ERZ A;  2MTA H;  3BG0 A;  4J77 A;  3OW8 A;  3EI3 A;  3EI1 A;  4O3T B;  3MZL A;  2Q7Q A;  1XHM A;  3MKS B;  1MG2 A;  3E0C A;  5K1C C;  3I7H A;  5EM2 A;  2AGY A;  1OMW B;  3OTT A;  4NSX A;  3KRW B;  3PSL A;  5HE1 B;  2UZY B;  2H6Q A;  3V5W B;  5TEE A;  4J8G A;  4A11 B;  2AGX A;  4J86 A;  5FA5 B;  3JPX A;  3EI3 B;  3EI1 B;  2B4E A;  4CI1 A;  3ODT A;  5EM2 B;  2BBK H;  3ORV D;  5HE3 B;  2H6K A;  3KRX B;  2YB8 B;  3U4Y A;  4J0X A;  3SCY A;  2HYE A;  4O3U B;  3SFZ A;  4FWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...