2J57A

X-ray reduced paraccocus denitrificans methylamine dehydrogenase n- quinol in complex with amicyanin.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
b'DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMICYANIN
molecule tags Oxidoreductase
publication title Tracking X-Ray-Derived Redox Changes in Crystals of a Methylamine Dehydrogenase/Amicyanin Complex Using Single-Crystal Uv/Vis Microspectrophotometry.
pubmed doi rcsb
total genus 23
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2j57A00
4E9SA 1SHXA 3OMIB 1AS6A 1NPJA 2BZ7A 3QJSB 4EF3A 3NSDA 1PZBA 4PCYA 3WI9A 2QDVA 1J9SA 1JVOA 2Y69B 3TBBA 3WNJA 1GY2A 2BP8A 2XU9A 3EH4B 2GHZA 2R7EA 4DP1X 1IKOP 2CBPA 2I85A 4M4RB 4P5SA 4DP8X 4G7RB 2PPCA 5B1JA 3EF4A 2HXAA 4DP7X 2UXTA 3H4HA 1TEGA 3SBQA 4DP0X 6PCYA 1WA0X 3G5WA 5I28A 5A7EA 3PAVA 4KNSA 4KNUA 1JZIA 3S3DB 1A4BA 2XV0A 5LDUA 1KCBA 1AZBA 1OE1A 1SFHA 3PLYA 3SQRA 1URIA 4JHUA 4YSAA 5B1BB 3T6WA 5I6NA 3T71A 1OCZB 1CYWA 3ZX1A 3BVDB 2QPDB 4KO9A 3QJQB 3DIVA 2HX7A 2Q9OA 4DP9X 4HHWA 3X2QB 2UX6A 4HCGA 5E9NA 2BP8B 2Y1AA 3FT0A 4AX3A 4K9JA 4A67A 4UAHA 2PP7A 3WNIA 2HRGA 4YSOA 3D12B 2HX9A 3N2JA 3NJNA 3AG1B 1L9QA 1XB8A 3HEIB 1ILSA 1KDJA 1QHQA 2FQDA 4HCFA 1NINA 3FYEB 4WTQA 1RZPA 4ENZA 5ANHA 3KW8A 1N70A 4YSQA 4G7SB 1N68A 5B3SB 1ZV2A 1KCWA 1L9TA 1ET5A 4X4KA 2VMJA 2VSMB 2FT7A 3T6VA 2UXFA 2BZCA 3QQXA 4G70B 2GSMB 2EILB 2JXMA 3NJKA 2PCYA 4DPAX 4YSSA 5I5MA 2DWTA 5FC9A 3PAZA 3QPKA 1I53A 4HHGA 4AZUA 2VM3A 3AG4B 2PLTA 1L9PA 1JZFA 2VW6A 1JXGA 4A66A 4GXFA 2BO0A 3OM3B 1DYZA 1IUZA 3S8FB 2OV0A 1IC0A 5I6KA 1CC3A 2H5UA 1E5YA 3BQVA 2J5WA 1RZQA 5B7MA 1ASOA 1AANA 3CZUB 1OOWA 2FJSA 2PP8A 3ASOB 5EHFA 1AR1B 5PAZA 1PLAA 4F2EA 4GY4A 1BYOA 3PXLA 1BQRA 1OE2A 1BXAA 2CUAA 4JHVA 1JZGA 2PCFA 1KGYE 3CVCA 2W88A 1ZDQA 1AQ8A 1M56B 1OV8A 1BEXA 1MZZA 3QJUB 2XWZA 3PAUA 3AG3B 3L45A 4Q8BA 2WO2B 4BXVA 1AZNA 1E5ZA 1NIAA 3NT0A 5D4IA 1AS8A 1J9RA 5AZUA 5I26A 4YSDA 2IDTA 3C75A 2PP9A 1AG0A 1IBYA 4L0PB 4YSTA 1NIBA 1JZEA 4ZK8A 3X1GA 3WIAA 2X88A 1BQ5A 2IDUA 3V9EA 2GC4C 1AZCA 1J9TA 1UATA 2XVBA 2IWFA 2VN3A 3WKPA 4E9TA 1J5CA 3TU6A 2MRYA 2ZWNA 4NERA 2YAHA 1JXFA 1GR7A 1BAWA 3WG7B 1CYXA 1V54B 5AFAA 2XV3A 1ZPUA 1WA2X 1R1CA 1JXDA 1JZJA 3CG8A 2PPAA 1NZRA 3ZDWA 2YAFA 5TK2A 2BW4A 1SDDB 5B7FA 3GDCA 3WKQA 2UXVA 2AANA 4A2FA 3QJTB 4GP5B 2HRHA 1BQKA 4YL4A 1JZHA 5I5IA 7PAZA 2HLEB 5F7AA 2ZOOA 5I6MA 3MX0B 4BDVB 4KOBA 3JTBA 4CSPA 3FSAA 4DPBX 1E30A 5D4JA 3PPSA 2N0MA 1ASQA 3IN2A 1ET7A 1KDIA 1JVLA 1NPNA 3X1NA 2FQFA 2J55A 4QLWA 5I6OA 3DTUB 4BWWA 4BDVA 1BXVA 1A3ZA 3NJFA 4AKQA 2YAEA 1BXUA 3SBRA 4E9VA 1PLCA 4M3HA 3S3BB 1PMYA 3CDZA 2B08A 1E65A 1KBVA 2YAMA 2PPFA 4W9ZA 1JERA 3H4FA 4BXSV 2LLNA 1L9RA 4YSRA 2TSBA 3RYMA 4KO5A 1E67A 3TASA 3ZBMA 1AOZA 2AZAA 3ASNB 2FT8A 2MTAA 3NJGA 4G71B 1X9RA 2XXGA 3T9WA 4E9RA 4A2DA 3OD3A 3IE9A 1SDDA 2IDQA 2P80A 2RACA 1CUOA 2XV2A 2TSAA 2BP0B 1MZYA 2GI0A 1AZRA 4N4YB 2EIKB 3S8GB 2CJ3A 4AKPA 2DYSB 1NIFA 2DY2A 3GXUB 4AI7A 2VW4A 1WA1X 2PPEA 1QLEB 4YSUA 1OCRB 1L9SA 3NYKA 4A2EA 7PCYA 1PNCA 1HFUA 4YVUA 3N55A 3UACA 4GYBA 1J5DA 1V55B 3FPYA 1ZIAA 2IH8A 3NSFA 4KOCA 3GYRA 3X1FA 3FSZA 4DP6X 4DP5X 4E9XA 4HALA 2YXWA 5D4HA 1AZUA 1ASPA 1JOIA 2I7SA 3UAEA 1AACA 1SJMA 2A3TA 2XX0A 2XUWA 4JKNA 3QJRB 2BWDA 4N8UA 5B1AB 2UX7A 2CCWA 1QNIA 1T5KA 1ET8A 3FU8A 2FQEA 4NAJA 2GC7C 1PF3A 2HZHA 2QDWA 4F7KA 3FSWA 1KBWA 3PCYA 1ID2A 1WS8A 4FA7B 1BYPA 1TKWA 2YARA 1XMEB 1NDTA 1A4AA 2VW7A 1L9OA 3FQ2A 3FU9A 2NRDA 3OMAB 5AKRA 5I6PA 1OCOB 1PCSA 1OE3A 2GB2A 1NICA 2EINB 5I6LA 1YLBB 1MDAA 2FTAA 3AY2A 1MG3C 4FAAB 3FS9A 4HCIA 1GW0A 4KNTA 3ABKB 1PAZA 5TK4A 2E86A 3TA4D 4BK5C 3NJHA 3KW7A 1GYCA 2H3XC 1M57B 2XXFA 1IBZA 2IAAC 1WS7A 4BWTA 1HAUA 5F7BA 1X9UA 1XB3A 3CDZB 4RH4A 1J9QA 3HB3B 3FQ1A 1W8EA 2IDFA 2YAOA 3AW5A 3NJMA 1ILUA 1M9WA 3FU7B 5IY5B 2R7EB 3NJIA 2EIMB 4YSPA 4W1TA 2OJ1A 4A68A 1V10A 8PAZA 2HX8A 4E9WA 2VM4A 5I5JA 4DP4X 1ETJA 1GS7A 2VSKB 3EH3B 3OQRA 1PLBA 1A4CA 3EHBB 1FA4A 1OF0A 1GSKA 3UAAA 4A2GA 4YVNA 3U25A 2AFNA 3DKHA 3FQYA 1F56A 2J57A 2X87A 3JT2A 1TU2A 3ABGA 5B1JC 1FFTB 1SHWA 1VLXA 2AZUA 2DWSA 3EH5B 3FPXA 3OMNB 4MFHA 1KYAA 3T6XA 2YXVA 2PPDA 1RCYA 1W6LA 2FNWA 1AG6A 6PAZA 1AS7A 1AAJA 1NIDA 1DZ0A 2YAPA 2ZONA 2JFCA 2FT6A 4KO6A 1CURA 2DYRB 4E9YA 3AG2B 2WSDA 2CALA 3UABA 2XLLA 3H56A 2EIJB 3QJVB 3IBOA 4HZ1A 1HAWA 1NWPA 2Q5BA 1MG2C 1SF5A 1TEFA 4A2HA 4AKOA 2FQGA 9PCYA 2BP0A 2BW5A 1AIZA 3AZUA 4UF7C 3T6ZA 4WKXA 1FWXA 3ERXA 2I7OA 4QKTA 3V9CA 2BHFA 3CVDA 4G7QB 1NWOA 4GP4B 2BWIA 3ZIYA 4DPCX 2YAQA 1WAEA 1XB6A 4UANA 3SBPA 2FWLB 1A8ZA 1PY0A 4HAKA 4HIPA 4YSCA 2IWKA 5B7EA 1ADWA 3X1BA 1ZDSA 1PNDA 1ZIBA 2UXGA 3FYIB 2AVFA 3NSCA 4TXVB 2DV6A 2YQBA 3MBWB 5PCYA 2IH9A 3NP4A 2IWEA 3ABLB 3UADA 1A65A 1PZCA 1SF3A 5B1KA 3FU7A 4KO7A 1EZLA 2WO3B 3NP3A 1EHKB 1B3IA 4NB7A 4G72B 4PAZA 1OCCB 3NJLA 1PZAA 3NJJA 4GP8B 1SFDA 2CAKA 2IDSA 3TBCA 4E9QA 2GIMA 4P5RA 2W8CA 3X1EA 4Q89A 2QT6A 2XYBA 3S3CB 4CSZA 3NSYA 1NIEA 2J56A 2QPEB 2B3IA 4DP2X 2ZXWB 3FSVA 2GBAA 1W6WA 2H47C 2P80D 1GS6X 1GY1A 2XX1A 1SNRA 4F2FA 1RKRA 3IEAA 3CVBA 1GS8A 4YSEA 2OCCB 3IN0A 3UGEA 1NTDA 3ABMB 4BWUA 1KV7A 2JKWA
chains in the Genus database with same CATH superfamily
4Q4IA 1VFOA 2QHLA 1LJMA 1P6FA 3Q48A 4ZMTA 5EEWA 1TO5A 5AW4B 2ED8A 5D7JD 2ZWSA 5AOJA 2DH3A 3L3KB 3OB8A 2BSBA 5I76A 1IQDB 4WTWA 4XAKE 2EE6A 3RY6C 2WLZA 3EH4B 3UXFA 2X6CA 4X8JA 2PYEB 1A6UH 2XN9B 3FU0A 3EFOB 3QO0A 1XGZA 1R24A 1D9KC 4OLVH 1MFMA 2HMIC 3MGAA 4DCQA 4ZBJA 1EZVX 3SQOH 3T8XB 4AYMC 5BZXA 1QPKA 4DO4A 4DP0X 3TJEL 1J1PL 2HLFD 3BW9B 1F90H 3X11B 4LPXA 5DZ9A 5I28A 1AKJB 1Q38A 3L5HA 4LMQE 4OSUH 4X7FC 3LPGA 5C09A 1JYVA 3NVQA 2JIXB 2LVEA 3Q5YA 4ZZKA 1XTLA 1FIGL 1CFNB 5KTEL 3DX9A 3U4KA 3U83A 5KSVA 4JM2A 4G42B 5C71A 1RHHA 3CX2A 3GHEL 4ODVL 3KPMA 1ROWA 5B3JE 4XNAA 3NZSA 5CZXC 3QDJD 2IBZY 3DECA 3K5SA 2E56A 3LZRA 4Z7IA 5F9JB 2NXYC 3PDGA 2Z35B 4KPHH 3FT3B 1OGAA 4N8PA 1R19A 2VDOH 2ZUTA 1P4BL 1WO2A 2L7UA 3P9MA 3AB0B 1YNTB 2NCEA 4JHBA 5DJDA 4MA1C 1ND0B 1RJZB 1A22B 3SOBL 5TF1H 1M05B 1K2DA 4WWID 5HYIA 5HYJD 1GGUA 5A7BA 3DMMD 2OI9B 4LSUL 3PNRB 2ZSWA 4M9OA 2FR4A 1QSVA 1I8IA 3M17A 4G8GA 1CFBA 1V7NH 4HCFA 4PMFA 4TVPL 3VFUB 1RIVH 5I30L 2ZX9A 4IS6A 4JREB 4ZMNA 4IOSD 2BNRB 3MOBL 5IW1B 1JGVL 2WQXA 1T20A 3CVIH 1S2EA 4NXKA 1KCWA 3ELQA 3QPQD 3SJVA 3HAEG 3CXDL 3WDIA 1KOAA 4LAQL 4FFZH 2BSED 3BWUF 3G5XA 2BZCA 2KZ1B 4YS4A 1A8JH 1I7UA 1Y1DA 4LL4A 1KEGL 2FBOJ 5HI5D 2WQAA 3JXAA 4PBXA 5DJAA 1MPAL 4HHGA 3VRLE 4WJ5B 3LNHA 3O9WC 5HHVL 4AZUA 4M93C 2V2WA 4X6DB 2JI2A 3CXFA 2A9MH 4FN0A 4MMZB 4KJQC 3ISWA 2VW6A 5LUMA 2Y06H 2BNRA 4XR8C 4F15B 4ABVA 1OANA 3IMSA 1R3IL 2ZCZA 3PWUB 4NOFA 3D34A 3DMMB 1CC3A 2Z92B 4FNQA 3GHBL 2FNBA 1H3UA 1ETZB 4IBLT 5KVFE 4F7CA 4RGMC 4YE0A 5GS1C 5GISH 3U7YH 4RWYL 5K9KA 3P11H 2R1XB 4I7ZC 2WHVA 5EHFA 1JZ5A 1EBAA 3VXTA 5TH2A 2YOAA 3WJJA 4AMKL 1KENL 4XVTH 2LTQC 5D1XB 4KXDA 4O02A 5LAXB 2PCFA 5D7IE 5FKPA 3UZEA 2Y6TE 4YHIA 4DVBB 4RETB 1ZDQA 1N6QL 2OZNA 2VC2B 3GJFA 4JY5H 4PB0L 1NCHA 4B5ZA 4L4VB 4NT6A 5J6GB 4EQ2A 3SDXE 5D4IA 4QPEA 5ADOL 4MB5A 3QUHA 4GKNA 5DA4A 2EDYA 2VLKA 2A9BA 2PTVA 3HVNA 2VDRH 2AGJL 4DK6A 1UHVA 4XNUL 1WEJH 3PWUA 4NN7B 4N2CA 3HG0A 4D94A 4YBQD 2P48B 3MCLH 2FEJA 3U4BH 2DLFH 3QG7H 2HPTA 2ED9A 2Z7WA 1ITCA 2Z91B 4JDTL 4B9JA 5CLTA 1TUPA 1ES0B 3CVHA 1BZ9A 3VQ1C 3O81A 3HC2A 3QI9D 2GK0B 2ZWNA 3N1MC 3RQ3A 1PEZA 4D2NA 2J8HA 5KVEL 4FTVE 2BOBB 1CE6A 1D7DA 3QDJE 4NENA 3OKOA 5C0FA 4BH8B 2FLBT 1YYML 3FO2B 3K0YA 4GAYB 4TSCL 2Q7YB 1X7SA 5GGSA 5G55A 2O5XH 5KG9A 3C12A 4NKMB 2NYYD 4JRLA 3VH8G 1OP4A 1HH6B 3U7YL 3GSQB 4HKBA 1FGVL 4XCEB 2AAVA 2H2SC 1BBDH 3FQUB 1ULVA 5CZVH 5I1KH 1CR9L 2F5BL 1KBKA 5IJVB 1IGTB 3SE6A 5D7IB 1CICD 4MAYD 1NGQH 4KMQA 4Y4FD 3OR7B 4GRLC 5D1XE 5DHDA 3D0VB 2ZQKA 4ZXBD 4Y1SA 7PAZA 3STZA 4KKCC 5E00A 4XMWA 5MERB 3QWRD 4JCWA 3HE7D 4LRIA 1IARB 3GRWL 4FYRA 4O4YL 2VDQL 1ZWIA 3WBDA 5C6WH 2QL1A 4JO1L 3NFPA 2BC4A 4WZ9A 4X5QA 1JF1A 4Y5XC 5MI0B 1SPDA 3T08A 3DK2A 2X6VA 3BPNB 3VXMA 3MV01 4HIHB 1T7WA 3WLWC 1YDPB 2OULB 1GPOH 3LZOA 3VD3A 2MCG1 1FFOA 4L37B 1AYRA 1JCKA 3L3OA 3KVQA 4GUPA 4XBEL 2Q6WB 4HT1L 2DBLL 1DSFH 1YY8A 3U4BL 4EI0A 2ZUYA 1Q9LB 2Q76B 4LOUD 5F7DB 3ZBMA 1KN2L 2PWGA 5EC2B 4PS8A 3MNWA 3GM0A 2BHYA 2XXGA 3BE1H 4POUB 1WZLA 4PTUA 3HOGA 1R3IH 4ZMQA 5ACLA 2VH5L 4M5YH 4NP4L 2AJ3B 2CGYA 2DWDB 2VDMH 5BZWA 3TNMB 1H8LA 2ZYRA 4GQRA 4OUOA 1JYNA 4NDMA 4OIFA 3MJWA 4B9KC 5F3HA 4BFEA 5AB0A 3II1A 2OP4L 2J1XA 4WU7B 4YHPA 3WXWH 1HHKB 1BBDL 5I1KL 1KJ3L 3L3KA 5SWSA 1QEWB 5KZCB 3RVWD 3FSZA 2X6AA 1Q90A 2C3VA 3RKDC 4H8HA 4HALA 1CGSH 1J5OH 1AACA 3HIZA 3L16A 4MCZB 5H2BA 1HXKA 4CJ0A 4WFFD 3FUHA 3QJRB 1I8AA 3DYMA 3BAEL 1QFWM 4N3UA 1T5KA 5JUEH 4P23C 2X6MA 1DUYA 4ODSH 1QACA 4UTBL 2G3MA 4AIZB 3SQBB 1Q0XH 1RQ5A 3QWRA 2VLKE 3CAFA 4WFHE 5C92A 4XBGB 5BUGA 4WHCA 1UWXK 2UWEA 2X4NA 5HPMA 2PXYB 4Y8AA 3P9WB 3ZOAA 2XWTB 1KIUA 2GB2A 2VXSH 3KEDA 4D3CH 3OJDB 1UYWL 4HT1H 1RZIB 3IGAB 3RG1C 1S7SB 3UG3A 4MCYB 2WTRB 1A1OB 4NGHL 1IGJB 4N28A 1O5PA 3H54A 5HHQB 3N6YA 3SCMC 4TRPH 1FUNA 1C5CL 3RDTB 3GSUB 5FFOA 2NCMA 1G7PB 3TFKC 4J3OC 1NCGA 5B39A 3IFOA 3C08L 1M3IA 2EO9A 2IAAC 1WS7A 2BSRA 4Y4KA 4EUPA 5C0CA 1ZLWH 1M53A 3UPRA 2I9TA 3FQ1A 1WGOA 4K7PH 4BELD 3NJMA 2YPKA 1CL7I 1M9WA 2XKNB 3G5ZA 3L5XL 3NFSL 1NBVL 2JKRM 1DVXA 2NQ3A 4P2QA 1AVAA 4DGIL 3C6SA 4HIJB 4N0UA 5ECJE 5ACZA 2XA3A 4PJ7A 5DHYB 1INQB 1QSFD 4NO5A 4BFRA 1QUNB 1MCIA 3LEVL 4F2ME 1PW3A 1WBXB 1E4WH 3JWOH 4XMZA 1OO2A 4PJIF 4QNPE 3GSNB 1GSKA 3ARDD 5FM4A 4BZYA 4CUCA 4GIOA 3W5NA 5AZ2H 1GOHA 1P1ZB 2YMOA 5L9DL 4LCWE 1HS6A 2K8MA 1KLFB 1FCGA 1Z9MA 3V5DB 5BOJA 5JO5B 4L9LA 4MFHA 3KPSD 2AZUA 5DK0A 4LL9A 4R7XA 4X4ZA 3ARGB 1RCYA 1U3HD 1NKGA 1MFCH 5FO7B 4ZYKA 4NLHA 3DETD 2X4QB 4H4NA 5SX5K 1N0XH 2P52A 4PWKA 2KH2B 4NZ8A 3RP1A 4F27A 3ZMNA 1UFGA 3EYFA 2YAPA 4Y5VB 5CEYB 1LEKB 2E6JA 2WSDA 3FQXA 1AR1C 1IZJA 2K7QA 1N8ZB 5CUSL 4WI6A 3DBXB 3WNOA 4F57L 5J3HD 3UG4A 1HZLA 3W39A 2G0LA 3CLWA 4XMVA 5BZDB 3OXSA 4AKOA 1S8DB 3MUGA 3D39E 4YX2L 3TA3B 4NO3B 2YMXL 5CNHA 5FV1L 4JS7A 1S7XB 3DVNA 1NDGB 3ARED 3NFSH 3X13B 5CGBA 1M7XA 4X9IA 1IM9D 1SUHA 4XN8A 2YUVA 2NSMA 3HZMA 3EBHA 1UZ8B 4ZMWA 1WBYB 1GCYA 2Y07H 3TJHC 1OAJA 2QVKA 2YGPA 1S9VA 4YPJA 3WL9A 2CO7A 2IAMD 5I5RA 2OMZB 1NOFA 2Z93A 5DGRA 3S4SG 2WKOF 4KK8D 3BPLB 1SF3A 4Q6IA 1DQQB 1N0LB 2YGNA 3KE0A 1FVEB 3NP3A 4WNQB 2X4RA 5D2NC 2YRLA 3P2TA 2QQLH 2DQHL 3GMNB 3HHSB 1AMYA 2XNAA 3BQUB 4JFDD 1MCOL 3OSKA 1ROCA 4P49A 3KPSB 4FI6A 4GBXA 5DU7A 3VXRA 3V4VL 4POYA 2NY4C 3TBCA 4L2LA 3DUUA 1N0XL 1EUUA 1DBMH 1GIGH 1MF2H 4GLRH 4M8QB 4XO9A 3VGEA 3C5SB 3TYFA 3ZDZE 1SUJA 1MCHA 2NY4B 3IJ8A 5KW9H 2IMNA 4UBDD 2UY6A 3UZVA 4HSAC 1HINL 4WJ5A 3INUL 5M7QA 4U6HB 3T2NL 1MFBL 2XX1A 1G94A 4LCIH 3S5ZA 2WXJA 3RWHB 4JFUA 1U92A 3NABH 2EYSB 3MRJB 2IQ9H 3FTSA 3VWJA 3JSSA 3PWLB 3GO1L 1VA9A 5DJCA 5F7MC 3TCTA 4P5MA 5IROD 2DJSA 2ZX7A 4E36A 3KLHC 5MHSE 2WLLB 4TULL 3ATDA 4P4RA 1QTYT 1MI5A 4KVPA 3IAQA 1R17A 4PCYA 2Y07L 5JIPA 1QVOA 5LGHH 5KYXA 1J9SA 3CFQA 2MOVA 4JL1A 3BAYA 4NUJB 2VITB 4N2KA 1FJ1B 2QSVA 4Z6AT 2J88L 5I73B 3I6LE 1FPTH 4OM1L 3N43B 3LEYL 1ONQA 3SO3C 2IF7A 2CD0A 1HNFA 4YE4L 3POCA 2XPGA 3ARBB 5CWSB 5DFVC 3SDDC 3H4HA 5JHLH 3MNZB 1JGVH 4ADJA 4DKEL 4FQ2L 4I1RA 2Y1ZA 3DJSA 3M1CA 4K3DL 3ZY7A 4I8DA 4KQ3H 4NI3A 1JZIA 3V0HA 2AQQA 1S7WB 3OR6B 1BMZA 4NLAA 1AZBA 4GBXD 2X09A 3IJYB 4M02A 1JZ3A 5ALCH 1G5GA 1B4RA 4JFEB 2IG2H 3BWUC 1S78D 1WZ1L 1G7JB 3WEAA 2VDOB 2WIMA 5DO8A 1G43A 5IMKA 3PGCA 1KWGA 2H0PA 3PJSB 2QPDB 1PD1A 5EOQH 1AXIB 1ZVSB 3HRZC 1OP9A 1OARL 4AQ1C 4KFMA 1XO8A 2BIOA 3ZTNL 5EPMA 1JAEA 4K71C 4UT7L 5IIEB 1GPOL 3MRLA 1SMAA 3R8QA 5CGMA 3D25B 1FNLA 5E9NA 1RP9A 3K8LA 2ZD0A 1MWOA 3L13A 1SXSA 1MJUL 2LVCA 5GSVB 2HRPL 4HHAA 4WI2A 1XF4A 3T8XA 5DEFB 3S35L 1M6OA 1CI5A 2F58L 3U4EA 1NC4A 2C5DC 1KGCE 5FYKE 2OL3B 4BK5A 1ILSA 4EE2A 1I9IH 3GBDA 4IGBD 1SN0A 1MHCA 3O3BA 2NNFA 2VH5H 3PUCA 4M5YL 4OCLC 4N2FA 3QHZL 3TGXA 1KYOK 4L5FE 3R7RA 3V7AE 1AD9A 4KFZC 4HLEA 5KSBB 4G80B 5ANHA 5KN5B 4G1EB 4WVRA 5B3SB 1EFQA 4GFXA 3UERA 2QKIA 3QNFA 3T09A 2R2HB 4HOZA 4XBPA 3W9EB 3QQXA 2GSMB 3ATFA 1MHEB 3RVVD 5DHVA 5I18H 4YDLC 2CCVA 4HV8A 5DK2A 1HEHC 3MV7E 3VTMA 3U0WH 1WT5C 3QUKB 3R1GH 8FABB 1SLVA 3WGVB 3AS2A 1MFAH 4H13C 3O3AA 5FIEA 2WBJC 4OLYH 4MSWB 3BCFA 2FYVA 1I85C 5ACMA 1FHNA 5MEQA 2I27N 2QJDA 1XF2A 4XWOC 3TH3T 2OTUA 4FQCL 3IB4A 4N5UA 4APXB 2OV0A 3VQ2C 1G9NH 5CSBA 2FVNA 2WN2A 5JPMB 3BIKA 3BQVA 4N1CA 1R5WB 5C9KA 4X0KA 4Z5RB 4X4ME 1AHKA 4KVNH 4YLQT 5DJ2A 2YK1H 2F5AL 4JDEB 1HKLL 2ZX5A 3I9GH 4RBPK 4Z7UA 1XD0A 2PP8A 5EV7A 4NAMA 4N26A 1GTNA 2JCCF 4A63A 5DC4B 1M4KA 4I0KA 4LASH 3UO1L 4HPYL 5EPMB 3UDWC 4G7YL 1JZGA 2VDKH 2AXGB 1CFQA 3CVCA 4AIEA 4F8LA 1N5YH 3V0WH 3HS8A 4Y5VC 3F58H 4X8XA 1A14L 3FUEA 5GGRA 5J6SA 2QQKL 5HGDB 2V7HB 1SHSA 2X4TA 3N42B 4Q8BA 3U1QA 1EJFA 3PAYA 2VUKA 3C75A 4TUOA 4NN6C 1NFIB 4UTAL 3QXDB 5F7UA 2OXHA 4PRDB 5I1HH 3F2LA 3MA9H 4KQ4H 2IO5A 3AU1B 3UTOA 2GW5A 2NMSA 5IV2A 4NN6B 5E8EA 5I0YA 3BXNB 3O3DA 1LO2L 3S3PA 3MBXH 1PG7W 3BP5A 3QWOB 2WCGA 1DSYA 1QFWL 4IDLA 3TU6A 4YHOH 1TXKA 1RLBA 5TE4L 5FCUL 2B3RA 3QG6B 1PQZA 2BRRL 3TEXA 4P2OC 3L3IB 1X6LA 1FV1A 3GB7A 4ODUB 5T5NF 1H9DA 3GZQA 1F1DA 3V6OC 4YK4B 3PWLA 3TBSB 4CW1A 1G1OA 2WXFA 5CUSH 3CCHB 1YJDC 1R5VB 4HS6A 2WWMC 4X6DF 4Y88A 5IFHL 1H3PL 1G4MA 1Q4NX 4LCYB 3TP4A 4XX1E 3FO0L 1DVFA 1LWJA 1VHPA 4NN5C 1DQVA 4KOBA 4BJLA 4LSPH 1E30A 4NKQB 1NCAL 3PPSA 3NTCH 3KVPA 5C7XL 1OM3H 5J5EA 3PU7A 4HC1H 1LQSR 5ERWA 3OKMA 1BXVA 4R7NB 2FEEI 3ZQWA 3W0WA 4QT5A 4OD3L 4AMWA 1F3JB 4UMGA 5JDJA 4JQIL 1R5VA 2WXGA 2GITB 3BAEH 1D2PA 5E94B 5E9DE 2HLAB 1HQ4B 1KY7A 3DX6A 3ILPA 3KLKA 3BEWB 4HC1A 4M48L 4NYLB 4F33B 2VAJA 3KGUA 5GHWH 5E70A 4Z7WE 1RZFL 4DJMA 4AZ8A 1LLAA 4JZJC 2BVUA 1AOZA 2W9EL 4BE6A 2KPNA 1U9KA 3MGOB 5FUOH 4XCNA 1JS4A 1V7MH 3FCTB 1GRWA 1ZY9A 3GBNH 3W37A 1WBZB 4PJ9B 2Y7OA 2WLNA 3SE8H 1BZ7B 2P24A 5B1CA 1DE4B 3S98A 3BUQA 4XTRC 4N4YB 3GJEB 2EIKB 3TC9A 4P23D 5E8EB 4FL4C 3SKOA 1HH9B 5HJ3B 4MJ4A 3UBXI 4OQTH 2GJZB 5J11C 1E4XL 4XVOA 1KN4L 3HBPA 3C6LA 1FH2A 4U0RC 3N55A 1W80A 3QCUH 4ZNCD 1V55B 5FYKD 3G9VA 3VXSB 4UB0H 5E6RB 3X1FA 4DP6X 5L2JB 3W2DL 1VACB 1UWFA 2X4TB 1K4DA 2Z65C 2V7HA 2JJVA 1IGIL 2G5UA 3BP7B 4XMUA 3IJSA 5I0XA 2BWDA 3MSPA 4PRIE 1MFUA 1NAMB 3KWVA 1ID5I 2ZCHH 3VXOB 3WJLC 4HULB 4R97B 1ZHBA 3PCYA 4JQVA 2QVFB 2N1KA 3F7VA 1JK8B 4QRTA 3VQLA 4ODTL 1XMEB 5CBAA 2C9SA 3ARTA 1P7BA 2MWCA 4XCYA 1A66A 4DUVA 4MKTA 1PCSA 4N3TA 2WNGA 4OH2A 3RPIB 3WIIL 1T1ZB 1K5NA 2FTAA 3ARDB 3ECWA 4K8RD 1AO7B 4IRJA 4NM8L 1A02N 1FZKB 4XN1A 3FULA 3IYLW 2CO2A 4ECNA 4GO6B 1H0DA 2YPVL 2D8KA 1NMBH 3HS9A 5A2FA 1QATA 2WD0A 3Q1SH 3MRQB 3NCBB 1CDUA 1WHOA 2NY5H 1HCFX 1JI2A 4V1DD 4LLWA 5EU6B 1OAQL 2R69L 3RDJA 5AZ2L 4YR6A 3WD5H 1NC2D 4C83A 4KX8A 3NIDB 1PAMA 5HI4C 1AE6H 4MMXA 4OJCA 3MCLL 2BNRE 3MLZL 3FTVA 1BXXA 4XMKL 4YEEA 1ETJA 3MOAH 1YZZA 4MJIA 4NNPL 3VXUE 2K4WA 1NFKA 5HP5A 2PO6D 1QEXA 2BP3A 4DHLA 2C9PA 2DLHA 2VERA 2FATL 2VJ0A 3GLAA 2C9AA 3HS0B 3W2DH 2H2SD 4F2MA 4G1EA 4A2GA 2CPUA 3QDGE 5K1VA 4JRXA 1CXFA 4I48A 1LDPH 2IV9A 4W9LC 3NUKA 4L3EA 1FDLL 1F56A 3PHOA 3QRBA 4FZ8L 4MA8H 2CDFB 3V6OE 4KZDH 4S1DD 1BP3B 3FK3A 2DTMH 5DC2A 2R0ZH 4ZG1A 3WFHA 1W6LA 3LN4A 2IALA 2FNWA 3L08A 1NGXB 2DIBA 1AGCB 1T4KB 4G6ML 1CDHA 1UOVA 3LH8A 4I0PB 1T0MB 4HUVB 3OBAA 3JYCA 1DUYB 2RB8A 4ZUWA 2FL5B 2ZOWA 1E28A 4FMKA 4CADA 5I8KH 4I2XB 4NM8H 3LD8B 1U93B 3WFDH 4KDTA 5EBMA 5C9JA 1J0HA 4G9DB 1U4EA 1ZVSA 2XYCA 4TQPA 2L0DA 3C8DA 4P5TB 1JPGA 2D03L 4EN3C 1AHMA 4LHJB 5F9DC 1RJYA 1GAFL 3GTVA 1FG9C 4M5ZH 35C8L 3CVDA 4ZPVA 2OCJA 1CDCA 4R5VA 3E2HB 4DTGL 4MA7H 5A1AA 2E7CA 1T80A 2EIZA 2VQ1A 3DDFA 2Z31C 5I0DA 1SDYA 2B1AL 3S6CA 2ROYA 2XN9E 3A6CH 2VN5A 4I18C 1I7ZA 4LEEA 3NDZE 3GMQB 5DZOA 1A6ZA 4PJFF 4AXWA 4CVZA 4PTUB 4TXVB 5DT1H 3KZ8A 2CKBL 3NP4A 3ETBJ 4DEWA 3FN0H 4JQVC 4LPVA 5TTRA 3P3YA 4XCFH 2OQJB 3OG6B 3LXBA 3PWVB 4QOKA 3L81A 1FGNH 1JP5A 4N5EC 4WFHD 5G5DA 3CH1B 1GKOA 4NRZA 3L5WA 4YHYB 2BFGA 1CFTA 4JJOA 5LXGH 3ATBA 2Y06L 1ZLSH 3V2AR 4XP4L 5KBMA 5K1NA 1SFDA 5I16A 4P5MB 1NL0L 1BSIA 3CHXA 1IGYA 8CGTA 1V5JA 1ZVHA 2N4IA 2X05A 2BLFA 1RFDL 1WUNT 3VH8A 1QG3A 4U1KB 4CSZA 5E95B 5C0BA 4I18A 2CXKA 3MCKB 3MFFA 3NAAL 1SDAB 3MGTB 3ULVE 5D1XD 2VAAB 5SV4A 1CGYA 5JIIA 2WBXA 3ZKQD 3MYZA 3SKMB 5L7XH 3CFMA 1CIDA 3QUZB 1FLTX 1YUHB 3RWDB 2ADYA 4J1UA 1KXHA 2DD8L 2D3VA 2ZP9A 4HS3A 3LKOB 5K9JH 3GMRB 4P59L 2VTFA 4UM9A 1XGUB 4M1GL 3TZVB 3IDIA 3DJTA 1RV6X 1TVDA 2AEOA 4P57A 4ZFFA 4PY7A 3QJSB 4ANXA 4HVBA 4X9GA 1EEQA 1A2YB 3MCG1 4PJXB 4AH2A 2HFEB 3A6CL 3A0OA 2OYKA 1CMOA 3S35H 3BIAX 1MVFA 4WI0A 1M2OA 4E0RA 2R7EA 3BPCA 5DVOA 1CD1B 2XZAL 3MV7A 4CDHA 1XGYH 2XWBB 5JYMA 1K6QL 3AQDA 1BEYL 4AT6A 2BINA 3WY4A 1BVOA 4PJCB 3UJJH 1F1AA 3Q7JA 3MTXA 1RUPL 4IRSA 2IMMA 2BMKA 3CK0L 4PJ9C 4EPSA 4AGMA 3CFBA 1Q9WB 2VLLA 3G5WA 4LXFA 4NWUL 4AW4A 1JGDB 1TCRA 2IAMC 3FUMA 4B9CA 4L4TB 4OFKA 3TV3L 3LNEA 3HJ0A 1NL0H 2VXSL 1O9ZA 1IKFH 2ARJB 3OZKA 4JO3H 3BLPX 1TZGL 3VWKC 2WGXA 5DCCA 3HHRB 1EDYA 1QYGH 1OCZB 4U05A 3C5JB 5JLZB 4FTDA 4NT6B 4H0IA 2R2EA 5AOLA 3BT0A 4M6OH 4DKFL 4U6VH 2UV3A 3ALWA 4PJHA 3WY1A 3NA4A 4KO9A 2HX7A 3QZBA 1YEHH 5JQHC 3BHBA 2HSIA 4GLRI 1ORSB 1BQUA 1QI4A 4P2OA 2UZYA 2YD6A 3VYPA 1FZJA 5FA3B 3ENEA 3DVGA 3L4UA 4M7KL 2YUXA 2KERA 3FRPB 1UD3A 2FK9A 3WNIA 1EIBA 3HLAA 5AW5B 3OKLA 5F0PB 5AW0B 2MPAL 4ONHA 1MF2L 1TF4A 3IJHB 1W15A 2Q7NA 4ZTPL 1CK0L 1U33A 1XB8A 1WISA 4OV6F 4W4OC 5CILH 4EI5A 1U3NA 2NW3A 1XBRA 3MLXH 1U3YA 1UVQA 3IDGB 3MO1B 4L5FH 1IVLA 2F08A 2DM2A 3GINA 3EYOA 3O0RH 5F89B 4ZW7A 3KDMB 3QBTB 2WB1A 3T3PB 2X70A 2Z8SA 1BBJA 4MQ7B 1G1KA 3FW6A 5F1OB 5F3BB 3FB7B 3QUGA 5CP3H 1ZGLM 1TEYA 4Q58C 4R9HA 3S2CA 3NABL 2M8XA 3MGTA 5CCJA 4PFEA 3SO3B 1O6VA 1UQSB 2RQEA 2A6IA 4UDUA 1NUNB 3VH8B 5CEZE 2BWQA 2DEXX 3SDDB 5I19H 1IC4H 4JDVA 1CXHA 2O6FA 2IPTL 3QH3B 5LGHL 4NKOB 4NQEA 2PLTA 4TQEL 3FTGB 3V0VB 4ZPTB 4G1MA 1IQWH 5C0JB 4GUOA 1F8TH 1T1WA 5HHVH 3LMJL 2HTKC 5EZJB 1CWVA 1I9EA 2CGRH 2NY1C 4XAWH 3B2UD 4WDIB 1EBPA 3N50A 3D3VD 5F6HJ 3U0TA 1XSKA 3AS3A 1FG2A 1FYTD 3Q01A 3MODL 4HWZA 4OB5L 4WLCA 5BVJB 5I6KA 5LGJB 5ISZE 5HHQA 1X4ZA 2A2QT 2WSPA 2NNRA 2KMWA 4I9WE 1BJ8A 2YMXH 5DJ0B 4APQC 3WV0A 3VDBA 4C4KT 5B7MA 5CR1A 5K9JL 3GMQA 1RIHH 4CVZB 2YUZA 3HG2A 3KXFB 2AABL 5ETUB 2CBOA 3UOAB 4I13B 2CU9A 2J5LC 4RRPG 2E7DA 3RGVD 1PLAA 2BFVH 2Q3ZA 3QZLA 4HK3J 4GY4A 4PJ5E 3MUY1 4PRPB 1RUQH 4N9GB 5JIKA 5LCVA 4GAJH 4NQXB 2YWZA 5EU4B 4PWIA 3WTSA 4DW2H 3M7FB 2PR4H 5JW5A 4C57C 1MVUB 1M56B 2K6ZA 4JY4B 1EZUA 1OZUA 1MZZA 1RHHB 2IH3A 4QMEA 3EGXA 4F3FA 1CLVA 2WO2B 4Z7WA 4G42A 1NGPH 5I8EA 5LBVA 1PX8A 4QDGA 5K9QG 4KKAC 3BAJA 3P02A 2IDTA 4YSDA 2B16A 4OFYA 1HHJB 1GH7A 2QQLL 5D1QE 2R83A 1U8NB 5EOTA 1GHFL 1IJ9A 1E28B 1UJ3A 1OAYH 3FN9A 5CKGA 4N2BA 5AW1B 3NEEA 5C08D 3WIAA 2AGJH 2DLEA 3REVA 3W5MA 4WO4D 1DJSA 2OX5A 3EJTA 2IALB 4QR7A 4QHUA 2C9UA 1KFAH 3WKPA 1CLCA 5DZLA 5CN1A 5JHMA 3HG1A 3ZDXF 4P2YA 3CSGA 3GIZL 5BZZA 4JB9L 1NBVH 2V3EA 1EEUA 5EN3A 4PJ8B 4QWWD 2ZP8A 1E6OH 5AL8A 3QWNA 1DFXA 3ARWA 5FW7A 5I18L 4X5WB 2BOLA 3BWSA 3EOTH 2CDEB 2D0GA 1T66D 2OJEA 5DDHB 3ZL4L 4WW2C 4R4FH 2JLPA 3UL4A 4RX4D 1CLZH 3GZKA 4JE0A 4XWOD 2ICWB 4HWEH 4M1DL 1O7VA 3AY4A 3EO1B 1AHWB 3E6HA 3UAJC 2KI6A 3S5LB 4G8IA 3RILA 1J05A 3ZZ1A 1MI5E 5GSRA 1NCDH 2P9RA 5EO1A 3TVMD 1YMMA 3S97C 2H9GA 1F6AB 3KYNB 3IN2A 3MLWH 4GMSH 1H15B 4GW4B 4I0PC 5EZOH 3TBWB 3M1BB 3WS3A 4OF5A 1XQ4A 5C0NC 3PL6C 5FECA 2VZOA 3ZKND 4C58B 3WUWA 1UWEH 4S11A 1ED3B 3QR1A 3VW3L 3F84A 2QR0A 1U8QA 4H25A 5HYJB 2NYKA 4MMXC 3IPFA 2DQGH 4CVXA 4MASA 1KCKA 5KVDE 1KT2A 4NQUA 1DQJA 2WBKA 4AEIL 3RDTC 3MX0A 5IVXF 4HJGA 5KYWA 4AJYV 2BNRD 1INDH 1KPUB 3NDYE 3UTQB 1WZ1H 4BM7A 4YL9A 4PU2A 5JW4Q 3QRLA 2FT8A 1YPZA 5D1ZD 4DN4L 4WWOA 2G75B 4RZCB 3B43A 1ZKAA 3OXRA 3MV8A 5IB3A 2Y7SA 3BRGC 1HJBC 4ZTEA 5CZXD 2AJVL 4G43B 2P5PA 4ZMYA 1BZDA 3D2TA 2EH8L 5TDNB 4Y16A 3RL1A 1HL8A 2DQEH 1XWVA 2DY2A 3MZTA 1CS6A 1DBKH 4WU5A 5F6IC 2AQ2A 2PPEA 3HC0A 4HIXH 4YSUA 3FO1B 3RWJA 1L9SA 1HSBB 1UVQB 3IDGA 5IJDC 3ULUD 3MROB 3FFDB 2PTTA 4JFVA 1HHJA 4GKNB 4CL7A 3DMMC 4HLJA 1DCLA 3JVGC 3SPVA 5DD6A 2F53D 5J6HB 3QIBA 1WD8A 1PJ9A 3VWKB 4L4VA 3PWPA 3QEQA 4RMSA 2OYLA 4CC1A 1J10A 3LS5L 4PRAB 4V1DB 3KR3L 3BSGA 4ZD3H 1K4CA 4OVVA 4PJEF 1PL3A 1O0VA 1K72A 1G7HA 1QAWA 3IKKA 3ZGHA 4MA1B 3EOBA 4Y19E 5BXFA 1A3LH 2WBWB 2YMTA 3CV5A 4AZ8B 4B7LA 2NRDA 3NIGB 4GKZA 2HN7A 3WNMA 2UY7B 5DQJA 3AQXA 2YRBA 3UROR 4IRJD 2K4AA 3QAZC 3BYTA 2UYLB 3NN8B 4H0HB 1IBBA 3C60D 3B7YA 1BEYH 3BGMB 2EXYC 1IEAB 2QQNL 3VFMA 5AOIA 4UV4L 2H26A 3KW7A 2CK0H 3QO1B 4NGHH 2XWJA 3C5ZB 4NXSA 5JW4M 3S88L 4H8WL 4GW5B 4JFQB 1VFAB 5T1KB 5KAQG 1KPVB 2ZOKB 1E6OL 1Y07A 3C6LD 1LHZA 4WEBH 4JO3L 4ZOAA 1ZV5A 4LSVL 5FHBL 2BS8A 5L8LB 3JWDH 4S1DC 4C47A 2EIMB 1KCUL 4PPTA 5E1IA 2FX8H 3V4PA 2OJ1A 3ECBA 5IVNA 4A68A 3GSOB 3S7GA 3K2UH 3KCWA 4HX1A 4UOJA 3D08A 1CIUA 2NR6A 4BGLA 3VSQA 1A2YA 1GA2A 4PJXA 3G5XB 7TAAA 1FO0A 1BAFH 5I71B 4CKQA 1ZTXH 3VD4A 3ZUNC 4P5TD 3HA0A 1M7DA 4Y9EA 1BMGA 1G1CA 4R96B 3CU7A 3LIZH 3U6XS 4S0SD 4NQEE 1XGUA 3UAAA 5F7KC 3X3GH 1JRHH 1A7NL 5D93C 4M7KH 3SN6N 4YVNA 3U25A 2NY7L 2L4OA 1F41A 2J57A 1DVQA 2EKSB 4JY5L 4P3DB 5K93A 2GTQA 2V37A 2BS9A 3EFDL 1RZ7L 3I3DA 4YHKH 2PPDA 3HHMA 3RAJL 3EF7A 3HZKB 2YPLB 1QHPA 5GRXG 4D8PA 4JPIB 1AS7A 3BH9B 2OMNA 5C08E 4M62L 1LEGA 3WIFB 3Q2WA 1CQYA 2X4SB 5DTFA 5BQDA 5IFHH 1IGFH 1AQKL 5AAWA 3ZDXE 4NKDB 5CP7B 1TTUA 2ICES 3UABA 2YBRA 3Q05A 2J4WL 5I1IH 4G3YL 4GOSA 5E2VL 3STLA 4HH8A 5GRVK 2XOTA 3WNPA 4PLNC 2Q5BA 1MG2C 4KTDL 4LLDA 4JPWL 4JFXA 3CH1A 3DURA 4LGPB 5E2UL 5E8DH 4FQHB 2OQJA 4UF7C 3T6ZA 1XZWA 2ODIA 5H4ZA 3ERXA 4PJBB 3F6JA 3QHFH 3X12A 3SYQA 5ISZD 4NQCE 3JTTA 5EU3B 3SBPA 4HAKA 2FBJH 3UBXA 5EWIH 3X1BA 3AXLB 3GS4A 1TZIB 4PJDB 5HY9B 2CA3A 2C7FA 3VFNB 1OTTC 1J1OL 2AEQL 5FB8B 4ZXBC 2YQBA 4XVJH 5PCYA 4UQDA 1HU8A 4DETA 4PJ7E 1NGQL 3L4CA 2XG4A 3C9NA 1UD8A 3UC0H 3UJIL 3CZFB 1F45A 3BCDA 3L5JA 1AJ7L 3U9UB 1QRNA 3NFNA 4L3CB 1ZRUA 3I74A 1MHPH 4PY7B 3NJLA 2IBBA 4OZFG 1D7FA 1PZAA 3QORD 1W0WA 4MXQC 3VB8A 4PJIB 4HEME 1JPSL 4FQCH 2VLJE 2FEEL 3H9HB 4GRMB 2V5MA 3PABA 2HB0A 2WLKA 3HBQA 5C0RL 1BQHB 2EZ0C 4U1MA 5IR1B 1WAAA 3OF6A 4XBPB 5ILTH 1RZGA 1MFDH 4ACPA 3LN4B 4G59C 1O75A 4NX0A 2A73A 4X7DC 4ELKA 1E5UI 5DFAA 4KTDH 3F04A 3O2DH 4YUEL 3BZFB 2WWKO 4YDIH 2B77A 4PJ8A 2EDBA 1UM4L 4UQBA 3IEAA 1GJUA 4I48B 3VMOA 4I5BA 1A25A 3VI4E 3PL6B 4Z95L 3IN0A 5FM5M 4J7RA 5CXPA 2E7LC 3UZQA 2Y22A 1UH3A 3DO4A 3JWDL 3VE0B 2ZXGA 1FIGH 2VR7A 3L5WB 4GI6A 3K2UL 3MLSL 4PWGA 5F21B 5G5DB 5K5YA 3VFRB 3CN2A 2Y2YA 3PWJB 4H2CA 3K91A 2ESVA 1GY2A 2YJQA 4HKZB 5HI5C 4ZTPH 3MV7D 1SM3H 4ZOEA 3RIKA 4DIXA 5A16B 1HL4A 3ILEA 3EOAB 2NY5L 2VR4A 4G7RB 4HU2A 4L8DB 3IWVA 1I7ZB 2UXTA 3FQ4A 3I84A 4HKXB 3NPZB 4YHYC 1AGFA 2ADIB 3FH5A 3KBHE 4Q4EA 4NIYE 1UGKA 4FMFA 1ZHNA 4WKZB 4H88L 1JPSH 1NQBA 3AROA 3HMXL 5ESVA 3KH3A 3PLYA 3QORA 4PJEB 5CKAA 3ULUF 1C8PA 5GRZA 4MGXA 4ONFH 1IC7L 1LO4L 3VFNA 2WW8A 3VI3E 4CBPA 3NEXA 3NMEA 4MD4B 4H5SB 3E38A 4H8WC 3HG4A 1TTAA 3CPUA 1I3RA 1VESA 1E9QA 1XTMA 3WEBA 1F0LA 2HAZA 4QHKJ 4BUQA 3SY6A 4Y5XA 1NEZB 1KY6A 3IJ7A 4PB9L 4UAOB 3VD2A 1FC2D 3ZTNH 3E3QE 3BT2H 3D4YA 3IJSB 3V0AC 2LV4A 2CCLA 4O58H 5CJ8A 5C86A 1HE7A 3N2JA 4LLDB 4ZPTA 3ZT6A 4E41E 1ZD6A 3L95A 5L0QB 2ZYIA 3MJ8A 4GW1B 5C7XH 1RERA 1KLGB 3MOAL 4NNPH 3HCVB 3H7LA 1J8HE 3LX9A 3AM8A 5DO2C 1A7PL 2E76C 3SDDA 3BPOB 1W9XA 2BP5M 3V0IA 3N44F 4NPKA 4WUKL 1QOKA 2CBMA 1IKNC 4AG4H 3OAYK 4G7SB 2D03H 4JO5A 1ZV2A 4AVIA 2OK0H 4KGLA 4JGNA 5GRYA 2E27L 1RZGB 3EGSA 2CM6A 3QHTC 2D2OA 4N6RB 4ZS7H 5AAMC 1TQWA 4XCNB 1QBAA 5FC9A 3UZEC 1G7IA 3AU0A 4C83B 4IBUA 1I53A 4JKMA 5KOMC 3S96B 4J3TA 3AFLA 3GM8A 3QR2A 3D85D 4XMXA 5FW8A 3NCWA 1KZQA 3ULVF 3OKLB 1NGYA 2BY2A 4JVPA 4NN5B 4XNBA 4PV8B 1IAMA 2EE2A 5CEZL 4N2IA 3DNKA 2BO0A 2XRAL 1BV8A 5E94A 4CJ1A 3ECBB 2G3NA 3EDKA 4XOCA 3TM6A 3ZE2E 2WQ8A 5HDRA 3MV9E 4XCFL 1FL6A 2H5UA 2AEIT 4Y2LA 4P9MH 1OALA 1Z7JA 4YDIL 2Z93B 3VWJD 2P5EB 3LZQA 1UZ6F 3WLBB 1J0IA 3AQYA 4GW5A 1IIKA 3HZVA 3KHOA 4WO4B 4KVNL 4OZIA 1AR1B 2NZ9C 4WUUD 5F0JB 5K9OA 1XH0A 2O30A 4F2EA 1BYOA 2KLTA 3RX5A 2AJZA 5LCVH 1T03L 3ZL4H 1BXAA 5C1MB 3NPSC 4JFPA 5IF0A 4PJFE 3CJJA 5IM7A 1DVSA 2ZOLA 5K9OB 4Z0XA 4K5PA 2DI8A 3QQNA 4ELMF 3X14A 1X5AA 2Y5QA 5BZDA 4EZMA 5CLWA 1DO5A 3TS8A 4R8WL 1NCDL 3WLBA 3D85B 4IKIA 5I1CH 3BFQG 5CD3A 4CBZA 2R29A 1EO7A 1OP3H 3WFBL 5CJOL 4UQIM 1RU9L 4LOEA 1E4XI 1GSMA 5BS0D 1QLEL 2A4EA 5DUBA 4BFJA 3P4MB 4FFTA 5AQ0A 1MQ8A 4FNRA 4ZO6A 1QPPA 3TBYB 3HPLA 3Q44A 2HJKB 4ZFFB 2M1KA 1JFQL 15C8H 5DUBB 2FJGA 3EYVA 3WN5B 3F05A 1PG7L 2ZOTA 5ICUA 4UM9B 2ZNWA 1WBZA 1A64A 3KNBA 3L7FB 3S0PA 1EQWA 3L6FA 3L1GA 5IJKA 1WQVT 5JR1L 4B7IA 5TF1L 1S7VA 3GLEA 4YHNA 3TBVB 4IDJH 5JYLA 1TPXC 5T33H 4OJFL 2R0WH 4ATWA 2D7MA 1KJ2H 3OKDA 1F6LL 3MV8B 4DZBA 4RGNB 5IW3A 3MFFB 1CFQB 4TQ8A 4ZRGA 1HQ4A 2R1YA 3DX6B 3SYPA 2UUDK 3T6QC 3W11D 2XN9D 3GRWA 5C2BL 1TETL 3CXDH 4BEIA 2ZOOA 2ZXEB 1NCBH 3MX0B 5AYQA 1CQKA 1XXFC 3WJMA 2BNUA 3P0YL 3PV6B 3UAJA 3NIGF 5HGAA 3WMPA 4DKFH 4JFHD 3TYGL 1D5ZA 4XMPH 4WNSA 2R0ZL 2FGWH 2QSCH 2EE0A 3BKJH 1SLUA 1KNOB 4L23A 1MEXL 3LPFA 3NCYP 2VC2H 1JWUA 5F1NA 3RA7L 2X0VA 1NEZA 2QGBA 3RHWF 4QAMB 2XQBH 2WWKT 5LO7A 2JVUA 3CDZA 4JO8A 3ZQXA 1CTNA 2K8QA 4RMRA 2UWEB 2MIZA 1JGUL 1XFPA 2ENSA 4EN3D 5A2LH 5GZND 1LEIA 2OW7A 4HIXL 5JHBA 3CVHL 2D7NA 3L3IA 2AQ3A 5E4EB 4MJ6A 3IMVA 3HNTL 1BDYA 4PVMA 1G7HB 1BCIA 1G9HA 1TTCA 5IVZA 5C0AB 3NGBB 4O2CB 1SDDA 2IG2L 3BD4A 3VG0H 1RJYB 5F0LB 3TPKA 1JPGB 3BVWA 4LOFA 1AZRA 3KGSA 4PRHA 3G6JB 5DD6B 1NIFA 4G80A 2OSWA 4MB3A 4I87A 3VI3F 4IIZA 4XB7A 3L17A 4YDKH 3N1QC 1EUTA 2VDMB 1X9QA 4I2XA 5DK3A 3AWFA 6TAAA 4WU7A 1RVFL 2AJSH 3BISA 5EEYA 4URTB 4KOCA 1YUKB 4CN6A 4NDMB 1JOIA 4M6MH 2XV6B 1T2QH 5GJTH 3ZIMA 4YC2B 4ETQB 4N8UA 2H3NA 4DOHE 3D4ZA 2EIDA 2Y5EA 4JO4H 2VN4A 4U7KA 2DYPB 5IOPB 1YPZB 4FA7B 3UAJD 3MJ6A 3TEUA 4JDTH 1OGAE 1T7ZA 3S37L 3N85H 2K6YA 1L9OA 1ZCRA 3OKYA 2NY1B 3OGCB 3OMAB 1KBGH 1ZXQA 4Z7UB 5HGBA 2VQUA 4R7DA 3RNQA 1KULA 5KWYC 5JIQA 4LVEA 4PVBA 2UZXA 3RFZA 1MNUH 2QHRH 2DTSA 1L9NA 1ED3A 4GRMA 3BUBA 4KXCA 4ZUVA 4PJIA 5BJTA 3HUJE 2XXFA 5F9WC 3RBGA 4M8UA 2GQHA 4LVHB 4OIBA 4LU5H 1H3GA 3CDZB 4OCMC 5J0BA 4L3CA 1F13A 2OTWB 5JR1H 4RQQB 1BWWA 4XNQA 4XXDA 1TQBB 3U1PA 4A7GF 1CT8A 1UASA 4TF4A 5GRUH 3S8WA 3HBZA 1V10A 4JM0A 2PW1A 3LRLA 4O4YH 5IQLA 1F42A 2B5IB 3V6BR 4DGYH 1D6VL 2P49B 3FF8A 1M9SA 2J25A 2WXKA 3K7UA 4H0GA 1OF0A 3DWTA 4L3ED 2X38A 2VL5A 3SKJL 4FG0A 3B2VL 2C1OA 3IAPA 4ES9A 2Z1KA 4KXZH 3JTSB 1CU4L 4KJWC 3RA7H 2EO1A 1DQMH 2BJML 3GS0A 3B3IB 3T4YB 4M6OL 2AEPH 1JWMA 4HA1A 4LQFH 2J8UA 3Q3GB 4X6BA 4F7MB 2MCAA 2I25N 1MHPL 4IBSA 4PJXF 5GS2H 5D7JA 2YHGA 4KK9C 1JCVA 2NR6C 1BVKA 3KNBB 4AL8H 4OV5B 4OZIE 5MEND 3AG2B 5FWRA 2YO3A 4Q6YA 3P73B 5DC0A 3KLSA 4XI5D 3CVHH 3QJVB 1HIML 3R06A 3V4LA 4FFVD 1IGCL 4LCCA 3GMNA 3HHSA 4GH7B 1LYQA 3BKCH 2B4CC 3ZE1F 4X8GA 2FH8A 4BKLB 5KVDH 3TZVC 2XTJE 4U1GB 5I15L 4OCNC 2WLYA 5IBUB 3CZFA 4PCSA 1JYXA 4QRRB 3WTTA 3VFOA 3FUIA 1JGEA 1CO1A 2GJRA 1DHKA 1T0PB 2PCFB 4MNGB 2ESVE 3EYSL 2Z9TA 2LFEA 1MSPA 3BZEA 2NZ9D 1USQA 2HG0A 4NO0D 1WAEA 2A6JB 2ZTBA 2I32A 3D05A 4LKCB 4XO3A 4WI7A 4HIPA 1U91A 4MXQD 2V6HA 3SDDD 1M7DB 3HG1E 3C08H 2EC9U 2BDNL 3B2DC 1VGEL 1W8OA 5IFJB 4NYLA 2EUVA 2DV6A 2OMVB 3CFJB 3MBWB 3QJHA 3MJ7B 1YYLL 4GEIA 3TV8A 3BAKA 3V4PB 1OT2A 1S7XA 2UZPA 5ICZB 4BZ2L 4KTGA 1CXLA 1CL7H 1FYTB 2ZOKA 4MJHA 4NFDA 5JHDE 2RTTA 4XX5A 5FGBA 3EW3B 5FHBH 3WEXA 4NB7A 5BMFL 3PDOA 4LSRH 3P3RA 1BFVH 2FX8L 3FTGA 4UWQB 3WJJC 1KXTB 2NXYD 2NX5B 4W6XB 3QO1A 4E9QA 2D3NA 1TLMA 4IK6A 1XGQB 5GS1A 5DR5H 3TIDB 2QT6A 1VADB 2BVPA 3OTTA 1I82A 1UQSA 2FEDD 4PRPD 4PJGA 3TBSA 4CW1B 4D8OA 1NMAL 5DZPA 4GQQA 5CD5C 2EDNA 5D5MB 2WKOA 1CGXA 2MOGA 1HZKA 1SHMA 5DZVA 3LEYH 3WYRA 1GS6X 5B8CB 3G08A 2YN5A 1G6VK 3F7KA 3WE6B 5DD3L 1C12B 1QLEH 3M07A 1TQVA 3CDCA 3LRSA 3QNXA 1MCDA 4WV1B 5CN2A 5F3FA 2QSTA 2ZXDA 5BV7L 5J1TC 3S48A 3HTLX 1OLZA 5FA4A 3SKMA 3PWPB 3QEQB 3OSVA 2NY6B 1SHXA 3DXAB 1AS6A 2C9RA 3BQUA 1BLIA 3J07A 5CF3A 5IEKB 2CUMA 3MCKA 1L7IL 4LOVA 4UQ2B 3OX8B 1WC7B 2EXTA 3KYOA 2LE9A 4QRUB 4Y2NA 4PGBA 5KYYB 3R4DA 4TUKH 2C3WA 4UB0L 4DP8X 4UT7H 4K2UL 3BUYA 3MRHA 1QLFB 4QKXB 4Q6KA 4MQXD 2GUYA 5IROC 3FN3A 5D71L 1DVFD 5TDPA 4L1SA 6PCYA 1XIWA 1Q0YL 3W56A 3NZUA 3OXRB 4JJHA 3WY3A 4FULA 4H2AA 1N4XH 2CDGB 2P5WD 3QFJB 1KCSL 3FHAA 4WY7H 2G9KA 1ZK5A 3OF6D 3RX7A 5F93C 1PX4A 3CC1A 3HN8A 4FABL 1KIPA 4HMEA 5G4NA 3TV3H 1HILA 4NO3A 4ZQTA 3SBWC 1KT2B 1OIOA 1LE5A 3CBKB 3SE9L 3VGFA 2WAHA 3QJQB 2LAAA 4MLIA 3UJIH 1C8QA 3BYYA 3ZE0B 2CQVA 1LMIA 3RWCB 2E9BA 2I07A 4JNXA 4NC0B 3UBHA 3OLIA 5F97E 1D6EA 3EO0B 3T0EE 3EJZD 4OFPA 3L3HB 3Q2LA 1F4YL 2AERT 1TZAA 4HPOH 3IKCB 5IVXE 4LCCB 3SPVB 1G0YR 1YMMB 1ODUA 1QEWA 2DAVA 2XIDA 5DK0B 5C0RH 1JV2A 4EI5D 1G7IB 4BIKA 3ZKNC 1VEMA 4ZUWB 3VG0L 1Q9OB 4TSAL 3WKNA 4X8CA 4FQJH 3KW8A 5DDHA 3GSNA 4OGXH 3VU1A 5C6TL 4MX7B 4ICWA 3TESA 1OSPH 4G82A 1P84K 2MEJB 4DAGL 4DPAX 4I18B 4ZSOE 5KSBA 3ULUH 2DWXA 2E5EA 1GZHA 1T04A 4CDGC 2L8AA 3RTLA 4ZTOL 2JMRA 4FLRA 1MHCB 1XIWD 3RUGE 1XF1A 2E7LA 2O26U 3R7QA 3T0DA 2EP6A 3B6SB 1TQBC 2Q6WA 3SD2A 1HXYA 4EMZA 5MEOA 2XTSA 4MQXC 3V0WL 1IUZA 4YIQB 1QWHA 2ED7A 1UJ3B 2QQQA 3CLEH 3HC3H 1IC0A 4FXGB 4MZIA 1D5XB 1JFQH 4ZUUA 3O8XA 4MDJA 4P5KA 5E2UH 4RNRB 3QWQB 5E4AA 4Q97A 1JV2B 1R0AL 3BAXA 3D06A 4D0DA 5DD3H 3LVTA 3CZUB 3RGVA 4YC2C 3EDJA 1ZWIB 4OD1H 4PRHD 4GG6A 3AM8C 2E75C 1B9ZA 1R75A 3ASOB 3GXMA 3ROLB 4WFED 5IQOA 3OR7A 2OSYA 4PJEA 1UXSB 3FQRB 2YBGA 3BKMH 1J0KA 2NPLX 4JHVA 4NZTH 1EO8H 2JJSC 1F97A 3C8KA 2B1AH 1ZE3C 1BEXA 1VFUA 4N2NA 3T0VA 2HKHH 2CR0A 4GG8A 3ARBA 5CWSA 2GCYA 2VYRE 3WFZA 4OQTA 15C8L 1G6RA 3DUSA 3P0YH 4HP5A 4OZGB 4XPGH 3FU6A 3B56A 4LDLB 2BOBA 5T1KD 1DJGA 4WWNA 5C6PB 4NBYB 2VDPL 4HWZB 4DGVH 4F8QA 1D6VH 5BVJA 4OZIF 3X1GA 1LP9B 1W72H 3T8MA 1ES0A 3PWJA 4WDIA 5EC1A 1T66C 3QC6X 1UATA 3MRHB 3HG1D 4KROD 2X40A 3D9AH 1NBYA 1RURH 2H32A 1N18A 4KBPA 1AP2B 5AVQB 3BP6B 4ODXA 5ILTL 4JRYB 5JXAH 4RAVA 1J5CA 5AVUB 3OJVC 4QRUA 2D7TL 4L3AA 1CU4H 3Q6FA 1T89A 2XTJC 2AJUH 1G7LB 4L9DA 4LDEB 1MUJB 4OZFA 1BVZA 4W68A 5D55A 3K74B 3GIVA 1R1CA 3SKNB 1HJCA 1KTLA 1JZJA 4C54A 2IH3B 4M7LH 4OD2A 2QSCL 1AI1H 4JY4A 1II4E 2YAFA 3JWOC 1OVZA 1BZ7A 1SDDB 4MJIB 1WRFA 2O5YL 1XL6A 3K71A 4A2FA 5KZCD 2HRHA 2ROXA 4HQQL 1D9KB 3VFSB 4HK0B 4OUUA 4Z18A 3MV11 1BGXL 4QRPD 3F12A 1CE1L 4Z3JA 4DGIH 5JA8B 2NZ1A 1FFNA 1E2ZA 1MCWM 1N10A 3JTBA 4LBEB 4ZODA 3VRJA 4CMHB 5C0DB 1QD0A 2W95A 1WFNA 3O6LH 3FH8A 3VD5A 4FS0A 4F7CB 1QRNB 1PZ5B 3NFNB 4WNQA 4BWWA 4H7VA 4BZ1L 3VI4A 3NJFA 2AK4E 5SWSD 4J2XA 4HMDA 1U3JA 3PV7A 2F7IA 4E5XG 4LASL 1YNLL 1DJWA 1MFBH 4MMYA 3IMBA 2E9JA 4P3WA 3KCPA 2DQIL 1QR4A 2FYYB 3S3BB 2W0PA 2ZE0A 4O5LH 1EFXD 4G6FD 2GJ6E 5GS0L 1RUPH 3QT2A 3H4FA 1U36A 1H9VA 3F7YA 5DRNB 3O3EB 4JMXA 2IVFC 2JKIS 1JGLL 1I8KB 3UAFA 3RYMA 3S3JA 3T2LA 4M93B 1TZOA 4FNLL 4ALAC 5L2KE 4X7EC 5IESH 4G71B 4U3XA 1T0NB 2IANB 1DVTA 3IDYC 4HH9B 2W9DL 5JOFB 2JJTA 2ZCHL 1QKZH 3FAWA 2M83A 4APQA 1T83A 1B9KA 2GI0A 3WFCL 3V9FA 3ILQD 1HZHH 5HHMB 2X70B 4MQ7A 1WA1X 2BH0A 4ODWA 1CDBA 4IS6B 4LU5L 3BZEB 2XWBA 4TNWF 2JV6A 4RGNC 3QDMB 4NC1E 4MNGA 5DRWA 4DKEH 4YFLF 4Y5VA 4GMTH 1OT1A 4JE4B 4CSTA 4GYBA 1J5DA 5T3ZE 2GFBA 2IH8A 1CF8L 3MLYH 3U0PA 3MRPA 2H0EA 3OJMB 3TBYA 5DMIH 3R06B 1JV5B 4OT1L 5HHNB 5IBUG 3UTSE 1FVDA 4H20L 3DVIA 5FF6A 1IX2A 4P2OB 2BCMA 4P9ML 4U1NA 3T0EC 2J5LB 1OARH 2VXTH 2HZHA 2WQUA 2HLFC 1KBWA 2IGFL 4NJ9H 1CICC 1YEDB 1TQCB 2NXZB 4MAYC 2R69H 3GMMA 4D7PA 1WAAF 4Y2OB 4Y4HC 4PJHB 3VXTB 4FG6C 4OJAA 2R1XA 4Z7AA 1AMXA 4F7EA 4Y4FA 3FAXA 4RFOH 5C2BH 1R3LB 1TU2B 2H6OA 4KAQL 1Z2KA 3ULVL 5D2LB 1OAZH 5T5FL 3RRQA 4H8VA 1C5CH 4KNTA 1NLDH 2HT2C 3NACL 1EJ8A 5IQNA 2NX5A 4LRNH 1SJHB 1KXTA 4NI6A 1WT5A 3K6NA 2J6EA 3QXWA 4HETA 1LDSA 2VKWA 4X7SL 1AH1A 1YA5A 1QKZL 3HB3B 1JNHB 3TFBA 1XGPA 2C4FU 3AW5A 4Q2ZA 3D0LB 4N2MA 3WFCH 5JORB 2I5YH 3D2UB 4Y2DD 2WXQA 2R7EB 4E68A 1SJXA 1IQDA 3DLQR 1BPLB 2ILLA 3NZHH 4MCYA 1J7VR 2YC1B 4E9WA 1BW8A 4AH2B 4K15A 3HE6A 3EH3B 2HN7B 1BGXH 5GSRB 2EEXA 1LO3H 4JPKL 1OY3B 4JHWH 5SX5H 1K5WA 1T20B 2JKJA 2D9CA 3UH8A 4B96A 1XDTT 5BXFB 1V3JA 1FCCA 1NA8A 1V27A 2YEVB 3ESMA 3DKHA 1VGEH 1YEJL 4NN7C 3SDCB 3IMUA 5GZOC 3DIFB 3CHQA 1YEIL 3O6MH 4OF0A 1MRFL 1KSRA 3SGDH 4M7ZB 1G9ML 1A9VA 1OB1A 3CC5A 3TVMC 2NY2D 3UTTE 3T6XA 3VAEA 1MCSA 1BVLB 2PWHA 3GRWH 4MA7L 2VO5A 4UINL 1TJGL 3W82A 5C0BB 4R5XA 2P42B 1OTSC 5IOPA 5DLML 1CURA 4RISH 1HHKA 1OAZL 1IFHH 2RAMA 5EA0H 2FL5A 3U6XA 4KUCF 3RPKA 3KJ4C 2H32B 4B5EA 3U36B 1E8YA 2NNAA 3NRPA 4NZFA 4KHXH 2XWDA 4LKXB 5INDA 2G9HA 2KZBA 2X4OB 4GKOA 1TYRA 5MP6H 1A14H 1X5MA 2VR9A 2XXMB 4JM2B 1HEZB 4JKLA 4Z0BH 4G7QB 1S9YB 4AYID 1SOXA 4DPCX 1H3WM 4NQED 4X0NA 1PY0A 4F3FB 3E8UH 3IFLH 3V4PH 3DOHA 2B5IC 4Z7QB 5CEZD 4L37A 1BPVA 2WN3A 5D1ZB 3C8KB 5EUOF 3CE1A 1FFOB 5FUCC 3SIKA 5HYJA 1GGYA 1I1YA 4PREB 5DD0H 3UFIA 3B9DA 3VFGL 1JZ7A 3EFOA 3M6DA 4UU9B 5DD5H 4HIHA 5DS1A 1CICA 4MAYA 4KQ0A 3L1FA 4HD9A 2AXFB 3UTSA 1FL5A 4IM8A 1EZLA 3ROLA 1T3FB 4L8SC 3PPEA 3CDGB 3LYRA 4MSWA 2X4PA 2GTZB 5I6XC 2P5ED 1BIHA 3MRQA 1DN0B 2Z31D 5DJ0A 1EMTH 1D7CA 1X44A 3LPOA 3P4LA 4R26L 3E6HB 5JUEL 4PHZA 2DM3A 5CP3A 2JI3A 2XYBA 2OAAA 4W70A 5JHAA 3GBLA 3ARSA 3VFRA 1T1WB 2QPEB 4K9EH 5T3XD 4P4RB 4KDVA 5B22A 1DL7H 3UCRA 2EYRA 4IBWA 3MREA 3PV6A 5T5NG 1SXNA 3UTTD 5C7ZA 4GAYA 3ETTA 5DJCB 3FUNA 2HJLA 3ULVC 3RZCA 4NHUA 3RB5A 1EJ6A 3KM1A 4F5CA 4NENB 5E6YA 4XRCA 5I8KL 2JXMB 3MDJA 5AWNL 3BAWA 3W0WE 1CGVA 5C0EA 4HUWA 4QHUB 5EEXA 1K4DB 2BZ7A 4ONGL 2DRUA 5DEFA 2GEQA 3IJEA 3WI9A 1SLWA 5IG7B 3TBBA 1F3RB 4XHJC 3BQUD 4LAJH 4JFTA 4UUJB 3HI5H 4XVUD 2IDCA 3LKNA 2R29H 1MCLA 4N2DA 3JUZA 3VSTA 4YE4H 2AV7A 2G3XA 3M7OA 3IJHA 5EF0A 3LKPB 4GINA 2PPCA 4M43H 3IKCA 2DPKA 1YHPA 5CSGA 3GI9L 1TVBA 4ISVA 3B9KC 1Q8MA 4YJZL 2WO4A 4ZDHA 1KIQB 1NBCA 3DHJA 1D6EB 5DZAA 5E99H 5C6TH 4F24A 1T4WA 1QSEE 1HCYA 2OMZA 3QB7C 5E4OA 5CILL 4QXVA 1U8PB 5FXCH 1BVNP 3N40P 5LG1A 5CJQH 2APWA 4PS7A 3TT3H 3WXVH 3C5JA 2QMKA 3V6OA 3BVDB 1EZVY 4G9FE 3BX7C 5EU3A 4NZRL 2A83B 4MJ2A 4YHML 1G6RH 2X1OA 2H45A 2Y0SA 4DZ8A 4Y4HA 1RUAH 3X2QB 1M2VA 2YD7A 2Y1AA 1TT6A 3U6RB 3U0TB 1K8IB 4A67A 3SGEH 5LVEA 4Y7MA 3O11B 1DDHA 4G8FA 5F7HA 4YSOA 4PJAF 3NJNA 4B0MB 3UO8B 5F44A 3SGEI 5EUKB 3CFKA 3D4GA 3K2MC 2KKQA 3FQXB 2JELL 2DQJL 1WF5A 2EYSA 5KBDA 5CCHE 3QVAA 4HWNA 4NM4L 4ENZA 5J11B 2R1YB 3O41A 4PV8A 5D8JH 3G6JF 4OZFH 1N68A 4MTMA 1BQLL 5HVWA 5C07E 3CFIC 4N1HB 3UZVB 4FP8H 4YLCA 2FT7A 4N24A 4WTZG 2XWRA 3ARBC 1IM3A 1TPXB 1Z5LA 2F54B 1JWSA 4S1RL 2ATPA 4IBVA 3GMRA 5CGYC 3WHE0 2PCPA 3OMZA 5BW7A 2JH2A 1OAXH 1QI5A 1XGYL 3KBFA 2WLJA 3QFDB 4L4VD 1TTRA 2YLHA 3HNVH 1JZFA 3IT8D 4TSBH 5D7LE 1CFSB 5IHUL 1B0RA 4J3OD 5HHOB 1DYZA 4Q6IB 4KK5D 2ZZUT 1CL7L 1PG7X 4DUWA 3ZSSA 4AYGA 4XB3A 5KSBF 1AANA 1CFTB 3VCLA 5E6ID 1S9VB 2FJSA 3ZR6A 2GSGA 2ID5A 2BRQA 4J8QA 3SQOL 3FFCE 4FGMA 4ELMB 2I60H 1HINH 1Y0LB 2KHAA 2WNKA 2DI9A 2FD6L 3V4UH 1U8JB 4ZO7A 4HSCX 2BDNH 4GG6E 5FO8A 4OQTL 2CMRL 1JGDA 1TCRB 3ALPA 5E9DD 1A6ZB 1Q9WA 6FABH 2YRPA 4GKZB 5H94A 1J8SA 3AG3B 5EBWB 5HI3C 4ES8A 2ZKHL 2QKIC 5E6SB 3QORB 5T1LB 2R27A 2VGLM 1BFOB 3QJFA 3VU2A 4ENED 1R47A 2NY0D 4JG0L 2HTLC 4M7JH 5F96L 5D6DA 1EHLH 4C4KO 3VXQA 3C5XA 3QWOA 2JB6A 4U6VL 1VEPA 1BQ5A 1QTSA 3KMDA 3FTZA 3GGWB 3BXNA 3IU3A 1T6BX 3O3DB 2A7BA 5CZRA 5DD1H 5ABZA 1DVFC 1L0XA 5JTWA 4FMVA 3ZMRA 5GPRA 3T65B 1NCIA 5IMLA 2VN3A 1QNZH 3ES6B 4W9JC 3APMA 3QUXB 5EO9B 3KAAA 1UB5A 3H9SD 4NO2A 5DJXB 3EJRA 4X5RA 4NO0B 1T0MA 4HUVA 5F7FA 5E1HB 5AOMA 5I19L 5DLLA 4MXVE 5DHVB 3SJVE 4HJIA 1SYVB 2B0SH 2D7PA 3LRKA 4F80A 1P2CB 2WWOA 3O9WD 3AREC 5LG6A 3CG8A 1YEWA 1NCCH 2PPAA 2VZUA 4G43A 4TQIA 1QUNA 4BFKA 5GS0C 1F5WA 1U58A 3O6FA 1BM7A 2WYIA 5GS2D 4FQXB 2DJ4A 2YZ1A 3C6SB 1E6JL 3CSFA 5CJ5A 3EJYC 2BSSA 4NBXB 3AWGA 4HUKB 1PGRB 1LO5A 4U1HB 4NQDE 3KLQA 1LP9F 3NH7H 3KBPA 3WCYA 2Q7AA 2E4FA 4O9HL 1PLGH 3GSNL 4CSPA 4YXKL 4ELKB 4O02H 1B88A 1UURA 1DQML 5F9OH 3LKRB 3ZO9A 4DVRH 1IL1A 2L7QA 3JUYA 2YD5A 1CXKA 3W1ZA 4EKJA 3L3DB 2EXYD 1N2RA 4N86A 4MD5A 1E0OB 2DL9A 1FO0H 2BY1A 3H3KA 3WUWB 5IIEA 1D2OA 1QBML 2OTUB 3RVTC 3GT6A 2VLRD 2KLSA 1T5XA 3CWGA 4OZGF 2XC8A 4JAMA 3MRBB 4EOWL 1RZFH 3WS3B 5FR3A 1C16B 1EHAA 4QXTB 3LJ3A 4G6KH 3FFOA 5IMKB 2DMBA 4MD4A 5EO1B 1MFVA 5DD1L 2OSXA 3LD8C 2CKBA 2VSCA 2AXFA 2QELA 5DJYA 3NSJA 2Y1VA 5D5MF 3W9DB 3OG4B 5F6HI 3GWJA 5JIMA 3RFZB 1U3HA 3FQUA 3T9WA 5F6IB 4E9RA 1DBAH 3DVFA 3LZNA 5HDOA 3IE9A 1RK1B 4OFQA 5FB8A 2A6DB 4PD4K 4JFSA 3RPIA 2NNXA 1J18A 4AJVA 3B9VA 3F85A 4KI5E 5KG9B 5FAAA 4AENB 3HNSH 1J1PH 3X17A 4K3HA 4OT1H 4PW3A 1TLKA 3WSQL 1L7TH 3O4LB 2IIJA 3EOAA 5E8PB 1QLEB 1DN2A 2ZKXA 1CBVH 4IRZH 3NYKA 3GBMH 3T77A 3RDTD 4OZHE 1AD0A 5EO0B 1IBHA 5IVXA 1BFOA 3HMWH 3QJFB 3PQYB 4OF3A 3O3UN 2FAUA 4LK4A 5KYXB 2Z91A 2K9FB 5DYFA 4AQAA 1YPZF 4XCCH 2NT0A 2AJSL 5D4HA 1IAKA 1BM3H 3TO4D 3UYPB 4I85A 1O5DT 1LNUA 1SJMA 1F11A 4Q56A 1LWHA 4GI9A 1CDJA 3VXUD 2CCWA 1MCEA 2BNQD 3FU8A 3PHOB 5F0MB 5C07D 1OEZW 4NAJA 1FRGH 3J7HA 4ODTH 5EEZA 1WS8A 1GVIA 1DLHA 3ORJA 2GIYA 3BZFA 1EEYA 5T3XH 2OMXB 3QEHB 1H8SA 3V4VB 5BV7C 4XGZA 4AVJA 2VW7A 5J6GA 1SLXA 1I75A 2TRYA 1YEGH 2EKSA 4P3DA 4W9EC 5LKNA 4Z8FH 2D3JA 2QPSA 2AV1B 4O2CA 1EAPA 5GGVY 4NQXA 4NRXB 5TDOB 2WCPA 1TITA 2OMTA 1TMCB 4PH8A 4EIBA 3MFGB 1TR7A 4LLWB 2JTDA 2Q1EA 2XWXA 3VXRB 3M45A 3KXFA 5ETUA 1FFQA 3ARGD 3AXIA 4G6JH 4F33A 3ZDYB 4OZ4B 3CXHK 1JVKA 1O9WA 3P77B 5ENWB 1N0LA 4LOUC 3WN6A 2KBGA 4JUTA 2XTJD 4FL4B 1OSZA 3EYUH 5TE4H 1ZA6B 5ERWB 5BVPH 8PAZA 1WPCA 1OSEA 2V5SA 4IJTA 5BO1L 4N20A 4JFFB 1KNOA 4BFNA 1E6JH 3G5VA 5DZJA 4UT9H 1WWBX 3MRRA 2F7PA 4LCIL 2HFGL 2MMXA 4KK9D 3WJMB 2AJXH 4FXKA 2DJMA 4DEPC 3MUZ1 4A6YL 4OF8A 5E2VH 5LBGA 4HLZH 2DBLH 2DDQL 2X5PA 4HJTA 4BH8A 4JM4L 1F4XH 3U46B 3MLPA 1CGTA 1YNKH 3SODB 5I1LA 4MNQE 4JVWA 3N91A 1UT9A 5CGTA 5B1JC 3CHRA 5EUKA 1KYAA 3U79A 1ICTA 2GY5A 2OJZL 1IC5H 3TBVA 4YHNB 5DMYA 3O45B 4FFYH 5F3BA 1JPST 4URKA 1U8CB 2VDML 3NPSB 4MB1A 5MEPB 3GSRA 5ID0A 5EIIA 1JNLH 3GUTA 3QG6A 4OU3A 3ZPDA 1ITBB 4F92B 1A4JB 2WLHA 2NSXA 4L0ZA 3SGKC 1U41A 3FFCA 3D48R 2J72A 4N25A 4DKTA 2MNJB 4HZ1A 1KEML 3QIBB 1TO4A 1VPOH 4FQ2H 4D8PB 1B4JH 3MRPB 4J4PD 4WHDA 3IDMB 2CO4A 3FOLB 4A2HA 9PCYA 2BP0A 4K9EL 1CDIA 5GZOA 4WKXA 2VDLL 1DQQA 2I7OA 3K46A 3S36L 4OW6A 3D50A 3BSZL 3TF7C 4GP4B 1FSKB 4WSJA 1UADC 1NM9A 1UD4A 5F9JA 1I4FB 3HFMH 3D85A 1SJEB 2KYIA 1HDMA 3QZPA 2OL3L 1VKXA 3QJZA 1ZDSA 4YAQA 3I02A 3QI9A 5JLZA 4X99B 3NA9H 3DX0A 5DHYA 5AKVA 3FYIB 4OCXL 3I6GA 3K72A 4R3SA 4JFDE 4RGND 4BFBD 2EDEA 1G4RA 2IWEA 1RJLA 1N8OE 3IS1X 5C09E 3UADA 4HYTB 2F8IA 3FU7A 1KC5L 4XZUB 3F7YB 3LV3A 4ALAH 3A47A 4NZUL 4QLRA 3UPRB 1KYOJ 1B3IA 2I9TB 1OTUC 1T22A 1RZKH 3KPPA 4HJUA 2FB4H 4JFQA 2BSRB 3N06B 1MJ8L 2N7SA 4Y4KB 1UD2A 2F19L 3ATEA 2OMUA 1M1XB 3GDBA 2FWOA 2J21A 4PBVC 4ELDA 4DNLA 2H2PC 3A4AA 4LCCC 1ZE3H 2GIMA 4LDOB 6FABL 5IB4A 1OAUL 3KPOA 4TLKA 3F6LA 3D6GA 4Y4HD 1NIEA 5AD0B 5D7JC 5D7KE 5FDWA 4P04A 2OYPA 2X42A 3O3AB 1IEBA 4OD1L 3VRJB 2VIRA 1B4JL 3KEHA 2QLVB 2N56A 1GY1A 4RFNC 2VLKD 5FWQA 2XQ0A 4KNQA 3ZU8A 2CJUL 5E23A 3ZL2A 1J48A 1QFOA 4IJ3C 4EXKA 3HI5L 5BS0A 5K59F 1GGCH 1T0OA 3ECVA 4DO5A 4MZ3A 3K71B 4IBYA 4OB5H 5T3XE 1MLCB 1WFIA 1T21B 1JDAA 4HZAA 4M1CD 3I9PA 1WZKA 1QRKA 2VLRE 2OSLB 2VISB 5AVVB 3L2NA 3MOBH 3R0NA 1M05A 3BMVA 5J6HA 4TYUA 4B3EA 1J5IA 4DN3H 4UOQA 3NSDA 1AQMA 4QRQA 3P9MB 4ONFL 5E2TH 1YEEL 2ICCA 2OLDA 4U6TA 1UFUA 4U1JB 5J06A 5ANMB 1N7ML 1OOAA 3QW9A 1NFIA 1XXDC 1RUQL 5KAQF 2I85A 2OL3A 3IDNA 3D7PA 2MCPH 4X7SH 4TV3A 4D0BA 3L95B 1NCWH 4L9LC 2WUCL 3EF4A 2HXAA 2NY1D 3IDXL 4NOBA 2HP4A 1E3ZA 1TEGA 3RIAK 4H8UA 4W6WB 4ZMOA 4YN3A 1A6WH 4HSQA 3LNFA 4KNSA 4LSSH 1CFNA 4KNUA 2D7TH 2YA2A 5FPIA 3AAZA 4ANUA 1S9YA 5LDUA 3IETB 3LN5B 1BF5A 4O2FA 1KPRA 4WQOA 3CIQA 3UTQA 1G6RB 3DUSB 4JHUA 4EI6B 5TE7L 1KCSH 4WY7L 5EIQA 1A7PH 1QLRB 5A2AA 2XZQL 4R2GC 2BIQA 2DMCA 3HI6H 3BE1L 2IV8A 4CVXB 3IJYA 2X2YA 3BP4A 2Q9OA 1T1YA 1E9OA 1UEYA 1YEIH 3O6ML 2R2BA 3QUZC 4PP2A 3EFFB 3IE4A 2BP8B 3A4DA 4U1JA 3REWB 3I9IA 1Z0NA 1J1OH 2AEQH 4MCZA 4GG6B 1PU0A 5A43C 3B7UX 4K7FB 1S5HA 2H9GB 3GJFK 5CAYB 3UGUA 1NAKH 5D7KD 1A3LL 3UYOD 2K1MA 2FX9L 2BRRH 4QRPE 3QC5X 1IGMH 3D0VA 1Z32X 2RGSA 4H8PA 3ZDYF 3HZYB 5D7IA 2ZCLH 4CADB 2NY2B 4WTQA 3CSPA 4QRAA 5DXWA 3HNSL 4WHYH 5LNEA 4QTHA 32C2A 3QAQA 3SE3C 1Y6NR 3SOBH 2WLLA 1NFDF 2WSKA 3VE0A 1ET5A 1O9VA 3KL0A 3T6VA 4BQ6A 5AW2B 5C07A 4GS7B 1B3JA 3K80A 4OCRH 5KN5A 3EUUA 4GRWE 1UUSA 2DQTH 2WYZA 2AI0L 2APTA 1YECH 2K45A 4FNLH 4U1LB 2EACA 3CFEA 1FZOA 2I9LB 3BLBA 4JQXC 1PDKB 2X0UA 4PD4J 4WSGA 3RKPA 1YY8B 1IQWL 4FOMA 4FADA 5DUMH 1WV7T 2V9UA 4NCDA 5DSCA 2H6PA 3MR9A 3KPPB 4J3OG 1SQ2N 5EH1A 2XZQH 2VB5A 1CPUA 1WFUA 2HG5A 4NKIL 3W11C 4Z95H 3B9KD 4LNRB 2E4TA 3UPAA 3OGOE 1FNFA 1CZ8H 4LQ1A 3TH2T 3EDEA 1RJLB 5H35A 4F1ZA 5EU6A 2L3BA 5MP6L 4U31A 1XSJA 2P4AB 4YO0A 4EDWH 1ACYL 1VENA 2DQDL 1JHLL 3EGXB 4P06A 2XZCL 1S78C 4AEFA 2X3CA 1GCFA 2Y9RT 1A7OH 2ZSVA 4CMHC 5B38G 1U21A 2D0HA 4LFHD 4QRSB 3AMLA 5EFIA 4S10A 4MA3B 4Y1AE 2PR4L 2CUAA 2J43A 4U1NB 1G9MC 2J8UE 2G2PA 4G6JL 1AQ8A 1JHTB 3GXTA 3CH8A 2R2EB 4O58L 2A6KA 1MKFA 4NZTL 4ZUTB 4OGZA 4QXWA 1ACZA 5GXBB 1GGIH 3B9AA 1PSKL 1PLGL 3GSNH 1DSWA 1ZHKA 1ZSDB 4AQ1A 1BLNA 4GB9A 4ZFOL 4I0CC 1MNNA 4WWKD 4YNYA 1V3MA 3QCTH 5BOZG 4NZJA 4NHCH 2AI0H 1JZEA 1OWWA 2AKRB 2WQVA