2J57A

X-ray reduced paraccocus denitrificans methylamine dehydrogenase n- quinol in complex with amicyanin.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tracking X-Ray-Derived Redox Changes in Crystals of a Methylamine Dehydrogenase/Amicyanin Complex Using Single-Crystal Uv/Vis Microspectrophotometry.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords AMICYANIN
total genus 23
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2j57A00
4DP1X 1J9QA 2XV2A 1E5ZA 2DYSB 1CC3A 1JZIA 2VSMB 1NICA 2W8CA 4A2DA 1KYAA 4G70B 2BHFA 2XXGA 3FSAA 2BWIA 2Y69B 1E67A 1ZIBA 5B1KA 2FT8A 2YAEA 2AFNA 2GSMB 3N2JA 4AX3A 2GC7C 4YL4A 3PAZA 3H56A 4UANA 4Q89A 5PAZA 2IDQA 5D4JA 2UX6A 4BWUA 4DPBX 1ILUA 1PZBA 2YAQA 4NERA 1SDDA 1OCCB 4AKPA 2HX7A 2BO0A 4E9TA 5I6PA 2MTAA 1SHWA 4HHWA 1AZNA 1PAZA 1WA1X 1GS8A 3QJRB 2CJ3A 4W9ZA 4YSEA 1X9UA 4UF7C 4DP8X 1JXGA 4DP5X 3IN2A 2IH8A 1W6LA 4KO7A 1AZBA 4ZK8A 3FU7A 4KO9A 2GI0A 3TASA 4JHUA 4RH4A 4A68A 2XX1A 1KCBA 1GYCA 1OE3A 1SNRA 2QDVA 1BEXA 1IBZA 4HIPA 4AI7A 2XLLA 1V55B 2CCWA 3X1NA 2VN3A 1OE1A 3FQYA 1WAEA 3DIVA 5AFAA 1XB8A 3ZDWA 2EIMB 2PPEA 4E9QA 1BQKA 2N0MA 1I53A 2B3IA 3QJUB 4JKNA 4G7RB 3NSFA 3SQRA 3UADA 1ASQA 3X2QB 4F2FA 2GBAA 3NP3A 2Y1AA 1ZIAA 2HX8A 2PPAA 2PP7A 3MX0B 1ET8A 3NJNA 2FT6A 4G71B 3T9WA 1KBWA 3NJLA 5A7EA 2YAMA 1L9SA 9PCYA 5I6NA 1NPJA 5B1JA 4NB7A 1NINA 4G7SB 3UGEA 3GDCA 2HX9A 5B3SB 4K9JA 3PAUA 3X1BA 5I28A 2QT6A 4YSCA 1GS6X 2R7EB 1MZZA 4DPAX 5B7MA 1A4BA 1L9RA 4HCFA 1CYWA 4YSUA 4G72B 4DP9X 3BVDB 1PMYA 1FWXA 5F7AA 4EF3A 3NP4A 2PLTA 4AKQA 5I6KA 4NAJA 3HEIB 4QLWA 5I5MA 2HZHA 3NJHA 1PZCA 3EF4A 2J56A 3UACA 1MG2C 2LLNA 1N70A 2CAKA 3PPSA 4KOCA 1KBVA 5FC9A 3FT0A 1BXUA 2FWLB 5I5IA 2IWKA 4AZUA 3NJKA 1FFTB 1BYOA 2BZ7A 3AG4B 3FU7B 1GR7A 1IBYA 1JZEA 3WKQA 1AQ8A 5I5JA 2FTAA 3CVCA 2VW7A 3PXLA 4KO6A 1OOWA 4YSRA 1PLCA 3UAAA 1ILSA 1JZGA 4DP7X 2WO3B 1ADWA 3G5WA 1A4AA 3IBOA 4N8UA 2NRDA 2P80A 1NIBA 1CYXA 2EIJB 2Q5BA 3NSDA 4CSZA 4DPCX 2XX0A 4FAAB 1TEFA 3PLYA 3SBPA 4A67A 1ZDQA 2OJ1A 1QHQA 3QJQB 4ENZA 4L0PB 1NWPA 4E9SA 1AG6A 1NDTA 1WA2X 2J55A 2FQFA 3AW5A 2HRHA 1AS8A 2TSAA 2A3TA 3WG7B 3ZX1A 2PP9A 5I6MA 2HXAA 1W8EA 2BP0B 2BW4A 2UXGA 2VSKB 2XVBA 3T71A 4AKOA 3AG1B 4GYBA 2X87A 5LDUA 1URIA 1GY2A 4KNUA 3WNJA 5I6LA 4HAKA 2WO2B 1RCYA 1M57B 1JZJA 1SJMA 3OMNB 1XB3A 3S3CB 2AZUA 2PPFA 2E86A 1NIAA 2ZWNA 1AIZA 3AG3B 5B1AB 2IDFA 1BYPA 7PCYA 1M56B 1NPNA 1PLAA 4FA7B 3PCYA 3ABKB 4DP0X 2DWTA 1JERA 2IDSA 3NJIA 4HHGA 2XWZA 3C75A 1FA4A 4HZ1A 1AANA 1DYZA 4YSPA 2I85A 1PNCA 3TA4D 2FQGA 3AZUA 3V9CA 3EH5B 1M9WA 1NWOA 1QLEB 1T5KA 5F7BA 5I6OA 5B7EA 1PF3A 4UAHA 2YAFA 5AZUA 5B1JC 1PZAA 3OD3A 2IDTA 3NJJA 4BDVA 1UATA 2WSDA 2W88A 2BP8A 1XMEB 1RKRA 4GP8B 4HCGA 2XUWA 1R1CA 2BW5A 4QKTA 3QPKA 3S3DB 2OV0A 1ID2A 1L9TA 2FT7A 1CUOA 5B7FA 1AS7A 1IKOP 4F7KA 2XU9A 1OCRB 1IUZA 1KGYE 3SBQA 3CG8A 3FSVA 2IH9A 4W1TA 4WTQA 3QJVB 5PCYA 2HLEB 3S8FB 2ZOOA 1BQ5A 2UXTA 2PPDA 1SFHA 4P5SA 1PY0A 2B08A 1E30A 3UAEA 1BAWA 1QNIA 3D12B 3KW7A 4GP4B 3SBRA 4YSSA 3CDZA 3FQ1A 1GS7A 3CZUB 3L45A 4E9XA 4F2EA 1PNDA 2AVFA 3IEAA 1V54B 1MG3C 4MFHA 1AAJA 1XB6A 4E9WA 4A2EA 4N4YB 1A8ZA 2YAOA 1RZQA 4YVNA 3DKHA 5EHFA 2CALA 3X1FA 1HFUA 4X4KA 3QQXA 1SF5A 2IWEA 1SFDA 1OCOB 2MRYA 3RYMA 3MBWB 1AZCA 1NZRA 1OE2A 3FSZA 4JHVA 3T6WA 4KOBA 1A3ZA 2J57A 2XV3A 3TBBA 1WS7A 4BK5C 1E5YA 1TEGA 3FYEB 4A2HA 3AG2B 1AR1B 5I26A 3WIAA 1NIFA 3QJSB 3FS9A 2UX7A 1J9TA 2YXVA 3NJFA 3WKPA 1ZV2A 1ET7A 1GSKA 2GHZA 1L9PA 1JXDA 4YSQA 5B1BB 3EH3B 2VM3A 2Q9OA 1SHXA 1A4CA 4DP4X 2EILB 2H47C 1ASPA 3NSCA 2FJSA 4BWWA 2AZAA 2DWSA 4P5RA 3EHBB 2X88A 1GY1A 4HALA 1PCSA 4BXSV 5TK4A 2EIKB 3FQ2A 2EINB 1YLBB 2H5UA 1ZDSA 2P80D 2QPDB 2QPEB 3H4FA 2ZONA 3OMAB 4YSAA 3HB3B 7PAZA 5ANHA 4YSOA 2CBPA 2JKWA 1OCZB 2VW6A 1J5CA 3FU9A 2UXVA 3UABA 5AKRA 4KO5A 4A2GA 1MDAA 4BDVB 4TXVB 1WA0X 1AACA 1E65A 1OF0A 1TKWA 2BP8B 2JFCA 4G7QB 1L9OA 1MZYA 1SDDB 3ZBMA 3ZIYA 1KV7A 4GP5B 4A66A 3IE9A 2JXMA 1CURA 1HAUA 1JOIA 1A65A 3QJTB 2PP8A 1J9SA 2FQDA 4E9VA 1J9RA 2FQEA 4YSTA 3GXUB 5D4HA 2GB2A 1JZFA 2H3XC 1KDJA 2YAPA 2QDWA 3DTUB 1NIDA 1JVOA 1J5DA 8PAZA 4YSDA 3GYRA 3ASOB 3TU6A 3OQRA 2CUAA 2I7OA 3JT2A 4KNTA 1V10A 3T6VA 4BWTA 1DZ0A 1WS8A 2XV0A 2IDUA 4PAZA 4WKXA 1X9RA 3NYKA 3OM3B 4GY4A 3NSYA 2GIMA 3WI9A 2IAAC 4KNSA 1EHKB 1BXAA 3V9EA 4M4RB 3U25A 2IWFA 1AS6A 2YAHA 3BQVA 3NT0A 1ZPUA 2BZCA 4A2FA 1RZPA 1L9QA 4DP2X 1JVLA 1TU2A 3WNIA 3KW8A 3NJMA 3CVBA 1ETJA 3PAVA 3JTBA 3S8GB 3FYIB 1NTDA 2TSBA 3ABGA 3FU8A 1AOZA 1KCWA 2UXFA 2YXWA 5TK2A 1ASOA 3EH4B 3FSWA 4YVUA 4HCIA 1GW0A 2I7SA 2BP0A 1JXFA 1BQRA 2PCYA 2DV6A 5IY5B 3FPXA 2VMJA 2VM4A 3TBCA 2J5WA 4BXVA 4M3HA 3AY2A 1KDIA 1BXVA 2RACA 2DY2A 4GXFA 2GC4C 3T6ZA 1B3IA 1OV8A 3ASNB 3CDZB 1AZRA 1VLXA 1SF3A 2BWDA 3ABMB 3T6XA 1IC0A 3H4HA 3X1GA 1N68A 1W6WA 3ABLB 3X1EA 2VW4A 6PAZA 2XYBA 2PCFA 2DYRB 2ZXWB 2AANA 4PCYA 4Q8BA 2OCCB 4DP6X 3NJGA 2YARA 4E9RA 4CSPA 2HRGA 2YQBA 4E9YA 1NIEA 3FPYA 1EZLA 3N55A 6PCYA 1HAWA 2XXFA 1AZUA 2PPCA 1PLBA 2R7EA 1JZHA 5E9NA 1ET5A 2FNWA 3OMIB 3CVDA 1F56A 3ERXA 3S3BB 5D4IA 1AG0A 3IN0A
chains in the Genus database with same CATH superfamily
3MV11 3BSZA 4KK5D 4DP1X 5J56B 2XV2A 4L3ED 2B7DT 2VSMB 3KJ6L 3MLXL 5T8IA 3D0VB 4PJHA 4HKBA 3VWKC 2J8HA 2J8OA 5BOJA 4Y2OB 1DBKL 4HUWB 1KT2B 5F88A 1G4RA 4OF0A 5IQOA 3D5OF 2IIJA 2Y5EA 2ZCHL 2ICEB 3N2JA 1KIPB 4X8JA 3V0VA 3EJRA 5EO0B 5A6LA 4Y5YC 5EZLB 1PZBA 1FI8C 3MXWH 4XNQA 3MNVB 5E4OA 5T3XE 3GMNB 3GXFA 4LHUB 5I6PA 3QNZB 3VFGH 4M7KL 1IGJB 1UJ3B 1OGAB 3F7YB 2C8NA 3ES6B 4I3RH 2IFGA 3DXAD 3MUGB 4ORGB 2CJ3A 3V4VB 1S9VA 3VQ1C 4FFZL 4ZFGH 2WXFA 5I30H 5DZLA 2X6MA 4WJKB 1RZ7L 1R17A 4O51A 4EKXA 1AZBA 1OAUL 2YK1H 1SGKA 3NACH 1FORH 4LF3A 1KWKA 1C8PA 1GYCA 4QUOA 1CGTA 2YPKB 4GSXA 5BZWA 2QPFA 5DHVA 1V55B 3NZSA 5IESL 1YN6A 3MOBH 3TH4T 1QW9A 2F53E 3ZDWA 1YEGH 4ZUTB 4G8AC 1BCIA 2XBTA 1I1CA 3BFOA 4Y1AE 3V10A 2BNRD 3LN9A 2BY2A 2DM2A 1ZVNA 3GIZL 5MEQA 3KXFD 1FAIL 5GZNA 1CB4A 1D3CA 1ZIAA 4AH2A 1S7RB 2PW2A 3EDFA 4KZCA 3F7KA 3T9WA 5F1KC 4X42A 1XCWA 2PR4H 4NN6C 4Q56A 5E8NA 2EVJA 1XCTB 3O3BB 1UC6A 2MSPA 5FYKE 4R90H 5KS9F 3VTTA 1T0NA 3KBPA 2YGPA 3BJLA 43CAA 4F7CA 3GIVA 3CLEH 2DEXX 2AJVH 1LK2A 4NCC2 3L7EA 4YDVB 5AAMA 3GRWL 4RGMB 4LQFL 1NOAA 4L29A 5H37A 3LQZA 1UH4A 3ROOA 2EKSB 1MAML 5IQLA 3JYCA 4LARL 4I0KA 1GSMA 4XODA 4QGTA 3LH2H 3KL3A 4IOIB 2WBXA 1E4KC 2DQHL 1TJGH 5ANME 2ZOUA 3EUUA 1CI5A 4KKNA 3WNLA 3MLWH 1HK6A 3UCQA 4W9GC 1LP9F 4X0KA 1IFRA 1N0XH 3VG0H 5I19L 3AY4A 1S78D 4ES8A 3C5JB 4KK9C 2EE9A 2GFBA 1MCWM 2WC7A 2MCPH 3NH7L 5I1AA 2VW7A 2IXQB 2VJXA 4AVJA 1MHHB 1LO0H 3VXMD 5D5MF 4MJ5A 5JOPD 4KTEL 1JWSB 4ZPVA 3D85B 5I0YA 3Q44A 2HRPH 2VMCA 3E9TA 1JV2A 3ML9A 4N8UA 5KYNA 3GBDA 5F3BB 4I85A 3QG6B 4JVUA 3QUZC 4S1SH 5AQ0A 1U8QB 5CEYA 2WLZA 3FQNB 1HXKA 5F96L 1U8QA 3PQYB 2VDLH 4D0CB 4WSJA 4ETQB 4BV1A 3QZWB 1L9NA 1ZV5A 3CWGA 3CV5A 1JNHB 1B6DA 4K7PX 3Q6FB 2P8LB 1SMOA 2W5PA 1A1MB 2VN6A 2Q7AA 4PJEA 4GAJH 3HZKB 3QA3B 5LGJA 3PHQB 1P7QB 5BS0D 4JZNB 5MENE 1NMBH 1YMME 2NUPB 3GM0A 4WWKB 2MH4A 4ZG1A 4PRPB 4BM7A 2IPTL 4LL4A 2D9QB 1Y0LA 3MJ8B 1KB3A 1PZSA 3DURA 5CD3B 1JFQL 1OT1A 1PSKL 3L54A 1OGAA 3CXHK 4QHUA 3WFCH 1B2WL 4X8CA 2YC1A 4U31A 2C3XA 4YBHA 2G5UA 3LPPA 1HEZB 3DX2A 4LVOC 3O6LL 3AG3B 5G4OA 3CZNA 1NUDA 3QZOA 2FO4A 1DQJB 4JHBA 5HXMA 2CIIA 5D5ME 4RMRA 4I0PD 1G9EA 4Z7WA 2LV4A 1HXYA 1RJLA 5AVSB 5EEXA 2ZAHA 4NHCH 4Y5XB 2BS8A 1YCSA 5H94B 4OZFH 3CCHB 3IB4A 4NO0D 5IF0B 2B39A 3FO1B 3RU8H 4LSSH 4DGIL 5LB1A 1KJ2A 4JZOA 1OP5K 3ILEA 4FJYA 3BPLB 2Q86B 4ZUTA 1JPSL 3BH8B 2V6HA 5DO8A 3VXME 1T21B 2UWEE 3B7YA 3SBWA 2WLMA 1OAQL 3V0DA 5KZCB 2BW5A 1SJEB 4KY1L 4AK2A 1UB5B 1FL6B 3P73B 5F93C 3QP3A 1CXLA 3FUHA 3GXNA 3HC3L 3J2PA 1GKEA 4PRBA 2IF7A 1ML0A 3C5SA 4HU2A 4HS6B 5EU5A 2BY1A 3QUMA 5TH2B 4B0MM 5CIPB 4L9LA 1VADB 4QRSA 1E9OA 4RGNE 1ZHNA 4M93B 1NFDF 4KJYA 4TUOA 2MNJB 1BLNB 4P46C 1A4KB 5H4YA 5LHDA 3RWFA 3SGDH 5HI3D 4KGJA 1UZ8B 1JYVA 5PCYA 2HLEB 5CP3H 2YOCA 2IALB 3GGWA 4UT9L 1W0VA 3U2SA 4J6IA 3FQRB 3FO2A 4APQC 3ZYIA 4HW6A 2B08A 4ZAKA 2WZ5A 4FFZH 4ZFGL 3SPJA 4GP4B 4MYPA 1U95A 3AB0C 3JV6A 4J3UA 3MNZB 5DEJA 3VFMA 3OJDB 1CLOH 5JW3H 4D3CL 1DQQA 3Q5OA 3HCVA 3NGBB 1DUYA 3U2JA 4F2EA 5IGXH 5JXAH 3VDAA 4UBDC 3DSFL 1ZHKA 4FHBD 4HD9A 4PJBE 4CW1B 3WDJA 3MJ9H 1RZQA 4JFQB 2CIKB 2Y2WA 4YGAB 1I7TB 3IBEA 2ZXBA 4NIKB 1CDIA 1HFUA 3QULA 4C55A 1XXDC 1RZ8B 3F7VA 4PYHA 4AJYV 1CWVA 1FPTL 2O5YL 3BP6A 1OWRM 1U3ZA 2KYIA 1EEQA 4HLZH 1SN0A 5E03A 5CJ5A 4MZ3A 5ICZB 2F58L 1A3ZA 1XBDA 2EEAA 2F54E 3G3LA 4G9DB 1KFGA 1QI5A 3ZKMC 1Q9LA 3JWOL 1OVZA 4KDVA 5HYEA 1P4LB 1U42A 2R59A 3ISWA 1ZLWH 2WZPD 4I0PB 3ARED 2P1YA 4OCYL 5L2KE 5BO0D 5FF6A 3KEDA 5FS5A 1HVXA 2AMUA 4NO0B 1LO3L 1KTDB 4M29A 5HPMA 4Y1AD 3X14A 4RAUB 3ARXA 2OI9B 4G8GA 4JG9A 4J3SA 2V2TB 2IGFH 4JM0A 5DS8A 3CZEA 1UADC 1E4WH 4UQ3A 2AJZA 3GJFB 5DZ9A 1DBAH 3NACL 5BV7C 4CL7A 5J3HD 5GXBB 3QIBB 5KSVA 1KBGH 3G5YB 5DVLA 2DQFB 5J9PB 4RWYH 5C0CB 3DGGB 1JYNA 3QRFM 3VSTA 1W91A 3CUPA 3O8XC 4Y8DC 2CHNA 3BO8B 4JVPA 5F44A 3UJTH 3R06B 1XGYL 5C0AB 3OKKB 4K55A 1MCFA 4GI6A 4CJ0A 1QTPA 3MLPA 4RGNC 2E5EA 1A22B 5B4MD 1TPXB 4L1SA 5F9JB 1MHEA 6FABH 1RL1A 2AQ2A 5KJRL 1J5OL 1QQDB 4K2UH 4FQ2H 4J27A 3SGJC 3VI4B 1KGCE 1CFTB 5HGAA 3QR2A 4KQ4H 1BW8A 1LDPL 2ED6A 2E6QA 4I1NB 4MB3A 1M05B 1FGVL 4A2GA 1PX4A 4LCVA 4EN3A 1M53A 2F5BH 2E7LC 4OFIA 4LIQH 1SXCA 2IAND 3KPLA 4I3GA 1PKOA 2OZNA 1A4JA 4Y4HC 1K5NA 2HJFB 1NBVH 4I5BA 4B3EA 4JM2C 2H1PL 3K6NA 4OLUH 5TFSL 4J12A 2A6JB 1NCWL 1E4WL 1SJXA 4XN1A 2YD2A 1B0GB 5EBMB 1UJTA 4ZO9A 1HOCA 3GSNB 2VSCA 4EOWH 3CFUA 4HJ1A 4JPWL 4Z7VF 3T2NH 2J43A 4ODHL 2HPTA 3V8CA 4K4KA 3FUKA 3A6CL 5I74B 1UWXK 3C5ZB 2IO5A 1HEJC 1CGYA 3LZRA 1JG9A 1N0XL 2A38A 2CUAA 2IH1B 1DQML 1A5FH 3KPNB 1V10A 3BEWB 1I8LC 1XTMA 1MNUL 1RUQH 1E0OB 3NESA 4BWTA 3UC2A 2P5PA 3MJWA 1MCPH 1ETZB 5ADPH 4FQPA 4S0HA 4X5PA 4MJ5B 3QXVA 1EHKB 5EUKB 1FFNA 2WP3T 3U2IA 1PZ5A 1IAMA 2BS9A 2K7QA 2V9UA 4KZEH 3ZTNL 5IB5B 4IBQA 3SO3B 1U8CB 5BVPH 5I1IH 2BOCB 3TVMB 3WIHH 2XTJC 3S48A 4GBXB 3MRFA 4NRXB 4ZTPL 4I4WB 4A2FA 1RZPA 1LEKB 4PJ5E 1BOGB 2YXFA 3MRFB 2GHWB 3RTQD 4BSWB 3LCYA 4GAAA 3UG5A 2AK1L 4C8XA 3FYIB 5DURD 3J27A 1RH8A 3GSVB 1G0DA 1GL4B 5FLUA 2CH8A 3SKJH 3LQAC 2X41A 5IMMB 1BVZA 1QFHA 3MUY1 4U4BA 2IOOA 2H9GB 4J6RL 3CFJA 3HZKA 2DTML 3HNVH 1RAMA 3MV9E 3MRHB 5EV7A 2R9HD 4JCMA 4PGEB 3DX8A 3QIWB 4QHPA 5D72H 3FPXA 3WUWB 1FZOA 2QR0A 2YGVA 5JHAA 3H2WA 4M7LT 4YAQB 2VMJA 5ICYB 5FWRA 3WFEH 4OAWB 2H2PD 3K5SA 3AREC 4L2LA 1TCRA 4RQQA 1TOXA 4YDJA 2XACC 2Z93B 4X9FA 2OYLA 3K91A 4WI0B 2CHWA 1DVFC 1R19A 2XA8L 4M62L 1E9PA 4M8QB 1X5HA 2P5EB 2XYBA 1BVLB 4HQQL 4OR1A 4Z7OF 5IFJB 3QCTL 1I85A 1KUMA 1GTNA 1U33A 4PCKA 1TENA 3DGDA 2C4FU 4RISL 3IKKA 4WFGD 3MV7D 4LKCB 4OI7A 1XFPA 2WNKA 3UXFA 1KELL 5CBEA 1U8LA 3EO9H 3N55A 4N3UA 3U0TA 4N87A 2R7EA 4N2IA 4DW2H 3HBPA 4XCFH 1ET5A 3GSRB 5GS1A 2JF1A 3S3BB 1ZLDA 2C7FA 3GHBH 3TA3B 3CLEL 4JRLA 2I24N 4XPFH 4GQ9H 3JV0A 1JZIA 3IPFA 2WXKA 3HI6L 4UOW0 5CR8A 3A24A 1CFQA 3O6FB 1QVOA 4A1RA 2A74B 5IT2L 3UG4A 1E3ZA 1G7HB 4AV0A 5B1KA 4MA3A 1EXUB 3RY6A 5JHLA 4A7GF 2AKRA 2CPCA 5AOZA 3CHSA 5PAZA 3QJXA 3N41F 4M7ZC 4CVWA 3R8BB 1F1DA 4UTAA 2KI6A 4K94H 1SQMA 4LLMB 4LPCA 4XP6H 4Y4KD 1PY9A 4L5FL 3RWCB 3W0WA 2YBRA 4PJDF 5HGBA 5IHBA 2QTVA 4JFHD 3QUXA 4MHHI 5IROC 4Y9GA 2ITFA 3T2QA 3MLSH 1H3WM 2JK5B 2FR4A 3U46A 1FDLL 3X12B 3EJQA 2WXGA 2FSEB 2QSTA 4GLRI 3BXNA 3RIAK 1FCGA 1AGBA 4HSQA 1HI6A 3F7PC 1CICD 2FSEA 3LSOA 3OKLB 4Y4FB 4CJ1A 1KIRA 4XPTL 2CDFB 3E8UL 1AY1L 4RWHA 2GEEA 1AIFA 4GKSA 1UVQA 3RY6C 2V33A 4WUUA 4DVBA 2VN3A 1FGNL 1DBJL 4HFUH 2NTFA 3RJDA 3QUMB 3D2UB 4JG5A 3L6FA 2PPEA 2BERA 3ZTNH 1PX8A 1U21A 1AGCB 3THML 1B0RA 5I73B 1L0YA 3GLDA 3EYVB 4LSPH 5MP6L 5BV7H 4MDRA 4PG9A 2EZ0C 4K3GA 1LJMA 1FN4B 4LP4A 2RALA 4CVZA 3K71B 4DTGL 2DMGA 5MEPB 2DKUA 3MGAA 3DPDA 2HVKA 4RAHA 2FT6A 2AK4D 4H0IA 3VXRE 4LDLB 4JO2H 2YQGA 4OJDH 1CCZA 1NPJA 1ORQA 1S7XB 5C07B 5JZ7C 3DO7B 1SDAB 3GDCA 2MQGA 1R47A 3V5DB 4G6KH 1N4XL 3VYNA 2LHAA 4MQXD 4B97A 3IETA 5KANI 5D72L 4BFJA 3VXSA 1ZCRA 4AM0Q 1R6VA 4G3YL 4X6FA 1AXTL 2VB5A 3RE0A 3M1CA 4EUPG 4DP9X 2ZKMX 3KG5A 3FB8A 3HOGA 4OFVA 4GH7B 1WFIA 1QNZL 1PBYA 1N6QH 1KIUA 3J7HA 1BQUA 1H9VA 1P84J 5F7EL 1J1OH 3KHQA 4NAMA 1MCKA 1T66C 4X6DB 2YKKA 4UOJA 3B5GA 1Z3GL 5JDSB 2R8SH 4XX1G 3B9DA 4JRYB 4KRNA 5BZZA 1OAJA 4RQQB 3VWJC 1YNKH 4F37K 1UYWL 4ECNA 3A4FA 1KYOJ 2E9BA 5J7CC 5JOPE 1RUKL 4OD3H 2OYPA 5E5UB 5I5JA 4YO0B 5ACLA 1U3YA 4ZT1A 1EDYA 4WFHD 1JZGA 5DRNA 5LBSA 1IM9D 4FL4C 5I8CB 5ELIA 3DUSA 2C1OA 5BS0B 2YZ8A 3WBDA 3GFUA 4WWKD 1EHLH 3CVIL 4ELMA 3D7PA 3RA7H 4QR7A 1G9ML 1U4EA 4JFED 1CTOA 1SRDA 3PLYA 1HSAB 5DGQA 12E8L 2JKNA 4LDEB 2HG5A 2EXYD 3EIFA 3WO4B 3VFWA 3ZDZB 4L0PB 5ID1A 3QXAB 4DEPB 4QTIL 1EBAA 3BW9B 3MRCB 4RMBA 1AS8A 5KZCD 1UD3A 1P4IH 4IOSA 3FFDA 3P69A 3S3PA 1WAAE 3P3YA 1MQKH 2FBJH 3NTCL 4QRPD 5FCUL 1OAKL 4CNIA 1KACB 3BUYA 3NFNA 5BRZA 5I0VA 4IBUA 3LPGA 3GMMB 3KLLA 4BQCA 5CJOL 4FQHB 4XHQA 3VXUE 3O45A 1WD8A 2F8OA 2RGSA 1AO7E 2W0KA 5DRWB 1SOSA 2AZUA 1IGFH 2G5BA 3B56A 4RFNB 3QUXB 1B9ZA 4ZW6A 4M5TA 5EOTA 5C0JA 3EJSA 1WGVA 4P2QE 3MMEB 5LXGH 4NDMB 1PLAA 1VFAA 1G6RA 3VXOB 3M1BB 3EYOA 4O2CA 3BHBA 3INUH 1TVHB 4B9ZA 8CGTA 1JGVH 2J1XA 1KB9J 3GUTB 1LVEA 1EHLL 3IMRA 2P5EE 4M3KB 3L3JB 2WYIA 5IV2B 3BVWA 1TCMA 3BKYH 12E8H 4K23L 1XEUA 2Y0SA 5J13B 4NN6B 5IIEA 1Y6NR 3DROB 1Q94B 2VZVA 5J1SC 4BDVA 1CVSC 2MKWA 2XWDA 5IB3B 3MJGX 1YNLL 1WWCA 5AENA 4PEEA 4XXDB 5DEGA 3KZ8A 1XF4B 2H2SD 2CLRB 2VISB 4IRSC 2GEQA 3BH9A 4HC1L 5B7FA 4F7KA 3TBYA 4JPQA 2DIJA 5IVXE 2A6IB 3IFLL 1MHPL 4WHYG 4XNUL 2AC0A 2D03L 1KOAA 3DYMA 4PGZA 3QJVB 4BFIA 1F02I 4YMPA 1A7RH 1S2EA 4C56A 1XHHA 2I32A 3IPEA 3VD3A 1OP5H 5E0FA 2ZICA 1FLRH 1V05A 1W72B 4UT6A 4ZFFB 1AD0A 5EU6D 4WCYH 3PWLA 4WJG3 5EEUA 2ZSWA 4P5SA 2QEJA 3EAKA 3MACL 1LWRA 1TETH 2EXSA 1KGIA 2CLVB 1OHQA 3MRDB 5ACMA 4ZUSB 4X7TA 4KAQH 3PQYE 2FD6L 5TJWK 5JDSA 4LGRB 4H1LH 5ENWB 1XB6A 3MCKB 3GSVA 3QCVH 4Q97A 1U36A 2FX7H 3PWNB 4YHPB 3CBKB 1DJHA 1J8RA 2C3HA 2NY0B 2P28B 3Q2NA 5DVOA 5FUZL 5IM7B 4I1RA 2HJLB 1KNOA 4L4TE 5BMFL 5KS9E 1NUGA 4Y1TA 5F8QC 4CDGC 1UZ6E 3FUMA 2ARJB 5CEZD 1DVFA 1SF5A 2YZ1A 4PGCB 4S1RH 3MBWB 4LVOB 4H20H 3VQMA 5IBLD 4OIIH 1EZVX 2AVGA 1SEBB 5GGVH 2VN7A 4KC3B 3FT4B 1UXWA 4UOW1 1TLKA 3QIBA 5FO8B 4ODWA 3MTXA 3MCYA 3OKNA 5FCUH 5CD5D 1AQMA 2OMTB 5IQNA 1OALA 1MXGA 1M7XA 3QZBA 1JNLH 4AGQA 2HB0A 1FZKA 4DKFH 2CRZA 2HN7A 3OGCB 4KKQA 3FK3A 1JK9A 4L5FH 3D39E 4HHAB 2OW7A 5GHWL 5DD5L 1I82A 2Y6SD 2P5WA 3FTVA 4JZJB 1MNUH 1RUQL 1U8KB 3ARZA 2RAMA 4WU7A 5FM5M 5HHOA 4DP4X 3D0LA 3EW3B 5D55A 5DRWA 4YUEL 1U3JA 4HK3N 1JGEB 2I26N 3B8YA 4NZTL 3AFLA 2DLFH 3SEPA 1U4FA 5CP7A 4PYGA 3W9EA 4CKQA 1KIRB 4HWUA 4F2MB 4WJ5A 1TU2B 1I1AB 4GIOA 2X88A 3KLAA 4NO5B 4OZGB 3O3BA 3RWEA 1IGTA 1KLGB 2WZPA 1MH5B 3MA7A 4FQQB 3BZ5A 5DI8B 3UZQA 3E9UA 1IGTB 2PXYC 3ZXAC 5F7KC 4JY4A 5E2WH 1IJ9A 2P9RA 4QRSB 5IEKB 2AXHA 1XGPA 4GQZA 3VFUA 2ZT9C 3D6GA 4JQXC 4R7DB 1JNNH 3HN3A 5E6ZA 4LL1A 4QXVA 3IGAA 4RNRB 4YXKH 5JOFB 5GS3A 3LEVL 4JDEB 3KL5A 4HZLA 4MDJA 1FHGA 4CVUA 5I1GL 1L9OA 2P52A 1I8KA 2AABL 4AEFA 1GGIL 1MZYA 2V3EA 5MHSE 4JLRB 4IBSA 3BKCH 4N8VA 5HYSB 4EXKA 4QRUB 3I6SA 3N40F 3T4AB 4BUQA 2JKTM 1CO1A 4NNPL 3EJYC 3Q13A 4DGWC 2FB4H 3SODB 3T08A 2CHDA 4N8PA 2BOCA 4BFIB 1TTRA 2QDWA 1YYLH 1GIGH 2G4EA 3LV3A 1ZMYA 4TULL 2W9DL 2PWGA 5G2NA 1IJNA 3B83A 1CBJA 3FMGL 3O0RL 3IDMB 3LX9A 3N85H 3DK2A 4AVIA 1H3TA 5I66A 1SPDA 1CU4H 1TKWB 1OB1A 3ZRCC 3VWKB 2AERT 4KDTC 3C6LC 4XN5A 4YFLI 4EKJA 1RZ7H 2I7OA 2J2ZA 3VX1A 2PKDA 1XGQA 3HI6H 3AGVA 3CFJB 1JWUB 2ITDA 3LQAL 4TM9A 4P06A 2DWDA 4K8RD 2GIMA 2QQLL 3ETSA 1TJIH 3ETTA 3PWNA 4YHPA 4ODSL 4WTZG 3O2DL 3Q2CA 4JQIH 3CVHA 1BFOA 2IWFA 3R8QA 3WFDH 3C5ZC 3T0DA 2IDCA 3HG3A 2GQHA 3MRPA 2Z93A 3MC0A 5IZ7A 2F7RA 3TPKA 3W11C 4OZ4B 3GBML 4OLEA 3M88A 1CGSL 1DSFH 3L2NA 5CZRA 2IAMA 1TQTA 1BIIB 3GZPA 5KN5B 3JTBA 3O8XB 4CVXA 4PGBA 2HT2C 3H9ZA 3LHPL 1KCWA 2CXGA 1WIOA 4FQLL 1YEJL 1ASOA 4LLYA 2AJZB 1UXWB 3GJFA 1D5IH 2NYZA 1RP8A 3LEYH 3UTPD 4MQTB 3A67L 4BZ1H 4Z3IA 1WZMA 1IQDB 2OQJB 5IY5B 3RPBA 4WI8A 4X4YA 3FO1A 4M1CC 1GGBL 4UIMA 4R2GD 4C54A 4PREB 4GBXD 3GJEA 4M3HA 1BBDL 5DXWA 4EUPH 4XWGL 4I77H 2RACA 3BKML 4LQFH 1KEML 3VMOA 3CMOH 3KLSA 2K6YA 1A6TA 1AO7A 1YQVL 3PGDB 4PREA 4RCAA 4UT9A 3THMH 1UQSA 2DWEA 3HHSB 1NFIA 3LKPA 1AZRA 4JZJA 2V8LA 4V1DE 3MJ6A 3GMQA 4QRAA 1W6WA 3ABLB 3BAEH 4Q6IB 5DMKB 6PAZA 2GK2A 4WI2A 4BH8A 5L7XH 4BJLA 3GXDA 3HNSL 3ARBA 4LLUA 5I1LA 5L8KB 2PTTB 3OQ3B 5BXFA 3CN4A 3C5SB 4OGAC 1G9NC 1MNNA 5EBLA 1SN5A 3IMSA 3SZ6A 1IAIM 2YJLA 3CN3A 1NIEA 1N3NB 4CADA 3CK0L 2DN7A 2VLRE 1DEEA 4XMLL 4EI5D 5EA0H 1N9PA 5AVTB 2XQBH 3K6SA 2JQAA 4JY4B 5HTSA 4F33A 5I1GH 1JXKA 3FL7A 3IDXH 3JWDC 2VR5A 4GO8A 2WBJC 1HU8A 1YEJH 1WE5A 3OXSB 2OP4H 4MJIE 2QGEA 4YPGB 5EBMA 5JMOC 3W38A 1ZHLA 1SXSA 4JM2B 1X5MA 4MMXB 1DQQB 3GC3A 1J1OL 3GI9L 3S96B 1A14H 4FOMA 3VXOA 5DUPL 1HCZA 2VO8A 3QDJD 1MCWW 1CN4A 3BYYA 4M5SA 4W6YB 4BWUA 1QRNE 2WUBH 1D6EB 5IJBC 2V7HB 2A4CA 3MGOB 3LZFL 3FQXA 4P3DB 4PCTA 4JJ5A 3BEWA 2CO6B 1BZ9B 3Q2LA 5AOMA 4MA7L 1AZNA 2WXJA 1QWHA 4R26H 4XNAA 3NZHH 2BMKB 1LP9B 2UY7B 2JCCE 3H42L 3WLBA 3F62A 1JXGA 3QUZB 4DP5X 1S9XA 3IN2A 4PP2A 4LSVH 3MLTB 5DC0A 2V5RA 2ZNXA 4FFZA 4PJ5B 3WFCL 2R1XA 2XLLA 4FNPA 4WFEE 3TEUA 4P0DA 1OE1A 1TJGL 1WPCA 3HLAA 4NQVB 3MJ7B 5B4MC 1WAEA 5C0BE 4EN2A 2EIMB 1BQKA 1NBYB 1F4HA 3SE4A 2HLFD 2VAJA 2DQUH 4L8SB 3NCYS 1GYUA 1B3JA 4RFEA 4S2SB 2ARJA 2Y1AA 1DVFB 4NC0B 1IQWL 3UAJA 4AUUA 3C87A 4K3JL 4DGIH 4ZFFA 1G9NL 4ZXBC 2Z9TA 4FD0A 1F4WH 2A77L 2PP7A 2NW3A 2Y7SA 2V2TA 3CVHB 1CLYH 1S3KH 9PCYA 4HG4J 3FZUD 4ZAKD 3UGEA 3KPOA 4BEIA 1HIML 5D1XA 3UBXI 3MA9L 2BCKB 4QYOA 2QT6A 3ULUF 4AT6A 3MQIA 4GXVL 1G7PA 4IU3B 2H0JA 3ECVA 4M8UA 4V1DD 3ZO0A 5C0CA 3QDHA 4DHLA 4HXBH 3BRFA 5T1KB 3FRPB 1MIML 1AE6H 4FMFA 4WI5A 4EZKA 1ETB1 3VXRB 4DP7X 4LHUA 1OF2A 3SDAB 3B2MA 5C07E 1AKJB 2KDYA 5GSRB 2CCLA 1BD2E 4BFBD 4U1HA 1KJ2B 4NNYA 3MO1B 1G9HA 1TT6A 3B4NA 1MG2C 2NNAB 5EDXA 5ADOH 5GZOC 3D0LB 1KBVA 2DWYA 4JY5H 2J1WA 5GGSB 5AG8A 3F84A 4H0GA 3M86A 3ARQA 4Y16A 4LGPB 3H53A 1IBYA 1CGVA 3TPUA 3VXTB 4OZHB 3OZ9L 3IE4A 1MWAH 1PFOA 2NY2D 5KTEH 1AQ8A 3NK3A 2FTAA 2WJ5A 3RZCC 1EZUA 1ZT4B 3UAAA 1ILSA 1CFVL 5TH2A 7FABH 4LNRB 5H35A 2K8MA 4ADJA 6TAAA 2EIJB 2SODB 1S3KL 5H35B 1MVFA 4PJ7F 4NO3A 2XX0A 5L9DH 3GMRB 2CBOA 2QADD 4FA8A 1XF2A 1N5YL 2ADIA 1SN2A 4P99A 2QPSA 4Z7AA 2WTRB 1YEIH 2I69A 2BOLA 3FT9A 3B6SB 3RWIB 4I3SH 2P45B 3EOTH 4NX0A 1ZT7A 3RWIA 4E9SA 3X12A 4XP4L 4CMMA 4O2CB 2NW2B 4UZGA 3X13B 2DKSA 1HL5A 2OR9H 5CKAA 2OYKA 4TMPA 3NGBC 5IMKA 5ITBH 3KGRA 1NKOA 3Q8BA 3FTGB 1ZHKB 5F7DA 2KMWA 4FG6D 1SVBA 5IR1B 2C9VA 2ZUXA 3QFJE 1JK8A 3AMLA 4UMGA 4FG4A 5SWQA 4PB9L 2I07B 4G8EA 5AZEL 5T1DH 2YFOA 1IVLA 2F8XC 3EJZC 1ZV9A 1HL9A 5BRZE 1VHPA 1T6WA 4RMQA 4O9HH 4ERSL 4MVBC 1UA7A 4ZAKB 1M56B 4W81A 4HS3A 1WZKA 5K39A 1Z2KA 4BSWA 1HKLH 3DOSA 1S7VA 2JI2A 2A6IA 4OIIL 4DP0X 7FABL 3RZCD 5EU3B 1RHHA 4NGHH 3QJOA 3M1OA 4F3FB 1ZSDB 2UWEA 4AGMA 3WNNA 1LO4H 2V7NA 3L48A 2N56A 1R3IH 4DEUA 1QLEB 1D6VH 1ZA6B 3MNWA 1DANU 1PF3A 1W15A 2DQEL 1UWGH 4W9LC 2CBMA 4PJDE 5HGGS 3W5NA 3RGHA 4QOKE 1WHOA 2TRHA 2X1OA 3FONB 4KTDH 2D3LA 3FQNA 4KV5F 4RFEB 1QFWI 1DSFL 4WI7A 3QHTC 2BIMA 4X6DE 5D7KD 1LQBC 3V6ZA 3WGVB 1FFOB 4ANUA 1DL7L 4PWGA 3KWXA 3PDOB 4X5XB 1MIMH 2UZXB 1UG9A 5TDOA 2XU9A 4JRYA 3SBQA 4LBAA 2IH9A 4IEFA 4HWEL 3W39B 3W37A 3EYFA 5IHUL 4G1EA 1TF4A 4GMSL 4CILA 3RB7A 4G6AD 3DSNA 1SVCP 2QLYA 1WSST 4E5XG 1LHZA 2EH7H 4RA3A 3SGEI 3WO4C 4KHTH 1YQVH 3TYFB 2R4RL 2PO6C 3FB5B 3KE0A 1OSZB 4HV8A 1CZ8H 2YA2A 4NQEA 1MJUL 4BKLB 3BAEL 5LAPA 4TNGA 4BK5A 5BNXD 4HKXA 1CFQB 3O6FA 2HKAA 4LVEA 2M2DA 2BP3A 2O4EA 5L88H 1I8IA 3IT8D 4N25A 5GRJL 4MQ7B 1FNGB 2GJPA 3TV8A 3SKNB 5I8OH 3IDGA 2X6UA 2A9MH 3RJOA 2AKRB 5KSAD 4NZFA 4FLRA 2OS7A 1NSNL 2A6DA 2N59A 4YVNA 3CH8A 3DX7A 4N2NA 3VXSD 2DQDL 5KYYA 3DKHA 2ESVE 3FOMB 2A6DB 2NY6B 3FFDB 4X4KA 3PWJA 32C2A 4X7SL 3ZOAA 4EDXA 4ATWA 2MRYA 5DD1L 1MCPL 3S4SG 3RAJH 2GBTA 3ZT5A 3CVHL 1AZCA 3HG1B 3SKOA 1DSWA 4X6DF 1EJOL 4LSRH 1KENL 5IW6B 1GCFA 2APBA 4AMXA 4HIIB 5ISZA 4JGMA 4JE4B 3BD4A 5FHBL 4NFBA 2A9NL 2OFQA 3WEOA 5DQJB 4FMKA 3REWA 3F3HA 3IJHB 1UWYA 4UT6L 4G8GE 2GTZA 4WWPA 1PZUB 5F0JB 2BFVL 5D2NE 3C08H 5TE6L 4JGJA 4XBEH 1FFPA 4ZMAT 5IQ9B 3FHAA 3U0PB 4H0LC 4OGQC 3M1BA 4CMHB 3MRBA 3BVTA 4GAGL 4NLHA 1E27B 4TVPH 4HGKC 1E42A 3TNNB 2I9LA 2WIMA 1MHCA 2DI9A 3DETC 2APXA 4IMKA 4KKCC 4R8WH 2YRBA 5B38B 2A6JA 4KI1A 4OTXH 4OCWH 1D5BA 5H2BA 4TVUA 5TGBA 1HH9A 4MCYB 2XTJB 3I02A 2QVIA 1QSEA 3NSCA 4N0UE 4XHJD 4BQ9A 2EIZA 4N0CC 2DAVA 3JTTB 2VC2B 3V4PA 4QJ5B 3QORA 3I02B 4BWWA 3TZVB 3GRGA 5HJDA 3AT8A 2AP2A 2AQNA 2BM3A 1C5BL 4DOHE 4Q2ZA 2XRAL 3US9A 1FVDA 4PSPA 5D7KE 1MRCL 5IVXB 5DK2A 2NX5E 3I6LD 4NJAL 4MJ6A 3TFKC 2A6KA 2Y24A 2P80D 2D2CC 3PL6C 3WJLA 4LHQB 3LKOA 1WTLA 3OMAB 3SDXB 1HHIA 4CBZA 3SDAC 5EF0A 4PLKC 4UQIM 4B41A 5M95B 1DJYA 3DRQA 4N85A 4OZFG 2QVKA 2CKBB 4URKA 1SYVA 1DL7H 3R7QA 2HVJB 5F0PB 3VNZA 2VLJA 2NCEA 2EDDA 3LNHA 4Z7NF 1GHFH 2BVPA 1JD7A 1TKWA 1JV2B 1MJ7L 2D7NA 1BM3H 1G0XA 4OCRH 4NM8L 4ENEC 4A2MA 3ULVL 3HZMB 1Z9NA 1TJHL 3E1ZA 1KV7A 3N0PB 1JOIA 2LGNA 3WY3A 3ULAB 4GO9A 1KJ2L 1CDHA 5IHLB 4KQ3H 4ZOAA 2PP8A 2EH7L 4HJGB 2L4OA 5ANMB 2AHIA 1G7IB 1T2JA 2X3AA 3VSUA 1G94A 3ARGA 1GRWA 1NUNB 3NN8A 4PRAB 3X14B 3L4VA 3T0EA 2EYTA 4QXTB 4MWFA 4U1HB 1B2WH 1J0JA 1J5DA 3S4SA 5DA4A 3H7LA 3VMNA 1VESA 3BSGA 4PRNB 4N2GA 3TU6A 4BKTC 5I19H 2GJZB 3IFOA 3HI5L 4KNTA 5JPMB 2GJRA 4DPRA 4PLKD 4QWWD 2WWKT 4OT1H 3MBXL 4D0DA 2ZTBA 3CH1B 3OM3B 4ZMZA 1TFHA 5LGHL 2ZUQC 3CFMA 1AQDB 5FUCE 1X7SA 4IIQA 5EN3A 4P2AA 4WW1A 5LCVH 5F1IB 2E4FA 3FQTA 1UWGL 4ELKA 3CXDL 3MRIB 4OM0H 4Y1AB 5F1IA 5AW0B 1KELH 1GJUA 2YBRB 4RWYL 4PRHA 3HLKA 2H2SC 2PETA 5F96H 1JGUL 3WNIA 2HKHL 2ADIB 1UZGA 5E6SB 3KPRA 3ZZLA 1DR9A 2Z31B 1ETJA 1RU9L 2G3MA 3N04A 2BX5A 3V4LA 1ADQH 4NEHB 4L1TA 1XEDA 4LESA 3BQUD 2VOTA 5EU6E 1LE5B 4JZJC 4YBQC 4L2YA 4OQTH 3ZZSA 4JG1L 1LE5A 1GW0A 4HXAL 5C0AD 1DBKH 3BLKA 4WJ5B 5BZWB 4E2OA 1NAKL 4FULA 4NBXB 1E28B 4JPKL 2BIHA 3ZYJA 4EBQH 3UP6A 4Y9BA 5IV2A 3RWEB 2VM4A 3ELAT 3IKCA 4BXVA 2G3XA 4WFHE 4MTMA 4PJ6A 1R34A 1VLXA 4UV4H 2CBQA 1SF3A 3C8KA 2X2HA 4LARH 4MAUL 4Y8AA 4JFPB 3BSHA 3FQWA 4TLSA 3GLZA 4OZIB 5HHME 2NR6C 1D7FA 5C9JB 1FLTX 5HI5C 3JTTA 4OLWH 5JR1L 2BVOB 3V4PH 1WCQA 2FECI 3TEYA 2OCJA 1BZDA 1J7VR 4A6YB 4F92B 3FULA 4U6YB 3D4CA 2Y7LA 5FHAH 3L4XA 4Z78B 3DV6A 1MHHA 4CSTA 1KC5H 1BECA 2BNRB 2Y22A 4JPVL 4XMZA 4MJ6B 4ZOBA 1IIKA 1PCXA 1GZQB 2QKIB 4ODXB 4F27A 5LDSA 3ZR6A 4A2DA 2WVUA 3DX9A 3Q05A 4FG2A 1G9MH 1SY6L 2Y9RT 3UTSE 3FCSA 4F7MB 1QR1B 4IJ3C 3N06B 3JVFC 2GSMB 3CDGB 4OD2A 1OAYH 1E8ZA 2XG5B 1I7UB 3IJYB 4PG2A 1QRKA 4M6OH 3HZMA 3QO0B 3QUHA 4WI9A 1MFCL 1RJYA 1SHWA 1QBML 4PJEB 4XPGL 3RVVD 4TSBH 3V79C 5F9OL 2OR7A 3TVMD 2DQMA 1RK1A 4DP8X 4WWKA 2ZKYA 3OLIA 1EFXB 5FF6B 5TPWH 2IH8A 2R2EA 3BZFA 4J6RH 3TASA 4N3TA 4RH4A 4QXTA 2ZAGA 4B9CA 1DLFL 3TURA 3WTSA 4P9HL 1KYDA 4NXKA 1IBDA 2VDLL 2R8SL 1Y07A 3I85A 1SJHB 1BMWA 5HGDB 1MRCH 4IKJA 2IBZY 1RJCA 1O6SA 3EDEA 4NHCL 5KS9A 4Y9FA 5DF0A 2VLLB 1KB5L 5DGRA 3NP3A 5HHQB 3NCWA 5LBVA 3ZT7A 2VDOH 1PJ9A 4OLZH 4AVKA 3H0TA 2C3VA 1XGTA 3MRIA 4Y1AA 3MR9B 2Z8SA 1L9SA 5DJZA 4D8PB 1NINA 1AGFB 2R0KH 1IFGA 3MODH 1QQDA 2VJ8A 2XVLA 3NCFB 4QHUB 4OBSA 5D4QA 4LAQH 1Z5HA 4G7VH 5D2LE 4NUJB 1GS6X 1I9JL 3CPLB 1UM6H 4U1IA 4YHOL 4ZSOE 2NR6D 3VWJB 1N10A 3IDGB 1DE4A 1IGCL 5D1ZA 1FYTB 1DO6A 1N6UA 3DMMD 4UB0L 1CYWA 3POHA 5EBLB 3FT1A 1AMXA 1PMYA 5GGTL 3KPLB 4QTFA 2XZQL 4PJGB 4YDKH 2X2YA 2OX5A 4NQSB 5B39G 3T2LA 1F4YL 2RMNA 2I9LB 5C0CE 2IFFH 3SE3A 5K69A 3HG1A 3SKOB 2D4DA 3O45B 4KHXH 3WLWC 3B7RL 2A83B 3K6SB 1VGKB 4CMMB 5DJCA 1TQCB 3TP4A 3OLGA 5DK3A 3ORJA 3UH8A 4ZQTA 2XJLA 5DJCB 4GG6B 2O5NA 2IJ0C 3I84A 3LRKA 1A8JH 3L4YA 5AW4B 3TBVB 3CVCA 2CDEA 3NEOA 4M02A 1OCWL 4XO3A 5I1EH 4X9GA 1QWUA 3FB7B 4S1DC 2EUWA 1TZ8A 1AP2A 2JJTA 4NOBA 1JK8B 1CYXA 5CU9A 1U91B 4B95C 3L5XL 2F53D 4Y2DC 4CSZA 4NENA 3L3KA 2Y06L 3U36B 4PJAE 4M1GH 4LSQL 1NQBA 1RU9H 4Y19D 1NMAH 2R2BA 4BFOA 4ENZA 4JFWA 3NSJA 1QFWL 3KH4A 5HPOA 3DO7A 3TBWA 5FR3A 2X3BA 4P48A 4QXGH 3TYGH 5CD5C 3UP1A 2ZKHH 2N1TE 2V2WA 3KLQA 3U4BL 4GW4B 3IXTA 3V4VL 4M5YH 3OWEA 1A7PH 3SQOH 5LDUA 3VD0A 4I0PA 3IFLH 3WNJA 5AWNL 2O6FA 2WO2B 4TQEH 4XOBA 5EZIL 3T65B 2QADB 3VFVB 3LZQA 3OMNB 1HHJA 2ZX8A 5DFVD 1DQTA 3RFZA 3CSBA 2ENQA 3M46A 1T5XA 3D39D 4M62H 1ESOA 1OTTD 2G2RB 1X5YA 4X5LA 4LCUA 2P48B 2HTLD 2VLRD 2WK2A 3V0EA 3CVHH 5LXVA 4J3XA 4MNHB 1V5JA 1V3KA 3U0WH 4ICWA 2FUTA 4RBPK 4XBPB 4IMLA 4TLTA 4KTGA 3LZNA 3U1PA 2WXPA 1IE4A 2O72A 3GI8H 2HFFA 4K3HA 2HLFC 1BVKA 3BAKA 5DU7A 4DUXA 4G82A 1S8DB 1UH2A 1QATA 2B1HH 2MTPA 3QS2A 3RDTD 1JGDB 3IGLA 1DBBH 3HZYA 1WO2A 2WSDA 4F7EB 4ZMXA 3E6FB 2IPKA 2CLZA 4MZ2A 4K5NA 3GUFA 4WHCA 4R90L 1R3JB 2FT7A 3ZPDA 4IRJA 3U4BH 3AU1A 1EDHA 1WZLA 1ADQL 2CBTA 3L2MA 1T83A 1H3VA 3CSYA 4MRBA 1GZPA 2ADGB 2R2HA 3KR3L 4U33A 4X8GA 4ZD3L 3T77A 3PWPE 4JS7A 3SCMD 1AGFA 5JQ6L 5KBDA 5FW8A 3VH8B 3JYBA 1AXSA 3O6KH 3JVGC 4NIYE 2ODIA 1OP4A 2KZKA 1VZIA 4XMUA 1DJIA 1S9WA 1CGUA 4XPGH 2X40A 4OVUA 1YEDB 1ZS8B 3DJRA 4GT7A 4PHZA 4AYSA 3LRSB 3ZE1B 1S7TA 3Q8FA 3CFBB 4H26B 3UAEA 3IMWA 4MYWB 1O6VA 4L4TB 1S7TB 5CGBA 1D2PA 1UCBH 2EYSB 1GC1H 6FABL 1H3XA 3CFDA 4JPWH 4PVBA 1U2CA 2DBLH 2IV9A 1MPAH 2J88H 2SEBA 4HS8L 2J6EH 3IU4L 3E3QC 3U46B 1Y7VA 2EDKA 2NNFA 1JPSH 3HJ0A 4XNDA 2YAOA 4FLOA 1UTDA 3OKYA 1NAMA 4LCWE 3TZVD 1XSJA 3L3HB 3HUJB 3U4EB 3X3GH 4XCNA 5E56A 3U7YL 1PTZA 3QDGE 5B39A 1QI3A 3VI3F 1QFPA 2FJFA 1YNTA 3K4ZA 1Q94A 2Y1VA 2JKSA 3LPFA 3EYUH 3P0GB 5BVPL 1SYSA 3L95B 4U1SB 3QE5A 3TBBA 3GKWH 5CR1A 3FUFA 3EYSH 3HG5A 1Q0EA 2Y7OA 4W93A 5MEND 2EVGA 4LAQL 2VQUA 3AG2B 3BFWA 1FGVH 3TF7C 3WY4A 2IPTH 3FC8A 4TNEA 4UDUB 1AXTH 2F8VA 5KSUB 3S37L 2ITCA 2F54A 2VMFA 4XCEA 1ET7A 2A6KB 4P5TB 5C07A 4HKZB 1BPVA 1L9PA 3QZWG 2FL5A 1FV1B 2H9GA 1T22B 1A66A 4U6YA 3R4DA 1U3HD 2VM3A 3C60C 1KTCA 1DHKA 1HOEA 4PMEA 4FDWA 1KB9K 4ZUVA 5A7BA 4HJ0D 1ASPA 5FYLH 3K6FA 2HWZL 3T65A 5I18L 4TV3A 4H25A 3QDAA 3D8MA 2E9WA 1JTOA 3BN9C 4YDJB 4XC1L 5EC2A 5AW6B 1BOGA 4GLRH 2NZ1A 3A21A 3UYPB 2HT3C 3HR5A 2VDNL 3B7SA 3WIIH 1JL8A 5C2BL 1WBZA 1N59A 3K5RA 1EJFA 3ARGB 4JHWL 1JZ7A 3WFBH 2J8UA 4WRLA 1AHWA 3K72B 5AG9A 1U3HA 3D48R 5DSCB 3QB7C 2C26A 1JAEA 1WWWX 2CR6A 4Z7QF 3FRUB 4HC1A 3N91A 3N1MC 3N44B 1CDUA 1CG9A 1DQDH 1EQWA 1PU0A 3EHBC 2DMHA 2C1OB 1K4CB 3FT4A 1DVXA 1HSBA 4X4MA 4AQ1A 4Z7VA 4PBXA 5DC2A 1T83C 3RTQB 3TIDA 4BH8B 5AVYB 5D9SA 4OZHA 3HTLX 3MYJB 4U6VL 1YEHH 1WEJH 1J9SA 5IROA 3UROR 1S5HB 3R4RA 2GSGA 4RZCA 4ODUA 1M2OA 5I0XA 2WXMA 5D4HA 2GB2A 1D7CA 3TEWA 4AM0A 4YDIH 2JJSC 4K7PH 4XNYH 4JFTA 1ZK9A 1EEYA 2Y7QB 4AM0B 4ONOA 4WK4B 3QZPA 4G59C 3LS4H 5A6IA 3QQ4A 1GGBH 1FJ1B 4R4BB 3ASOB 1CXFA 1RZKL 4PJCA 1M7IA 1UYWH 4H8HA 4F9PA 4DT2A 5C71A 3ATDA 3BT2L 1RSYA 2NNXA 3TBSA 4WNJA 3SCMA 1DO5A 3UJJH 4M8RA 3HPJB 1HHHA 3HB3D 3F6LA 1I1RA 4UM8B 4AENB 3U1SL 3BIAX 4YUEH 1V27A 2GTZB 3KD4A 3NMEA 3TBTB 4GRLB 4TUOB 1AS6A 3BVXA 3JXAA 2BZCA 2FE0A 3WKMH 3SSGA 1ZA3A 4KQ0A 3CFCL 1WICA 2LU4A 3HE6D 3KW8A 5KJ4A 1P7BA 1IM3D 5E7BA 4DTGH 4IU2B 3EG9B 1K5WA 4GUCA 3EADA 2G60L 3IJSB 3D69A 4GQ9L 4OLUL 3QEUB 5C6WH 3L95A 3O6FD 4W9HC 4HUXB 3EH4B 1JGLH 3ZSSA 4O02A 3QEUA 3GSUB 2YK1L 1OAUH 2DL9A 1C16B 5I75B 3C12A 3PWUB 1O5DT 4X9IA 2G0KA 2ZQKA 1NBQA 1IT9H 1HWWA 1CE6B 3NJVA 4FKEA 4YBQD 4ZDHA 4PG2C 1DBJH 1TZAA 1YQ2A 2J5WA 2H0FA 4YFEA 4XCEB 3J07A 1BXVA 3NDZE 1I9IH 2DY2A 3UC0L 3CDCA 4ZNEA 5FKPA 4CU8A 3KNBA 4L8SC 2NY3B 5D8JH 1M6OA 4R9HA 2XZCL 5AAWA 3T6XA 2DDQL 3H4HA 1WC7B 3TWCL 1LO5A 2ESVD 3FONA 4ZXBB 3NCCB 5HJ3A 4YEFA 3DWTA 2G2RA 3TO4B 5L2KD 1QEXA 1FAIH 2ZXWB 1CPUA 4Q8BA 4ZUVB 2R0LH 5C92A 1XIWD 3D4GA 1CL7I 2Y23A 4Y4FD 1BXXA 3QEQD 2R69L 1T4KB 4OD1L 4WK2B 1SJVA 2CR3A 3VACA 5IJVB 4H8VA 1KB5A 2JLLA 1MCOL 5IVZB 3MODL 2HH0L 2CO1A 1FH2A 3I9AA 1YEWA 2NY5H 3OF6A 1DFXA 3A4DA 5CUSH 5I8EB 4O58H 5DC9B 2VL5B 4H1LA 4IGBC 1RK1B 4KFMA 4XPBL 3SPIA 5HHMB 2EE0A 3LNFA 1YSOA 2C3WA 1CC3A 2NOYA 3G6AA 1LL1A 4QRTA 3PPEA 1EFXD 4EDWH 3JWOC 5L9DL 1TTAA 1KIUB 4LLQB 4IRJB 5ACZB 1P5UB 3JWNH 2YPLA 3VFOA 3X11B 1CDBA 4Q89A 4WW2C 5JIHA 4Q4EA 4I48B 4JRXE 5F1NA 1MWAB 1IFHL 4P2CG 1WUNT 4GKLA 4YDIL 2HX7A 1W72H 4N2KA 3MRQB 1I8UA 3HPLB 3SDCD 3U9WA 3G5XB 4HK0B 3VWJD 4QIRA 3ARDD 2BSRB 1Q72H 1A6AB 1SY6A 4GRMA 4EDXB 3MRKA 2VXUH 1D5MB 5L8JB 2CKNA 3ZMRA 4XNBA 4YWGL 4KO7A 1W6LA 3BFQG 1COBA 3RGVB 4JG0L 1JUFB 1KCBA 1OE3A 2DW5A 3C6LD 3L5XH 1QW8A 1RERA 3T0XA 2CCWA 2J1YA 2QZ5A 3X1NA 5FYLD 2LABA 3WEBA 5LXGL 5G55A 1VGEH 4FABL 1F3DJ 1T21A 1NEZA 3BE1H 5L4FA 1A7QL 2X1WL 1AXSB 4PJ5D 4YFLF 4ZFZA 5A2JH 1H6FA 1SJEA 2HSIA 4M6AA 2AQ3A 4K71C 5D1XE 3TJHD 1DVUA 4NOFA 1LEIA 2YD6A 3TCXA 5AD0B 2Q87A 3BUYB 2WZAA 4MXWH 3QI9C 4Q4IA 5D1QA 2ZSVB 5CINL 3NJNA 4GRLA 1VFBB 2F53B 3SKJL 3LKSB 3HVDA 3BPNB 4ODVH 4R96B 5KEZA 1TTCA 3DETD 1MCEA 5B3SB 3MNMA 2HUHA 4LPUA 4KJPD 4HUMB 5E8PA 5HYSG 3FF7A 1KCSH 5EOTB 4PUBL 4AH2B 2BSTA 2JKRM 5KG9A 4IBWA 1PGRB 5B8CC 2IH1A 3MRRA 3QUYD 1P4BL 2XFXA 3BWSA 4XN7A 3UZEC 4BIKA 3MGOA 4EF3A 5DZVA 3MV7E 2PLTA 4HCRH 3T2PA 3UTTB 1JTTA 5F3FA 3VXSE 2WWKO 1ZA6A 4TNWK 1J88A 3QXUA 3IS0X 4BFRA 4EE2A 3KVDD 2OMXB 3PWLB 4YR6A 1FRGL 2G3NA 2WV3A 5E2UL 4LOEA 1B0IA 4Y19B 3C2SA 2QQNH 1CD1B 2RB8A 3MACH 4N0UA 4PWEA 5FOBA 2AXGA 3RUGB 1DJGA 2C4FT 1E9QB 3HI1B 1W80A 3IXAB 4DW2L 2HCZX 1MW3A 3D33A 1MCLA 4ADGA 1PLCA 1FZJA 1THCA 3AWEA 4K3DH 1JPST 3LNIA 4HEPG 4HIXH 2NY2C 5GISL 1HZLA 4HUCA 2Q5BA 2BSBA 1A1OB 1A6WL 1VERA 5T1LD 5I1AB 3TESA 2IBZX 2WMPA 2VLKD 4HA1A 2CK0L 5EWIH 4CC4C 5J57B 2EUZA 3BQUC 3KGTA 4H20L 4ZPTA 3D85A 3RGVD 3SOBH 1YPZB 3WELA 2Q8AH 2X6BA 1BPLB 2CKBH 5HDBF 5LLIC 1ZLVK 4UIKL 3ME0A 4CU7A 1AGDA 5HGHB 3AG1B 2WYHA 3HNTH 4AEIL 2XN0A 3WL9A 3CHPA 3MCKA 4DKFL 3K74B 2DMBA 5ESAB 3IS1X 2DZEA 5FUOL 1FZMB 2J6WA 1BZEA 1M57B 2DOCA 2QELA 3FOMA 1RMFL 1XB3A 3PHSA 1UM5L 5HBBA 3MRNA 5SWZE 4EUPB 3VRIB 2ZWNA 4OJFH 25C8L 2DH3A 3N85L 1CG9B 5FO7A 3V5KA 3PCYA 4H13C 2OI9C 2GSIB 3JSSA 1NC2D 4K3DL 2J5LB 3TFBA 4L1LA 1TNMA 4UQ9A 1A7QH 1B88A 4ILDA 4NQEB 4V2CB 3BT2H 5TQ0L 4YSPA 1AMYA 5J12C 3SCMB 3VE0B 1UB5A 1EBPA 1CBVL 3BVNB 2HMIC 3NIDE 3CPLA 3VWJA 3O2WH 1CR9L 4NQTA 2V5YA 2IDTA 4JFYB 5FO2A 2BP8A 1XMEB 5HHVL 3PIQA 4FFVC 4HCGA 4X7SH 3TNNA 2W0FB 2XWCA 3U6XS 3RNKB 1ID2A 2OV0A 5IF0A 4RDQF 5IW1B 4KI5C 4P23D 2VXTL 1EMTH 4F1ZA 3VD9A 3QUYC 3CIAA 4XPHL 4YXHL 3SOTA 3IMBA 3GJFK 1BQHB 3WHXB 4HT1H 3APNA 2IBBA 2X4QA 4ZX4A 3B2XA 1CDGA 1I7RA 1R3LB 1JN6A 1F2QA 1PYWB 3IJHA 5D71L 5HHNB 3WMPA 4WFGE 1XV8A 4KUZL 4NZRL 1DVTA 1J8KA 3L3IA 3MV9A 5CCJA 5FYKU 1Z3GH 4KNQA 1XGYH 3PWPA 1IGYA 4LCYB 4ORZC 3EUDA 4FQCL 1QNIA 4ZNEE 4KITB 5LG6A 1B9KA 4JHWH 4AUJA 1GS7A 1S7QB 3EO0A 4AW4A 2PNDA 4OM1H 4Q9QH 4M6ML 2DI7A 5DTFA 3LS5L 1OW0C 4PVMA 3MRLA 4E9WA 2VRAA 1S7XA 4A2EA 3ABZA 1VGEL 5I9QB 4JX0A 3ULVD 5D1ZC 3RUGA 4QRRA 4DNLA 3T8MA 4X0KB 4F3FA 3OLEA 2XN2A 3QQNA 3ARUA 4AGPA 3VD2A 3MBED 1MCRA 5IFAH 1BYNA 4PJGF 1T2QH 1CE6A 2F9BT 2I60L 1OCOB 2IWEA 4PJBA 4YK4C 5EFIB 1LK3L 1SM3L 2VERA 3MV8E 2LFGA 3ARGD 4HBCL 2P3YA 3ULUC 3BP7A 5K5YA 1X3DA 3BAYA 1L3NA 4E5XA 2P7TB 3RIFK 5J8OA 5KSBA 3BDYH 1WT5A 4JEGB 2HVJA 3D05A 1FUNA 2FJUB 2VCOA 3FYEB 3MPCA 1UXSA 4U3CA 4YXKL 5ACZA 3VGAC 1AR1B 1K8IA 2VR9A 5GQBA 4TKWA 4KROC 4MNGA 5I66B 2UX7A 2YXVA 4N68A 4PS4H 3ULVH 4DUWA 1W72L 1GSKA 4D9RD 3LZFH 1TJHH 1EUTA 1QLEH 2OULB 2OMUB 2GITB 1IL1A 1I8MB 1RSFA 2KBGA 2ZUQB 3KWUA 3II3A 1I4FB 3Q3GA 3TT1H 3IDNB 4RSVA 1AKPA 2PABA 5JTWA 1SHXA 1IARB 5HHQA 1A4CA 2EILB 4YZWA 3S97C 1J0HA 5D1XC 1FRGH 2Z34A 3OMZA 5E2UH 2LFEA 1U3HC 2EYTB 5FYJD 1K6QL 2Z6FA 1UA3A 2W9DH 5F6IB 1BQSA 1NCHA 2YD8A 1XXFC 2B4CH 5CKGA 1YC8A 3BKYL 4K23H 2OYMA 2YJQA 3L4CA 5T33H 4U3SA 2NNAA 1T1XB 3VVVA 3O2WL 4F9PC 1QEWB 2R15A 3P77A 4KXCA 4UTBA 2YPVA 1YLBB 5DHYB 3KHOA 4NUQA 4AJ0A 5L0QB 4I1PA 2VZTA 2DQIL 3CH1A 3UO1H 1EA9C 3ARBD 3O9WC 2OTUB 1U41A 2XFGB 3ULUD 1LEIB 1J5CA 3ISYA 2GTWA 1K5NB 2A77H 3CE1A 4AL8C 3ZVVA 4NM4L 3L5WA 5DFAA 4BH7A 5EU4B 1MFUA 3LRSA 4OCXL 1KEGL 1AACA 1AZZC 2BP8B 1HE8A 4P59L 2E6JA 5IT2H 4MJIB 2FGWL 2HVBA 4AYFB 1H6UA 2ICWJ 2J6EA 1JGUH 4N5EC 1GGCH 4XR8C 3NCXA 1KN2H 2ZUYA 3GMQB 4GFXA 4Q0XL 5DMKA 3O6FC 4P3CL 3T1FA 2EQDA 5E1HB 2QHRL 1NFDA 5IVNA 5JPMC 3CSGA 4LMQI 1I8LA 1RURH 3AXIA 4DZBA 3BKJL 3H6JA 2O61A 2VKWA 1NCBH 4AE0A 5CILH 2FLMA 1NIDA 5HI4C 5JORB 4GKOA 1M1XB 4G1MB 2LU5A 4NQUA 4JJ5B 3B7UX 3FDWA 3RWJB 3WNOA 4NN5C 3NAAL 1U8MA 2WQUA 2F18A 4I89A 1A9EA 3ILPB 3VXNB 2ZCLH 4ONGH 3V4PB 4HEPA 3T5WA 3BUBA 4TVPL 4FNLH 1RD6A 1Y6MR 3HMXA 4LU5L 2FYYB 4Y1SA 4JM2A 1LO4L 3GSWB 3LD8C 2GUOA 4KNSA 4AC2A 4J2XA 5AAPA 4NQVA 4A7VA 4UU9B 3EOAA 5DLLA 4GOSA 3IK2A 3WTXA 3BWUF 4J1UA 2VWEC 3EOAB 4MAYD 2F54B 1ZPUA 1R75A 1VF5C 3AGWA 1V8HA 1N5YH 2R0ZL 1H8LA 2EDOA 2Q20A 3DDGA 3ZDXF 4MA7H 2ZPKH 1AQKL 3RHWK 2VUKA 3WUWA 1E5AA 1F0LA 3HE7D 1L9MA 3PNWA 2JIXB 1N0LA 2VO5A 3WE1A 5HHOD 5ICZA 1XIWB 5DK0A 4QEGA 3FUIA 4X99B 5D93B 2CO4A 2DLIA 4FKKA 5J1TC 2R1XB 5DURB 1JXFA 1O9VA 3BN3B 1VACA 4HD5A 4F15C 5C0AE 1TITA 1YJDH 1Q9WA 4K7FA 2AJVL 5KVFH 4FQCH 3FT2B 5CM1A 1LE9A 4MD5B 1AGEB 3HAEA 3VU2A 4YZFF 1BVNP 3ABMB 3ARDB 4WZ9A 4MD5A 5GJSH 1BZ7A 2WO4A 2P46B 3AJ7A 3QNFA 4E68A 5C1MB 5JIPA 2ZOLB 1KXQA 3CHXA 5DJ0B 1KPVB 1ZPLA 2F74B 3MLUL 1JPTL 4NJ9L 2ZOLA 4JDTH 3G5VB 4FCAA 1MWAA 3NJGA 3RZCA 1A6UH 3ESOA 3FN0L 2JQZA 3OKDB 4NQDE 3KYKL 1HILB 2XKNB 3QGVA 5DJ8A 2VDRH 1G7HA 4FG0A 4U1IB 4WHDA 5A16B 3QDGA 2MCPL 4ELMF 4TNWF 4GG8B 3QEGL 4NM4H 5K1JA 4FJ6A 3SDCB 2JI3A 3MZTA 5IMOB 1H3PL 5CMAA 3D30A 4AUYA 2YEZB 4XH2B 4NSKB 1NICA 1QO3B 2W8CA 2ATKB 3PIQB 2D7QA 3BVVA 1I9RH 4JFFE 2A9NH 5I16B 3LEXA 4U1KB 2YEQA 5DRXA 3PREA 3K2IA 2WTRA 3HKZA 4KU1A 2RQEA 4DO4A 3VFRA 1Y6KR 1PZDA 5F21B 4NERA 4QD2E 1KIQB 3REVA 2PR9A 4LVHB 4JY6B 5E24E 5LO7A 3V7AG 5IJKC 2LVEA 4DEPC 2K9UA 2NY7L 4PBVC 3UO8B 1N12A 5GGVY 1CICC 5EIIA 4YZFE 4HPOL 3VD1A 1WA1X 1XVSA 3U30B 4LRNL 1G7MB 1WBYA 1X9UA 2O26U 1UT2A 4DCQA 4OF3A 1XF1A 2B9BA 4KO9A 3VGFA 2BC4A 1P9MC 2EDMA 3CFTA 4A68A 1AVAA 1YEEL 2DI8A 4P5KA 4D9LH 1RPUA 3QHZH 2QQLH 2P24B 2VDRL 3WJJC 1U8MB 1NCAL 3MKGA 5AFAA 4J28A 4K9EL 5DUBA 4MKTA 2XN9D 1I53A 3U83A 2EIZB 4GIAA 2DIEA 4NZUL 4L3EB 3VA6A 1PDKB 5AVXB 2DTSA 4P5TA 2Q3XA 1ZSDA 1RPQA 3IXTB 3SE8L 3CD4A 43C9B 3SDDD 3V7MA 1M7UA 1DQVA 1NCNA 5I6NA 1JBJA 3H6AA 3OKEB 1WGOA 4N9GB 2VR8A 3IDJA 2OJZL 3PAUA 1NGQH 4PJIE 5CGYD 2ZX5A 4OCSH 1YMMD 4CVZB 3K71A 2VZOA 4R26L 2BVTA 5K1NA 1MZZA 1FZJB 25C8H 4JUSA 2K4AA 3F7VB 3LIZA 4HS3B 5BQ7A 1I3VA 3IGFA 1QUPA 5DFWH 4GAGH 3TYGL 3DC0A 4LXFA 1CFSA 2ZCHH 1OANA 3DMMC 5DMIH 1MI5B 1N2RA 2MOGA 3O9WB 3U6XA 3RL1A 5HD8D 2MOQA 2FIKA 3EFDL 2BDNL 5T1LB 5DDHA 3VI3A 3I50H 4NPYA 4XXCC 1WFOA 4AMKH 5E94B 2X28A 2X6CA 4KHTL 2BZ7A 2CJTA 2JCWA 3DVIA 1DBMH 3GBNH 5B8CB 3RL2B 3HI5H 2X4SB 3G6AB 2P8PB 3QQ3A 2DQUL 5FM4A 5J3HC 3BAXA 3LMJL 5LCVA 1KTDA 3U48A 5HPMB 3MLZH 3P3SA 1EXGA 4LU5H 4XMLH 5DR5H 1FDLH 5EZOL 5JA9A 4JB9H 1OOWA 1F4XH 4LBEB 4U3SB 3QXWA 5FA3A 4MNGB 1SEBA 3JVGA 4NQED 5GGRA 1A02N 3G6JE 2NRDA 3Q43A 5CZXC 1NIBA 1P6AB 4XN9A 3E38A 5AB1A 4AIZB 5JPMA 3OKNB 1I9RL 3DMMA 1HIMH 3ZKQD 1FGNH 4WW2B 4AIZA 3EXJA 5KBKA 1MDTA 4Y7OC 2AEIT 2OJ1A 3VQLA 4OBRA 5C9KA 4GI8A 1S7SA 2VE6B 4Z7OB 5K9KB 2GSIA 3LDBB 4D2NA 4ELKB 4OLXL 3NZ8B 3S3JA 2TSAA 3HAEH 2BIOA 3NIGE 3KPMA 4JFXB 3RVTD 2FJGA 4QF1A 5LBGA 1ACXA 1W8EA 5BZXA 3HC2A 4ZRGA 1XH3A 4XXWA 5C0JB 3QISA 1S7RA 2C9RA 3KWTA 4HSAC 4ZMQA 2FLRT 4MD0A 4DQOH 1YEKL 2W0PA 1P69B 3KMDA 4L8CA 4QHMA 4XBEL 1SQ2N 4UILH 4UV7L 5KVFL 4BFEA 3MLWL 4QHMB 3ZT6A 4Z7WE 1E3FA 3BPNC 3ZDYE 3WMQA 1TNNA 5ESQA 2VLKA 1YEFL 1E27A 3JUYA 4NP4L 5C0GA 4XHJC 5GRYA 2L0DA 4J3VA 3VXMB 1BOYA 5IK3A 4AQAB 2IDSA 2YMOA 4K71B 2ZXDA 5ESVA 3LSOB 3C75A 4NKIH 3SGJA 3FW6A 1AI1H 3RWGA 5C8JB 1I8AA 1IX2A 4P2QA 3QO1A 1M9WA 1X5ZA 2WXLA 2NR6A 1XF5B 4R4FH 4XP1L 2A9ML 2YGOA 1F3JB 2NX5B 2O6PA 2VDNH 4XVUC 2V7HA 4XP4H 3ESPA 1NM4A 1L0QA 2V0AA 2DQGH 1MI5D 3KBFA 3O9WD 1INQB 5IQ7L 3X3GL 2R0ZH 1HZKA 4LPTA 2PXYB 1R5VB 3NIGF 2A2QT 2J7LA 3F01A 4F7CB 3C6SB 1HQRA 1AD0B 3WLWD 1P7QD 5IWLC 2NZ9C 4K5OA 4Y0GA 3GEWB 2LLLA 2OMXA 3CX2A 3FSVA 4KGLA 3VRJB 1ORQB 2Z0BA 5IB5A 3II2A 1MJJB 4JFFB 1OLZA 2V3FA 3VRJA 4X7TB 2LTQC 5E4EB 3GRBA 3H8NA 4NP4H 2DQHH 2MFNA 1EZVY 3P4NB 1YAIA 2EDJA 3L1EA 4N0YH 4O02L 2PWFA 3SBRA 2X4NA 2H6PB 3PP4H 5ECJE 4MJHA 4C56E 4N8VG 5DZNA 1A7PL 5CSZB 3V52H 4LKXA 1M6UA 4HWBL 5B1CA 4XE5B 4TQIA 3QIWA 4J3OH 2Z4TA 2FVNA 4OLYL 1T1YB 2MQCA 1YPZA 1IC4H 5B8CA 1PZ2A 2YS4A 3HRZB 1DUZB 3V4PL 3WTWA 1G7QA 4BELD 3NCJL 1XH2A 2J12B 3GEFA 3P9LB 2PYFB 1A6ZB 1UKQA 3MYJA 1YY9D 3SD5A 4ENED 3GNML 5GS2D 1VA9A 3DX1A 3G5XA 4HK0A 5D1QE 5FA4B 1A6VH 4TNFA 5CMAB 4KXZH 5L4MA 3U82B 3QIUB 2ZCZA 4KOBA 2QFPA 4RESB 3RIKA 1H8OA 4AZ8A 3GTTA 4HWEH 4K2UL 1EEYB 1C7SA 3W82A 5KS9B 3GHPA 3QQDB 5J12B 2H32A 1RLWA 3KPRB 2VE6A 5SV4A 2Z31A 4JM4L 3QJSB 1JZ2A 5IBLC 4FS0A 4XVOA 1VZHA 3PJSA 3BISA 3VXUB 3CXHJ 4MJID 3MLVH 2X10A 2J72A 1NA8A 3MBEB 1P1ZB 3B5HA 3NJFA 4P9HC 5CAYB 2FX9L 4KI5E 2GY7B 2YPKA 5CU5A 2XN9E 3L16A 3WIFA 1C1EL 2EH8L 5EIIB 4UM8A 4AENA 3N5AA 4LRNH 2BSED 1NBCA 2IFFL 3ARBB 4LLUB 3VQ2C 4FQ1L 3D4YA 3PU7A 2RQ8A 5TPWL 4YHLL 4MVBD 2QZQA 3UC0H 2WBWB 1VFUA 1EK3A 1BD2B 4U6TA 1Q9KB 2X2UA 3H9HB 2RR3A 3EHBB 2Z4QB 4LSSL 1UA6H 3APDA 2IALA 4XAWL 3HS8A 3AC0A 2HJKB 4ABWA 5TF1L 5INDB 5JHDB 3H54A 3MOAL 3LHPH 1ZDSA 1EEZA 1R3KA 4P5MA 3BD5A 1YY8B 4JLRA 1XCTA 1RUMH 3KBEA 2OKMA 3AS1A 5D6CA 4ZDHB 2XV6B 1ZTXL 2C9SA 2V4LA 4EI6B 3FH7A 5AKRA 1VKXA 2HG0A 1B0WA 3DV6B 5J6SA 1OTSC 3NCYP 4L4VE 3L6FB 4I9WE 4WAFA 1SDDB 4N9GA 2VQTA 1N64L 1J8SA 3H1ZA 5HJ3B 1HINH 1KY6A 2E9JA 3E2HB 2YUZA 3FCSB 4F7MA 1QR1A 4G7YH 3VD7A 2JIXD 3CDGA 1OAYL 3QUZA 3QEHA 4IRSA 3Q6GL 2R4RH 4JG1H 3WS6A 3EYSL 2K0RA 5EO1A 3CQQA 1S46A 5AOIA 5FGBA 4I18A 5FFLA 4N1HB 2JV6A 8PAZA 4HJEA 2GVYA 5DQ9B 2UVFA 5CLZA 3P4MB 3SN6N 4DWHA 5JUEH 2DQTH 4URTB 1RZGB 4HSCX 4AEHL 3AY4C 1O7DC 2XT1B 2XKUA 2V37A 1N0LB 4I87A 1HXMA 3TJEH 4G6AC 2CZNA 3HE7B 3ILQD 4X7CC 5IHZA 4QDGA 1NCDH 3RWDB 2IAMB 1LO0L 1CIUA 3GI8L 5FV2A 3KXFA 5GZND 1NCGA 4LBEA 3O3EA 3ZTCC 2NPLX 4WHTA 5F1NB 3SJVB 1OIOA 5I18H 2Z91A 1KZYA 1FNEA 1ACYH 3O8XD 4G6FB 3ZTJG 4PY7A 2ATPA 3M8OL 1NCOA 4GS7C 2W81C 4HGMA 2YLKA 4ANXA 3EJCA 1DFBL 3KWWB 5T5FL 4JR9L 1JP5A 5BO1H 3L7FB 1JDDA 3EGSB 4U05A 4AC4A 2LAGB 3T1WA 5CWSA 4XP9H 4BGDA 4EXPX 2AEQL 2V2XB 1XSOA 2YXWA 2YPLD 3DHUA 4PJXE 4WEBL 4L3CA 4QXGL 4J3OF 2D8KA 3RDJA 4NC2B 4Q58C 1G1CA 1OGTB 4L3CB 3CZFA 2FRGP 1XGRB 1KCSL 2JNZA 4TUUA 1G1KA 4MNQB 2BP5M 3SDCA 3S2CA 3UGUA 1INEH 4HUVB 2NSMA 4BCXA 1IGCH 1P1ZA 4ODUB 4NXSA 5D7JA 3OGCA 4YL9A 1AYOA 5BW7C 1XQ4A 1OV8A 4LSTH 2JSFA 2ATKA 2YQ2A 1E2WA 1HWHB 2RH0A 1GKOA 2ZG1A 3PP4L 5KBNC 3CZSA 5HHPB 1RZIB 5C0AA 4R2GB 3HZVA 4HIEB 4XXWC 2GBUA 1FJ1A 4R4BA 3QAZB 1Z5LB 4KFZC 5FFGA 1ZS8A 3WEXA 1PIFA 2VDPH 5AOJA 4DP6X 4NQCB 3S5YA 1F11B 5E08H 4IK7A 3CBJB 4L4TA 2YQBA 5F8RC 3AWGA 1AD9B 1QG3A 1RUML 1FIGH 2F1BA 3FPYA 5ILTH 2ZWKA 3TO4D 3L9EA 3TFKD 4N0CD 1FL5B 4BA8A 3CFQA 5E9NA 4XCYA 1TDQA 1RZKH 4QRRD 2APSA 2E4TA 1H8NA 1UENA 5GRZA 1OLLA 4N6RA 2UY6A 4UINL 1BDYA 4LHUD 2IOMA 2WBJD 1F4YH 4MXWL 5MERB 4TQHA 1LP9A 3MVSA 2WIIB 1YUKB 4UANA 2YPVH 4CDHA 5CLYA 5CJQH 4RDQG 1C5CL 3HE6C 4LMQE 2XZAL 4M3JA 5JHBA 1SDDA 3GSUA 3V4UL 4AGOA 4E9TA 4RGOL 4IBZA 3ARFD 1IEHA 4G7VL 4GAYB 4FG6C 1RULL 3A6CH 1KXTB 4FFWC 4NO2A 4P57B 3QCTH 4YSEA 3I9IA 4P4KB 2APWA 1MW0A 1XCQB 5EU3A 4WV1B 3RX5A 4OB5L 1A3LL 2E59A 4JHUA 4P4KA 5EF2A 1AC0A 3MRHA 1IM3A 3II1A 4LLDB 5CJXC 5CSZA 2BMKA 2Y5TA 5CO1A 2JCCA 5FCSH 5E5LA 2GJ6A 2DL2A 1JMZA 4PJ9A 2C1PB 1XB8A 2WLHA 2R2BB 1JZ6A 4K15A 2ID5A 1WZ1L 2B3IA 2CUHA 4G43A 1MJJA 1P6WA 1CS6A 1TVBB 2BSSA 1T1WA 4LO9A 3SQRA 3X2QB 4QY8B 4DOHB 3VDBA 3ULUL 3N44F 1BLIA 4K8RH 2BNQA 4HLJA 4GW4A 5CZXD 5F88B 1LDPH 4ODTL 4R3SA 3QZWA 4YHZL 1JZ5A 2KZWA 2RFXA 1MREH 4CN1A 3PGCA 2R0WL 5B1JA 1K3ZA 4CN6A 4ZXBD 1WZAA 3WHE0 4EUPA 1LE9B 2ZOWA 4POZD 1CFNB 1AKJD 2FHBA 1HINL 4OF8A 1GXEA 3FXIC 2R69A 1KYFA 1FVEB 2GJZA 1C5DA 1FBIL 2B8OT 5D2NA 5GS2H 3UOAB 1V3LA 3MRGA 4LP8A 4X6CF 1AJ7L 5FGRA 4DN3L 4Z7VB 1FWXA 2N7BA 3ME0B 3WEMA 5J9PA 5E23A 3ULVE 1W8OA 3P9MB 1BVLA 4V1DB 5DC4B 1PEZA 3BVNA 3MXVL 5HHMD 3NJHA 4HF5L 2J56A 5T3XH 3UPRA 2CAKA 2ICEA 1QPPA 1E6OL 3VO0A 3FT0A 2Q2EB 5IMOA 3DPBB 3EDDA 5K9KA 3I9GL 4LDCA 2MEJB 1CIDA 4U7MA 4Z3JA 2WUCL 4UYPA 3DYOA 5I1DB 3P3UA 4I8DA 3WKQA 2AJSH 1F3DH 2FH6A 5EF3A 1XF2B 4XOAA 4M6MH 2JK5A 1UM4L 2NYYC 1C08A 3MO1A 3H85A 5IJCC 2DLHA 1MQ8A 1ADWA 5F89B 4ZUWA 1A4AA 2PTTA 3CU7A 4PJCB 2PW2B 3NRPA 3WSQH 4UQ2A 1VFOA 2GKIA 3E8UH 2AJXL 3BUPA 1UWFA 1KGUA 3OC8A 3E6HA 3FU0A 4WU5B 5BO1L 4P2RB 1BG9A 5AB9A 1ZDQA 3ZE0E 2NX5D 4LK4A 5DYOB 1NAMH 2K6ZA 1X5KA 1F2XK 1F42A 4W4OC 1WA2X 3O3UN 3C6LB 1ZWIA 4D8OA 3TEZA 1CE1H 1AFVH 1G7LA 1MH5A 3S36H 4GW5B 3V0WH 5LNDA 4HIJA 4U1SA 3DXAE 2UVEA 3K6OA 4MAYC 2C9PA 3HNVL 4S0TD 4YIQA 4FQIL 5L8LB 4ZD3H 3LN5B 4OVVA 3QJHB 5K39B 1GY2A 1NFDE 4NC1E 4WSKA 1INDH 4KRPC 3D9AH 2IH3B 1DQKA 3QJHA 4J4PA 1HX0A 4WO4A 4YHKL 1AY1H 1I8KB 2CA4A 4O2FB 2E6PA 4XPAL 1IB5A 1XR9A 2CR0A 3IETB 4LEBA 4Y4KC 2EACA 1AIZA 3P4MA 4CUCA 1Z6JT 5IW3A 2KLTA 1GZQA 2QKIA 1K8DA 5T3XD 4B6ZA 4L4TD 5KVFE 2HTKC 2DWTA 5FKPB 1S7QA 4ALAH 3SYAA 5ES4B 2M1KA 2I85A 2BVEA 3L81A 4R83A 2DBLL