2J57A

X-ray reduced paraccocus denitrificans methylamine dehydrogenase n- quinol in complex with amicyanin.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMICYANIN
publication title Tracking X-Ray-Derived Redox Changes in Crystals of a Methylamine Dehydrogenase/Amicyanin Complex Using Single-Crystal Uv/Vis Microspectrophotometry.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 23
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2j57A00
2PP7A 5ANHA 1L9SA 5I5JA 5IY5B 2IDSA 1KV7A 3TBCA 3PPSA 3KW7A 2HX8A 3CVBA 3UACA 3IBOA 4A66A 1W6WA 4A67A 3X2QB 3WIAA 3TASA 4YSUA 1J9TA 1PNDA 1TEFA 3WKQA 1HFUA 2YARA 5D4IA 2PLTA 2PCFA 2PP9A 5PCYA 2PPDA 4JKNA 3NJFA 5TK2A 2IWFA 3HB3B 2CBPA 4KO6A 1JZGA 3PLYA 3SBQA 3ZX1A 2UXVA 3CZUB 1BEXA 1HAWA 1GW0A 1MG3C 2CAKA 3NSCA 6PCYA 3TU6A 1SF5A 2BZ7A 2DWTA 3NYKA 1OOWA 4E9QA 2GC4C 3MBWB 4HAKA 2I7OA 3WI9A 5F7AA 2ZXWB 3DKHA 3EH3B 3NT0A 5B1KA 4RH4A 4HCFA 3U25A 1ET7A 5LDUA 2FJSA 3ERXA 4YSRA 2FTAA 1A3ZA 3EH5B 3PCYA 5I28A 2OCCB 3ZBMA 1A4AA 5I26A 3FYEB 2PP8A 4DPCX 1JZHA 1MZZA 3S8FB 1OCCB 1SFDA 3OMIB 4YSEA 1GY1A 2FWLB 3H4HA 2DY2A 4AX3A 3NSDA 5I6LA 3C75A 5I6NA 2J55A 1J5CA 9PCYA 4WKXA 1J5DA 4DPBX 1WA2X 2XU9A 2BWIA 3L45A 1ZIBA 3KW8A 1GS6X 3CDZB 1OE2A 2HZHA 3ABKB 2FT6A 2CUAA 1AQ8A 3D12B 1J9QA 4KO7A 3S3CB 1ILSA 4DP1X 3FQ1A 2PPAA 1BXVA 5B7MA 2FQFA 4N4YB 1CUOA 3V9CA 1L9QA 3EH4B 1IKOP 2R7EA 1PF3A 1PZAA 1SDDA 3AY2A 2H3XC 1L9TA 2FQDA 4JHVA 2IDUA 7PCYA 2VM4A 1JERA 2YAPA 4YL4A 1AOZA 1KGYE 2UX7A 2XV2A 3OQRA 4GY4A 2I85A 5B7FA 3AG3B 2IWEA 1V54B 3NP3A 2HRGA 3DTUB 1V55B 4AZUA 2Y1AA 1IC0A 1JXFA 2GHZA 1IBYA 1BXUA 7PAZA 4TXVB 2YAQA 5AZUA 2JXMA 4A68A 3UABA 5I6KA 2TSBA 3UAEA 2ZOOA 3CDZA 4HHWA 4F7KA 5F7BA 2YXWA 4YSCA 2QDVA 1OE1A 2BWDA 4CSZA 3RYMA 2XYBA 3FSVA 1WA1X 5D4HA 2UXFA 2XV0A 1NIAA 1PLAA 2UXGA 1A8ZA 4E9YA 2J57A 2BP8A 1RZQA 3DIVA 1CC3A 4YSDA 2RACA 4K9JA 2XLLA 3CVDA 3H56A 1WS8A 3NSYA 4GP5B 4YSTA 1BQKA 1N68A 1AZUA 3SBRA 6PAZA 1ASOA 5I6MA 3FQ2A 4BWTA 4KOBA 1KCBA 2LLNA 3PAZA 1ADWA 3FPXA 4X4KA 2VW6A 2A3TA 2XX1A 3FU7A 3FU9A 4N8UA 1OF0A 4PCYA 2XVBA 4ZK8A 1W8EA 2N0MA 1GY2A 4GP4B 4A2FA 4BWWA 1BYOA 3TBBA 3HEIB 4NERA 2X88A 3GYRA 4DP7X 3FPYA 4JHUA 3SBPA 4DP6X 4DPAX 2GBAA 2FNWA 3JTBA 2BO0A 2IDQA 3ZDWA 1SF3A 4P5RA 1KDJA 1GS7A 5A7EA 4KNTA 2GIMA 1HAUA 2PPEA 2WO2B 3WG7B 4ENZA 1NIDA 1NDTA 2QDWA 2R7EB 1SDDB 2VSMB 4AKOA 5B7EA 3IEAA 2TSAA 4A2GA 1JZEA 1FFTB 2BP0A 3NJMA 3NJLA 4KO5A 2J5WA 4BWUA 1AG0A 1BXAA 4GYBA 1GR7A 1AG6A 2NRDA 2UXTA 1PZCA 4WTQA 1ZPUA 3QJUB 4YSSA 2I7SA 2DYSB 3T6XA 2HX7A 1E5YA 4G7RB 4AKQA 2YAMA 1NWPA 2EILB 1QNIA 1AS7A 2EIMB 2FT8A 3N2JA 1I53A 1L9RA 3QJQB 1BQ5A 4MFHA 1M9WA 2OV0A 2VMJA 1NZRA 1PY0A 1M56B 3IN2A 4UAHA 2PCYA 4KOCA 2YAEA 3TA4D 3FYIB 4FAAB 1BAWA 1AS6A 3WNIA 1A4CA 2CJ3A 3S3BB 3N55A 3SQRA 1PCSA 2BW4A 2BP8B 2GC7C 3NJIA 4CSPA 1KBVA 2HLEB 4BXSV 1YLBB 3BQVA 2MTAA 2OJ1A 3IE9A 3EF4A 2W88A 4NB7A 1RKRA 2Y69B 4UANA 4E9VA 4Q8BA 3X1NA 4FA7B 1FWXA 2GB2A 1FA4A 1L9OA 4G7SB 2IAAC 2IDFA 3QJTB 1CYWA 3MX0B 4BK5C 3WKPA 2IWKA 1JOIA 2VW7A 2XXGA 2XX0A 3BVDB 5FC9A 1CURA 1SHXA 1NTDA 3ASOB 3FU7B 1JZFA 3ASNB 2AANA 1WA0X 4BXVA 2J56A 1ETJA 2QT6A 3ABMB 2FT7A 4KO9A 4E9TA 1SJMA 1J9RA 1AR1B 1GYCA 2AVFA 1AZRA 5TK4A 1BYPA 2IH9A 2DV6A 1EZLA 1NWOA 2XXFA 3ABGA 4HHGA 1NIFA 2XUWA 4QKTA 4YSPA 3T6WA 8PAZA 4DP5X 1QLEB 1PAZA 1JXDA 1OCZB 4YVNA 4NAJA 2BZCA 4G7QB 1AIZA 2BP0B 1TU2A 4A2HA 2YAFA 2WSDA 3T6ZA 3QJSB 1J9SA 1BQRA 4M3HA 3ZIYA 1AZNA 2PPCA 3UGEA 1SNRA 1TEGA 4G71B 4UF7C 1AACA 1IUZA 1X9RA 3UAAA 1NPJA 3FSZA 1ZDQA 4GP8B 2JKWA 1E30A 4E9SA 3NJNA 5B1JA 1AANA 4YSQA 1UATA 2GI0A 2MRYA 4HZ1A 5B3SB 2Q9OA 1CYXA 2H47C 4PAZA 4F2FA 4HCIA 2BHFA 3X1BA 3AW5A 4DP4X 3NSFA 4HIPA 1L9PA 4EF3A 1NICA 1B3IA 4HALA 4Q89A 2YAHA 1KDIA 2VN3A 5EHFA 1MG2C 2VSKB 2XV3A 4AI7A 5I5IA 1KBWA 1OE3A 5PAZA 1AZBA 3V9EA 2AZAA 1AZCA 1ASQA 2P80D 4W9ZA 4L0PB 3G5WA 4AKPA 1NINA 3JT2A 4DP9X 2CCWA 4G72B 1XB6A 2CALA 1PMYA 2P80A 1E5ZA 4DP0X 1JZJA 4HCGA 1ZIAA 1PLCA 3NJJA 2UX6A 3AG1B 3FSWA 3FSAA 4YVUA 1OCRB 3CG8A 1VLXA 5B1AB 4E9XA 1WS7A 2AFNA 3NJGA 5B1JC 1OCOB 1M57B 2XWZA 2YXVA 1ET8A 1OV8A 2EINB 1ZV2A 1PNCA 1XMEB 3NJKA 1E65A 4DP2X 1T5KA 2YAOA 1DZ0A 1JXGA 1W6LA 4A2EA 1PLBA 2AZUA 3QPKA 5I5MA 3NP4A 1NIEA 5B1BB 4DP8X 4E9RA 1TKWA 1AAJA 3NJHA 2GSMB 1X9UA 4GXFA 5I6OA 1JVLA 4BDVB 2DYRB 1GSKA 3QQXA 5D4JA 1ID2A 1KYAA 2QPDB 1E67A 1DYZA 4YSOA 1IBZA 1ET5A 1URIA 2EIJB 2JFCA 3FS9A 1A4BA 1EHKB 3GXUB 3T6VA 2EIKB 2HXAA 4F2EA 3PXLA 4W1TA 1R1CA 1SFHA 3FU8A 1KCWA 2IDTA 3OD3A 4E9WA 1WAEA 2YQBA 2VM3A 3FT0A 1XB3A 3ABLB 2DWSA 3QJVB 1A65A 1MDAA 1N70A 2HX9A 2E86A 3OMAB 3H4FA 3GDCA 4KNSA 5E9NA 4G70B 3CVCA 5I6PA 3T9WA 3S3DB 3X1GA 4QLWA 4KNUA 2Q5BA 3S8GB 3PAVA 3UADA 3X1FA 1V10A 4BDVA 1QHQA 4M4RB 3FQYA 3AG2B 2ZONA 2X87A 3AG4B 1JZIA 1MZYA 3PAUA 1XB8A 5AFAA 2WO3B 1ZDSA 3X1EA 1JVOA 3AZUA 1GS8A 3T71A 1NIBA 2VW4A 1ASPA 1RZPA 2W8CA 2ZWNA 4YSAA 1NPNA 4P5SA 2BW5A 2FQEA 1PZBA 3IN0A 5AKRA 2PPFA 3OM3B 3QJRB 3EHBB 3OMNB 4A2DA 1RCYA 2B08A 3WNJA 2B3IA 2QPEB 2IH8A 1F56A 2FQGA 2HRHA 2H5UA 1SHWA 1ILUA 1AS8A
chains in the Genus database with same CATH superfamily
5HYSG 3T3PB 1TCRB 1J1PL 4U49A 5FUZH 3P30L 1B9KA 4FQIL 2WWMD 2APSA 3TASA 4UMGA 2RR3A 3DV6B 4HPYL 5HDRA 5IHWA 3GINA 5JPNB 1G1KA 2PLTA 4PHZA 1CU4L 1VZGA 4NUPA 2HT4C 4J6IA 3KDMB 1ZT7A 3VH8B 3TZVC 3QUZB 2KYIA 2A4EA 1OP9A 1XL6A 3P0YL 5TK2A 2D7TL 2YZ1A 4WAFA 2XJKA 4APXA 1DLHA 4N0UE 4IBQA 3LPGA 2E6JA 3PWPB 3ZX1A 3LN5B 3CZUB 5T3XD 1SOSA 3Q1SH 4OT1H 3II3A 2BZ7A 2DWTA 3HG5A 3VFVA 4KJWC 2IOOA 3RL1B 2C9RA 1HNFA 4Z3JA 1A7PH 2V2WA 3OQ3B 3QQ4B 1NDGA 4W93A 5K9QG 3O3DA 4Y5VC 5CJQH 3RA7H 1JSYA 1NC4B 4B0MM 1QVOB 5B1KA 4RQQB 1EJ8A 1FRGL 3CZSA 2JVUA 4H8HA 4I1RA 4LL4A 4M6ML 4O02A 3U9PH 5MENA 3B5TA 3H9SD 3EH5B 5GGRY 3GJFB 2J88L 1SMAA 3ESNA 4JCMA 2YR3A 3PCYA 5GHWL 1OGAD 5FO2A 3LIZH 3O9WD 1QSEB 3X3FH 1XR8A 3H9SA 3GMLB 4XNBA 3QUXC 4GS7C 4EOWL 1QYGH 3V2AR 3NH7H 1NGQH 2VT0A 3G7TA 1BQHA 4PWHA 5E08H 2YD8A 2YGQA 3FQXB 2GI7A 3BQUB 3RY6A 4A7TA 2NDFA 1QR4A 4CN4A 1NBQA 3ZMRA 1MCPH 1SDAB 1KTDA 2YPVL 4YXLH 3EJYC 3O4LB 3Q5OA 4UV7L 4QNPE 4QDGA 3C75A 1GZQA 4D0CB 2R9HD 1BIHA 4RIRA 4BFRA 1J0KA 3C09C 4OQ1A 4B27A 5I8EA 4TVUA 4UQIM 2EIZB 3MRBB 5BUAA 3O0LA 3KW8A 5I23A 3MV9D 4GKSA 4ENED 2JE8A 3ABKB 4N86A 4WI9A 1J9QA 4K9EC 3EYOA 4P04A 1HDMA 2ICWI 4QEGA 1AE6L 3LN4B 4EIUA 3MV9A 1BXVA 5JW4M 3SYCA 1CUOA 1ZXQA 4LOUD 5FM5O 3BD4A 3ILQD 1GC1H 2WTOA 3FCTA 4Y4KC 3VWJD 2ZUQB 4NO2B 1T1WB 2NW2A 4C4KT 3X11A 4JHVA 1YSOA 3V9FA 5IJVA 5D6DC 1PSKH 4H7VA 4U1NB 3V6OC 2I9LB 3ETTA 3F12A 2Z35A 4I0PA 2X3BA 3FU0A 4LSQH 5ALCL 2EQDA 5EO9A 2J43A 1XIWC 3EJZC 5DRNA 2BM3A 2UUDH 4BH7B 3GHEH 3LS5H 3LRSB 3NEXA 5DK0A 4TL5A 3QFDA 2VLME 3L3OA 2J1XA 3ULVF 2ODIA 5KANG 1UACL 3WY1A 3DBXB 4UV4L 1OSPH 3SD5A 4BFEA 5BS0B 4OU3A 4ELMA 3HI1B 2VJ0A 4KXDA 4N1HB 4PD4K 2C3HA 2D3JA 3VD0A 4AEIH 4YHKL 1J18A 1IGFL 1MRCH 3I02A 5ALBL 5IQNA 2UXGA 3QDJE 4N6QA 1A8ZA 2AQ1A 2A6IB 3IDXH 4YSDA 1SXBA 1ZHKA 1E2ZA 4YSTA 1N3NA 2XRAL 3MJ7A 1U3JA 4PIBA 4E42B 4JM2B 4JFVA 3GS4A 1R9FA 1GYAA 4U1SB 5CSBA 4XP1H 4OCSH 1UD6A 4PJDA 2QQNH 4LF3B 4OJDH 3QEQD 2G2RA 1KCBA 4FQQA 4HJ0C 5HD8C 4XMTA 3EFDL 3MV11 3PAZA 5IJKC 1OSEA 2F1EA 1OALA 5IR1B 1FL3B 5KYNA 3QEQA 4YPGB 3DIFB 4MYPA 1PDKA 4PP1D 3T5WA 3F7LA 1N8ZB 4MJ6A 1EDQA 2I25N 1MQ8A 4ZMZA 5F1SA 3GXDA 1HHIB 1ZVSA 3JVFC 1PU0A 1S4IA 4HKXA 2JKLA 3VXTB 3VDCA 1S78C 2OSYA 3O3UN 4S1RL 5CZXD 3JTBA 4YQXL 3WXVL 4FFWD 5AKTA 2DH2A 1RZFH 3KPRD 4GIPD 1ZLVK 3VE0A 5IHUL 3FU3A 2AP2A 2EYSB 4MDIA 5IQLA 4U3CA 4M00A 4LOFA 2D0HA 3KPRA 4GQZA 3HBZA 4TM9A 3A67H 5L8KB 1IGCH 3VU1A 4E9LA 2VR7A 3ALWA 4EZMA 3VFNB 1AMXA 2FGWH 2XVLA 5CD5C 2NZ9C 3OKEB 1T1YB 4NKIH 1FFTB 2W9LA 3KWXA 4KHXH 3SPVA 5DURB 4NPKA 5IB3A 1YCSA 3G6DH 4CU8A 2J5WA 3ZGIA 1N4XL 3LNDA 4Z7QB 3EOBB 4Z8FL 4DN3H 1EZVX 3WHE1 4FXGB 1FNFA 1P2CB 1SEQL 2I32A 3DUUB 1OEZW 3LEYL 2WBXA 4U3HA 4H0GA 1TQWA 4WTQA 1LVEA 1A7QH 1B4JL 1QEWB 1KXVC 1O9WA 1HXKA 1OTSC 4KK8C 2XN9E 4M4PA 4QWWD 3VRJA 3BXNA 4I8DA 4PJDF 5E2UH 1EX0A 4N2AA 3QJQB 5T1KD 2ARJQ 1MPAL 3GB7B 3F58L 4G2AA 3AROA 4NPJA 1Z0MA 3BSZL 3H0TB 2RFXA 1YN6B 5DQDL 4AYEC 5T1KA 2X2YA 3QISA 3UBXA 1AS6A 3KYAA 1TVBA 3QZWA 2CJ3A 5I2IB 1EEYB 4HJGB 4XNZB 4CSPA 4K3DH 3RBGA 1AGCB 2FBJH 4Z23A 3B8YA 3VWKB 1F4AA 3EF4A 1Q72H 4PRHB 4NB7A 2J1ZA 2Y69B 1WVZA 1XR9A 3GHBL 3I6GB 3K81A 3V79C 1UXLA 3MUJA 4JUSA 2CU9A 5J57B 3QUMH 2QSQA 1JCKA 1ID5I 3WKPA 4HMEA 4M48H 2OMYA 3MGOA 2XX0A 4FNSA 2F1AA 3UTQA 3MO1A 3RWIB 3LQAH 4L29A 2FECI 2HJFA 3MRKB 4KX9A 5JTWA 1IE5A 4D2NA 1V7NH 3QI9A 4M7LL 4F7PB 2Z4QA 1D6VH 5KG9B 2GUOB 4XE0A 3NPZB 5ILTH 4KO9A 1XGPA 3MJ9H 5FV1L 5C97A 4B9IA 5TDNA 2H3NA 1NCNA 2VRAA 4ZDHA 4PRAA 4QAWA 3B56A 5FO7A 1MQKL 1I8UA 3VI4B 1ORSB 3PFQA 1R3JA 5EOQH 1BF5A 1J8HD 3AM8C 3VXSE 5HGBB 4QPEA 4OKVB 2X1PA 2CGRL 4RWYL 2WYIA 1A6WH 5AVQB 3HOGA 3RZWA 4QRSB 1OP3H 3U36A 5L6YL 1J8HA 4HUUB 2GTZB 4YGAB 3BIAX 4NO5A 1Q0EA 1QRKA 3ZO9A 5E94A 1AZNA 4PWJA 3L7FB 4Y4HD 3GZKA 3QIBA 1L5GA 1MJJA 4PJ8D 4UTAA 3F7PC 2DS4A 2B20A 1CFTB 2CKBB 4Y4HA 1ZRUA 4XB7A 3RVXD 3D25A 1CGVA 1HEHC 3GSXB 2WLJA 4LU5L 1SBBA 1AANA 4JFSA 1KZYA 2I26N 3DTXB 1GJWA 3BP6A 3DVGB 4TUJB 3BMVA 5JXED 6FABH 2O93L 3A6CH 2VXSL 5DVPA 5B3SB 3QEGL 3MBEC 4CW1B 3T3ME 3FRPB 4KTGA 1U0QA 2OULB 4JRYD 2QELA 4M5ZL 5MEQB 4JKPL 2Q8AH 1U8CA 3W56A 5HYFA 1A6ZB 4JRLA 4JRYA 5AD0A 3UG5A 2H45A 3IFOA 1JK8A 3V4LA 1PZ5B 2ZX9A 1N12A 1FYTB 2X41A 4IRJD 2AZAA 1UKQA 4W6YB 4RMWA 1KIUA 3N1QC 3IDYC 4I2XA 2CCWA 4IRJA 4TL4A 4RFOL 3D39D 2Z92B 3C8DA 1Y07A 1S5IH 2EE3A 4X5WA 1ZKAA 1RHFA 3P3TA 3AAZB 1YYML 1HIML 4HYTB 5KUMA 1WFUA 3D39A 1WS7A 2QADD 5D7JD 1KYDA 3KD4A 1U95A 3W5MA 1TMQA 1QPPA 4GXUN 4UT7H 2FAUA 3F05A 3JZ7A 2YAOA 4UDTB 3TNMA 4DAGL 5D7JA 2APVA 4JFFB 4FI7A 4HWUA 4D9QD 5D2LB 4FHKA 1VFUA 5C3LD 4X6DA 5EU6E 1EGJA 1Q94A 2A77L 5KJ4A 2WLLB 4OZGA 1NCOA 5L8JB 1XO8A 5KS9B 4OH2A 1T4KB 4CNIA 2R4RH 1NMCC 2AI0L 2BZDA 5I1HH 4NXSA 2ICEB 4UAOC 1P69B 2VMFA 3OXRB 1KCWA 2YD1A 2K7PA 1HL5A 5C0CD 1WAEA 1TXKA 4BZ1H 4OM0H 1LWJA 3GMQA 3WEXB 3GZQA 4F8NA 4FLOA 1LQSR 4G8GE 4IMLB 5C0CA 4JJHA 1AP2B 2OMXB 5D55A 5J11C 2F8XC 5F96L 1DQJB 2Z93B 3ATBA 1LILA 1M1XA 2E3VA 2OPCA 2HG0A 3PWUB 4JY6B 2EUVA 2X4PA 3KPQA 4AM0A 3IJ8A 4KKNA 1SBSH 3JWOL 3BEVA 4R96B 3WMPA 4PJGA 4JFYA 1XF4A 2FEEL 5DZOA 3VI3A 4OZ4A 3GK8H 3WE1A 3S3SA 5KWYC 2ZONA 1D5IL 3L4YA 1Y1UA 1QTYT 4KPHH 3P9WB 2FX9L 4NZTL 3L16A 4N85A 1LDSA 1EJFA 4G8IA 2N1KA 6CGTA 1XF1A 1GGBL 2ZYRA 4G5ZL 2IH3B 2QR0A 2VKXA 4MYWB 1FHGA 3ZDYE 1LEIB 3A24A 1FF5A 1U8JB 4OGQC 4BSVA 3QG6A 2DQEL 4PBDA 3QAQA 2DI8A 2C3XA 3MRGB 5I1EH 1KYOK 4R26H 3TT3H 2OXHA 2PO6D 5BRZB 4OZGF 5F7LB 1DLFH 2EEFA 4OGAC 1M6OA 2NLJB 4Y7OC 3CH1A 2WINA 5DLML 4WFHE 4HIXL 5CEXA 4Y16D 2EZ0D 4Y2OA 5LXGL 5GIRA 5FS5A 4M8RA 5TPWL 1C08B 3K6OA 2IV9A 4HUVB 5DA0B 3ABZA 4LHUD 3S4SB 4Y16A 1FFNA 3FCUB 3IGAB 4HT1H 3DC0A 4L2LA 4LEXL 2GJPA 5D1QB 1YDPA 4EQ2A 1AGEA 5LWYL 1I9IH 1EZSA 2CDEA 1CFVH 1OQOA 4ACPA 4W68A 3TVMC 1Q9WB 4ZQTA 1CO1A 1UOKA 1UD2A 4TTDD 4U1GC 4WWKC 1HHKB 1HEZA 1T2JA 3NYKA 5TE6H 3AGVA 4ALAC 4GUPA 1CICD 3WIHH 1A6VL 5AW8B 5F7AA 3RWGB 2V2TB 4P3CL 5FWQA 1MKFA 1JZ6A 4NRYB 1CICA 3C9NB 3KM1A 3BHBB 5DI8B 2R23A 3L95B 3NIDB 3VI3F 4YOKA 1DFXA 2F53B 2FTAA 4X42A 3ZQWA 2ENQA 4NNXA 3UTTE 4HUMB 5FHBL 1BQHG 4CMMB 3U6RA 2BVQA 1CQYA 3SKJL 2EVHA 3OHMB 4OJYA 4HUWB 5KVDE 1AD9B 4K3GA 3B6SA 3GSOA 4FYTA 2J8HA 2AQQA 3NCBB 3O8XB 3PABB 4O58H 4V2BA 1UTDA 4ZFZB 4Z77B 2CLVA 3BYTA 4NNYA 5DS8B 3G5YA 4O51B 1QUNB 3BWSA 43C9B 1YEGH 1ROCA 2WXQA 2H4EA 5I1AB 2AV7A 3A6BL 5AW9B 4LASL 3TO2B 5IW6B 5EFIB 3MI6A 4X6EA 1M4KA 1A1NA 3D69B 1OM9A 1YEDA 3CFJA 4MQTB 4N2MA 3QAZB 4OLZH 4S10A 2KPNA 4MTMA 3LEVL 1TZHA 5FPIA 5GS0H 1HHHA 3TWYA 4L4VE 1HINH 2B1AL 4OD2A 3H6AA 3T0EE 5KYYA 2E9IA 3W1ZA 1CLYH 1NCDL 4JZJC 3ULUE 5EEZA 2BWIA 3T77B 1ZIBA 3SGDH 4K3JH 5BZWB 3AU0A 4TVSa 5HDBE 3EG9A 2YUWA 3NQIA 3SDDB 4U1HA 5J5EA 4PV9B 4FQLH 3EZJB 5FV2A 3MNZB 4UCFA 4Y4FC 4NP4H 5DZLA 3VD7A 4A7VA 1AGBB 3B2VL 3LQZB 5KVFL 5E8EB 1OXYA 3TEUA 1OK8A 2VLJB 5CN3A 3Q06A 3CVIL 3QUYC 5HY9B 2GEQA 3DRQA 3BPLB 1OL0A 2BERA 4ZSOA 2NY3C 1AQDA 4GKLA 5ETUA 1C5BL 1RP9A 1HJBC 4NQVA 4AH2A 2HRGA 3GSVB 3BISA 1DP0A 5A3IC 2VN5A 1WBZB 2HJKA 4GXVL 2Y1ZA 5GGTL 5HYQB 3KCWA 1JXFA 1QPKA 4MAZA 5DUMH 7PAZA 1FNHA 3EBAA 1EEZB 1UM5L 4IMKA 4PG9B 2EUXA 1DSFL 2FYYB 1DCEA 2NXYB 3MRCB 2PW2B 4TSAH 1IEAA 1ADQA 4O2EB 1UJ3C 4BQCA 5HJ3B 3EADA 5FW6A 4QD2E 2YK1H 3FSVA 4XHJC 1S5HA 2Q76B 4ZFGL 2DF3A 1IAKA 3FCGA 4N0CC 4EVNA 1QLRA 1IBHA 5LG6A 2BP8A 2I5YL 4NAMA 3S2AA 2JWYA 5T3ZE 3CQQA 1Y0LB 4WV1A 3GD1C 3QHZL 2JKTM 4QO1A 1PS3A 5KBPA 1DL7L 2JCCA 3IFLH 3JZYA 5DYOA 3II1A 3FMGH 4WY7H 5SWZE 5INCB 5FR3A 2OR7A 2LLNA 1TTBA 2W9DH 3SCMD 4DNLA 4Q4IA 4H0HB 3QUMB 4KQ4L 2FD6L 1SHMA 2IXQB 4F5CA 1TPXB 1MAJA 4AQ8C 2Q7AA 3VG0L 3VXRB 4LVOB 4J1UB 3SCMA 3EJPA 3SQOH 2GSGA 1M7DA 4HPOH 4XMVA 2N7AA 4MXVF 2A4ZA 4TQHA 2Z91A 2IOMA 1AO7D 3UEZA 4P2AA 2NSXA 4L3FA 1TG8A 2PYFB 3ZL4L 3ARYA 4ZNEA 1U8IB 3L3JB 1AO7A 2IDQA 1HZLA 1EBAA 2LQRA 4X0NA 1ZANH 3T09A 2QQQA 4TVPL 4GIAA 3BZEB 4XZUB 1ZSDA 1WPCA 3Q2WA 1N6UA 5HVGB 3ME0B 1G7QA 1T3FB 2GYSA 4ENZA 5JR1L 2V7NA 3CXFA 3KJ4C 2QDWA 4IOSD 4NO3A 2XQYA 1TIUA 4ATWA 3SPGA 3UCRA 3UTPD 2ARJA 3JV0A 5D2NB 5DEJA 5DO8A 3UMTA 3Q05A 1AI1L 4NT6B 2BP0A 3MRPB 4FABH 4MBOA 3F8UB 4IOSA 1AJ7L 3L1OH 1WDAA 5F7DA 4B9KC 1H3WM 2Q86B 3MOBL 1RIUL 3MZGB 2L7JA 4LIQL 5DJ6B 3K2IA 1DJYA 2WQUA 1AG0A 1OAZH 4GYBA 3DVIA 1AG6A 2OTWA 2OJZH 4PB9H 1PZCA 5B22A 4OIBA 1YNLH 4YSSA 5TE4L 3EBGA 3QWOA 3B5GA 3O45A 3QFJE 4G7YH 4X6CB 4XCYB 4DO4A 2Z31D 3FFDB 2FT8A 4QRUB 5HI3D 3UBXG 5MI0C 3ULUH 3QZWG 5EUOB 4MFHA 4PJHA 1M9WA 2GY7B 3VTTA 2Z31A 3LZNA 1M56B 1TETL 2AEQL 1RJYA 1GGCH 4R5XA 4TSCH 5BOZG 5ICZB 1E9QA 3FYIB 2OI9C 4NC1E 4AJ0A 4DVBB 1O5DT 3U0TB 3RX7A 4WFEE 2BW4A 5ECJE 4B9JA 2HLEB 1UFGA 5IHBA 2QGBA 2LTQB 3IE9A 2Q3AA 4EQ3A 2ZSVB 4XNMA 1FORL 3DPDA 3LOWA 4PWEA 1F8TH 2V37A 1I1AD 2AXWA 3ZMEA 4KZDH 5KUKA 3LS4L 4ZFQA 2ZCZA 3QDGE 4WU5B 2HKFL 1S7UB 2O4EA 4LSUH 1I1AA 4DZBA 4MHHG 2ZD0A 3QORD 3UAJC 4WF7A 1TVHA 1YUHB 1FGNL 3VM7A 2B1OA 4K3EL 2A9ML 5CD3B 2O5YH 3QFGA 1NTDA 4YIQA 5IW1B 2FHCA 2IGFL 3V5HA 4PY7A 4OFVA 4PEEA 1MNNA 3JYBA 1GW6A 3EYFA 2F15A 5IKCB 1A8JH 4NC0B 2X6UA 1FL5A 3VFOB 5BJTB 4YHMH 4M7KL 3QDAA 5AAPA 4X83A 2JELL 1WEJL 4KDTA 3GMMB 3Q7JA 5CO1A 3IU4L 2YRPA 3EOTL 5KANI 1HYSD 1VKXA 2EIDA 2HFGH 3VTMA 4IRSD 1E5BA 5EZIH 3V52L 5T3ZH 1JTOA 1OTTC 4BKLB 3WIFB 4IRSA 3IRPX 4PS7A 1JN6B 3X17A 1AHMA 3V0GA 3NA9L 3BH9B 4IU2B 2CBQA 4PJHF 1MEXL 2DQTL 2O5XH 3R8BB 1A25A 1V3KA 1JK9B 1FLTX 4NYLA 4GT7A 1MHCA 5BUGA 1G6RA 1RP8A 2YBRA 3RFZC 4AIZB 2R0WL 3HKFA 4UF7C 3TBWA 1WAAE 1UJTA 1MCDA 2OMUA 4V11A 3KWVA 3PL6C 3F7KA 3PQYE 1E8WA 4V1DE 3VACA 4XXWA 5M94B 1MXGA 3RVWC 1VACB 4XHQA 2X9ZA 4P2YA 4JY5L 3V4PA 5CBAB 4RISH 5I74C 3BT2H 4JVUA 2VLKD 2HP4A 4K5OA 4HZ1A 4OFYA 1SY6L 1PEWA 2Z7ZA 2Q9OA 2YPLD 3WO4B 3V95A 4UIMA 1WD9A 2K8QA 2VLKA 5AYQA 2JJTA 1I1YB 3HW7A 5D7LE 5IUCA 2CMRL 1QUPA 4WNQA 1TTGA 2YPLA 1ZTXE 1B3IA 1T83C 4DJMA 4DOHE 4N0RA 3TJHC 4JFED 4ZMXA 3K6SA 3HS0C 2CM5A 4NOFA 5JHMA 3K6NA 3VXSB 3PXJA 3U1QA 4YDLB 3MZTA 2HFEB 8CGTA 1AZCA 2B1HH 4JFEA 2Q3ZA 2VQ1B 1I7ZB 2YMXH 5FDWA 3FNKA 5D1XA 3FH5A 5GSVA 5D6CB 1N26A 4K71C 2XVGA 1LE5A 1UKSA 1EAJA 4ECNA 3QUZD 2V6HA 3QXDA 3FSAA 5JPNA 4DW2H 3VXQB 1FO0H 3ARWA 2Z65C 2WBJB 1ZLVH 3VH8A 2WMPB 2BIIA 1SQMA 2Y7LA 3PWPD 3QUZA 4HLZG 3SD2A 5EC2B 3RTQC 3CQFA 3SN6N 3W81A 4UOW1 4Z7UB 4AYSA 3NAAH 1U91B 3BLPX 1KLUA 5BV7C 4YXKL 2FEJA 5GGSA 4YPJA 1PAMA 4UM9B 2V17H 3QPXL 4Y9BA 1WWWX 2F54E 2R1WB 1NC4D 3BYYA 2IV8A 2MPAH 1GSMA 2Z34A 4JDVA 2AABL 4OCNC 3BIKB 3QQXA 3RL1A 1IBDA 4BYHA 3QQ4A 4NNPH 3QCUH 1JG9A 4FLQA 2KPWA 1QVOA 3GBNL 1ACCA 3MGTB 1HCFX 3NFSL 4XAKD 4NM8L 4JPWL 2AJVH 4G6FB 3FRUB 3GKWL 4PS8A 1QSED 3G6JB 1KENL 3GJFA 4PD4J 2MQGA 3CXHK 3T0AA 2VM3A 3WO3B 5FYLE 2FUTA 3DVNA 3LKQB 4JHAH 2A5UA 2EYRB 4EN3B 4R4BA 3HE6C 4XPBH 3FCBA 5IMOA 3BQUD 3GBEA 2HX9A 3I85A 3MA7B 4NLHA 5KVGH 2YKLH 3N85H 3QCTL 3O4LD 4XX1E 2OA9A 5GZNC 4JHBA 4JPKH 1U8KB 5LCVL 4S1QH 2BH0A 3MNVB 4BDVA 1Q38A 3O4LA 1Q9KA 4LZKA 1SOQA 4K7PY 1MZYA 4FCHA 3NACH 5EU6B 5FWRA 3AZUA 3P4MB 5IB2B 3HNTH 1LDPH 1XF2A 2FEDC 1R4XA 2EIZA 3MRBA 1KJ2L 4K2UH 2X4UB 2PWGA 4ZFOB 5LGKA 3A4EA 1U3HB 2JB5L 4LSTH 3EHBB 1X5HA 1T22A 2YWYA 2Y2WA 4NUJB 3LN4A 4PREA 2LABA 3V4VL 2AS5M 1INDH 3ATDA 1ILUA 1D6EB 4PVMA 4G8GB 1RXLA 4NO2A 1T1WA 5DEZA 5IY5B 1T1ZB 4FFZA 3IDIA 2XQBL 3QPQC 4PRNB 3KGRA 1QQDB 4U1NA 4HWBH 2XWDA 3X2QB 1J1XH 2Q2EB 3QNFA 3MRMB 1ODUA 2NY0C 2CJUL 4NSKB 4LPCA 3SKMB 4M3KB 1Z9OA 3UMNA 4BH7A 4HSQA 2IF7A 3EOYG 2WXNA 3HI5L 3KYNA 1F6LL 3ZL2A 2HTKD 4CILA 5BS0D 2YXFA 3C08H 1M05B 1UUNA 2UXVA 1UH3A 3DBXA 1PD1A 3QIUC 3QZNA 4FFYH 3U7YL 2XFXB 3SDYL 5BS0A 2YEZA 1FCGA 3DJRA 3HI1A 3NUKA 4PJXE 4NRXA 1CLZL 5CCKH 2DQGL 3O2WH 4KKZA 1IEBB 2CO6A 3Q5YA 4P5TA 5C0FB 1KGCE 3GDBA 4FI6A 4P2RB 1U33A 4UT9L 1KWKA 4DKEL 3U25A 3MFFB 1KXQA 1R5WB 2A6IA 4JM2D 3HG1B 4PJ9C 4D3CH 1MCJA 3SOBH 2AK4B 4K94L 4Z78B 3Q6FB 4L8SB 4E41B 3GIVB 3W0WB 4Q6YA 1R3IH 2ADFH 3KLAB 4H0LC 4MVBD 4U1SA 2D03L 4AGNA 4PG2A 4MLSA 1QNZL 3MCYA 4JY4A 3LH2L 4LF3A 4ZOCA 3GBML 2PP8A 4UOW0 5DRXB 2LAGB 1FL3A 1EK3A 2E27L 4ZW7A 4NKDB 4YPGA 3DIFA 4KKCD 2KC0A 3FB5B 1TQSA 4FJZA 3ARDB 1HHIA 4XAWL 3UZVA 4WU7B 3BGMA 2WAHA 1NGXB 2GK0B 1LNUA 4J3OF 3WFCH 1QI3A 1YEWA 4R97B 3H53A 1AMYA 5IVOA 4OUOA 1JFQL 4JN1H 3BAWA 5BCAA 2WGNB 2EXTA 4Y2NA 5T1MB 4BFKA 5IBUB 1BHGA 3R18A 1A9BA 1A7NH 2YGVA 3S3CB 3CSGA 1JHKL 3UTTB 4Y9CA 4LAQH 4N4YB 2A7BA 2AGJH 3HUJB 5DURD 1RUMH 1YJDH 3DHPA 3Q9QA 4P3DB 1IAMA 1F58H 3OKEA 1T1YA 2XSKA 3DX0A 4AC4A 1FNSL 4XN9A 3ATEA 2XV2A 2OBGA 2BSRA 3BWUF 1BFSA 4LVHB 2H2PD 3ZSTA 4ZPTA 5TH2B 4FXGA 2BIQA 2M8XA 5D7KD 3DTUB 1VDGA 4JFXA 3QP3A 5T3XL 2Q3XA 3HR5B 2ZKHL 3P3UA 2BVTA 2WQXA 4F57H 1YYLL 2V2XA 3MYZA 3AREC 4M7ZC 1BPVA 5DT1H 3MLWH 25C8H 2VB5A 3DOSB 3GB7A 2VXQL 3UAEA 5I30H 3BP5B 3T0EB 4GG8B 1YN6A 3VTAA 2XV6B 2VDML 5BNXD 3GPEA 5DRWA 2B5IB 4ZYKA 2MHAA 5LQBH 3FT4A 3VWKD 1XSJA 2K9UA 3M6DA 5I2IA 4PRHD 4OV6F 3CFCH 4H20H 1EEYA 2CM6A 4HJGA 3DIVA 4IK7A 4U6VL 2ZF9A 3KPLA 1AGCA 2PYEB 5E1QA 1F90L 2ADIB 1N68A 1U8LB 4X4ZA 5EMYA 2FHFA 3FSOA 1CFNB 4Q9RH 1X7QB 2BFVH 4Z1PA 5FFGA 2KLRA 3ZHDA 3I6GA 3PUCA 3SGJA 4EAEA 4MWFA 1XVSA 1KIRB 3K7UA 1F4XL 3IU3A 2O5ZH 5EO1B 1FIGL 5FGCE 1JGUH 2Y07L 3ZZ1A 2BXZA 2X70B 5GPRA 4HISA 5F9WB 4YDKL 3FU9A 3N9GH 1G5GA 1IGYB 1RAMA 3QCVH 3MRKA 3F85A 3U30B 4AGOA 2Y25A 3TL5A 1BPLB 4F7PA 5KG9A 3GYRA 1ZXKA 4TQIA 2VRQA 3FCSB 2CO2A 4J3SA 3DO3A 1N7ML 2BSCA 3OMZA 2QKIB 4K3HA 4P2QB 5FCSH 4Z95H 1BIIB 4PCSA 4Z3FA 4DKDC 2CIKB 3N0AA 3L9YA 4D7BA 4WENB 2EVGA 1TSHA 4I13B 1KG0B 1ORSA 4ANWA 4XPFL 5HGBA 4PJEF 4HU2A 2WWMC 2QZQA 1JWMB 3Q48A 3F01A 4QRSA 1A3RH 1RUKL 2GTZA 5DS2A 4G3YL 1TTFA 5AQ0A 3GRBA 5FHAH 1W0WB 1Q0YH 3OVUB 4I89A 15C8H 4PTTB 2P42B 1KB9K 3HMXA 1IO4C 2P1YA 3C5ZB 4R2GB 2WYZA 1VPOH 43CAA 2I7SA 5C7ZA 1BZ8A 5F88A 3T6XA 4WO4B 4G7RB 4AVIA 2BFGA 3WIIH 3CHSA 3DTXA 3DVGA 4QCIA 4TUJA 2EILB 3WEBA 4AIOA 1L9RA 3V5DA 2W80C 1I7RA 2CHZA 3MKGA 2P43B 3FRPA 2BVOA 1LO0L 1HTYA 3CH8A 4FMFA 1TJIL 4EPSA 4QHNB 4AGMA 1F4YH 3CZEA 3VFSB 3L08A 5MEQA 1FYTD 5BVPH 5JHLL 3L4UA 1CI5A 4NQSB 3KWUA 1A6ZA 1LHZA 2EICA 5CN1A 3RNQB 1PCSA 3CDFA 3EDDA 1PZ5A 4NI6A 4KI5E 1YLBB 4ILDA 3BKMH 3LDBB 3O9WC 5C7XL 5EV7A 4NBZB 4GG6E 5KSUA 3MSPA 4PJAE 2ZAHA 1CDJA 3K0YA 5EORH 1RKRA 3RY6C 4X9GA 2VDOH 4Q8BA 5CP3A 3IETA 3WLWD 4Q9QH 2C9SA 2GITB 1YAIA 1L7IH 4PRDA 5IB5A 2QPFA 2IWGA 2ZCKL 1JZ3A 5FGSA 2BNQB 4Y5VB 1IGMH 3WSQH 1XGRB 2I07B 3DDFA 3CUPB 2DOCA 4CADB 2NOYA 1KYOJ 4C55A 3SDAB 5FC9A 3F84A 4JFFD 1FO0B 5JIIA 4JR9L 3HNVH 4R8WL 4ORGB 2R9HC 4UDTA 1QSZA 4M1DL 2YQ3A 2AJYL 1RK7A 3NEOA 4GEIA 2BS9A 2WLZA 5GRVL 1RERA 5D2LA 1AHKA 1C5CH 2OL3H 2HMIC 3ABMB 2CBOA 2FT7A 3HZMB 4ENEC 4JGNA 4GT0A 4RFEA 2WLLA 4Z7OB 4JVPA 4JPQA 1RV6X 3SYAA 1WV7T 5ICXB 1BWMA 3EFFB 4LOUC 1T4KA 3ILQC 4BJLA 2QQKL 3ARFB 4R83A 3VWJC 2EEXA 2ICEA 2A1WL 5IZ7A 1TQVA 4WJG3 2CO4A 1MFAH 4X8JB 1HHJA 4WGKA 3MYJB 4LSPL 3N1PC 1QD0A 2J20A 4QHPA 4G7QB 4LP5A 3WEXA 2XQ0A 2A99A 2JQAA 3BVNB 3KWWB 3MC0A 3SYOA 4G82A 4HVBA 4G83A 3FOLA 1U4EA 1UASA 3T6ZA 4IMLA 4L05A 2BSDA 1HXYA 5HHVH 3MOAH 1AP2A 3ML8A 4ABUA 1MI5B 5I15L 2J7LA 2OYPA 1VF5C 3S36X 3L5JA 3ZR6A 3L8QA 5HJBA 2W95A 1ZT4B 3PWUA 4I85A 5E8DH 3UTOA 1NCUA 3TCLA 4XPTL 3ZQ9A 4JKMA 2IIJA 4KJPD 4R96A 2EDQA 1DANT 3CFEB 3AITA 1QR1B 3MLYL 5JQIB 4PV1C 1P5UA 4PN6A 5H4YA 1KGXA 1RZ7H 3X12B 5AVUB 4JZOB 4RGMC 4OZIE 4FQCH 2ENYA 4DP4X 3CN4A 4M5SA 1NICA 1DFBL 2IH3A 4GAGL 4XP9H 2F5AH 3FB8A 3T1FB 5DD1L 3VGHA 3HBGA 5BRZD 5EU4A 3ZY7A 3CLEH 5PAZA 3IVKB 1OP4A 1KF9B 4JDEB 2QLYA 2R2EB 4PGDB 5BRZA 1BQLL 2QGCA 2VDRH 3MRQB 4W70A 4HG4K 3PREA 1BZ9B 1HXMB 2NLJA 1G94A 3NCYP 4ODSH 3CMOH 2XPGB 1AQKL 2G5BB 1IM3B 4NZFA 5TFSL 3NJJA 1XH3B 3IMUA 4PP1C 5DU7A 1OCRB 3CG8A 1VLXA 2VN4A 1J9CT 5B1JC 5D1QD 3QZBA 2RQ8A 2VERA 5DGQA 3S4SA 3BSHA 1T5KA 5GRZA 4AUUA 5KSAA 3V4UH 4PWFA 5I0WA 5CZXC 2LW3A 5D1QA 2ESVA 1M6UA 2C7FA 3DGGB 1Q9WA 4FFWC 4XB3A 5EBLB 1HHKA 5IVZA 3TCTA 4UBDC 2G3MA 3EYQD 3TCXA 3MNWA 1W8NA 3OZKA 1QABA 3OBAA 4OCMC 1G43A 3PDOB 3VXOA 4DOHB 2Y7OA 4WFFE 1RL1A 5HHPA 2F53D 2ZSWB 3ECVA 1MHPL 2JFCA 5DI8A 4BCYA 4H1LB 3L95A 1ERNA 3NGBC 3B37A 4N2FA 1IGIL 5A16A 1H5BA 5C2BH 1UFUA 4Z0XB 1HN1A 2F53A 2LFGA 2A6DB 2ZOKB 4YBLC 3UO8B 2OX5B 1M2VB 4PW4A 4ODXA 1RZ8B 4L0YA 3AQXA 1OP5H 4OLYH 3WFDL 2CGYA 3O8XD 2PR4L 1N6QL 1OAUH 1AD9A 1IU1A 1G7JB 1UD3A 4AYGA 1KPRB 4A6YH 5JW4N 3TBYB 2LU7A 4JRWA 1N70A 3PABA 2YGNA 4U0RB 5ITFB 5DS8A 4O51A 4OQTH 43C9A 3R1GH 4WHTB 3RUGE 5IFAH 2WJ7A 1BVZA 4N0UA 5I1AA 4DO5A 2COVD 4MHHI 1X5JA 5I66B 4C59B 4LDLB 3MLXL 1RUPL 2H26A 3LAFA 3PAVA 1N6VA 3D69A 4JFOB 5F97E 2YRLA 3AG2B 3G9VA 4JFDB 5GZOD 3UJTH 3US1A 3BZ5A 1Z9NA 4TLKA 1NIBA 4KUZH 3LNHA 4ZTEA 1G9ML 3SDDD 4JGJA 1NPNA 1UADC 2ZG2A 2NX5E 4PS4H 3T77A 2AF2A 3IN0A 3T08A 3WNLA 4KXCA 5BZWA 3PXHA 3LB6D 4PRBA 4P5KB 1BP3B 5DLLA 5B1CA 4AJYV 2VLJD 1UM6H 4FG6C 5I1JL 2OAAA 3SE8H 1DBAL 2B4CL 3JSSA 4J3OG 1AGBA 3LQZA 1NGPH 5E8EA 4LCCA 2VLJA 3KZ8A 2R15A 2H7WA 5HY9A 3RWHA 1F11B 4Z7VB 4OM1L 4P46B 2DZEA 3FQ4A 2IBZY 2P8MA 1LYQA 3LVEA 2ZOUA 2HN7B 3APNA 4X80H 4NUGH 4XVUD 4Y89A 4OF0A 3CFKA 1MCIA 3GSVA 3OJVC 4XVJH 4RRPA 4HJTA 4WEBH 3A4AA 3VGAC 3NJFA 2P48B 4PPTA 3BUYA 2JB6B 1T80A 1A64A 1OWRM 3DIDA 5ESAB 1G7MB 2NXYD 3H9ZA 3PGDA 5LXVA 5JIKA 2X4QB 5FOBB 3REVB 2FYYA 1NBVL 2PW2A 3D30A 2JJWA 1EJOH 2YN5A 4XMPL 3LRMA 4O2EA 3B2DC 1KJMA 1OAJA 2WWOA 1RJLA 1QMUA 5GJTH 2VMDA 4BKSC 1T21A 1JNHB 1N64H 1LP9E 2VZSA 5LBVA 1UWEL 3BDYL 2OR9H 2KS0A 3AS0A 3INUL 3BKCH 4N0YL 1TO5A 3S48A 3B83A 1OAXL 4Y4HC 2P24A 4ZJ9A 1GGIH 4X5PA 2DTML 4MSWA 2V5YA 4Z3TA 3VCLB 3GMPB 2LOEA 3TIEB 5INCA 1C12B 1ZAGA 3GZPA 3VXRD 4RMUA 3RVXC 5JIQA 4Z7AA 2FO1A 1EVTC 2NT0A 3OC5A 3QUMA 1OM3L 3I50L 4YDZA 2LFEA 5JXEC 3VSQA 3HHSB 3VXRA 4J1UA 3WY3A 2FWLB 2HJLB 1LO3L 4Z18A 4EEEA 1WHOA 1NKGA 4B53A 3HG4A 4R3SA 4FOMA 4IOIB 4XMLL 1GIGL 4BFJA 2GAZB 3RWCB 4PJXB 3NMEA 3GSWB 1U8IA 1G9MC 1S2EA 2F58H 3WNPA 4JPSA 2VO8A 2VXVH 5AZEL 3MJ9A 1UWGL 4PJFE 1SMDA 3AJ7A 4IRJC 1AGFB 3QDJA 3BZEA 2W0LA 1PKQE 4M5TA 4XZUA 4ZOEA 3VXUE 3D18A 4OLUL 4QNPF 2B4CC 1T3FA 1HCYA 1MCWW 1IKOP 1NLBL 3PF2A 3CFNA 3ZN6A 4XVTH 1YEKH 4XN8A 3MBEB 5D2NA 4YWGL 1FAIH 3KVDD 4NT6A 5JW5B 3HMWL 2QADC 3O81A 1XH0A 3MRIA 5D7JC 3ZDXE 4JQXA 5I75C 2Q86A 2I85A 4X0KB 3N06B 2WIIA 4HCRL 4IJ3C 5JW3L 2IWEA 3UC0H 2ENPA 1V54B 1ACYH 5GGUA 3DX1A 4AENB 1IT9L 5I1GL 3THML 4KX8A 2P52A 4M43H 2XG4B 5ADPH 1KLFB 5HHNB 5I1DB 2HVJB 3B2XA 1FN4A 2DBLH 4BZ2H 2VDKL 1KJ3L 4WHYG 5HXMA 4QRUA 3MRRA 5AL8A 4MMYB 4AVHA 1MCQA 5AZUA 2H9GB 4FZEH 5I6KA 1HSBA 2WZ6A 1CFSB 1PQZB 3S5ZA 5JOPE 3C6LA 5IROD 5C6TL 4KTDL 2UZPA 1UWXK 1F45A 4AL8L 2ZXCA 5D4HA 3LZRA 3ROLA 1BOYA 1MREH 2E0PA 4XBGB 4ZD3L 5I18L 5JQHC 3QRFM 5AZ2L 4JG0H 4DVBA 3U0TA 3ZYOA 1NANI 1U8NB 1H6EA 4K7FB 4P2CG 1BJ1H 4ZUTB 4F58H 4AYDC 3DGCR 1CMOA 2X6AA 3Q6GH 1P9MA 1F4HA 3KNBB 4MGXA 4BBWA 3NABH 2ZSVA 5J13C 2E76C 1OAKH 3W9EA 2WM0A 3J2PA 1F02I 3NOIA 2V3EA 4WW1B 4WU5A 2P8LA 2F9BT 3CSTA 3GRWH 4B96A 3LZPA 3IJSA 1A0QL 1I85C 1PVHA 1MVYA 1CF1A 2VW6A 1O6TA 1YUHA 4L5FL 4WUKH 3S88H 4IDJH 1UXMA 3DI3B 5IW1A 1DBBH 5D70L 2WSPA 1KY7A 2XVBA 2XN9A 4Y5XB 4ZK8A 3JWDL 1JRHL 1CDYA 2AJXH 4ONFL 5IKCA 3MJGX 2X0VA 5C0RL 4F9LA 2IBGA 3VFOA 3ZTJG 5BJTA 2MKLC 1WCBB 1UH4A 2X88A 3PHQA 2OL3B 5D8JH 2WC7A 2KBGA 4ELDA 1QBMH 4OLVH 3AWGA 3NN8A 2YA0A 1UCBL 3UG3A 2H0JA 1XCTA 2PO6C 3RIFF 2G75B 3QQDA 1R0AL 3NK4A 3KDPB 5EEXA 1DCLA 5BMFH 1JN6A 1FZMB 5D72L 3ZL1A 3HI6H 2C3WA 3MUUA 5EIQA 3OJDB 3N43F 5B7EA 3RI5F 3P4LA 1EXUB 4NZ8A 4EXKA 5TE7L 4Y16C 1XZ0A 2EZ0C 5SWQA 4BZ1A 1JK9A 4U33A 2EDJA 5CILL 3VFUB 1GH7A 5EBMA 5FGCB 2WYHA 4K8RD 4AIZA 3HAEB 4P48A 2VDPL 2OTPA 4B3EA 4AGQA 1RIHH 1T2QH 2HAZA 3WAJA 1GR7A 1A1MB 3AU1B 5AYUH 2Y22A 2M83A 3CXHJ 1LO5A 5CFAA 3QJFB 4TTDC 3SE4C 2XG5B 1I1CA 3DROA 1CB4A 7FABH 1A7RH 4EKJA 3QR1A 1WZ1L 2WUCH 5E5RB 1R19A 1CICC 2ISDA 5ACZB 2R83A 2KHAA 35C8H 4ZXBB 4OLXH 4AL8C 2L0DA 3KXFE 1K4CB 4XN7A 3R06B 4BSJA 2C1OB 1BJ1J 5FGBA 2CLRA 3RZCB 2UZIH 1CL7L 3VXSD 3BWAB 2R0KL 3MJ8A 5DUPL 1NCWH 3C2AH 3N55A 3VXSA 1LK3L 1KBVA 3BPOC 3MXVL 2ZAGA 2EDNA 4LE8A 1P1ZB 4WK4B 4JO4L 4GFTB 5DZ9A 4XVSL 3HJEA 2PW1B 2GB2A 2VDRB 2OCFD 3MOQA 3B1UA 3KE0A 3MRLB 5IB1B 2WBJD 5KVDL 2QHLA 4X9IA 5F7MC 4FKKA 3MX0B 3W38A 1WZAA 1VFMA 3WU1A 5MEOB 1B2YA 4MJ4A 1YHPA 2VW7A 1UWYA 2X44D 3LVTA 2WBJA 4JZNB 2WMPA 3WN5A 2V4LA 3FU7B 4L18A 4IGBA 1K8IB 4UM9D 3FO9A 3CMGA 1U8PA 3LKNA 3P9LB 4Z7UA 1P6WA 1MAML 4NENB 4CMHC 4UM9A 3QNYB 3A47A 2WZPA 2R1WA 2WIMA 3MUHL 1SJMA 2MCPL 4ACTA 1AR1B 5CWSB 1D2PA 3BIKA 2D9QB 1SLUA 4FADA 1TTAA 4AITA 1GTFA 1H3PL 3NG5A 4G6FD 4DEPC 4W4OA 2DV6A 3UJIL 3WIHA 2EDHA 2XXFA 5I16B 1I8LA 3GF8A 5D9SB 4U2ZA 1JF5A 4ONHB 4TSBL 4EZKA 5T33H 1CE1L 4OV5B 1JGEB 2ED9A 1F42A 4PJAB 4X8XA 4ODBD 4EN3D 4J4PD 3LKQA 1FG9C 2J8UE 2EYRA 1W80A 4JREB 4OF6A 4J4PA 4MCYA 1SNRA 2P5WE 4X7FC 4BSWA 1BA9A 4JG1H 2P9RA 1D5XB 4IMKC 4QXVA 1FFQA 4A6YB 3MA7A 1JZ8A 3FSZA 3OAWA 2FEEI 5E9DE 1SUJA 4FYSA 5EU6D 5BZDB 1U8KA 3JTTB 1ETB1 3MNVA 4YSQA 2MRYA 3D8MA 4UZGA 3TYGL 4J6RH 3I9IA 1QFHA 2NYZA 4WQOA 5GS0D 4WHCA 2ID5A 4IRZH 4RGNE 5EU6A 4KNQA 3PWNA 3BUBA 3P4MA 1KCKA 3HZYA 2EDXA 1U3HD 5IB2A 3AWFA 1SLVA 4NQXA 2QV4A 5EUKB 2O61B 3U46A 3T4AC 2XTJB 4ZFOA 1NCCL 1U3HA 3KPOA 4I3SL 2VN3A 4EE2A 4G8GD 4NUJA 4LPUA 4JRFA 3T3MF 5K9KA 2FK9A 3H7BB 2YJLA 2DEYX 1XTLA 1D6EA 5HHME 1NINA 4NKMA 5HDLA 5EZLA 2UWEE 1TLKA 5C09E 4G8GA 2NY6B 3SCMC 4QHLB 1T1ZA 1Q90A 5MHSD 3P3YA 4ZOBA 3OKOB 2E5EA 4MX7A 4QRPB 4XB8A 3S0PA 5FA3A 5DSCB 5EF0A 3MRMA 1T7VA 4DWHA 4F7MB 5CLWA 1SN5A 3SKMA 2AQ3A 3QNZB 2OMWB 4FP8L 2GHWB 4UZSA 3I75B 1GAFH 1LL1A 2VZVA 4QJ3B 3FB6A 5IVNA 3GIZL 4QKXB 1AGDA 1FVDB 1M05A 1MCHA 3ULSB 1FE8L 4APQB 5D7HA 2O6PA 2XFXA 4GQQA 4ONGH 3MNDA 4OZIB 1C5DB 3O6ML 1GSKA 1P84J 2NT1A 4LCWE 5D4JA 3WENA 5I9QC 1JJUA 1IEBA 4HK3N 4LLDB 1HVXA 5DK3A 4ZPVA 3TH3T 2NW3A 2VABB 4ERSH 1R3HB 1IMHC 5AW4B 1ET5A 2A74B 3HG1D 1VAHA 1RUAL 1KIPB 4GFXA 5DVKA 1PZUB 2AK4D 3SE9L 4DGYL 3BZFB 2HWZH 2X9YA 4E41D 3MFFA 3W0WD 1G6RL 1G5AA 4XC1L 4I4WA 2AK4A 3OD3A 1OHZA 4F9PA 4Z78A 1A4JB 5F71A 4L8SA 3CX5K 4E41A 3GIVA 4FXKA 4GUCA 3KLAA 4WWOA 1T03H 3U1SH 1P0SE 1IBBA 3FZUD 5E4AA 1L7TL 4IHOB 3H4FA 3KMDA 4XCNA 5E4EC 2Z31C 4KUCF 3ARDD 2OFQA 5HI3C 1YPZB 4YDVB 5HYSB 3W9DB 3IMWA 4GAAA 2VUYA 4XMKL 2V3DA 1V10A 3ARDA 3L3DB 4WU7A 5GGQH 1MHEB 1IC7H 1NFDB 1GS8A 4ZFFB 2APXA 4D8OA 1BBDL 5F6IB 5ACMA 1WGVA 4WI7A 3UTTD 5T1MA 5IT2L 2AAVA 3NCCB 1I1AC 3UTTA 4IYKA 4MAUH 1TSRA 3WE6B 4X6FB 1X5YA 3HUJA 2H5UA 1S6NA 3WY4A 1H15B 1L0QA 3H3BC 4KKRA 4WVRA 1X3DA 4F92B 3MUZ1 3S98A 5I8KH 4ANVA 4UMSA 1YEFL 2COQA 2K4AA 3QORC 3ZDYF 4GAFB 3KW7A 2HFFB 2R8SL 3BC9A 2IAMB 3SKUD 1J9TA 2G2NA 3DYPA 5SWSB 4QLRA 4ZS7L 5AB0A 3K71B 3ESVF 3OHXA 5TH2A 2ZZUT 2EVFA 3RUGB 1Z5YD 4PJ7B 3U4BH 3PE9A 2AK1L 2IDCA 2HKHL 3S37X 4TRPH 3PLYA 3T0ED 3V7MA 1HYSC 1C7SA 2C4XA 1E43A 4G6ML 1AR2A 4IRSC 5E2WL 3ES6B 4LCIL 5FW7A 1EAQA 3BP5A 3T0EA 1DQTA 3SDXE 5DJAB 3FT1A 2I7OA 1ZTMA 5FYJU 1E4JA 5C3IA 3A0OA 1OY3B 3QQ9D 5HI4D 1TZ8A 4XI5D 2ZKYA 1U8MB 1P4LB 3OGCB 5JNYA 4XCCL 3DETD 2PYED 2C9PA 1QFPA 3K4DA 3M8OH 4LCVA 3UDWC 5LDUA 1OAQH 3FJTA 3O6LL 5I71B 3HJ0A 1BLNB 1X5AA 2PYEA 2FX8L 4RZCB 4I18B 1YNKL 2ADIA 1RIVL 1CFNA 4XXWC 1A47A 3FHEA 2KUTA 1RZKL 1BYNA 1KCVL 1NSNL 1S7VA 1KIRA 5I26A 3ZKSD 2EDWA 2HVKB 1ZVYA 5EO1A 1WGOA 4DPCX 5F9DC 1RZJH 2PMZA 3BN9D 3NJVA 4HJ1A 4NN5C 4FYQA 5EZPA 2J8OA 4A7QA 2J5LC 4UB0H 3ZE1B 2JLLA 2WZ0A 2JJTC 3K3QA 3MLRL 4XCFL 1IGYA 3BH4A 3EOAB 1JPFA 2IJ0C 2QHRH 4UTBL 2EH8L 4XWOD 1U8HB 5CJ8A 3IGKA 1OANA 3V7AE 3D4YA 3IXAB 1NMAL 4MJ5B 4P2QD 4M5YL 3L6FB 1MFEL 4JFZL 5KEZA 1MRDH 1U93B 3FCSA 5EOTA 1R17A 5AG8A 1RI8A 1TFPA 1EMTH 3PY9A 2XU9A 4WNJA 3K0WA 2CIKA 2RH0A 1GS6X 2DWEB 1OE2A 1E6OH 1LP9B 3QO1A 1G4RA 5EZOH 2GQHA 3LKRB 3D12B 3HC0A 4R9HA 3OG6B 5F21B 3DURA 1KG0A 4FX5A 4K7PX 5JPNC 2NUPB 2Y6TE 4NWUL 2HG5B 3FTGA 1YY8B 4XT1C 4MQXD 3HCVA 5D4QA 1JWMA 3T65B 3QUZC 3CVHA 4PRIE 3ULUF 4Z7NE 1ZMYA 3R19A 5SWZA 2VM4A 2YAPA 3C5ZD 4R2GD 1E4HA 1DHKA 5HDBF 4GSXA 4H13C 4TUKH 1FH5H 2DLFL 4MKMA 4JM4L 1A22B 5KJRH 5CIPH 3C5ZA 4WO4D 2PCFB 3IDUA 1IL1A 5EIIG 4G9DB 5KVEH 2W91A 1NM9A 2J2ZB 4A39A 4ESKA 4WO4A 1IC0A 4M6AA 2YEQA 5FIEA 5IMLA 2FWSA 3QULB 1P4BL 4AIXA 1NQBA 1TF4A 1P53A 1J05B 4PB0H 4AG4L 4G9FE 3M1BB 2X3AA 4NZDA 3DX9B 5TF1H 4HHWA 1RUQH 1S46A 1GGUA 3WTSA 1OE1A 4N0FA 4CSZA 2BVPA 4L1BA 3RYMA 1PKQB 4BINA 4NQSA 1SXZA 2BMKB 3RNQA 5IGXL 2EDMA 1IKFL 4PMFA 2EH7L 3U2JA 2F19L 4JFQA 2A38A 1WS8A 4EZJA 3O11B 2BNQD 5CNHA 3BQUC 4LK4A 3SBRA 2HH0L 4OJFL 1GZHC 1REIA 3SYPA 3NZUA 5L8LB 2SODB 2WTRB 3SDAD 4YXHH 3FT2B 3MACL 4GI6A 1XGRA 4KTEL 4ZTPL 2I07A 2DQCL 3LHPL 1M9SA 1CWVA 3CUPA 4CADA 3Q0HA 1HL9A 2IOIA 3SDAA 2XX1A 2XWEA 1FO0A 3KYKL 4HG4J 4DO6A 5E6YA 3EYSH 3FU5A 4U3SB 5CEYB 5AVRB 5IK3A 4GP4B 2VXTH 1V27A 5TJWK 4UOJA 4FMKA 5K9JH 4NERA 3WTXA 1EZUA 5J1AB 4G6KH 1XBRA 4LMQI 5CF3A 1UEYA 4X4YA 3GI8L 4QHMB 4WFED 1CF8L 5C0BE 3ARFD 3ZTCC 4HXBH 4Q9CA 2ZUQC 5HJDA 5ICXA 4ZTOL 3IDMB 1M7XA 3ESUF 1KB5B 5TQ2L 4DHLA 4NUQA 5F9OL 1S7TA 1DE4B 1K2DA 4U1KA 5E00B 1E8ZA 1KGUA 3HLAB 4X8JA 3UP6A 3MYJA 3QRBA 1F18A 3I6KB 1OSYA 4Y9FA 3T0XA 3BVNA 3KWWA 1MI5D 1W0YT 3QDGA 5B38G 1IBGH 4AVJA 3NJLA 5K1NA 4QY8A 2ICES 4JQIL 4KJQD 4LGSB 4HC1H 3W11D 4HJUA 3L3GA 4ZW5A 2HTKC 2X6MA 1QZNA 4A7GF 4O4YL 4IKLA 5LN8A 1ZT4A 4WK0B 2BC4B 5LNGA 1IVTA 3IGLA 1MNUH 4L9LA 5B8CB 5GRUH 1L3WA 3OSVA 2YAMA 4UINH 4YBHA 5HHXH 3CFEA 4WWPA 4O2FB 5E8OA 3RLSA 5DMYA 1KJVB 1UYWL 1QR1A 2JXMB 1VGKB 2MTPA 1A3LH 3D33A 2PWDA 1KBPA 5E8NB 4JPVH 3DV4B 1QKZH 1GPOH 2H1PH 4S2SA 2ORBH 3QXWA 4HAFA 5LGJB 4DUVA 4JM2C 1D9KA 3U7AA 1N5AB 4UILL 2EO9A 3T1FA 1ZGLA 2P4AB 5AENA 4K9EH 4MVBC 4ZUWB 3IVKA 4JDEA 5BVJB 1DBKH 1IM3D 2BNRB 2XWBB 1XGTA 4YEEA 4XN1A 1J1PH 3GFUA 3MRQA 1M7UA 1BZ9A 1HXMA 2ICWA 3P30H 4D0BA 2X4OB 2XPGA 4OFDA 2G5BA 1IM3A 1RQ5A 2RB8A 4FQIH 4KGLA 4PWGA 1QAWA 3BGFB 4PLOB 3O2DH 1QWNA 1WAAA 4B41A 4HWBA 4KKCC 2ZKMX 1JZ7A 1CU4H 3PQYA 3BVDB 1OOAA 5DJZA 3SGEI 4ETQB 4HSCX 4OVVA 2XY1A 1R75A 5DJ0B 4BK4A 4DGVL 3BCDA 3DO4A 3TNNA 4HFWB 3IGFA 9CGTA 3DGGA 4HJ0D 4M1GL 1JDCA 1LO4L 5EBLA 4UQBA 2NY2B 2NCMA 5D7LA 2ZOTA 1SDYA 4FFYA 4D0DB 1F6AB 4OVUA 3HS9A 5AEAA 1PG7W 3CHRA 3MPCA 1EFXB 4P49A 1AZRA 3NJXA 5J89A 2MOGA 2A6KB 1FRGH 3VG9B 1NWOA 3PNWB 3FTVA 3E80A 3V0DA 1Z9MA 2CJSA 1IFHL 3O3BB 4L1LA 4M6MH 4Z0XA 5CJXA 2ZOKA 3OKMB 4FXGC 2C26A 2J88H 2OX5A 2ZP9A 5GHWH 2H2PC 1VFOA 2CKBL 2CLZA 3N91A 1PG7L 1KEGL 1N18A 5CCHE 3DSNB 4DEUA 4EOWH 1KPRA 4FQPA 2KZKA 4PI2A 4PGEB 4OF3A 1UWXH 1CI3M 3MGAA 2CO7B 4LFHD 5ITFA 5CFHA 3E6FB 3HRZB 4WHTA 2GY5A 4JFDD 5I66A 4AV5A 2Y7MA 5BZXA 2YPVH 1HYRC 1HL4A 3TIDB 1T0NB 2F54A 4X98B 3CIQA 1MJ7L 4XNZC 4AC2A 2H47C 1H3VA 4NQUA 4CU6A 2FSEB 2G3ZA 2HTLD 3X14A 3VWKC 5KSBB 5C0AB 4DTGH 1RURH 3NSFA 5AOIA 4EF3A 5GGVL 1CFQA 2YD7A 3SB3A 4IKKA 4P5KA 1AE6H 1Y1DA 3BVVA 2GCYB 3V9EA 4P46D 5E6RB 1IGJB 1W72L 1JGLH 2I9TB 2Y1VA 1XF5A 4R0LB 3DSFL 1F11A 1HHGB 2J8UB 1PCXA 3HNSH 1PMYA 1TITA 2E9GA 3UH8A 4HCGA 4QXUH 3LSOA 1B2WL 1PG7X 1I8KB 5ALCH 3MV8B 5B1AB 3UIYA 4HOMA 4ES8A 2GBUA 3VFRA 3HZKB 3Q1SL 2JB6A 1UVQA 1U2YA 4OT1L 1JXGA 5F7EL 3WGUB 3G04B 4MD0B 3C12A 1UACH 3X13A 3O6FB 4LCUB 3M7OA 4RGNB 4UV4H 1AAJA 5CJQL 3RA7L 5LG1A 2VXUL 5GS1B 1CCZA 1SYSA 1PZSA 4NQEE 4YHKH 1IGFH 3T0VA 5JQ6H 1IBZA 2GSIB 1JNHA 4XC3L 3RURA 4AUYA 1XCQB 1L4IA 1XMWA 1XGYL 2O6FA 3LXBA 5HHMB 3ARGB 3GO1L 3LIZL 4WCYL 1KELL 1FC2D 1OB0A 1EZVY 1QYGL 1R3KB 4IIQB 4LDOB 3EUDA 3FT3B 5FF6B 4B60A 2XBTA 3GMPA 1VEMA 1FV1B 4JB9L 5F9AC 3EFDH 1MDAA 1MCSA 2NDGA 2JIXB 2N1TE 3RNKA 3HHSA 3S3JA 1IQDA 4TKWA 3AMLA 4DUWA 2H8PA 3OKLA 2YC1A 3CCHA 2JKXA 4PJIE 4D9LH 4MNQE 4ODVH 1I8IA 3F00A 4MD5B 3FQYA 2GAZA 3H3PL 3JV6B 1SYVB 4PJXA 4APXB 3GXMA 4S1RH 4YHPA 1DZBA 5EF1A 3WUZA 4HLZH 4YQXH 1V3JA 4BFOA 3K91A 3WXVH 4CUCA 1M2OA 1PZBA 4JFWA 4W9GC 3VFVB 2FBOJ 4DERA 1CE6B 1G87A 1GC1L 2V2WB 2AQTA 2PCPB 1JNNH 3O3DB 2KKQA 3MBED 3WLWC 3S35X 1PSKL 4PCKA 5F0JB 2KLTA 1RULH 4P06A 3O0RL 4L1SA 2G5UA 5IQ9B 3L5XL 4O02B 5JW5A 4K23L 3PPSA 5MENB 3DJTA 2OR8A 4HIQA 1Q1JH 3ZPDA 1E5CA 4Z8FH 1XX9C 3UERA 3NDZE 1XR8B 3UFIA 3BKJL 3WLBA 3LEYH 4U05A 3P40A 4GKNB 3H2PA 4N8VA 1O7SA 2ALWA 3LHAA 2GJRA 1BQHB 3NK3A 2VWEC 2IGTA 2P5EE 2XN1A 3WAKA 5C07B 2ICEC 3B1TA 1QI4A 2H9GA 1MPAH 3BE1L 3F58H 1BFOA 3K72B 1MRCL 3BSZH 3DOIA 1CN4A 2VKWA 1PQZA 4FTDA 3ZXAC 2ZUXA 3JVGA 5DQDH 3MLUL 5K39A 3RIKA 2ZXWB 3JWNG 2XT1B 3LRHA 4XBGA 2KDYA 5I8EB 4HCFA 3WD5L 4RX4D 2ILLA 4K7FA 4MXWL 4ZUTA 4GKSB 5IFHL 3KNBA 1SXAA 3P02A 1NANH 4XP1L 3HHMA 1HDMB 2QQNL 3QQ3B 2WD0A 3TV3L 5F3BA 4PGBB 3PGFL 5I28A 3GHBH 1U30A 4JMNA 3FCTB 4WW1A 4K15A 4NGHL 1CLOL 4JE0A 5IJVB 1JZHA 2IFFL 1P5UC 3S8FB 1KC5L 3FO1B 3FULA 4KJPC 2EXWD 5FM5M 2R2HB 4GRWF 4N3TA 3C87A 2RIKA 4I0PB 3WNMA 4OFPA 4DFIA 1ODAA 4Y5XA 5F7YC 4M7LH 4F3FA 3AS3A 5DC4B 3MCG1 2FJGA 3L3OB 1WCBA 1OCWL 3UTSB 1J5CA 2H6UA 1HH9B 2D8KA 3VQMA 2OL3A 1WA2X 3ZKND 2ZNWA 1Z5LB 4WW2A 4F24A 1GC1C 4FG2A 1IGCL 5JIPA 2G75A 5BRPA 5A2JH 1NGYB 1MQKH 2FGWL 2ATPB 5KTEH 5E9AA 2CGRH 4RWYH 4R4FL 4UIKH 3OJDA 3G6DL 3FHAA 3KJ6L 3HN3A 5L6YH 5FW8A 1Y6KR 4CA4A 4AMKL 1EAPA 4KVNL 5D1QC 1BQUA 1N3NB 3MJ7B 1I82A 5HBBA 3BX7C 5D7SL 3ZKXB 3ARVA 1HOCB 5DHDA 1GYVA 1JF6A 4N2CA 4XMXA 4L3AA 5EOCL 1QZ1A 1A1MA 1BZDA 1ZOXA 5DR5L 1K72A 2G2RB 3GZOA 3BH8A 3PHSA 4FQQB 5JA9A 1VESA 2Y1AA 3MV7B 3UJJH 2DQUH 2YFNA 1JTPA 2XG5A 3AVEA 4LU5H 4PWKA 3QH3B 4ZXBD 2P5PA 1CIDA 3BVUA 3EYQC 2YD0A 2QKSA 3F7YB 2VXSH 2YAQA 1PDKB 1H3TA 3QEGH 2H0PA 2IBZX 3IJYB 3RZCD 4MJ6B 4XH2A 3CDZA 1V7MH 1ZVSB 1URZA 1K4CA 3R06A 5DD0H 2C1OA 3WS3A 1OGPA 4M5ZH 3RZCA 3KBFA 3BWAA 1WF5A 1BAGA 2FBJL 4K3DL 3Q1EA 1WZKA 3BEWA 4MB4A 2VGLM 2ZWZA 4M9PA 3UBFA 3VE0B 4AQAA 1W91A 4PJBF 3O8XC 2PTTB 2XLLA 3TA3A 4PRIB 4Y19E 3NFPA 2QGEA 1E27A 1AHWB 4GJTB 4MAYB 4Z7NB 5F1IB 2PW1A 3IMTA 3MRLA 1J8KA 4M48L 4WW2F 3FO0L 5IB1A 3VB8A 3FUKA 4XGZA 4L1HA 2X1XR 4J2QA 4NZUH 4WIQA 1NA8A 3MX0A 1U8OB 3SPVB 3SEPA 1NCBL 3QAZC 4KRLB 2O30A 4JZNA 2NYYD 2L7QA 4BHUI 1V7NL 4HIIB 3FU7A 4DAGH 1K8IA 2FWUA 5GZOC 1D6VL 1ZK5A 2IALB 4HGKC 3P9LA 5GXBB 5ILTL 4NENA 4G9FB 4A2FA 1AR1D 2E7CA 1TJGL 1FH2A 3QNYA 3SDDC 3HEIB 1WWAX 1LD9B 3E3QC 4G42B 3PV6B 5AAWA 2B59A 2A77H 1FC1A 5CWSA 3ET9F 2O5NA 4URKA 3LB6C 4UNUA 4UUJA 3HC2A 4KI5D 5AVTB 5EOQL 1P1VA 3BPLC 5L88L 2NZIA 3B2MA 4LDEB 5FDYA 2AI0H 1CZ8L 2V7HA 1QRNE 4LARL 2RFXB 5I16A 2XIIA 5D9SA 3MLTA 2WVUA 3RX9A 5E95B 4OV5A 4GG6A 2DM3A 4TMPA 3RPBA 1JGEA 4PJAA 2QPUA 3QZWB 2ZUTA 2QTVA 1JHLL 4XVUC 2ITFA 4I48A 4N22A 5KVFE 3GSNA 4HFUL 1VERA 1X9QA 2W0KA 3PP4L 3RVTD 2EE2A 3QXTA 4HUXB 1MCBA 2F1BA 3KAAA 4KQ0A 3ECWA 4BWUA 2IGLA 3ZRFC 1U9KA 1OPOA 2JJUA 1D5XA 1KTBA 3K2MC 4A6YA 2NXYC 1O5PA 2VZUA 3F7VB 2AQSA 2NRDA 2OK0L 1DQIA 1NL0H 3ARBB 1MFUA 3TURA 1H3UA 4P23B 5EF2A 4I87A 2L04A 3JWOH 2CNZA 5BZDA 4HX1A 4OQTA 4ZUSA 3MO1B 1FGVL 4GOSA 3U79A 4YLCA 2EIMB 5GISH 3QYNA 5ANME 1WTLA 1LQBC 2HJFB 2FX9H 2XTJD 2W38A 5F7WC 3I3EA 3QI9B 2PKDA 2VMJA 5C0BB 2YA1A 1AQHA 5IMKA 2DKSA 2Z4QB 4ZUUB 1GGBH 4M03A 5EUKA 4G5ZH 3C6EA 3KPSE 4POYA 2O61A 2WXMA 1XGPB 4Q52A 1T7YA 1EA9C 3FDWA 1ZLUK 2Q6WB 3FOMA 5GRWA 3VGAB 3NSXA 3KYOA 4QHKJ 4PRAB 2NY6D 5FM8A 2AEIT 1KACB 3P9MB 3A3YB 1TPXC 4PUBL 3KEDA 4QRPD 1B3JA 3WNNA 4MA8L 3IE4A 4LVOC 4MJIE 3ZHNA 5HI5D 3LQAC 5DLMH 3B9KB 4QRPA 1NEZA 5I0YA 4HIXH 3U36B 1BOGB 1UB5B 3EYVA 5FYKU 3C5JA 4KI5F 5TPWH 3QNZA 3K8KA 1OGTB 4QRAA 1SHXA 3DDGA 5E94B 2FE0A 3QIBB 4PJAF 4GG6F 1PKOA 3I75A 4F2ME 4APQD 1MJJB 1L5GB 4X7SH 4LEXH 5F72S 2DAVA 2VN6A 4AQ1A 4AE0A 2Z3FA 1N9PA 3AXLB 3ULSA 4APQA 2HLAB 3VU2A 4L3EE 3KVPA 2QT6A 4B7IA 4ABWA 4OZIA 4PI0A 4QMEA 3BP6B 2NNXA 2D7NA 3VX0A 1C5DA 2R4RL 3VYPA 4XRCA 4LLDA 1A6VH 2WW8A 5D2NC 4FN0A 4P3CH 5TQ0L 2A74A 4NP9A 1KIPA 1DEEA 3ABGA 4JFHE 4HLEA 4AYFB 2DL2A 3BZFA 3CGTA 4N8CL 3IS0X 3U4EA 4TVPE 1HC1A 2Y3NA 5FHBH 3UPCA 4MCMA 5IJBC 4M6NL 3IFOB 4X6BB 1JK8B 4Y1AE 1SPDA 5IVXE 3UEQA 4XX5A 3QQNA 3QE5A 4K8RL 2J4WL 4OBRA 1KIUB 2AKRA 2VZ3A 3IM1A 4G71B 2X09A 3CN1A 1WQVT 2RJMA 2WZ5A 4AYMC 1SBSL 1X9RA 5C0DB 1EFQA 4OIFA 4L37B 4LIQE 4ZAKA 1I9RL 2MKWA 3PWLB 4GP8B 1YC7A 3GK8L 3RWFA 4YDVA 3WFHB 2ZX7A 5HYSA 4LASH 1XAKA 5E7BA 3TPUA 3EBHA 1E90A 2Y7NA 3L3DA 1WTGT 5IROC 3U6XA 2CGZA 1MHEA 2Y7SA 4WFFD 1E3ZA 1DVUA 1G9NH 4HJSA 4F2FA 2BP3A 3UO1H 1J8RA 2LTQC 4LBEA 1NCDH 1L0XA 3AW5A 1QTPA 2D4DA 4NQDE 1Z32X 4XOBA 4PGZA 1ZJBA 4IEFB 4HMDA 4DK3A 4HALA 4OZGB 2YAHA 2O26U 2VSKB 3L5WB 3D2UB 2X2IA 5DC0A 2IANE 4YFDB 5FAAA 3SJVE 3WE6A 4X6FA 2P80D 2VE6B 3B2VH 1H15A 5HPOA 5BOJA 2IAMD 4MMXA 5SWSD 4CKQA 1S9YA 3F65A 2P80A 1E5ZA 3TO4A 2HFFA 4QRRE 1ZHLA 1JZJA 3NCEB 5BRQA 3J07A 1C7TA 2IAMA 4LXFA 2DYPB 3GMQB 3FSWA 3C60B 1XGQA 5AUMB 2YQ2A 2EE6A 3CSFA 5EA0H 4B6ZA 2DWXA 5E2VH 3V0VA 3RUGA 1ET8A 4WJ5A 1CFVL 3OAUL 2ITEA 1T0MB 3QSKB 3MU3A 1M1XB 1AXSB 2X4PB 3E1F1 3KPQB 3QPKA 3V4PH 3I6LD 3U9WA 4BZ2A 1UM5H 3BRDA 1DSFH 3BEVB 3ES6A 3NJHA 1Z7JA 4YHYB 2XWTB 4JFYB 1XF4B 3VI3B 1EANA 2NQDA 3KH4A 4Z5RB 2NX5A 1KCUH 2VO5A 3TTYA 2NPLX 5DVLA 1USQA 2BY2A 1NAKH 1S9WB 3OKDA 2RALA 4LVNB 4ZFGH 2XA8L 3RPIA 3OGCA 4G8IB 5C92A 1IARB 4LMQE 32C2A 1URLA 2I5YH 3GM8A 3V6ZB 2QR0B 4F2EA 5HGHA 1SFHA 4UTCA 3QHZH 1WC7A 2VSDA 2WN3A 2YQBA 3QG6B 4I18A 4K8RC 3BUQA 5JHDB 1XB3A 5C0EB 4O58L 4YEFA 1WFJA 3D52A 2EDBA 1A65A 1F6FB 2RAMA 2HVKA 2E47A 2UZXA 3CH1B 4KQ4H 2BIPA 1I75A 3WO4C 2MQ0A 3EIFA 3U0WL 2QVKA 3VG0H 2ENSA 3JV5A 4WO0A 5DRZB 2V5MA 4OLZL 5GIRB 1UH2A 1THCA 5IHHA 2EUWA 2R0ZL 5GS0L 2XZCH 1IRAY 1BX2B 1U8HA 3IXAA 4M3JA 1FFNB 4JNXA 2M1KA 1CLYL 1JZIA 3DPBA 4ODTH 4YDLC 3ZL4H 4BUQA 2ZICA 1AGEB 1U93A 2EDLA 3OV6A 4K3JL 2TRHA 2CDEB 3FQNA 4NQEB 5H37G 3RUGF 3D2TA 1FLRH 4ZX5A 4TVPH 1BGXH 3GUFA 2DWEA 4FQLL 2DMKA 1LP9A 3ZDZE 3UGUA 3LKRA 4KRPB 5JR1H 1JL8A 2NUPA 1LMIA 4YO0B 2KI6A 2HG5A 2Q1EA 3RIFK 1YY8A 2WBJC 3EYUL 1ICTA 3WFEL 2MCAA 3T65A 1AI1H 4X9YA 1MDTA 5FGRA 2IDSA 4AWJC 4C58B 4NNXB 3D09A 1AJ7H 3TJHD 3CX2A 4N8VG 4XN4A 1IC4L 5JLZA 5IFJB 3RI5K 3MOBH 3SDCB 4YSUA 3U6RB 1DEDA 1NGZB 3LN9A 4LNRA 2YARA 5AW6B 5FYKH 3MA9H 1BZ7A 1HWHB 2PCFA 2PP9A 4QYOB 2PPDA 5CEZL 3VAEA 4PJIB 5TE4H 2J2ZA 4XR8C 5T1JA 2O6CA 3DRTA 3QULA 4W4OC 4CAGA 1OT4A 3G5YB 3S2CA 3ZZSA 5DZNA 5ISZE 1I8LC 1J05A 2CAKA 1XTMA 2IQAB 2AV7B 3NFNB 3N1MC 4RDBA 1SF5A 2CCVA 1TETH 2VIRB 1UA6L 2AEQH 2WQ8A 1YEDB 1RMFL 3GTNA 5EG6C 3K6FA 4WSKA 4OCXL 4ANXA 1TZHB 1PKQA 3VXUA 5ERWB 4OD2B 1ES0A 5KYYB 4ZT1A 2BMKA 4D9RE 4J4PC 1JGVH 2J6EL 4BQ8A 2FJSA 5ABZA 5F3FA 2CK0L 1WZLA 1AZZC 4DCQA 4JFUA 3IFNL 4HIEA 1FORH 5HYJE 4G1MA 4H8UA 1YYCA 3IFPA 4N68A 4U1HB 4WY7L 4Z9KB 5JZ7D 2B0SL 1M1SA 2W9DL 3CK0H 4BFFA 1PJWA 2HKFH 1A4AA 3O4OB 1LP9F 4NS0A 3I9PA 2C3GA 4LLVB 3DRQB 3BW9B 3SQOL 2AVGA 4ZSOB 1FGNH 5E6SB 4J3OH 4RA3A 4K3EH 2A9MH 4FTVE 1AQDB 1OF2A 1HI6A 2IGFH 1I9JH 5GS0C 5I1LA 2OCJA 3O2VL 5JOPD 2YPKB 5CEYA 4M6OH 1U3HC 5FXCH 2HJKB 3LJ3A 1VSCA 3CFUA 3VA2C 2JELH 1WEJH 5J1AA 4M29A 2XNAA 4XP5H 4KKAD 1PZ3A 3IU4H 3EOTH 2XACC 1LEKB 3V52H 2J25A 3FN0L 2G0KA 3U2SB 4PM1A 4ES9A 2E9JA 2F7IA 3DX8B 3LCYA 2L4OA 2VISB 2ZWKA 1DE4A 2GBVA 3NA9H 3EH4B 4V33A 1IAKB 4Q0XL 1PF3A 1MIEL 4EVNB 3I6KA 2DQTH 2YUVA 2FX7L 4PJFF 3M1CA 1IFRA 1HT6A 1NC2B 1ZE3C 4WV1B 1OAZL 1HNGA 1DJHA 2G5RA 2J1WA 2NUTB 4GY4A 2R0WH 1E3FA 2ZKWA 5CHNB 4U6HA 3LRLA 2VZ1A 1F1AA 4XPGL 3FW6A 3RTLA 4Q14A 4WK2B 1YEHL 4AZUA 5B8CA 3J8F7 3CHQA 3ZDXF 1FBIL 3Q2CA 2N7BA 3PNRB 1SY6H 4O2FA 3SHSA 1GGCL 2GSGB 4XE5B 2JXMA 1VGKA 2R51A 2ZOOA 4OTXH 5AW3B 1P5VB 2Z91B 3IJ9A 2YXWA 4IRZA 4F9PC 3GBDA 4L8SC 4AQEA 4M61B 4FXKC 5LGJA 1TZIB 3W57A 4MJ2A 3WJMA 1N5AA 1ND0A 1WH0A 1JYNA 5HJGA 1IE4A 4WUUE 2BNRD 3UOAB 2FBRA 5DF0A 4ZUWA 1CC3A 1ZSDB 2XWBA 2F6AA 3HC3H 1CR9L 1G7QB 4CRPA 4LSUL 3FZUC 2PF6A 3RG1C 1DJIA 2V7NB 1ZGLP 4IBUA 4NO3B 2X4OA 4JG5A 4QXTA 4HU8A 3ARDC 2ZYHA 3AC0A 1UT9A 2DTSA 2IADB 4ETQA 4R97C 3GXIA 2IC2A 5D71H 3SGEH 2NY2D 4BV1A 1UB6A 2NY5H 4YXKH 1UXWA 3QPXH 1E8XA 2VERN 1CBVH 4P5MB 3QWOB 1EFXD 5C9JB 2A2QT 3O45B 4JHUA 3SBPA 2EC8A 4X9FA 5F70A 2Q7YA 1F6AA 1OHQA 2H1LM 3E7JA 4Z76A 2DMCA 4R5VA 1GS7A 4XXCA 1JPSL 4PJHB 3GBNH 2A6KA 4FNLL 4MNGE 4LKXA 4WHYH 3NFSH 1RJYB 5MP6H 3LMJL 3GI9L 4NM8H 1B0WA 3PNWA 1ITCA 4OZFH 5K93A 5CLYA 4LVHC 1E9QB 5AVWB 3VD9A 3GKWH 5G4OA 3OKMA 2W94A