2J57G

X-ray reduced paraccocus denitrificans methylamine dehydrogenase n- quinol in complex with amicyanin.
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
382
structure length
382
Chain Sequence
EAETQAQETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tracking X-Ray-Derived Redox Changes in Crystals of a Methylamine Dehydrogenase/Amicyanin Complex Using Single-Crystal Uv/Vis Microspectrophotometry.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords AMICYANIN
total genus 95
structure length 382
sequence length 382
chains with identical sequence H, I, J
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2j57G00
1N6DA 3B7FA 3RLMD 3JZNA 4CI2A 2CN2A 5GXHA 4ESGA 3EI2A 2J55H 4E54B 3SVWD 4CC9A 1PI6A 4D0KA 1JMZB 2CN3A 1R5MA 3OW8A 1GXRA 2MTAH 5KDOB 3PVUB 4D6VA 2XYIA 3JRPA 3CIKB 4FA5D 3SWSD 4A0BB 4A0AB 2B5MA 3PXWD 3N0DA 1XIPA 4Y5RD 5HE1B 5FKSA 1NEXB 2XU7A 5EMMB 4IA9A 4FWWA 4L3HD 2QXVA 1B9XA 2IAAA 1A0RB 4X3EA 4IMMA 5IT9g 3I8CA 4A11A 3EI3B 5A2Qg 3JROA 4GM3A 1JJUB 4J77A 5EMJB 3L4OD 5EAPA 4GGCA 4J8GA 2YMUA 5CYKA 2O9KA 3ORVD 4U7AA 2IWKA 1GOTB 5C9ZB 5IGQA 4PXWA 2BCJB 2OVQB 3I7OA 2CE9A 3F3PA 4PSWB 2IUPA 3K27A 4O3TB 4GQ1A 2AGLA 5I5JA 5HYNB 3DXKC 3IJ0A 4A08A 5B4WA 1OLZA 1YFQA 3UVMA 2CNXA 3IIYA 2OIZA 4FA1D 2B5NA 2B5LA 2H3XA 4J78A 2PM9B 1N6EA 1OMWB 3U4YA 4A09B 2G99A 3ULEC 4FA9D 1P22A 3J81g 3FGBA 5HE2B 4GM9A 2YNNA 3I89A 5CYKB 4JXMA 3E0CA 3DM0A 4FA4D 4QRJA 3I7HA 4O3UB 2H9NA 4OWRA 3BG0A 3DWLC 4XEIC 4H5IA 5EM2A 3JAMg 3VA6A 1PGUA 3SN6B 3VGZA 3NVXA 4U1EI 5AFU3 4AOWA 3RFHA 4H5JA 3C9CA 3EI4B 3KRWB 1NR0A 1TYQC 3OKTA 3GREA 2HKRA 2I0SA 5CXCB 3SBRA 5EM2B 3L4MD 2HJ4A 3UKRC 4JSPC 4A2LA 4GGDA 2XL2A 4CY3A 4J79A 2H9MA 2BBKH 3JZGA 3OKYA 4R7AB 4A11B 2GC7A 3PSLA 4OZUA 3I7NA 3I7KA 4K3JB 4ZOYA 4G56B 5H1MA 4CI8A 1MG3A 2I3SA 4J84A 5EAMA 3MZLA 5K19A 4PC0A 2IUVA 3CFVA 2B4EA 4ZOVA 4GM8A 2YNOA 3EWEA 2P9LC 5C2VB 1FWXA 3OKYB 4LGNA 5H17A 3V7DB 1L0QA 2CO0A 3MKQA 3I7LA 4NSXA 5EARA 4CI3A 1TBGA 5TEFA 5CXCA 2YBAA 3RN1D 4FHLA 4J81A 5EMLB 4E54A 5FKTA 4JSXC 3SFZA 3GFCA 4GGAA 3IJCA 3K26A 5TEEA 3ZWLB 2OK6A 4CI1A 3JPXA 5SXMA 4TZ4A 2H9PA 2I3TA 3UVLA 3PVWB 2Q7QA 3UKUC 2TRCB 3RSEC 1K8KC 2H6KA 1N6FA 5H14A 1U4CA 2P9NC 3OTTA 5GSAA 4A08B 3VH0A 3JB9L 3AH8B 4CZXA 2H14A 3NVNA 4XYIA 5FQDA 1SQJA 3AFCA 4Z8LA 1JOFA 4A2MA 3F3GA 1SQ9A 4A0BA 3UVOA 3V5WB 4CY1A 5IC7A 4GQBB 2Z2NA 4A09A 2HXCA 4XYHA 3MZKA 4CY2A 4ERYA 4BH6A 4X60B 4YVDA 2AQ5A 4GZ8A 4KFMB 5FKQA 4FAVD 2AH0A 5HE3B 3MKSB 4L9OA 3SLED 2YB8B 4QL1A 4BUJC 4PNKB 4J0XA 3IKOA 4CZYA 2CO0C 5K1CC 5TF2A 2J57G 3EI4A 5GXIA 5GMKn 3OL2A 4J0WA 5AJAA 3P4FA 3AL8B 5I5MA 5HQGA 3PXTD 3UVKA 2HJBA 3EI3A 3I7PA 4JT6C 5IJ8E 4ERQA 4Y7RA 2OK4A 3IJ1A 3A0FA 3I8EA 5FLXg 4EWRA 1SHYB 1VYHC 3FRXA 4JT5C 2HKMA 3AL9A 2P9KC 1XHMA 2OVRB 2P9PC 3UVNA 4J86A 3C75H 2AGWA 3F3FA 4J73A 4K3ID 5IJ7E 2PBIB 1QNIA 4LG9A 2EBSA 3EU7A 2PM9A 3MMYA 4O9DA 1GP2B 2P9SC 3OKWA 4CY5A 2G9AA 2Z2OA 1MG2A 2H47A 4FAND 5TDHB 2AGXA 4A0AA 4J8BA 5IGOA 3RRMC 2I0TA 4L1QD 3KRXB 2IUQA 4JD2C 3BG1A 3RFGA 3BWSA 5FXYA 1U2VC 2QC5A 4X61B 4J87A 2P9UC 3PE7A 2AH1A 5EALA 2UZXB 2I0RA 4ZN4A 4UI9R 1JMXB 3N0EA 3RN0D 5CXBA 5FA5B 5JWZA 3IIWA 4FB1D 4PBYA 2Z2PA 2OJYA 2AGYA 4N14A 5EMKB 4MK0B 3W15A 3AL8A 3C99A 5C2WB 3SMRA 1PBYB 2H6NA 4QQEA 3EG6A 1Q47A 4PSXB 4BL0A 2IURA 3EMHA 3RMZD 2GNQA 1S4UX 3J80g 4E5ZA 4JSNC 3SBPA 3PXSD 4LG8A 4ZOXA 3EI1B 2PM7B 1B9YA 3SCYA 4GMBA 3V9FA 1MDAH 3SJLD 2HESX 4I79A 3NVQA 3MXXA 4J82A 3HFQA 3ODTA 4AEZA 2J56H 3UR4A 2P9IC 3SBQA 4ES0A 3EI2B 3SXTD 2W18A 2YNPA 3C5MA 2H13A 4A7JA 5HE0B 4O1QD 1K32A 4E5ZB 2IWFA 4GQ2P 4ERZA 2H6QA 3DXMC 2XL3A 3DSMA 3FM0A 2CE8A 3I2NA 2PM6B 3CFSB 1PEVA 3PSCB 4HDJA 2AGZA 4O45A 4QT8A 5THAA 2HYEA 5I5IA 2H68A 4PBZA 2H9LA 5FKRA 3EI1A 4X63B 5CXBB 3SHFA 4L3GD 2OVPB 4CZVA 1GG2B 5AMSA 3JZHA 3OL2B 1XKSA 4ZOZA 4JSVC 1RI6A 2UZYB 1ERJA 2GC4A
chains in the Genus database with same CATH superfamily
1N6DA 3B7FA 3RLMD 3JZNA 4CI2A 2CN2A 5GXHA 4ESGA 3EI2A 2J55H 4E54B 3SVWD 3T3PA 4CC9A 1PI6A 4D0KA 1GOFA 2VDMA 1JMZB 4WK2A 4G55A 2CN3A 4WK0A 1R5MA 5C92A 3OW8A 1GXRA 2MTAH 5KDOB 3PVUB 4D6VA 2XYIA 1VE6A 3JRPA 3CIKB 4FA5D 3SWSD 4A0BB 4A0AB 2B5MA 1O6GA 3N0DA 3PXWD 1XIPA 4NENA 4Y5RD 5HE1B 5FKSA 1NEXB 2XU7A 5EMMB 4IA9A 1L5GA 2VZ3A 4FWWA 4L3HD 2QXVA 1B9XA 2IAAA 1A0RB 4X3EA 4IMMA 5IT9g 3I8CA 3IULA 4RE5A 4A11A 3EI3B 3K72A 3JROA 5A2Qg 4GM3A 5M5VA 1JJUB 4J77A 3OF7A 5EMJB 3L4OD 3EQ7A 5EAPA 4GGCA 4J8GA 2YMUA 5CYKA 3T3MA 2O9KA 3ORVD 4U7AA 2IWKA 1GOTB 5C9ZB 5IGQA 4PXWA 2BCJB 2OVQB 3I7OA 3IURA 2CE9A 3F3PA 2IUPA 3K27A 4O3TB 4PSWB 4GQ1A 2AGLA 5I5JA 5HYNB 3DXKC 2VDKA 3IJ0A 4A08A 3GC3B 5B4WA 1OLZA 1YFQA 3UVMA 2CNXA 3IIYA 4G1EA 2OIZA 4FA1D 2B5NA 2B5LA 2H3XA 4J78A 5C86A 2PM9B 1N6EA 1OMWB 3U4YA 3ZDZA 4A09B 2G99A 3ULEC 3FCUA 4FA9D 1P22A 3J81g 3FGBA 1A12A 5HE2B 4GM9A 2YNNA 3I89A 5CYKB 2HU7A 4JXMA 3NIGA 4L1MA 3E0CA 3MVDK 3DM0A 4FA4D 4QRJA 3I7HA 4O3UB 3IJEA 2H9NA 4OWRA 3BG0A 4AMZA 3DWLC 4XEIC 4H5IA 4AN1A 5EM2A 3JAMg 1M1XA 3VA6A 1PGUA 3KCIA 3SN6B 3VGZA 3NVXA 4U1EI 5AFU3 4O02A 1VZ2A 4AOWA 3RFHA 4H5JA 3C9CA 3ZDYA 4AX4A 3EI4B 3KRWB 1NR0A 1TYQC 3OKTA 3GREA 2HKRA 2I0SA 5CXCB 3SBRA 5EM2B 3L4MD 2HJ4A 3IUJA 3UKRC 4JSPC 4A2LA 4BCDA 4QAMA 4GGDA 2XL2A 4CY3A 1GOGA 2EIBA 4J79A 2H9MA 2BBKH 4NBMA 3JZGA 3OKYA 4R7AB 4A11B 2GC7A 3PSLA 4OZUA 3V4VA 2JKXA 3I7NA 4AN0A 4DNUA 3I7KA 4K3JB 4ZOYA 4G56B 5H1MA 4CI8A 1MG3A 2I3SA 4J84A 5EAMA 3MZLA 4MMZA 3V4PA 4DNWA 5K19A 1UOPA 4PC0A 2IUVA 2VC2A 3CFVA 4BCCA 2B4EA 4ZOVA 1O6FA 4GM8A 2YNOA 3EWEA 2P9LC 5C2VB 1FWXA 3K71A 1U8CA 3OKYB 2EIEA 4LGNA 5H17A 3V7DB 1L0QA 2VDOA 2CO0A 4MMYA 2VDQA 3MKQA 3I7LA 4NSXA 5EARA 4CI3A 1TBGA 5TEFA 5CXCA 2YBAA 3RN1D 4FHLA 4J81A 5EMLB 4O2WA 1UOQA 3QHYB 4NAAA 4E54A 5FKTA 4JSXC 4MMXA 3VI3A 3SFZA 3GFCA 4GGAA 3IJCA 1QFSA 3ZE1A 3K26A 5TEEA 3ZWLB 2OK6A 4CI1A 3JPXA 5SXMA 2XDWA 2H9PA 2I3TA 4TZ4A 3UVLA 3PVWB 4BP8A 2Q7QA 4D9SA 5E6RA 3UKUC 2TRCB 3RSEC 1K8KC 2H6KA 1N6FA 2VZ1A 4AMYA 5H14A 1U4CA 2P9NC 3OTTA 5GSAA 4A08B 2VDLA 3VH0A 3JB9L 2QZPA 3DDUA 3AH8B 4CZXA 2H14A 3NVNA 4XYIA 5FQDA 1SQJA 1VE7A 3AFCA 4Z8LA 1JOFA 4A2MA 3F3GA 1SQ9A 4A0BA 3UVOA 3V5WB 3IVMA 4CY1A 4IRZA 5IC7A 4GQBB 2Z2NA 4A09A 3NIDA 1YR2A 1UTCA 4JHPC 2HXCA 4RE6A 4XYHA 3IUMA 3MZKA 4CY2A 1E8MA 4ERYA 3ZE2A 4BH6A 4X60B 4YVDA 2AQ5A 4GZ8A 4KFMB 5FKQA 4FAVD 2AH0A 5HE3B 3MKSB 4L9OA 3SLED 2YB8B 1E5TA 4QL1A 1H2WA 4BUJC 3K6SA 4PNKB 4J0XA 3IKOA 4CZYA 2CO0C 5K1CC 5TF2A 2J57G 4DNVA 3EI4A 5GXIA 5GMKn 3OL2A 4J0WA 5AJAA 3P4FA 3AL8B 3O4GA 5I5MA 4WJKA 5HQGA 1TYEA 3PXTD 3UVKA 2HJBA 3EI3A 4Z7QA 3I7PA 4JT6C 5IJ8E 4ERQA 4Y7RA 2OK4A 4NC4A 4BCBA 3IJ1A 3A0FA 3I8EA 5M5RA 5FLXg 4EWRA 1SHYB 1VYHC 3FRXA 4JT5C 2HKMA 3AL9A 2P9KC 1XHMA 2VDRA 2OVRB 2P9PC 3UVNA 2XZGA 4J86A 5E6UA 4UM8A 3C75H 1JTDB 2AGWA 3F3FA 4J73A 4K3ID 5IJ7E 2PBIB 1C9IA 1BPOA 1QNIA 4LG9A 2EBSA 3EU7A 1UOOA 2PM9A 3MMYA 3O4JA 1QFMA 4O9DA 2VDNA 1GP2B 2P9SC 4Z7OA 3OKWA 4CY5A 4JHNA 2G9AA 2Z2OA 1MG2A 2H47A 4FAND 5TDHB 2AGXA 4A0AA 5FFOA 4J8BA 1K3IA 5IGOA 3GD1I 3RRMC 3MUNA 2I0TA 1E8NA 4L1QD 4Z7NA 3KRXB 2IUQA 4JD2C 3BG1A 3O4HA 2EICA 3RFGA 3BWSA 5FXYA 1U2VC 2XE4A 2EIDA 3O4IA 2BKLA 2QC5A 5FFGA 4X61B 4J87A 2P9UC 3PE7A 5E6SA 2AH1A 5EALA 2UZXB 4UM9A 2I0RA 4ZN4A 4UI9R 1JMXB 3N0EA 3RN0D 5CXBA 5FA5B 1T2XA 5JWZA 3ZE0A 1C9LA 2QR5A 3IIWA 4FB1D 4PBYA 2Z2PA 2OJYA 2AGYA 4N14A 5EMKB 4MK0B 3W15A 3AL8A 3C99A 5C2WB 3VI4A 3SMRA 1PBYB 2H6NA 4QQEA 3EG6A 3IUNA 1Q47A 4WK4A 4PSXB 1H2YA 4BL0A 2IURA 3EMHA 3RMZD 2GNQA 3EQ9A 1S4UX 3QI0A 3J80g 4E5ZA 4JSNC 1H2XA 3SBPA 3PXSD 4LG8A 4ZOXA 1GOHA 5M5TA 3EI1B 2PM7B 1B9YA 4G1MA 3SCYA 4BP9A 4GMBA 3V9FA 1MDAH 1JV2A 3IUQA 3SJLD 2HESX 4I79A 3NVQA 3MXXA 4J82A 3HFQA 3ODTA 4AEZA 2J56H 3UR4A 2P9IC 3SBQA 4ES0A 3EI2B 3SXTD 2W18A 2YNPA 3C5MA 2H13A 4A7JA 1VZ3A 5HE0B 3ZDXA 2HU8A 4O1QD 1K32A 4E5ZB 2IWFA 4GQ2P 3MUOA 1H2ZA 2WQ8A 4ERZA 2H6QA 3DXMC 2XL3A 3DSMA 3FM0A 2CE8A 3I2NA 3FCSA 2PM6B 2VDPA 3CFSB 1PEVA 2HU5A 5M61A 3PSCB 4HDJA 2AGZA 5M5UA 4O45A 4QT8A 5HDBA 5THAA 5M5SA 2HYEA 5I5IA 2H68A 4PBZA 2H9LA 5FKRA 3EI1A 4X63B 5CXBB 3SHFA 3NIFA 4L3GD 1I2MB 2OVPB 4CZVA 1GG2B 5AMSA 3EQ8A 3JZHA 3OL2B 1XKSA 4ZOZA 4JSVC 1RI6A 2UZYB 1ERJA 2GC4A
chains in the Genus database with same CATH topology
1N6DA 3B7FA 3RLMD 3JZNA 4CI2A 2CN2A 5GXHA 4ESGA 3EI2A 2J55H 4E54B 3SVWD 4CC9A 1PI6A 4D0KA 1JMZB 2CN3A 1R5MA 3OW8A 1GXRA 2MTAH 5KDOB 3PVUB 4D6VA 2XYIA 3JRPA 3CIKB 4FA5D 3SWSD 4A0BB 4A0AB 2B5MA 3PXWD 3N0DA 1XIPA 4Y5RD 5HE1B 5FKSA 1NEXB 2XU7A 5EMMB 4IA9A 4FWWA 4L3HD 2QXVA 1B9XA 2IAAA 1A0RB 4X3EA 4IMMA 5IT9g 3I8CA 4A11A 3EI3B 5A2Qg 3JROA 4GM3A 1JJUB 4J77A 5EMJB 3L4OD 5EAPA 4GGCA 4J8GA 2YMUA 5CYKA 2O9KA 3ORVD 4U7AA 2IWKA 1GOTB 5C9ZB 5IGQA 4PXWA 2BCJB 2OVQB 3I7OA 2CE9A 3F3PA 4PSWB 2IUPA 3K27A 4O3TB 4GQ1A 2AGLA 5I5JA 5HYNB 3DXKC 3IJ0A 4A08A 5B4WA 1OLZA 1YFQA 3UVMA 2CNXA 3IIYA 2OIZA 4FA1D 2B5NA 2B5LA 2H3XA 4J78A 2PM9B 1N6EA 1OMWB 3U4YA 4A09B 2G99A 3ULEC 4FA9D 1P22A 3J81g 3FGBA 5HE2B 4GM9A 2YNNA 3I89A 5CYKB 4JXMA 3E0CA 3DM0A 4FA4D 4QRJA 3I7HA 4O3UB 2H9NA 4OWRA 3BG0A 3DWLC 4XEIC 4H5IA 5EM2A 3JAMg 3VA6A 1PGUA 3SN6B 3VGZA 3NVXA 4U1EI 5AFU3 4AOWA 3RFHA 4H5JA 3C9CA 3EI4B 3KRWB 1NR0A 1TYQC 3OKTA 3GREA 2HKRA 2I0SA 5CXCB 3SBRA 5EM2B 3L4MD 2HJ4A 3UKRC 4JSPC 4A2LA 4GGDA 2XL2A 4CY3A 4J79A 2H9MA 2BBKH 3JZGA 3OKYA 4R7AB 4A11B 2GC7A 3PSLA 4OZUA 3I7NA 3I7KA 4K3JB 4ZOYA 4G56B 5H1MA 4CI8A 1MG3A 2I3SA 4J84A 5EAMA 3MZLA 5K19A 4PC0A 2IUVA 3CFVA 2B4EA 4ZOVA 4GM8A 2YNOA 3EWEA 2P9LC 5C2VB 1FWXA 3OKYB 4LGNA 5H17A 3V7DB 1L0QA 2CO0A 3MKQA 3I7LA 4NSXA 5EARA 4CI3A 1TBGA 5TEFA 5CXCA 2YBAA 3RN1D 4FHLA 4J81A 5EMLB 4E54A 5FKTA 4JSXC 3SFZA 3GFCA 4GGAA 3IJCA 3K26A 5TEEA 3ZWLB 2OK6A 4CI1A 3JPXA 5SXMA 4TZ4A 2H9PA 2I3TA 3UVLA 3PVWB 2Q7QA 3UKUC 2TRCB 3RSEC 1K8KC 2H6KA 1N6FA 5H14A 1U4CA 2P9NC 3OTTA 5GSAA 4A08B 3VH0A 3JB9L 3AH8B 4CZXA 2H14A 3NVNA 4XYIA 5FQDA 1SQJA 3AFCA 4Z8LA 1JOFA 4A2MA 3F3GA 1SQ9A 4A0BA 3UVOA 3V5WB 4CY1A 5IC7A 4GQBB 2Z2NA 4A09A 2HXCA 4XYHA 3MZKA 4CY2A 4ERYA 4BH6A 4X60B 4YVDA 2AQ5A 4GZ8A 4KFMB 5FKQA 4FAVD 2AH0A 5HE3B 3MKSB 4L9OA 3SLED 2YB8B 4QL1A 4BUJC 4PNKB 4J0XA 3IKOA 4CZYA 2CO0C 5K1CC 5TF2A 2J57G 3EI4A 5GXIA 5GMKn 3OL2A 4J0WA 5AJAA 3P4FA 3AL8B 5I5MA 5HQGA 3PXTD 3UVKA 2HJBA 3EI3A 3I7PA 4JT6C 5IJ8E 4ERQA 4Y7RA 2OK4A 3IJ1A 3A0FA 3I8EA 5FLXg 4EWRA 1SHYB 1VYHC 3FRXA 4JT5C 2HKMA 3AL9A 2P9KC 1XHMA 2OVRB 2P9PC 3UVNA 4J86A 3C75H 2AGWA 3F3FA 4J73A 4K3ID 5IJ7E 2PBIB 1QNIA 4LG9A 2EBSA 3EU7A 2PM9A 3MMYA 4O9DA 1GP2B 2P9SC 3OKWA 4CY5A 2G9AA 2Z2OA 1MG2A 2H47A 4FAND 5TDHB 2AGXA 4A0AA 4J8BA 5IGOA 3RRMC 2I0TA 4L1QD 3KRXB 2IUQA 4JD2C 3BG1A 3RFGA 3BWSA 5FXYA 1U2VC 2QC5A 4X61B 4J87A 2P9UC 3PE7A 2AH1A 5EALA 2UZXB 2I0RA 4ZN4A 4UI9R 1JMXB 3N0EA 3RN0D 5CXBA 5FA5B 5JWZA 3IIWA 4FB1D 4PBYA 2Z2PA 2OJYA 2AGYA 4N14A 5EMKB 4MK0B 3W15A 3AL8A 3C99A 5C2WB 3SMRA 1PBYB 2H6NA 4QQEA 3EG6A 1Q47A 4PSXB 4BL0A 2IURA 3EMHA 3RMZD 2GNQA 1S4UX 3J80g 4E5ZA 4JSNC 3SBPA 3PXSD 4LG8A 4ZOXA 3EI1B 2PM7B 1B9YA 3SCYA 4GMBA 3V9FA 1MDAH 3SJLD 2HESX 4I79A 3NVQA 3MXXA 4J82A 3HFQA 3ODTA 4AEZA 2J56H 3UR4A 2P9IC 3SBQA 4ES0A 3EI2B 3SXTD 2W18A 2YNPA 3C5MA 2H13A 4A7JA 5HE0B 4O1QD 1K32A 4E5ZB 2IWFA 4GQ2P 4ERZA 2H6QA 3DXMC 2XL3A 3DSMA 3FM0A 2CE8A 3I2NA 2PM6B 3CFSB 1PEVA 3PSCB 4HDJA 2AGZA 4O45A 4QT8A 5THAA 2HYEA 5I5IA 2H68A 4PBZA 2H9LA 5FKRA 3EI1A 4X63B 5CXBB 3SHFA 4L3GD 2OVPB 4CZVA 1GG2B 5AMSA 3JZHA 3OL2B 1XKSA 4ZOZA 4JSVC 1RI6A 2UZYB 1ERJA 2GC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N6D A;  3B7F A;  3RLM D;  3JZN A;  4CI2 A;  2CN2 A;  5GXH A;  4ESG A;  3EI2 A;  2J55 H;  4E54 B;  3SVW D;  4CC9 A;  1PI6 A;  4D0K A;  1JMZ B;  2CN3 A;  1R5M A;  3OW8 A;  1GXR A;  2MTA H;  5KDO B;  3PVU B;  4D6V A;  2XYI A;  3JRP A;  3CIK B;  4FA5 D;  3SWS D;  4A0B B;  4A0A B;  2B5M A;  3PXW D;  3N0D A;  1XIP A;  4Y5R D;  5HE1 B;  5FKS A;  1NEX B;  2XU7 A;  5EMM B;  4IA9 A;  4FWW A;  4L3H D;  2QXV A;  1B9X A;  2IAA A;  1A0R B;  4X3E A;  4IMM A;  5IT9 g;  3I8C A;  4A11 A;  3EI3 B;  5A2Q g;  3JRO A;  4GM3 A;  1JJU B;  4J77 A;  5EMJ B;  3L4O D;  5EAP A;  4GGC A;  4J8G A;  2YMU A;  5CYK A;  2O9K A;  3ORV D;  4U7A A;  2IWK A;  1GOT B;  5C9Z B;  5IGQ A;  4PXW A;  2BCJ B;  2OVQ B;  3I7O A;  2CE9 A;  3F3P A;  4PSW B;  2IUP A;  3K27 A;  4O3T B;  4GQ1 A;  2AGL A;  5I5J A;  5HYN B;  3DXK C;  3IJ0 A;  4A08 A;  5B4W A;  1OLZ A;  1YFQ A;  3UVM A;  2CNX A;  3IIY A;  2OIZ A;  4FA1 D;  2B5N A;  2B5L A;  2H3X A;  4J78 A;  2PM9 B;  1N6E A;  1OMW B;  3U4Y A;  4A09 B;  2G99 A;  3ULE C;  4FA9 D;  1P22 A;  3J81 g;  3FGB A;  5HE2 B;  4GM9 A;  2YNN A;  3I89 A;  5CYK B;  4JXM A;  3E0C A;  3DM0 A;  4FA4 D;  4QRJ A;  3I7H A;  4O3U B;  2H9N A;  4OWR A;  3BG0 A;  3DWL C;  4XEI C;  4H5I A;  5EM2 A;  3JAM g;  3VA6 A;  1PGU A;  3SN6 B;  3VGZ A;  3NVX A;  4U1E I;  5AFU 3;  4AOW A;  3RFH A;  4H5J A;  3C9C A;  3EI4 B;  3KRW B;  1NR0 A;  1TYQ C;  3OKT A;  3GRE A;  2HKR A;  2I0S A;  5CXC B;  3SBR A;  5EM2 B;  3L4M D;  2HJ4 A;  3UKR C;  4JSP C;  4A2L A;  4GGD A;  2XL2 A;  4CY3 A;  4J79 A;  2H9M A;  2BBK H;  3JZG A;  3OKY A;  4R7A B;  4A11 B;  2GC7 A;  3PSL A;  4OZU A;  3I7N A;  3I7K A;  4K3J B;  4ZOY A;  4G56 B;  5H1M A;  4CI8 A;  1MG3 A;  2I3S A;  4J84 A;  5EAM A;  3MZL A;  5K19 A;  4PC0 A;  2IUV A;  3CFV A;  2B4E A;  4ZOV A;  4GM8 A;  2YNO A;  3EWE A;  2P9L C;  5C2V B;  1FWX A;  3OKY B;  4LGN A;  5H17 A;  3V7D B;  1L0Q A;  2CO0 A;  3MKQ A;  3I7L A;  4NSX A;  5EAR A;  4CI3 A;  1TBG A;  5TEF A;  5CXC A;  2YBA A;  3RN1 D;  4FHL A;  4J81 A;  5EML B;  4E54 A;  5FKT A;  4JSX C;  3SFZ A;  3GFC A;  4GGA A;  3IJC A;  3K26 A;  5TEE A;  3ZWL B;  2OK6 A;  4CI1 A;  3JPX A;  5SXM A;  4TZ4 A;  2H9P A;  2I3T A;  3UVL A;  3PVW B;  2Q7Q A;  3UKU C;  2TRC B;  3RSE C;  1K8K C;  2H6K A;  1N6F A;  5H14 A;  1U4C A;  2P9N C;  3OTT A;  5GSA A;  4A08 B;  3VH0 A;  3JB9 L;  3AH8 B;  4CZX A;  2H14 A;  3NVN A;  4XYI A;  5FQD A;  1SQJ A;  3AFC A;  4Z8L A;  1JOF A;  4A2M A;  3F3G A;  1SQ9 A;  4A0B A;  3UVO A;  3V5W B;  4CY1 A;  5IC7 A;  4GQB B;  2Z2N A;  4A09 A;  2HXC A;  4XYH A;  3MZK A;  4CY2 A;  4ERY A;  4BH6 A;  4X60 B;  4YVD A;  2AQ5 A;  4GZ8 A;  4KFM B;  5FKQ A;  4FAV D;  2AH0 A;  5HE3 B;  3MKS B;  4L9O A;  3SLE D;  2YB8 B;  4QL1 A;  4BUJ C;  4PNK B;  4J0X A;  3IKO A;  4CZY A;  2CO0 C;  5K1C C;  5TF2 A;  2J57 G;  3EI4 A;  5GXI A;  5GMK n;  3OL2 A;  4J0W A;  5AJA A;  3P4F A;  3AL8 B;  5I5M A;  5HQG A;  3PXT D;  3UVK A;  2HJB A;  3EI3 A;  3I7P A;  4JT6 C;  5IJ8 E;  4ERQ A;  4Y7R A;  2OK4 A;  3IJ1 A;  3A0F A;  3I8E A;  5FLX g;  4EWR A;  1SHY B;  1VYH C;  3FRX A;  4JT5 C;  2HKM A;  3AL9 A;  2P9K C;  1XHM A;  2OVR B;  2P9P C;  3UVN A;  4J86 A;  3C75 H;  2AGW A;  3F3F A;  4J73 A;  4K3I D;  5IJ7 E;  2PBI B;  1QNI A;  4LG9 A;  2EBS A;  3EU7 A;  2PM9 A;  3MMY A;  4O9D A;  1GP2 B;  2P9S C;  3OKW A;  4CY5 A;  2G9A A;  2Z2O A;  1MG2 A;  2H47 A;  4FAN D;  5TDH B;  2AGX A;  4A0A A;  4J8B A;  5IGO A;  3RRM C;  2I0T A;  4L1Q D;  3KRX B;  2IUQ A;  4JD2 C;  3BG1 A;  3RFG A;  3BWS A;  5FXY A;  1U2V C;  2QC5 A;  4X61 B;  4J87 A;  2P9U C;  3PE7 A;  2AH1 A;  5EAL A;  2UZX B;  2I0R A;  4ZN4 A;  4UI9 R;  1JMX B;  3N0E A;  3RN0 D;  5CXB A;  5FA5 B;  5JWZ A;  3IIW A;  4FB1 D;  4PBY A;  2Z2P A;  2OJY A;  2AGY A;  4N14 A;  5EMK B;  4MK0 B;  3W15 A;  3AL8 A;  3C99 A;  5C2W B;  3SMR A;  1PBY B;  2H6N A;  4QQE A;  3EG6 A;  1Q47 A;  4PSX B;  4BL0 A;  2IUR A;  3EMH A;  3RMZ D;  2GNQ A;  1S4U X;  3J80 g;  4E5Z A;  4JSN C;  3SBP A;  3PXS D;  4LG8 A;  4ZOX A;  3EI1 B;  2PM7 B;  1B9Y A;  3SCY A;  4GMB A;  3V9F A;  1MDA H;  3SJL D;  2HES X;  4I79 A;  3NVQ A;  3MXX A;  4J82 A;  3HFQ A;  3ODT A;  4AEZ A;  2J56 H;  3UR4 A;  2P9I C;  3SBQ A;  4ES0 A;  3EI2 B;  3SXT D;  2W18 A;  2YNP A;  3C5M A;  2H13 A;  4A7J A;  5HE0 B;  4O1Q D;  1K32 A;  4E5Z B;  2IWF A;  4GQ2 P;  4ERZ A;  2H6Q A;  3DXM C;  2XL3 A;  3DSM A;  3FM0 A;  2CE8 A;  3I2N A;  2PM6 B;  3CFS B;  1PEV A;  3PSC B;  4HDJ A;  2AGZ A;  4O45 A;  4QT8 A;  5THA A;  2HYE A;  5I5I A;  2H68 A;  4PBZ A;  2H9L A;  5FKR A;  3EI1 A;  4X63 B;  5CXB B;  3SHF A;  4L3G D;  2OVP B;  4CZV A;  1GG2 B;  5AMS A;  3JZH A;  3OL2 B;  1XKS A;  4ZOZ A;  4JSV C;  1RI6 A;  2UZY B;  1ERJ A;  2GC4 A; 
#chains in the Genus database with same CATH topology
 1N6D A;  3B7F A;  3RLM D;  3JZN A;  4CI2 A;  2CN2 A;  5GXH A;  4ESG A;  3EI2 A;  2J55 H;  4E54 B;  3SVW D;  3T3P A;  4CC9 A;  1PI6 A;  4D0K A;  1GOF A;  2VDM A;  1JMZ B;  4WK2 A;  4G55 A;  2CN3 A;  4WK0 A;  1R5M A;  5C92 A;  3OW8 A;  1GXR A;  2MTA H;  5KDO B;  3PVU B;  4D6V A;  2XYI A;  1VE6 A;  3JRP A;  3CIK B;  4FA5 D;  3SWS D;  4A0B B;  4A0A B;  2B5M A;  1O6G A;  3N0D A;  3PXW D;  1XIP A;  4NEN A;  4Y5R D;  5HE1 B;  5FKS A;  1NEX B;  2XU7 A;  5EMM B;  4IA9 A;  1L5G A;  2VZ3 A;  4FWW A;  4L3H D;  2QXV A;  1B9X A;  2IAA A;  1A0R B;  4X3E A;  4IMM A;  5IT9 g;  3I8C A;  3IUL A;  4RE5 A;  4A11 A;  3EI3 B;  3K72 A;  3JRO A;  5A2Q g;  4GM3 A;  5M5V A;  1JJU B;  4J77 A;  3OF7 A;  5EMJ B;  3L4O D;  3EQ7 A;  5EAP A;  4GGC A;  4J8G A;  2YMU A;  5CYK A;  3T3M A;  2O9K A;  3ORV D;  4U7A A;  2IWK A;  1GOT B;  5C9Z B;  5IGQ A;  4PXW A;  2BCJ B;  2OVQ B;  3I7O A;  3IUR A;  2CE9 A;  3F3P A;  2IUP A;  3K27 A;  4O3T B;  4PSW B;  4GQ1 A;  2AGL A;  5I5J A;  5HYN B;  3DXK C;  2VDK A;  3IJ0 A;  4A08 A;  3GC3 B;  5B4W A;  1OLZ A;  1YFQ A;  3UVM A;  2CNX A;  3IIY A;  4G1E A;  2OIZ A;  4FA1 D;  2B5N A;  2B5L A;  2H3X A;  4J78 A;  5C86 A;  2PM9 B;  1N6E A;  1OMW B;  3U4Y A;  3ZDZ A;  4A09 B;  2G99 A;  3ULE C;  3FCU A;  4FA9 D;  1P22 A;  3J81 g;  3FGB A;  1A12 A;  5HE2 B;  4GM9 A;  2YNN A;  3I89 A;  5CYK B;  2HU7 A;  4JXM A;  3NIG A;  4L1M A;  3E0C A;  3MVD K;  3DM0 A;  4FA4 D;  4QRJ A;  3I7H A;  4O3U B;  3IJE A;  2H9N A;  4OWR A;  3BG0 A;  4AMZ A;  3DWL C;  4XEI C;  4H5I A;  4AN1 A;  5EM2 A;  3JAM g;  1M1X A;  3VA6 A;  1PGU A;  3KCI A;  3SN6 B;  3VGZ A;  3NVX A;  4U1E I;  5AFU 3;  4O02 A;  1VZ2 A;  4AOW A;  3RFH A;  4H5J A;  3C9C A;  3ZDY A;  4AX4 A;  3EI4 B;  3KRW B;  1NR0 A;  1TYQ C;  3OKT A;  3GRE A;  2HKR A;  2I0S A;  5CXC B;  3SBR A;  5EM2 B;  3L4M D;  2HJ4 A;  3IUJ A;  3UKR C;  4JSP C;  4A2L A;  4BCD A;  4QAM A;  4GGD A;  2XL2 A;  4CY3 A;  1GOG A;  2EIB A;  4J79 A;  2H9M A;  2BBK H;  4NBM A;  3JZG A;  3OKY A;  4R7A B;  4A11 B;  2GC7 A;  3PSL A;  4OZU A;  3V4V A;  2JKX A;  3I7N A;  4AN0 A;  4DNU A;  3I7K A;  4K3J B;  4ZOY A;  4G56 B;  5H1M A;  4CI8 A;  1MG3 A;  2I3S A;  4J84 A;  5EAM A;  3MZL A;  4MMZ A;  3V4P A;  4DNW A;  5K19 A;  1UOP A;  4PC0 A;  2IUV A;  2VC2 A;  3CFV A;  4BCC A;  2B4E A;  4ZOV A;  1O6F A;  4GM8 A;  2YNO A;  3EWE A;  2P9L C;  5C2V B;  1FWX A;  3K71 A;  1U8C A;  3OKY B;  2EIE A;  4LGN A;  5H17 A;  3V7D B;  1L0Q A;  2VDO A;  2CO0 A;  4MMY A;  2VDQ A;  3MKQ A;  3I7L A;  4NSX A;  5EAR A;  4CI3 A;  1TBG A;  5TEF A;  5CXC A;  2YBA A;  3RN1 D;  4FHL A;  4J81 A;  5EML B;  4O2W A;  1UOQ A;  3QHY B;  4NAA A;  4E54 A;  5FKT A;  4JSX C;  4MMX A;  3VI3 A;  3SFZ A;  3GFC A;  4GGA A;  3IJC A;  1QFS A;  3ZE1 A;  3K26 A;  5TEE A;  3ZWL B;  2OK6 A;  4CI1 A;  3JPX A;  5SXM A;  2XDW A;  2H9P A;  2I3T A;  4TZ4 A;  3UVL A;  3PVW B;  4BP8 A;  2Q7Q A;  4D9S A;  5E6R A;  3UKU C;  2TRC B;  3RSE C;  1K8K C;  2H6K A;  1N6F A;  2VZ1 A;  4AMY A;  5H14 A;  1U4C A;  2P9N C;  3OTT A;  5GSA A;  4A08 B;  2VDL A;  3VH0 A;  3JB9 L;  2QZP A;  3DDU A;  3AH8 B;  4CZX A;  2H14 A;  3NVN A;  4XYI A;  5FQD A;  1SQJ A;  1VE7 A;  3AFC A;  4Z8L A;  1JOF A;  4A2M A;  3F3G A;  1SQ9 A;  4A0B A;  3UVO A;  3V5W B;  3IVM A;  4CY1 A;  4IRZ A;  5IC7 A;  4GQB B;  2Z2N A;  4A09 A;  3NID A;  1YR2 A;  1UTC A;  4JHP C;  2HXC A;  4RE6 A;  4XYH A;  3IUM A;  3MZK A;  4CY2 A;  1E8M A;  4ERY A;  3ZE2 A;  4BH6 A;  4X60 B;  4YVD A;  2AQ5 A;  4GZ8 A;  4KFM B;  5FKQ A;  4FAV D;  2AH0 A;  5HE3 B;  3MKS B;  4L9O A;  3SLE D;  2YB8 B;  1E5T A;  4QL1 A;  1H2W A;  4BUJ C;  3K6S A;  4PNK B;  4J0X A;  3IKO A;  4CZY A;  2CO0 C;  5K1C C;  5TF2 A;  2J57 G;  4DNV A;  3EI4 A;  5GXI A;  5GMK n;  3OL2 A;  4J0W A;  5AJA A;  3P4F A;  3AL8 B;  3O4G A;  5I5M A;  4WJK A;  5HQG A;  1TYE A;  3PXT D;  3UVK A;  2HJB A;  3EI3 A;  4Z7Q A;  3I7P A;  4JT6 C;  5IJ8 E;  4ERQ A;  4Y7R A;  2OK4 A;  4NC4 A;  4BCB A;  3IJ1 A;  3A0F A;  3I8E A;  5M5R A;  5FLX g;  4EWR A;  1SHY B;  1VYH C;  3FRX A;  4JT5 C;  2HKM A;  3AL9 A;  2P9K C;  1XHM A;  2VDR A;  2OVR B;  2P9P C;  3UVN A;  2XZG A;  4J86 A;  5E6U A;  4UM8 A;  3C75 H;  1JTD B;  2AGW A;  3F3F A;  4J73 A;  4K3I D;  5IJ7 E;  2PBI B;  1C9I A;  1BPO A;  1QNI A;  4LG9 A;  2EBS A;  3EU7 A;  1UOO A;  2PM9 A;  3MMY A;  3O4J A;  1QFM A;  4O9D A;  2VDN A;  1GP2 B;  2P9S C;  4Z7O A;  3OKW A;  4CY5 A;  4JHN A;  2G9A A;  2Z2O A;  1MG2 A;  2H47 A;  4FAN D;  5TDH B;  2AGX A;  4A0A A;  5FFO A;  4J8B A;  1K3I A;  5IGO A;  3GD1 I;  3RRM C;  3MUN A;  2I0T A;  1E8N A;  4L1Q D;  4Z7N A;  3KRX B;  2IUQ A;  4JD2 C;  3BG1 A;  3O4H A;  2EIC A;  3RFG A;  3BWS A;  5FXY A;  1U2V C;  2XE4 A;  2EID A;  3O4I A;  2BKL A;  2QC5 A;  5FFG A;  4X61 B;  4J87 A;  2P9U C;  3PE7 A;  5E6S A;  2AH1 A;  5EAL A;  2UZX B;  4UM9 A;  2I0R A;  4ZN4 A;  4UI9 R;  1JMX B;  3N0E A;  3RN0 D;  5CXB A;  5FA5 B;  1T2X A;  5JWZ A;  3ZE0 A;  1C9L A;  2QR5 A;  3IIW A;  4FB1 D;  4PBY A;  2Z2P A;  2OJY A;  2AGY A;  4N14 A;  5EMK B;  4MK0 B;  3W15 A;  3AL8 A;  3C99 A;  5C2W B;  3VI4 A;  3SMR A;  1PBY B;  2H6N A;  4QQE A;  3EG6 A;  3IUN A;  1Q47 A;  4WK4 A;  4PSX B;  1H2Y A;  4BL0 A;  2IUR A;  3EMH A;  3RMZ D;  2GNQ A;  3EQ9 A;  1S4U X;  3QI0 A;  3J80 g;  4E5Z A;  4JSN C;  1H2X A;  3SBP A;  3PXS D;  4LG8 A;  4ZOX A;  1GOH A;  5M5T A;  3EI1 B;  2PM7 B;  1B9Y A;  4G1M A;  3SCY A;  4BP9 A;  4GMB A;  3V9F A;  1MDA H;  1JV2 A;  3IUQ A;  3SJL D;  2HES X;  4I79 A;  3NVQ A;  3MXX A;  4J82 A;  3HFQ A;  3ODT A;  4AEZ A;  2J56 H;  3UR4 A;  2P9I C;  3SBQ A;  4ES0 A;  3EI2 B;  3SXT D;  2W18 A;  2YNP A;  3C5M A;  2H13 A;  4A7J A;  1VZ3 A;  5HE0 B;  3ZDX A;  2HU8 A;  4O1Q D;  1K32 A;  4E5Z B;  2IWF A;  4GQ2 P;  3MUO A;  1H2Z A;  2WQ8 A;  4ERZ A;  2H6Q A;  3DXM C;  2XL3 A;  3DSM A;  3FM0 A;  2CE8 A;  3I2N A;  3FCS A;  2PM6 B;  2VDP A;  3CFS B;  1PEV A;  2HU5 A;  5M61 A;  3PSC B;  4HDJ A;  2AGZ A;  5M5U A;  4O45 A;  4QT8 A;  5HDB A;  5THA A;  5M5S A;  2HYE A;  5I5I A;  2H68 A;  4PBZ A;  2H9L A;  5FKR A;  3EI1 A;  4X63 B;  5CXB B;  3SHF A;  3NIF A;  4L3G D;  1I2M B;  2OVP B;  4CZV A;  1GG2 B;  5AMS A;  3EQ8 A;  3JZH A;  3OL2 B;  1XKS A;  4ZOZ A;  4JSV C;  1RI6 A;  2UZY B;  1ERJ A;  2GC4 A; 
#chains in the Genus database with same CATH homology
 1N6D A;  3B7F A;  3RLM D;  3JZN A;  4CI2 A;  2CN2 A;  5GXH A;  4ESG A;  3EI2 A;  2J55 H;  4E54 B;  3SVW D;  4CC9 A;  1PI6 A;  4D0K A;  1JMZ B;  2CN3 A;  1R5M A;  3OW8 A;  1GXR A;  2MTA H;  5KDO B;  3PVU B;  4D6V A;  2XYI A;  3JRP A;  3CIK B;  4FA5 D;  3SWS D;  4A0B B;  4A0A B;  2B5M A;  3PXW D;  3N0D A;  1XIP A;  4Y5R D;  5HE1 B;  5FKS A;  1NEX B;  2XU7 A;  5EMM B;  4IA9 A;  4FWW A;  4L3H D;  2QXV A;  1B9X A;  2IAA A;  1A0R B;  4X3E A;  4IMM A;  5IT9 g;  3I8C A;  4A11 A;  3EI3 B;  5A2Q g;  3JRO A;  4GM3 A;  1JJU B;  4J77 A;  5EMJ B;  3L4O D;  5EAP A;  4GGC A;  4J8G A;  2YMU A;  5CYK A;  2O9K A;  3ORV D;  4U7A A;  2IWK A;  1GOT B;  5C9Z B;  5IGQ A;  4PXW A;  2BCJ B;  2OVQ B;  3I7O A;  2CE9 A;  3F3P A;  4PSW B;  2IUP A;  3K27 A;  4O3T B;  4GQ1 A;  2AGL A;  5I5J A;  5HYN B;  3DXK C;  3IJ0 A;  4A08 A;  5B4W A;  1OLZ A;  1YFQ A;  3UVM A;  2CNX A;  3IIY A;  2OIZ A;  4FA1 D;  2B5N A;  2B5L A;  2H3X A;  4J78 A;  2PM9 B;  1N6E A;  1OMW B;  3U4Y A;  4A09 B;  2G99 A;  3ULE C;  4FA9 D;  1P22 A;  3J81 g;  3FGB A;  5HE2 B;  4GM9 A;  2YNN A;  3I89 A;  5CYK B;  4JXM A;  3E0C A;  3DM0 A;  4FA4 D;  4QRJ A;  3I7H A;  4O3U B;  2H9N A;  4OWR A;  3BG0 A;  3DWL C;  4XEI C;  4H5I A;  5EM2 A;  3JAM g;  3VA6 A;  1PGU A;  3SN6 B;  3VGZ A;  3NVX A;  4U1E I;  5AFU 3;  4AOW A;  3RFH A;  4H5J A;  3C9C A;  3EI4 B;  3KRW B;  1NR0 A;  1TYQ C;  3OKT A;  3GRE A;  2HKR A;  2I0S A;  5CXC B;  3SBR A;  5EM2 B;  3L4M D;  2HJ4 A;  3UKR C;  4JSP C;  4A2L A;  4GGD A;  2XL2 A;  4CY3 A;  4J79 A;  2H9M A;  2BBK H;  3JZG A;  3OKY A;  4R7A B;  4A11 B;  2GC7 A;  3PSL A;  4OZU A;  3I7N A;  3I7K A;  4K3J B;  4ZOY A;  4G56 B;  5H1M A;  4CI8 A;  1MG3 A;  2I3S A;  4J84 A;  5EAM A;  3MZL A;  5K19 A;  4PC0 A;  2IUV A;  3CFV A;  2B4E A;  4ZOV A;  4GM8 A;  2YNO A;  3EWE A;  2P9L C;  5C2V B;  1FWX A;  3OKY B;  4LGN A;  5H17 A;  3V7D B;  1L0Q A;  2CO0 A;  3MKQ A;  3I7L A;  4NSX A;  5EAR A;  4CI3 A;  1TBG A;  5TEF A;  5CXC A;  2YBA A;  3RN1 D;  4FHL A;  4J81 A;  5EML B;  4E54 A;  5FKT A;  4JSX C;  3SFZ A;  3GFC A;  4GGA A;  3IJC A;  3K26 A;  5TEE A;  3ZWL B;  2OK6 A;  4CI1 A;  3JPX A;  5SXM A;  4TZ4 A;  2H9P A;  2I3T A;  3UVL A;  3PVW B;  2Q7Q A;  3UKU C;  2TRC B;  3RSE C;  1K8K C;  2H6K A;  1N6F A;  5H14 A;  1U4C A;  2P9N C;  3OTT A;  5GSA A;  4A08 B;  3VH0 A;  3JB9 L;  3AH8 B;  4CZX A;  2H14 A;  3NVN A;  4XYI A;  5FQD A;  1SQJ A;  3AFC A;  4Z8L A;  1JOF A;  4A2M A;  3F3G A;  1SQ9 A;  4A0B A;  3UVO A;  3V5W B;  4CY1 A;  5IC7 A;  4GQB B;  2Z2N A;  4A09 A;  2HXC A;  4XYH A;  3MZK A;  4CY2 A;  4ERY A;  4BH6 A;  4X60 B;  4YVD A;  2AQ5 A;  4GZ8 A;  4KFM B;  5FKQ A;  4FAV D;  2AH0 A;  5HE3 B;  3MKS B;  4L9O A;  3SLE D;  2YB8 B;  4QL1 A;  4BUJ C;  4PNK B;  4J0X A;  3IKO A;  4CZY A;  2CO0 C;  5K1C C;  5TF2 A;  2J57 G;  3EI4 A;  5GXI A;  5GMK n;  3OL2 A;  4J0W A;  5AJA A;  3P4F A;  3AL8 B;  5I5M A;  5HQG A;  3PXT D;  3UVK A;  2HJB A;  3EI3 A;  3I7P A;  4JT6 C;  5IJ8 E;  4ERQ A;  4Y7R A;  2OK4 A;  3IJ1 A;  3A0F A;  3I8E A;  5FLX g;  4EWR A;  1SHY B;  1VYH C;  3FRX A;  4JT5 C;  2HKM A;  3AL9 A;  2P9K C;  1XHM A;  2OVR B;  2P9P C;  3UVN A;  4J86 A;  3C75 H;  2AGW A;  3F3F A;  4J73 A;  4K3I D;  5IJ7 E;  2PBI B;  1QNI A;  4LG9 A;  2EBS A;  3EU7 A;  2PM9 A;  3MMY A;  4O9D A;  1GP2 B;  2P9S C;  3OKW A;  4CY5 A;  2G9A A;  2Z2O A;  1MG2 A;  2H47 A;  4FAN D;  5TDH B;  2AGX A;  4A0A A;  4J8B A;  5IGO A;  3RRM C;  2I0T A;  4L1Q D;  3KRX B;  2IUQ A;  4JD2 C;  3BG1 A;  3RFG A;  3BWS A;  5FXY A;  1U2V C;  2QC5 A;  4X61 B;  4J87 A;  2P9U C;  3PE7 A;  2AH1 A;  5EAL A;  2UZX B;  2I0R A;  4ZN4 A;  4UI9 R;  1JMX B;  3N0E A;  3RN0 D;  5CXB A;  5FA5 B;  5JWZ A;  3IIW A;  4FB1 D;  4PBY A;  2Z2P A;  2OJY A;  2AGY A;  4N14 A;  5EMK B;  4MK0 B;  3W15 A;  3AL8 A;  3C99 A;  5C2W B;  3SMR A;  1PBY B;  2H6N A;  4QQE A;  3EG6 A;  1Q47 A;  4PSX B;  4BL0 A;  2IUR A;  3EMH A;  3RMZ D;  2GNQ A;  1S4U X;  3J80 g;  4E5Z A;  4JSN C;  3SBP A;  3PXS D;  4LG8 A;  4ZOX A;  3EI1 B;  2PM7 B;  1B9Y A;  3SCY A;  4GMB A;  3V9F A;  1MDA H;  3SJL D;  2HES X;  4I79 A;  3NVQ A;  3MXX A;  4J82 A;  3HFQ A;  3ODT A;  4AEZ A;  2J56 H;  3UR4 A;  2P9I C;  3SBQ A;  4ES0 A;  3EI2 B;  3SXT D;  2W18 A;  2YNP A;  3C5M A;  2H13 A;  4A7J A;  5HE0 B;  4O1Q D;  1K32 A;  4E5Z B;  2IWF A;  4GQ2 P;  4ERZ A;  2H6Q A;  3DXM C;  2XL3 A;  3DSM A;  3FM0 A;  2CE8 A;  3I2N A;  2PM6 B;  3CFS B;  1PEV A;  3PSC B;  4HDJ A;  2AGZ A;  4O45 A;  4QT8 A;  5THA A;  2HYE A;  5I5I A;  2H68 A;  4PBZ A;  2H9L A;  5FKR A;  3EI1 A;  4X63 B;  5CXB B;  3SHF A;  4L3G D;  2OVP B;  4CZV A;  1GG2 B;  5AMS A;  3JZH A;  3OL2 B;  1XKS A;  4ZOZ A;  4JSV C;  1RI6 A;  2UZY B;  1ERJ A;  2GC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...