2J57G

X-ray reduced paraccocus denitrificans methylamine dehydrogenase n- quinol in complex with amicyanin.
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
382
structure length
382
Chain Sequence
EAETQAQETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMICYANIN
publication title Tracking X-Ray-Derived Redox Changes in Crystals of a Methylamine Dehydrogenase/Amicyanin Complex Using Single-Crystal Uv/Vis Microspectrophotometry.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 95
structure length 382
sequence length 382
chains with identical sequence H, I, J
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2j57G00
4H5JA 4BH6A 4A09A 4AOWA 5FKTA 4D6VA 3EWEA 3JROA 5EMKB 5A2Qg 4XYIA 3I8EA 2CE8A 1TBGA 4CZVA 3IJCA 1R5MA 3PXWD 3SWSD 5KDOB 3EI3A 1XKSA 4J73A 2IUQA 4CY5A 3DM0A 4J77A 3JPXA 4O45A 5TF2A 4A11A 4A0BB 5B4WA 2J56H 4GM3A 3DXMC 4JSVC 3VH0A 4O3TB 4GM8A 5CYKA 3PE7A 2EBSA 3PXTD 3RN0D 1XIPA 1TYQC 2GC4A 3L4MD 5GXIA 4GMBA 4A2LA 2HJ4A 3EI2B 3IJ1A 3RFHA 4FHLA 2BBKH 5AMSA 4GQ2P 2UZYB 2YNOA 2AQ5A 4QT8A 3KRXB 2Z2PA 3SBRA 2CO0A 4A0AB 4ERZA 4PBZA 5IJ7E 3RRMC 5AFU3 2P9LC 1GG2B 3RLMD 4O3UB 3JAMg 2G9AA 5GSAA 2YBAA 3MXXA 3DWLC 2AH1A 3EI4B 1GOTB 3L4OD 4FAVD 1NR0A 4ZOVA 3I7KA 2H47A 2OJYA 2XL3A 4FA5D 3PVUB 4ES0A 4J81A 2H9MA 3JRPA 3NVXA 2HJBA 1GP2B 2B5NA 4L3HD 5FKRA 5K1CC 4PBYA 3VA6A 3AFCA 2OK6A 1JJUB 2AGZA 3RSEC 4A09B 3V7DB 3PSLA 5EM2A 3K27A 1K8KC 5AJAA 3BWSA 3EMHA 5EAPA 3EI1A 2H9LA 1SHYB 2J55H 1P22A 2GC7A 2XU7A 3OKWA 1PI6A 4U7AA 3U4YA 1XHMA 4J0WA 3EI3B 4H5IA 4CI2A 4XYHA 3ZWLB 2QXVA 4GQ1A 3JZNA 4X63B 5IGOA 3AL8A 4CC9A 4ERQA 4ZOXA 1YFQA 1K32A 2IURA 2I0TA 3V5WB 3AH8B 2XYIA 4GM9A 2CN3A 3SVWD 1U4CA 5FA5B 5CYKB 3OKYB 5FXYA 1RI6A 2P9UC 3C75H 3CFSB 3IIYA 1FWXA 5TEFA 2HKMA 3CFVA 4A08A 5JWZA 4U1EI 3W15A 3JZGA 3PVWB 4UI9R 1JOFA 4X60B 5EARA 3C9CA 3IJ0A 4GGCA 2OK4A 4OZUA 3RN1D 1ERJA 3NVNA 3A0FA 5GXHA 2QC5A 2I3SA 2YNPA 3B7FA 1Q47A 2H6KA 3MKQA 3OKYA 4J8BA 4R7AB 1B9YA 5H1MA 5THAA 4GGDA 1JMXB 3SHFA 4CI8A 3C5MA 5HE1B 3SFZA 2PM7B 2PBIB 4K3JB 1N6DA 2AGXA 3K26A 5FLXg 5CXCA 4JT5C 3SN6B 2AGLA 4L3GD 2MTAH 2TRCB 3JB9L 1MG2A 2HXCA 3FGBA 3I7PA 4Y5RD 5EM2B 3VGZA 2PM9A 3EI1B 4CY3A 2HYEA 2H9PA 2O9KA 5FKQA 1JMZB 5FQDA 1SQJA 4PNKB 4TZ4A 4FA4D 5EMMB 4O1QD 4MK0B 4PXWA 2AGYA 4EWRA 5EALA 4QRJA 2Z2NA 3NVQA 3IIWA 3AL8B 5C9ZB 3KRWB 4GQBB 2I0SA 3F3PA 4KFMB 4HDJA 4J86A 3OW8A 3PXSD 3BG1A 2YNNA 1NEXB 4NSXA 3UVNA 5HYNB 5EAMA 2HESX 2H14A 4J84A 4FA9D 3GREA 3JZHA 3F3GA 3CIKB 3OKTA 3UVKA 5I5IA 2J57G 4A08B 1OLZA 4LG8A 5FKSA 3UKRC 5GMKn 3C99A 5IGQA 1N6FA 4E54A 5SXMA 3GFCA 4J8GA 2AGWA 1PEVA 1L0QA 2CE9A 4PSXB 4PC0A 3DSMA 2AH0A 4IMMA 3DXKC 4CI1A 3SBPA 5CXBA 4BUJC 3AL9A 2H6NA 4QQEA 2CO0C 3UVLA 4JD2C 5I5JA 2P9IC 5EMLB 1PBYB 4L9OA 4D0KA 4CI3A 2YB8B 4Y7RA 4JT6C 2P9NC 2W18A 2I3TA 3I7NA 1MG3A 4AEZA 5TDHB 4A7JA 5CXCB 4N14A 4ZOYA 3ULEC 2CNXA 2IWFA 4QL1A 3J81g 3I7OA 4ZOZA 4Z8LA 2Z2OA 3MMYA 2G99A 2H13A 3I89A 2Q7QA 2OVRB 4JSPC 4G56B 2PM9B 4JSXC 4E5ZA 5IT9g 3N0DA 5C2VB 3OL2A 5HE2B 2PM6B 4ZN4A 4J79A 4O9DA 3BG0A 2IUPA 4JSNC 3SCYA 1S4UX 3I7HA 2IAAA 5K19A 5EMJB 4CY1A 3SJLD 3MZKA 2H9NA 5HE3B 4XEIC 3PSCB 3UKUC 3FM0A 3J80g 3ODTA 2IWKA 1PGUA 3MZLA 1MDAH 3E0CA 4J0XA 5HE0B 3N0EA 4E54B 3V9FA 4ERYA 4X61B 5C2WB 4YVDA 4CY2A 3OTTA 5HQGA 2B5LA 1B9XA 3RMZD 2H6QA 4A0BA 4BL0A 4I79A 2I0RA 4K3ID 5CXBB 2B4EA 2YMUA 2XL2A 4LG9A 5I5MA 3UR4A 1SQ9A 2HKRA 4J82A 3MKSB 1U2VC 4ESGA 3IKOA 3I8CA 3I7LA 1N6EA 5IC7A 4CZXA 2H68A 3EI2A 5IJ8E 4J87A 3FRXA 3EU7A 2OIZA 1QNIA 4GZ8A 2OVQB 3UVMA 4A0AA 2UZXB 4GGAA 1OMWB 2P9SC 4CZYA 2BCJB 3SXTD 3I2NA 3SLED 4JXMA 3RFGA 4OWRA 2OVPB 2P9KC 3UVOA 1VYHC 2P9PC 3P4FA 5H14A 3EI4A 5H17A 3HFQA 3F3FA 4E5ZB 3OL2B 3ORVD 3SMRA 4X3EA 1A0RB 4L1QD 3EG6A 2CN2A 4FWWA 3SBQA 4A11B 4J78A 4FAND 1GXRA 2GNQA 2B5MA 5TEEA 4FB1D 2H3XA 4FA1D 4PSWB 4A2MA 4LGNA 2IUVA 4IA9A
chains in the Genus database with same CATH superfamily
4H5JA 5E6UA 4BH6A 4A09A 3NIFA 4AOWA 2VDLA 4WK2A 5FKTA 4D6VA 3EWEA 3JROA 5EMKB 5A2Qg 1VE7A 4XYIA 5FFGA 3I8EA 2CE8A 1TBGA 4CZVA 3IJCA 1R5MA 3PXWD 3SWSD 5KDOB 4RE5A 3EI3A 1XKSA 4J73A 4G1MA 2IUQA 3GC3B 4CY5A 3DM0A 4J77A 1E8NA 3JPXA 4O45A 5TF2A 4BP8A 4A11A 4A0BB 1H2YA 5B4WA 2J56H 4GM3A 3ZE2A 3DXMC 4JSVC 3VH0A 4O3TB 4GM8A 4Z7NA 5CYKA 2VZ1A 3PE7A 2EBSA 3PXTD 4G55A 3RN0D 1XIPA 1TYQC 3IUQA 4BP9A 3MVDK 2GC4A 3L4MD 5GXIA 1BPOA 4GMBA 4A2LA 2HJ4A 3EI2B 3IJ1A 3RFHA 4BCDA 4FHLA 2BBKH 5AMSA 4GQ2P 2UZYB 5E6SA 3T3MA 5HDBA 2YNOA 2AQ5A 4QT8A 1M1XA 3KRXB 2Z2PA 3SBRA 1QFMA 1QFSA 2CO0A 4A0AB 4ERZA 4MMYA 3O4JA 4PBZA 3V4PA 5IJ7E 3RRMC 5AFU3 2P9LC 1GG2B 3RLMD 4O3UB 3JAMg 2G9AA 5GSAA 2YBAA 3MXXA 3OF7A 4MMZA 3DWLC 5M5RA 2AH1A 3EI4B 1GOTB 3O4GA 5M5SA 3L4OD 4FAVD 1NR0A 4ZOVA 3I7KA 2H47A 2OJYA 2XL3A 4FA5D 5C92A 2WQ8A 4AMZA 1UOPA 3PVUB 3ZDYA 4ES0A 3JRPA 2H9MA 3NVXA 4J81A 1GOGA 2HJBA 1GP2B 2B5NA 4L3HD 5FKRA 1GOFA 3MUNA 5K1CC 4PBYA 4AN1A 3VA6A 1I2MB 2QR5A 3AFCA 3IJEA 2OK6A 1JJUB 2AGZA 3RSEC 4A09B 3V7DB 3PSLA 5EM2A 3K27A 1K8KC 5AJAA 3BWSA 3EMHA 5EAPA 3EI1A 2H9LA 1SHYB 1L5GA 2J55H 1P22A 2GC7A 2XU7A 3OKWA 1PI6A 4U7AA 3U4YA 1XHMA 4RE6A 4J0WA 3EI3B 4D9SA 4H5IA 5E6RA 1TYEA 4CI2A 4XYHA 3EQ9A 2XDWA 3ZWLB 2QXVA 4GQ1A 3JZNA 4X63B 5IGOA 3AL8A 4CC9A 4ERQA 4ZOXA 1YFQA 1K32A 4BCBA 2IURA 2I0TA 3V5WB 3AH8B 2XYIA 4GM9A 2CN3A 3SVWD 1U4CA 1A12A 5FA5B 5CYKB 2VDOA 2BKLA 3OKYB 2VDQA 5FXYA 4QAMA 1RI6A 3IVMA 2P9UC 3C75H 3CFSB 4O2WA 1VZ3A 3IIYA 1FWXA 5TEFA 5C86A 2HKMA 3CFVA 4A08A 5JWZA 4U1EI 3W15A 4NAAA 1T2XA 3JZGA 3PVWB 2HU8A 4UI9R 2VDRA 1JOFA 4X60B 5EARA 3C9CA 3IJ0A 1O6GA 4GGCA 2OK4A 4OZUA 3RN1D 1ERJA 4NC4A 3IUJA 3A0FA 3NVNA 3T3PA 5GXHA 2QC5A 2I3SA 2YNPA 3B7FA 1Q47A 2H6KA 1YR2A 3MKQA 3OKYA 2EIDA 4J8BA 4R7AB 1B9YA 2VZ3A 4JHPC 5H1MA 5THAA 4GGDA 1JMXB 3SHFA 4CI8A 4JHNA 3C5MA 5HE1B 1UTCA 3SFZA 2PM7B 1JTDB 2PBIB 4K3JB 1N6DA 2AGXA 3K26A 5FLXg 5CXCA 3VI3A 4WK0A 4JT5C 3SN6B 1GOHA 2VDPA 2XE4A 2AGLA 4L3GD 2MTAH 2TRCB 3JB9L 2VDMA 1MG2A 2HXCA 4AMYA 3FGBA 3I7PA 4L1MA 4Y5RD 5EM2B 3VGZA 2PM9A 3EI1B 5M5UA 4CY3A 2HYEA 5M5VA 2H9PA 2O9KA 5FKQA 1JMZB 5FQDA 1SQJA 4PNKB 4TZ4A 4FA4D 5EMMB 3ZE1A 4O1QD 4MK0B 4PXWA 2AGYA 4EWRA 5EALA 4QRJA 2Z2NA 3NVQA 3IIWA 3AL8B 5C9ZB 3FCSA 3KRWB 4GQBB 4UM9A 2I0SA 3F3PA 4IRZA 4KFMB 4HDJA 4J86A 3OW8A 3K72A 3PXSD 3BG1A 2YNNA 1NEXB 4NSXA 3UVNA 5HYNB 5EAMA 2HESX 2H14A 2HU5A 4J84A 4FA9D 3GREA 3JZHA 3F3GA 3CIKB 3IULA 3OKTA 3UVKA 5I5IA 2J57G 4A08B 1OLZA 4LG8A 5FKSA 3UKRC 5GMKn 4DNUA 3C99A 5IGQA 1N6FA 4E54A 5SXMA 3GFCA 4J8GA 1C9LA 1VZ2A 2AGWA 1PEVA 1L0QA 2CE9A 4PSXB 4PC0A 3KCIA 3DSMA 2AH0A 3V4VA 4IMMA 3DXKC 4CI1A 3SBPA 3O4HA 1K3IA 5CXBA 4BUJC 2EIBA 2JKXA 4UM8A 3AL9A 2H6NA 4O02A 4QQEA 2CO0C 3UVLA 4AN0A 1VE6A 4JD2C 5I5JA 2P9IC 5EMLB 1PBYB 3K71A 4L9OA 4D0KA 4CI3A 2YB8B 4Y7RA 3ZE0A 2EICA 4JT6C 2P9NC 2W18A 3ZDZA 3IUMA 2XZGA 2I3TA 3I7NA 1H2WA 4MMXA 1MG3A 4AEZA 5TDHB 4A7JA 5CXCB 4N14A 4ZOYA 3ULEC 2CNXA 2IWFA 3QHYB 4QL1A 3J81g 3I7OA 4ZOZA 4Z8LA 1H2XA 2Z2OA 3MMYA 2G99A 3O4IA 3I89A 2EIEA 2H13A 2Q7QA 2OVRB 1E8MA 3IURA 4JSPC 4G56B 2PM9B 4JSXC 4E5ZA 5IT9g 3N0DA 5C2VB 3OL2A 5HE2B 2PM6B 4ZN4A 4J79A 4O9DA 4WK4A 3BG0A 2IUPA 1H2ZA 4JSNC 3SCYA 1S4UX 2QZPA 3I7HA 2IAAA 5K19A 5EMJB 4CY1A 4DNVA 3SJLD 3MZKA 4Z7OA 2H9NA 3DDUA 4XEIC 5HE3B 3PSCB 4NBMA 1UOOA 3UKUC 1JV2A 3FM0A 3J80g 3ODTA 2IWKA 1PGUA 3GD1I 4WJKA 3MZLA 4BCCA 2VDKA 1MDAH 2HU7A 3NIGA 3E0CA 4J0XA 5HE0B 3N0EA 4E54B 1UOQA 3EQ8A 3V9FA 4ERYA 3K6SA 4X61B 5C2WB 4YVDA 4CY2A 1O6FA 3OTTA 5HQGA 2B5LA 1B9XA 3RMZD 2H6QA 4A0BA 4BL0A 3MUOA 4I79A 2I0RA 4K3ID 5CXBB 2B4EA 5FFOA 2YMUA 2XL2A 4LG9A 5I5MA 3UR4A 1SQ9A 5M61A 4AX4A 2HKRA 4J82A 3MKSB 1U2VC 4ESGA 3IKOA 3I8CA 3I7LA 3IUNA 1N6EA 5IC7A 3ZDXA 4CZXA 2H68A 3EI2A 5IJ8E 4J87A 3FRXA 3EU7A 2OIZA 1QNIA 4GZ8A 2OVQB 4G1EA 3UVMA 4A0AA 2UZXB 4GGAA 1OMWB 2P9SC 4CZYA 2BCJB 3SXTD 3I2NA 3SLED 4JXMA 3RFGA 4OWRA 1U8CA 2OVPB 2P9KC 3UVOA 1VYHC 4NENA 4DNWA 2P9PC 3P4FA 5H14A 3FCUA 3EI4A 5H17A 2VC2A 3HFQA 3F3FA 1E5TA 4E5ZB 3OL2B 1C9IA 3ORVD 3SMRA 5M5TA 4X3EA 4Z7QA 1A0RB 4L1QD 3EG6A 2CN2A 4FWWA 3SBQA 4A11B 4J78A 4FAND 1GXRA 2GNQA 2B5MA 5TEEA 4FB1D 3NIDA 2H3XA 3EQ7A 4FA1D 2VDNA 4PSWB 3QI0A 4A2MA 4LGNA 2IUVA 4IA9A 3VI4A
chains in the Genus database with same CATH topology
4H5JA 4BH6A 4A09A 4AOWA 5FKTA 4D6VA 3EWEA 3JROA 5EMKB 5A2Qg 4XYIA 3I8EA 2CE8A 1TBGA 4CZVA 3IJCA 1R5MA 3PXWD 3SWSD 5KDOB 3EI3A 1XKSA 4J73A 2IUQA 4CY5A 3DM0A 4J77A 3JPXA 4O45A 5TF2A 4A11A 4A0BB 5B4WA 2J56H 4GM3A 3DXMC 4JSVC 3VH0A 4O3TB 4GM8A 5CYKA 3PE7A 2EBSA 3PXTD 3RN0D 1XIPA 1TYQC 2GC4A 3L4MD 5GXIA 4GMBA 4A2LA 2HJ4A 3EI2B 3IJ1A 3RFHA 4FHLA 2BBKH 5AMSA 4GQ2P 2UZYB 2YNOA 2AQ5A 4QT8A 3KRXB 2Z2PA 3SBRA 2CO0A 4A0AB 4ERZA 4PBZA 5IJ7E 3RRMC 5AFU3 2P9LC 1GG2B 3RLMD 4O3UB 3JAMg 2G9AA 5GSAA 2YBAA 3MXXA 3DWLC 2AH1A 3EI4B 1GOTB 3L4OD 4FAVD 1NR0A 4ZOVA 3I7KA 2H47A 2OJYA 2XL3A 4FA5D 3PVUB 4ES0A 4J81A 2H9MA 3JRPA 3NVXA 2HJBA 1GP2B 2B5NA 4L3HD 5FKRA 5K1CC 4PBYA 3VA6A 3AFCA 2OK6A 1JJUB 2AGZA 3RSEC 4A09B 3V7DB 3PSLA 5EM2A 3K27A 1K8KC 5AJAA 3BWSA 3EMHA 5EAPA 3EI1A 2H9LA 1SHYB 2J55H 1P22A 2GC7A 2XU7A 3OKWA 1PI6A 4U7AA 3U4YA 1XHMA 4J0WA 3EI3B 4H5IA 4CI2A 4XYHA 3ZWLB 2QXVA 4GQ1A 3JZNA 4X63B 5IGOA 3AL8A 4CC9A 4ERQA 4ZOXA 1YFQA 1K32A 2IURA 2I0TA 3V5WB 3AH8B 2XYIA 4GM9A 2CN3A 3SVWD 1U4CA 5FA5B 5CYKB 3OKYB 5FXYA 1RI6A 2P9UC 3C75H 3CFSB 3IIYA 1FWXA 5TEFA 2HKMA 3CFVA 4A08A 5JWZA 4U1EI 3W15A 3JZGA 3PVWB 4UI9R 1JOFA 4X60B 5EARA 3C9CA 3IJ0A 4GGCA 2OK4A 4OZUA 3RN1D 1ERJA 3NVNA 3A0FA 5GXHA 2QC5A 2I3SA 2YNPA 3B7FA 1Q47A 2H6KA 3MKQA 3OKYA 4J8BA 4R7AB 1B9YA 5H1MA 5THAA 4GGDA 1JMXB 3SHFA 4CI8A 3C5MA 5HE1B 3SFZA 2PM7B 2PBIB 4K3JB 1N6DA 2AGXA 3K26A 5FLXg 5CXCA 4JT5C 3SN6B 2AGLA 4L3GD 2MTAH 2TRCB 3JB9L 1MG2A 2HXCA 3FGBA 3I7PA 4Y5RD 5EM2B 3VGZA 2PM9A 3EI1B 4CY3A 2HYEA 2H9PA 2O9KA 5FKQA 1JMZB 5FQDA 1SQJA 4PNKB 4TZ4A 4FA4D 5EMMB 4O1QD 4MK0B 4PXWA 2AGYA 4EWRA 5EALA 4QRJA 2Z2NA 3NVQA 3IIWA 3AL8B 5C9ZB 3KRWB 4GQBB 2I0SA 3F3PA 4KFMB 4HDJA 4J86A 3OW8A 3PXSD 3BG1A 2YNNA 1NEXB 4NSXA 3UVNA 5HYNB 5EAMA 2HESX 2H14A 4J84A 4FA9D 3GREA 3JZHA 3F3GA 3CIKB 3OKTA 3UVKA 5I5IA 2J57G 4A08B 1OLZA 4LG8A 5FKSA 3UKRC 5GMKn 3C99A 5IGQA 1N6FA 4E54A 5SXMA 3GFCA 4J8GA 2AGWA 1PEVA 1L0QA 2CE9A 4PSXB 4PC0A 3DSMA 2AH0A 4IMMA 3DXKC 4CI1A 3SBPA 5CXBA 4BUJC 3AL9A 2H6NA 4QQEA 2CO0C 3UVLA 4JD2C 5I5JA 2P9IC 5EMLB 1PBYB 4L9OA 4D0KA 4CI3A 2YB8B 4Y7RA 4JT6C 2P9NC 2W18A 2I3TA 3I7NA 1MG3A 4AEZA 5TDHB 4A7JA 5CXCB 4N14A 4ZOYA 3ULEC 2CNXA 2IWFA 4QL1A 3J81g 3I7OA 4ZOZA 4Z8LA 2Z2OA 3MMYA 2G99A 2H13A 3I89A 2Q7QA 2OVRB 4JSPC 4G56B 2PM9B 4JSXC 4E5ZA 5IT9g 3N0DA 5C2VB 3OL2A 5HE2B 2PM6B 4ZN4A 4J79A 4O9DA 3BG0A 2IUPA 4JSNC 3SCYA 1S4UX 3I7HA 2IAAA 5K19A 5EMJB 4CY1A 3SJLD 3MZKA 2H9NA 5HE3B 4XEIC 3PSCB 3UKUC 3FM0A 3J80g 3ODTA 2IWKA 1PGUA 3MZLA 1MDAH 3E0CA 4J0XA 5HE0B 3N0EA 4E54B 3V9FA 4ERYA 4X61B 5C2WB 4YVDA 4CY2A 3OTTA 5HQGA 2B5LA 1B9XA 3RMZD 2H6QA 4A0BA 4BL0A 4I79A 2I0RA 4K3ID 5CXBB 2B4EA 2YMUA 2XL2A 4LG9A 5I5MA 3UR4A 1SQ9A 2HKRA 4J82A 3MKSB 1U2VC 4ESGA 3IKOA 3I8CA 3I7LA 1N6EA 5IC7A 4CZXA 2H68A 3EI2A 5IJ8E 4J87A 3FRXA 3EU7A 2OIZA 1QNIA 4GZ8A 2OVQB 3UVMA 4A0AA 2UZXB 4GGAA 1OMWB 2P9SC 4CZYA 2BCJB 3SXTD 3I2NA 3SLED 4JXMA 3RFGA 4OWRA 2OVPB 2P9KC 3UVOA 1VYHC 2P9PC 3P4FA 5H14A 3EI4A 5H17A 3HFQA 3F3FA 4E5ZB 3OL2B 3ORVD 3SMRA 4X3EA 1A0RB 4L1QD 3EG6A 2CN2A 4FWWA 3SBQA 4A11B 4J78A 4FAND 1GXRA 2GNQA 2B5MA 5TEEA 4FB1D 2H3XA 4FA1D 4PSWB 4A2MA 4LGNA 2IUVA 4IA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H5J A;  4BH6 A;  4A09 A;  4AOW A;  5FKT A;  4D6V A;  3EWE A;  3JRO A;  5EMK B;  5A2Q g;  4XYI A;  3I8E A;  2CE8 A;  1TBG A;  4CZV A;  3IJC A;  1R5M A;  3PXW D;  3SWS D;  5KDO B;  3EI3 A;  1XKS A;  4J73 A;  2IUQ A;  4CY5 A;  3DM0 A;  4J77 A;  3JPX A;  4O45 A;  5TF2 A;  4A11 A;  4A0B B;  5B4W A;  2J56 H;  4GM3 A;  3DXM C;  4JSV C;  3VH0 A;  4O3T B;  4GM8 A;  5CYK A;  3PE7 A;  2EBS A;  3PXT D;  3RN0 D;  1XIP A;  1TYQ C;  2GC4 A;  3L4M D;  5GXI A;  4GMB A;  4A2L A;  2HJ4 A;  3EI2 B;  3IJ1 A;  3RFH A;  4FHL A;  2BBK H;  5AMS A;  4GQ2 P;  2UZY B;  2YNO A;  2AQ5 A;  4QT8 A;  3KRX B;  2Z2P A;  3SBR A;  2CO0 A;  4A0A B;  4ERZ A;  4PBZ A;  5IJ7 E;  3RRM C;  5AFU 3;  2P9L C;  1GG2 B;  3RLM D;  4O3U B;  3JAM g;  2G9A A;  5GSA A;  2YBA A;  3MXX A;  3DWL C;  2AH1 A;  3EI4 B;  1GOT B;  3L4O D;  4FAV D;  1NR0 A;  4ZOV A;  3I7K A;  2H47 A;  2OJY A;  2XL3 A;  4FA5 D;  3PVU B;  4ES0 A;  4J81 A;  2H9M A;  3JRP A;  3NVX A;  2HJB A;  1GP2 B;  2B5N A;  4L3H D;  5FKR A;  5K1C C;  4PBY A;  3VA6 A;  3AFC A;  2OK6 A;  1JJU B;  2AGZ A;  3RSE C;  4A09 B;  3V7D B;  3PSL A;  5EM2 A;  3K27 A;  1K8K C;  5AJA A;  3BWS A;  3EMH A;  5EAP A;  3EI1 A;  2H9L A;  1SHY B;  2J55 H;  1P22 A;  2GC7 A;  2XU7 A;  3OKW A;  1PI6 A;  4U7A A;  3U4Y A;  1XHM A;  4J0W A;  3EI3 B;  4H5I A;  4CI2 A;  4XYH A;  3ZWL B;  2QXV A;  4GQ1 A;  3JZN A;  4X63 B;  5IGO A;  3AL8 A;  4CC9 A;  4ERQ A;  4ZOX A;  1YFQ A;  1K32 A;  2IUR A;  2I0T A;  3V5W B;  3AH8 B;  2XYI A;  4GM9 A;  2CN3 A;  3SVW D;  1U4C A;  5FA5 B;  5CYK B;  3OKY B;  5FXY A;  1RI6 A;  2P9U C;  3C75 H;  3CFS B;  3IIY A;  1FWX A;  5TEF A;  2HKM A;  3CFV A;  4A08 A;  5JWZ A;  4U1E I;  3W15 A;  3JZG A;  3PVW B;  4UI9 R;  1JOF A;  4X60 B;  5EAR A;  3C9C A;  3IJ0 A;  4GGC A;  2OK4 A;  4OZU A;  3RN1 D;  1ERJ A;  3NVN A;  3A0F A;  5GXH A;  2QC5 A;  2I3S A;  2YNP A;  3B7F A;  1Q47 A;  2H6K A;  3MKQ A;  3OKY A;  4J8B A;  4R7A B;  1B9Y A;  5H1M A;  5THA A;  4GGD A;  1JMX B;  3SHF A;  4CI8 A;  3C5M A;  5HE1 B;  3SFZ A;  2PM7 B;  2PBI B;  4K3J B;  1N6D A;  2AGX A;  3K26 A;  5FLX g;  5CXC A;  4JT5 C;  3SN6 B;  2AGL A;  4L3G D;  2MTA H;  2TRC B;  3JB9 L;  1MG2 A;  2HXC A;  3FGB A;  3I7P A;  4Y5R D;  5EM2 B;  3VGZ A;  2PM9 A;  3EI1 B;  4CY3 A;  2HYE A;  2H9P A;  2O9K A;  5FKQ A;  1JMZ B;  5FQD A;  1SQJ A;  4PNK B;  4TZ4 A;  4FA4 D;  5EMM B;  4O1Q D;  4MK0 B;  4PXW A;  2AGY A;  4EWR A;  5EAL A;  4QRJ A;  2Z2N A;  3NVQ A;  3IIW A;  3AL8 B;  5C9Z B;  3KRW B;  4GQB B;  2I0S A;  3F3P A;  4KFM B;  4HDJ A;  4J86 A;  3OW8 A;  3PXS D;  3BG1 A;  2YNN A;  1NEX B;  4NSX A;  3UVN A;  5HYN B;  5EAM A;  2HES X;  2H14 A;  4J84 A;  4FA9 D;  3GRE A;  3JZH A;  3F3G A;  3CIK B;  3OKT A;  3UVK A;  5I5I A;  2J57 G;  4A08 B;  1OLZ A;  4LG8 A;  5FKS A;  3UKR C;  5GMK n;  3C99 A;  5IGQ A;  1N6F A;  4E54 A;  5SXM A;  3GFC A;  4J8G A;  2AGW A;  1PEV A;  1L0Q A;  2CE9 A;  4PSX B;  4PC0 A;  3DSM A;  2AH0 A;  4IMM A;  3DXK C;  4CI1 A;  3SBP A;  5CXB A;  4BUJ C;  3AL9 A;  2H6N A;  4QQE A;  2CO0 C;  3UVL A;  4JD2 C;  5I5J A;  2P9I C;  5EML B;  1PBY B;  4L9O A;  4D0K A;  4CI3 A;  2YB8 B;  4Y7R A;  4JT6 C;  2P9N C;  2W18 A;  2I3T A;  3I7N A;  1MG3 A;  4AEZ A;  5TDH B;  4A7J A;  5CXC B;  4N14 A;  4ZOY A;  3ULE C;  2CNX A;  2IWF A;  4QL1 A;  3J81 g;  3I7O A;  4ZOZ A;  4Z8L A;  2Z2O A;  3MMY A;  2G99 A;  2H13 A;  3I89 A;  2Q7Q A;  2OVR B;  4JSP C;  4G56 B;  2PM9 B;  4JSX C;  4E5Z A;  5IT9 g;  3N0D A;  5C2V B;  3OL2 A;  5HE2 B;  2PM6 B;  4ZN4 A;  4J79 A;  4O9D A;  3BG0 A;  2IUP A;  4JSN C;  3SCY A;  1S4U X;  3I7H A;  2IAA A;  5K19 A;  5EMJ B;  4CY1 A;  3SJL D;  3MZK A;  2H9N A;  5HE3 B;  4XEI C;  3PSC B;  3UKU C;  3FM0 A;  3J80 g;  3ODT A;  2IWK A;  1PGU A;  3MZL A;  1MDA H;  3E0C A;  4J0X A;  5HE0 B;  3N0E A;  4E54 B;  3V9F A;  4ERY A;  4X61 B;  5C2W B;  4YVD A;  4CY2 A;  3OTT A;  5HQG A;  2B5L A;  1B9X A;  3RMZ D;  2H6Q A;  4A0B A;  4BL0 A;  4I79 A;  2I0R A;  4K3I D;  5CXB B;  2B4E A;  2YMU A;  2XL2 A;  4LG9 A;  5I5M A;  3UR4 A;  1SQ9 A;  2HKR A;  4J82 A;  3MKS B;  1U2V C;  4ESG A;  3IKO A;  3I8C A;  3I7L A;  1N6E A;  5IC7 A;  4CZX A;  2H68 A;  3EI2 A;  5IJ8 E;  4J87 A;  3FRX A;  3EU7 A;  2OIZ A;  1QNI A;  4GZ8 A;  2OVQ B;  3UVM A;  4A0A A;  2UZX B;  4GGA A;  1OMW B;  2P9S C;  4CZY A;  2BCJ B;  3SXT D;  3I2N A;  3SLE D;  4JXM A;  3RFG A;  4OWR A;  2OVP B;  2P9K C;  3UVO A;  1VYH C;  2P9P C;  3P4F A;  5H14 A;  3EI4 A;  5H17 A;  3HFQ A;  3F3F A;  4E5Z B;  3OL2 B;  3ORV D;  3SMR A;  4X3E A;  1A0R B;  4L1Q D;  3EG6 A;  2CN2 A;  4FWW A;  3SBQ A;  4A11 B;  4J78 A;  4FAN D;  1GXR A;  2GNQ A;  2B5M A;  5TEE A;  4FB1 D;  2H3X A;  4FA1 D;  4PSW B;  4A2M A;  4LGN A;  2IUV A;  4IA9 A; 
#chains in the Genus database with same CATH topology
 4H5J A;  5E6U A;  4BH6 A;  4A09 A;  3NIF A;  4AOW A;  2VDL A;  4WK2 A;  5FKT A;  4D6V A;  3EWE A;  3JRO A;  5EMK B;  5A2Q g;  1VE7 A;  4XYI A;  5FFG A;  3I8E A;  2CE8 A;  1TBG A;  4CZV A;  3IJC A;  1R5M A;  3PXW D;  3SWS D;  5KDO B;  4RE5 A;  3EI3 A;  1XKS A;  4J73 A;  4G1M A;  2IUQ A;  3GC3 B;  4CY5 A;  3DM0 A;  4J77 A;  1E8N A;  3JPX A;  4O45 A;  5TF2 A;  4BP8 A;  4A11 A;  4A0B B;  1H2Y A;  5B4W A;  2J56 H;  4GM3 A;  3ZE2 A;  3DXM C;  4JSV C;  3VH0 A;  4O3T B;  4GM8 A;  4Z7N A;  5CYK A;  2VZ1 A;  3PE7 A;  2EBS A;  3PXT D;  4G55 A;  3RN0 D;  1XIP A;  1TYQ C;  3IUQ A;  4BP9 A;  3MVD K;  2GC4 A;  3L4M D;  5GXI A;  1BPO A;  4GMB A;  4A2L A;  2HJ4 A;  3EI2 B;  3IJ1 A;  3RFH A;  4BCD A;  4FHL A;  2BBK H;  5AMS A;  4GQ2 P;  2UZY B;  5E6S A;  3T3M A;  5HDB A;  2YNO A;  2AQ5 A;  4QT8 A;  1M1X A;  3KRX B;  2Z2P A;  3SBR A;  1QFM A;  1QFS A;  2CO0 A;  4A0A B;  4ERZ A;  4MMY A;  3O4J A;  4PBZ A;  3V4P A;  5IJ7 E;  3RRM C;  5AFU 3;  2P9L C;  1GG2 B;  3RLM D;  4O3U B;  3JAM g;  2G9A A;  5GSA A;  2YBA A;  3MXX A;  3OF7 A;  4MMZ A;  3DWL C;  5M5R A;  2AH1 A;  3EI4 B;  1GOT B;  3O4G A;  5M5S A;  3L4O D;  4FAV D;  1NR0 A;  4ZOV A;  3I7K A;  2H47 A;  2OJY A;  2XL3 A;  4FA5 D;  5C92 A;  2WQ8 A;  4AMZ A;  1UOP A;  3PVU B;  3ZDY A;  4ES0 A;  3JRP A;  2H9M A;  3NVX A;  4J81 A;  1GOG A;  2HJB A;  1GP2 B;  2B5N A;  4L3H D;  5FKR A;  1GOF A;  3MUN A;  5K1C C;  4PBY A;  4AN1 A;  3VA6 A;  1I2M B;  2QR5 A;  3AFC A;  3IJE A;  2OK6 A;  1JJU B;  2AGZ A;  3RSE C;  4A09 B;  3V7D B;  3PSL A;  5EM2 A;  3K27 A;  1K8K C;  5AJA A;  3BWS A;  3EMH A;  5EAP A;  3EI1 A;  2H9L A;  1SHY B;  1L5G A;  2J55 H;  1P22 A;  2GC7 A;  2XU7 A;  3OKW A;  1PI6 A;  4U7A A;  3U4Y A;  1XHM A;  4RE6 A;  4J0W A;  3EI3 B;  4D9S A;  4H5I A;  5E6R A;  1TYE A;  4CI2 A;  4XYH A;  3EQ9 A;  2XDW A;  3ZWL B;  2QXV A;  4GQ1 A;  3JZN A;  4X63 B;  5IGO A;  3AL8 A;  4CC9 A;  4ERQ A;  4ZOX A;  1YFQ A;  1K32 A;  4BCB A;  2IUR A;  2I0T A;  3V5W B;  3AH8 B;  2XYI A;  4GM9 A;  2CN3 A;  3SVW D;  1U4C A;  1A12 A;  5FA5 B;  5CYK B;  2VDO A;  2BKL A;  3OKY B;  2VDQ A;  5FXY A;  4QAM A;  1RI6 A;  3IVM A;  2P9U C;  3C75 H;  3CFS B;  4O2W A;  1VZ3 A;  3IIY A;  1FWX A;  5TEF A;  5C86 A;  2HKM A;  3CFV A;  4A08 A;  5JWZ A;  4U1E I;  3W15 A;  4NAA A;  1T2X A;  3JZG A;  3PVW B;  2HU8 A;  4UI9 R;  2VDR A;  1JOF A;  4X60 B;  5EAR A;  3C9C A;  3IJ0 A;  1O6G A;  4GGC A;  2OK4 A;  4OZU A;  3RN1 D;  1ERJ A;  4NC4 A;  3IUJ A;  3A0F A;  3NVN A;  3T3P A;  5GXH A;  2QC5 A;  2I3S A;  2YNP A;  3B7F A;  1Q47 A;  2H6K A;  1YR2 A;  3MKQ A;  3OKY A;  2EID A;  4J8B A;  4R7A B;  1B9Y A;  2VZ3 A;  4JHP C;  5H1M A;  5THA A;  4GGD A;  1JMX B;  3SHF A;  4CI8 A;  4JHN A;  3C5M A;  5HE1 B;  1UTC A;  3SFZ A;  2PM7 B;  1JTD B;  2PBI B;  4K3J B;  1N6D A;  2AGX A;  3K26 A;  5FLX g;  5CXC A;  3VI3 A;  4WK0 A;  4JT5 C;  3SN6 B;  1GOH A;  2VDP A;  2XE4 A;  2AGL A;  4L3G D;  2MTA H;  2TRC B;  3JB9 L;  2VDM A;  1MG2 A;  2HXC A;  4AMY A;  3FGB A;  3I7P A;  4L1M A;  4Y5R D;  5EM2 B;  3VGZ A;  2PM9 A;  3EI1 B;  5M5U A;  4CY3 A;  2HYE A;  5M5V A;  2H9P A;  2O9K A;  5FKQ A;  1JMZ B;  5FQD A;  1SQJ A;  4PNK B;  4TZ4 A;  4FA4 D;  5EMM B;  3ZE1 A;  4O1Q D;  4MK0 B;  4PXW A;  2AGY A;  4EWR A;  5EAL A;  4QRJ A;  2Z2N A;  3NVQ A;  3IIW A;  3AL8 B;  5C9Z B;  3FCS A;  3KRW B;  4GQB B;  4UM9 A;  2I0S A;  3F3P A;  4IRZ A;  4KFM B;  4HDJ A;  4J86 A;  3OW8 A;  3K72 A;  3PXS D;  3BG1 A;  2YNN A;  1NEX B;  4NSX A;  3UVN A;  5HYN B;  5EAM A;  2HES X;  2H14 A;  2HU5 A;  4J84 A;  4FA9 D;  3GRE A;  3JZH A;  3F3G A;  3CIK B;  3IUL A;  3OKT A;  3UVK A;  5I5I A;  2J57 G;  4A08 B;  1OLZ A;  4LG8 A;  5FKS A;  3UKR C;  5GMK n;  4DNU A;  3C99 A;  5IGQ A;  1N6F A;  4E54 A;  5SXM A;  3GFC A;  4J8G A;  1C9L A;  1VZ2 A;  2AGW A;  1PEV A;  1L0Q A;  2CE9 A;  4PSX B;  4PC0 A;  3KCI A;  3DSM A;  2AH0 A;  3V4V A;  4IMM A;  3DXK C;  4CI1 A;  3SBP A;  3O4H A;  1K3I A;  5CXB A;  4BUJ C;  2EIB A;  2JKX A;  4UM8 A;  3AL9 A;  2H6N A;  4O02 A;  4QQE A;  2CO0 C;  3UVL A;  4AN0 A;  1VE6 A;  4JD2 C;  5I5J A;  2P9I C;  5EML B;  1PBY B;  3K71 A;  4L9O A;  4D0K A;  4CI3 A;  2YB8 B;  4Y7R A;  3ZE0 A;  2EIC A;  4JT6 C;  2P9N C;  2W18 A;  3ZDZ A;  3IUM A;  2XZG A;  2I3T A;  3I7N A;  1H2W A;  4MMX A;  1MG3 A;  4AEZ A;  5TDH B;  4A7J A;  5CXC B;  4N14 A;  4ZOY A;  3ULE C;  2CNX A;  2IWF A;  3QHY B;  4QL1 A;  3J81 g;  3I7O A;  4ZOZ A;  4Z8L A;  1H2X A;  2Z2O A;  3MMY A;  2G99 A;  3O4I A;  3I89 A;  2EIE A;  2H13 A;  2Q7Q A;  2OVR B;  1E8M A;  3IUR A;  4JSP C;  4G56 B;  2PM9 B;  4JSX C;  4E5Z A;  5IT9 g;  3N0D A;  5C2V B;  3OL2 A;  5HE2 B;  2PM6 B;  4ZN4 A;  4J79 A;  4O9D A;  4WK4 A;  3BG0 A;  2IUP A;  1H2Z A;  4JSN C;  3SCY A;  1S4U X;  2QZP A;  3I7H A;  2IAA A;  5K19 A;  5EMJ B;  4CY1 A;  4DNV A;  3SJL D;  3MZK A;  4Z7O A;  2H9N A;  3DDU A;  4XEI C;  5HE3 B;  3PSC B;  4NBM A;  1UOO A;  3UKU C;  1JV2 A;  3FM0 A;  3J80 g;  3ODT A;  2IWK A;  1PGU A;  3GD1 I;  4WJK A;  3MZL A;  4BCC A;  2VDK A;  1MDA H;  2HU7 A;  3NIG A;  3E0C A;  4J0X A;  5HE0 B;  3N0E A;  4E54 B;  1UOQ A;  3EQ8 A;  3V9F A;  4ERY A;  3K6S A;  4X61 B;  5C2W B;  4YVD A;  4CY2 A;  1O6F A;  3OTT A;  5HQG A;  2B5L A;  1B9X A;  3RMZ D;  2H6Q A;  4A0B A;  4BL0 A;  3MUO A;  4I79 A;  2I0R A;  4K3I D;  5CXB B;  2B4E A;  5FFO A;  2YMU A;  2XL2 A;  4LG9 A;  5I5M A;  3UR4 A;  1SQ9 A;  5M61 A;  4AX4 A;  2HKR A;  4J82 A;  3MKS B;  1U2V C;  4ESG A;  3IKO A;  3I8C A;  3I7L A;  3IUN A;  1N6E A;  5IC7 A;  3ZDX A;  4CZX A;  2H68 A;  3EI2 A;  5IJ8 E;  4J87 A;  3FRX A;  3EU7 A;  2OIZ A;  1QNI A;  4GZ8 A;  2OVQ B;  4G1E A;  3UVM A;  4A0A A;  2UZX B;  4GGA A;  1OMW B;  2P9S C;  4CZY A;  2BCJ B;  3SXT D;  3I2N A;  3SLE D;  4JXM A;  3RFG A;  4OWR A;  1U8C A;  2OVP B;  2P9K C;  3UVO A;  1VYH C;  4NEN A;  4DNW A;  2P9P C;  3P4F A;  5H14 A;  3FCU A;  3EI4 A;  5H17 A;  2VC2 A;  3HFQ A;  3F3F A;  1E5T A;  4E5Z B;  3OL2 B;  1C9I A;  3ORV D;  3SMR A;  5M5T A;  4X3E A;  4Z7Q A;  1A0R B;  4L1Q D;  3EG6 A;  2CN2 A;  4FWW A;  3SBQ A;  4A11 B;  4J78 A;  4FAN D;  1GXR A;  2GNQ A;  2B5M A;  5TEE A;  4FB1 D;  3NID A;  2H3X A;  3EQ7 A;  4FA1 D;  2VDN A;  4PSW B;  3QI0 A;  4A2M A;  4LGN A;  2IUV A;  4IA9 A;  3VI4 A; 
#chains in the Genus database with same CATH homology
 4H5J A;  4BH6 A;  4A09 A;  4AOW A;  5FKT A;  4D6V A;  3EWE A;  3JRO A;  5EMK B;  5A2Q g;  4XYI A;  3I8E A;  2CE8 A;  1TBG A;  4CZV A;  3IJC A;  1R5M A;  3PXW D;  3SWS D;  5KDO B;  3EI3 A;  1XKS A;  4J73 A;  2IUQ A;  4CY5 A;  3DM0 A;  4J77 A;  3JPX A;  4O45 A;  5TF2 A;  4A11 A;  4A0B B;  5B4W A;  2J56 H;  4GM3 A;  3DXM C;  4JSV C;  3VH0 A;  4O3T B;  4GM8 A;  5CYK A;  3PE7 A;  2EBS A;  3PXT D;  3RN0 D;  1XIP A;  1TYQ C;  2GC4 A;  3L4M D;  5GXI A;  4GMB A;  4A2L A;  2HJ4 A;  3EI2 B;  3IJ1 A;  3RFH A;  4FHL A;  2BBK H;  5AMS A;  4GQ2 P;  2UZY B;  2YNO A;  2AQ5 A;  4QT8 A;  3KRX B;  2Z2P A;  3SBR A;  2CO0 A;  4A0A B;  4ERZ A;  4PBZ A;  5IJ7 E;  3RRM C;  5AFU 3;  2P9L C;  1GG2 B;  3RLM D;  4O3U B;  3JAM g;  2G9A A;  5GSA A;  2YBA A;  3MXX A;  3DWL C;  2AH1 A;  3EI4 B;  1GOT B;  3L4O D;  4FAV D;  1NR0 A;  4ZOV A;  3I7K A;  2H47 A;  2OJY A;  2XL3 A;  4FA5 D;  3PVU B;  4ES0 A;  4J81 A;  2H9M A;  3JRP A;  3NVX A;  2HJB A;  1GP2 B;  2B5N A;  4L3H D;  5FKR A;  5K1C C;  4PBY A;  3VA6 A;  3AFC A;  2OK6 A;  1JJU B;  2AGZ A;  3RSE C;  4A09 B;  3V7D B;  3PSL A;  5EM2 A;  3K27 A;  1K8K C;  5AJA A;  3BWS A;  3EMH A;  5EAP A;  3EI1 A;  2H9L A;  1SHY B;  2J55 H;  1P22 A;  2GC7 A;  2XU7 A;  3OKW A;  1PI6 A;  4U7A A;  3U4Y A;  1XHM A;  4J0W A;  3EI3 B;  4H5I A;  4CI2 A;  4XYH A;  3ZWL B;  2QXV A;  4GQ1 A;  3JZN A;  4X63 B;  5IGO A;  3AL8 A;  4CC9 A;  4ERQ A;  4ZOX A;  1YFQ A;  1K32 A;  2IUR A;  2I0T A;  3V5W B;  3AH8 B;  2XYI A;  4GM9 A;  2CN3 A;  3SVW D;  1U4C A;  5FA5 B;  5CYK B;  3OKY B;  5FXY A;  1RI6 A;  2P9U C;  3C75 H;  3CFS B;  3IIY A;  1FWX A;  5TEF A;  2HKM A;  3CFV A;  4A08 A;  5JWZ A;  4U1E I;  3W15 A;  3JZG A;  3PVW B;  4UI9 R;  1JOF A;  4X60 B;  5EAR A;  3C9C A;  3IJ0 A;  4GGC A;  2OK4 A;  4OZU A;  3RN1 D;  1ERJ A;  3NVN A;  3A0F A;  5GXH A;  2QC5 A;  2I3S A;  2YNP A;  3B7F A;  1Q47 A;  2H6K A;  3MKQ A;  3OKY A;  4J8B A;  4R7A B;  1B9Y A;  5H1M A;  5THA A;  4GGD A;  1JMX B;  3SHF A;  4CI8 A;  3C5M A;  5HE1 B;  3SFZ A;  2PM7 B;  2PBI B;  4K3J B;  1N6D A;  2AGX A;  3K26 A;  5FLX g;  5CXC A;  4JT5 C;  3SN6 B;  2AGL A;  4L3G D;  2MTA H;  2TRC B;  3JB9 L;  1MG2 A;  2HXC A;  3FGB A;  3I7P A;  4Y5R D;  5EM2 B;  3VGZ A;  2PM9 A;  3EI1 B;  4CY3 A;  2HYE A;  2H9P A;  2O9K A;  5FKQ A;  1JMZ B;  5FQD A;  1SQJ A;  4PNK B;  4TZ4 A;  4FA4 D;  5EMM B;  4O1Q D;  4MK0 B;  4PXW A;  2AGY A;  4EWR A;  5EAL A;  4QRJ A;  2Z2N A;  3NVQ A;  3IIW A;  3AL8 B;  5C9Z B;  3KRW B;  4GQB B;  2I0S A;  3F3P A;  4KFM B;  4HDJ A;  4J86 A;  3OW8 A;  3PXS D;  3BG1 A;  2YNN A;  1NEX B;  4NSX A;  3UVN A;  5HYN B;  5EAM A;  2HES X;  2H14 A;  4J84 A;  4FA9 D;  3GRE A;  3JZH A;  3F3G A;  3CIK B;  3OKT A;  3UVK A;  5I5I A;  2J57 G;  4A08 B;  1OLZ A;  4LG8 A;  5FKS A;  3UKR C;  5GMK n;  3C99 A;  5IGQ A;  1N6F A;  4E54 A;  5SXM A;  3GFC A;  4J8G A;  2AGW A;  1PEV A;  1L0Q A;  2CE9 A;  4PSX B;  4PC0 A;  3DSM A;  2AH0 A;  4IMM A;  3DXK C;  4CI1 A;  3SBP A;  5CXB A;  4BUJ C;  3AL9 A;  2H6N A;  4QQE A;  2CO0 C;  3UVL A;  4JD2 C;  5I5J A;  2P9I C;  5EML B;  1PBY B;  4L9O A;  4D0K A;  4CI3 A;  2YB8 B;  4Y7R A;  4JT6 C;  2P9N C;  2W18 A;  2I3T A;  3I7N A;  1MG3 A;  4AEZ A;  5TDH B;  4A7J A;  5CXC B;  4N14 A;  4ZOY A;  3ULE C;  2CNX A;  2IWF A;  4QL1 A;  3J81 g;  3I7O A;  4ZOZ A;  4Z8L A;  2Z2O A;  3MMY A;  2G99 A;  2H13 A;  3I89 A;  2Q7Q A;  2OVR B;  4JSP C;  4G56 B;  2PM9 B;  4JSX C;  4E5Z A;  5IT9 g;  3N0D A;  5C2V B;  3OL2 A;  5HE2 B;  2PM6 B;  4ZN4 A;  4J79 A;  4O9D A;  3BG0 A;  2IUP A;  4JSN C;  3SCY A;  1S4U X;  3I7H A;  2IAA A;  5K19 A;  5EMJ B;  4CY1 A;  3SJL D;  3MZK A;  2H9N A;  5HE3 B;  4XEI C;  3PSC B;  3UKU C;  3FM0 A;  3J80 g;  3ODT A;  2IWK A;  1PGU A;  3MZL A;  1MDA H;  3E0C A;  4J0X A;  5HE0 B;  3N0E A;  4E54 B;  3V9F A;  4ERY A;  4X61 B;  5C2W B;  4YVD A;  4CY2 A;  3OTT A;  5HQG A;  2B5L A;  1B9X A;  3RMZ D;  2H6Q A;  4A0B A;  4BL0 A;  4I79 A;  2I0R A;  4K3I D;  5CXB B;  2B4E A;  2YMU A;  2XL2 A;  4LG9 A;  5I5M A;  3UR4 A;  1SQ9 A;  2HKR A;  4J82 A;  3MKS B;  1U2V C;  4ESG A;  3IKO A;  3I8C A;  3I7L A;  1N6E A;  5IC7 A;  4CZX A;  2H68 A;  3EI2 A;  5IJ8 E;  4J87 A;  3FRX A;  3EU7 A;  2OIZ A;  1QNI A;  4GZ8 A;  2OVQ B;  3UVM A;  4A0A A;  2UZX B;  4GGA A;  1OMW B;  2P9S C;  4CZY A;  2BCJ B;  3SXT D;  3I2N A;  3SLE D;  4JXM A;  3RFG A;  4OWR A;  2OVP B;  2P9K C;  3UVO A;  1VYH C;  2P9P C;  3P4F A;  5H14 A;  3EI4 A;  5H17 A;  3HFQ A;  3F3F A;  4E5Z B;  3OL2 B;  3ORV D;  3SMR A;  4X3E A;  1A0R B;  4L1Q D;  3EG6 A;  2CN2 A;  4FWW A;  3SBQ A;  4A11 B;  4J78 A;  4FAN D;  1GXR A;  2GNQ A;  2B5M A;  5TEE A;  4FB1 D;  2H3X A;  4FA1 D;  4PSW B;  4A2M A;  4LGN A;  2IUV A;  4IA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...