2J57G

X-ray reduced paraccocus denitrificans methylamine dehydrogenase n- quinol in complex with amicyanin.
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
382
structure length
382
Chain Sequence
EAETQAQETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tracking X-Ray-Derived Redox Changes in Crystals of a Methylamine Dehydrogenase/Amicyanin Complex Using Single-Crystal Uv/Vis Microspectrophotometry.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords AMICYANIN
total genus 95
structure length 382
sequence length 382
chains with identical sequence H, I, J
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2j57G00
5GXIA 4MK0B 5GXHA 4PXWA 1Q47A 3ODTA 4CZYA 4E54B 3FGBA 5TDHB 5CYKA 2H13A 5EMLB 3J80g 3DSMA 3L4MD 4PSWB 2H47A 2HJ4A 2OJYA 4A11A 3PXSD 3CIKB 5IGOA 4O45A 2HKRA 3N0DA 4A11B 2H6NA 4XEIC 3EMHA 3UVNA 2AQ5A 2YMUA 3RLMD 3SBQA 5CXBB 4IA9A 4ZOYA 4FA5D 4GMBA 4J82A 4FHLA 3A0FA 2CE9A 5GSAA 4PBYA 3MZKA 4QL1A 4FAVD 2B5MA 2H9PA 4LG8A 2AH0A 2P9UC 3VGZA 3UVOA 2CE8A 3SFZA 4CZXA 1L0QA 2AGWA 1XKSA 4I79A 2UZXB 2P9IC 3DXKC 3PXTD 2YB8B 3EI1B 5EM2A 4A2MA 5IT9g 5FKSA 5EALA 4CI2A 4A0BB 4K3JB 2UZYB 3NVQA 3OKWA 4J84A 4J0XA 3OKYB 4CZVA 3DM0A 5K1CC 4HDJA 4OZUA 5JWZA 2H14A 2YBAA 4JSVC 2XL3A 3NVNA 3AL9A 5FQDA 2IURA 3ULEC 1QNIA 1JMXB 4JSNC 3K27A 4JT6C 5KDOB 4AEZA 1U2VC 3KRXB 3PXWD 3I7KA 2OVQB 1PBYB 2PM9A 5THAA 1SQ9A 3EG6A 1OMWB 4XYIA 3ZWLB 4U7AA 4CY2A 2B4EA 4GM3A 4X60B 4FA4D 2Z2PA 2Z2NA 2G9AA 5I5JA 5H14A 4JD2C 2QXVA 3IIWA 2W18A 3MZLA 3V5WB 2PM7B 2BBKH 3UR4A 4A09A 4OWRA 3C99A 2EBSA 1N6EA 4ZOZA 4J77A 1GOTB 4J78A 4FA1D 3NVXA 4NSXA 3K26A 1SHYB 4X3EA 3PE7A 4R7AB 1JMZB 2XYIA 3EI4B 2I3SA 4ERQA 1JJUB 4J87A 3RRMC 2OVRB 3BWSA 3UVLA 5HQGA 5HE3B 4A2LA 3OL2A 5EMMB 3DXMC 3RFGA 2O9KA 3OKYA 2J57G 3IJ1A 3JZNA 2B5LA 4GM8A 5I5MA 4JXMA 3GREA 5IJ7E 3J81g 4CI8A 4L3HD 3EI1A 3EI3B 4E5ZA 3AL8B 5HE1B 2IWKA 1GXRA 3MMYA 2XL2A 2H6KA 2AH1A 3OL2B 5HE2B 1K32A 5EMJB 5CXCA 1A0RB 5CXBA 4L1QD 4UI9R 4X61B 4ESGA 4GQ1A 2AGYA 3EU7A 5AMSA 5FKQA 3JAMg 2GC4A 4ES0A 4Y7RA 3B7FA 1XHMA 2I0SA 4J79A 2B5NA 5FLXg 4ZN4A 3I7HA 1GP2B 3F3FA 3SWSD 1PGUA 3JROA 1R5MA 5CYKB 5IC7A 3SHFA 4JSXC 5GMKn 3CFVA 2XU7A 4FAND 2TRCB 5K19A 3UVKA 1SQJA 3I8EA 3I7LA 5AJAA 2I0TA 3I7NA 3P4FA 4J8BA 5C2WB 4ZOVA 5CXCB 2H6QA 4O9DA 5FXYA 4FA9D 2GC7A 2P9KC 4A0AB 2AGXA 4O3TB 1TYQC 5TEEA 4CY3A 2AGZA 3JB9L 3SXTD 5C9ZB 1OLZA 4A0BA 1TBGA 3JRPA 3EI2B 3I7OA 5EAMA 2OVPB 4ERZA 5B4WA 5EM2B 1B9XA 1K8KC 2OK4A 4J86A 4J81A 2I3TA 4CI3A 2Z2OA 2HXCA 3PVWB 4O3UB 2I0RA 4D6VA 2HYEA 4PC0A 4GGDA 3U4YA 3F3PA 3E0CA 3UKRC 2YNNA 2IUPA 2CNXA 4BH6A 3EWEA 1NEXB 4D0KA 1PI6A 4A08B 3AH8B 5H17A 2IUVA 2P9LC 4GM9A 2PBIB 5HYNB 1MG2A 4J0WA 1S4UX 1XIPA 4A09B 4LG9A 2P9SC 2QC5A 2BCJB 2H9MA 3SBPA 4J8GA 3IJCA 3UVMA 3I8CA 4QT8A 3L4OD 4A7JA 3PVUB 4J73A 2G99A 4TZ4A 2H68A 3JZGA 3OTTA 3RSEC 2H9NA 3IKOA 4PBZA 4XYHA 5FA5B 4X63B 3AFCA 2PM6B 1NR0A 3RN1D 2P9NC 5IGQA 4H5JA 3BG0A 4K3ID 4A08A 4U1EI 4Z8LA 3F3GA 3FRXA 5FKRA 1N6FA 2YNPA 3I7PA 3RFHA 3C5MA 5H1MA 5IJ8E 3SMRA 3I89A 3JZHA 3N0EA 3PSCB 4CY5A 3EI4A 5TF2A 1N6DA 2CN3A 4G56B 4BUJC 4O1QD 2Q7QA 2GNQA 4H5IA 3EI3A 4QQEA 3SJLD 4GGAA 5HE0B 3UKUC 4E5ZB 5TEFA 3MXXA 5EAPA 3GFCA 4N14A 5AFU3 4GGCA 4GZ8A 3BG1A 4Y5RD 4FB1D 2J55H 5FKTA 3KRWB 4LGNA 2CN2A 3I2NA 1P22A 1RI6A 3VA6A 1MDAH 2IWFA 3SBRA 4CY1A 2H3XA 2MTAH 1GG2B 1YFQA 3MKQA 4BL0A 5EMKB 3EI2A 4KFMB 3FM0A 4JSPC 4GQBB 1FWXA 2HKMA 4E54A 5SXMA 3OW8A 2AGLA 2HJBA 3IIYA 1U4CA 4GQ2P 4L3GD 3VH0A 3RMZD 3DWLC 3SN6B 3PSLA 1VYHC 2IAAA 3SLED 2PM9B 2J56H 2P9PC 3C9CA 3MKSB 5EARA 3ORVD 5A2Qg 2IUQA 4FWWA 3RN0D 3OKTA 4L9OA 4YVDA 4CC9A 4QRJA 3IJ0A 4JT5C 3HFQA 3SCYA 3V7DB 1PEVA 2CO0A 4IMMA 2OIZA 4ZOXA 4EWRA 5C2VB 5I5IA 3V9FA 4AOWA 1ERJA 4CI1A 2CO0C 3JPXA 4ERYA 1JOFA 2YNOA 2OK6A 2HESX 3AL8A 3CFSB 4PSXB 3W15A 2H9LA 4PNKB 1MG3A 3C75H 3SVWD 4A0AA 1B9YA
chains in the Genus database with same CATH superfamily
4BCDA 3FCSA 5GXIA 4MK0B 5GXHA 4PXWA 1Q47A 3ODTA 4CZYA 4WK0A 4E54B 3FGBA 5TDHB 5CYKA 2H13A 5EMLB 3J80g 3DSMA 1GOFA 3L4MD 4PSWB 1K3IA 2H47A 2HJ4A 2OJYA 2VZ3A 4A11A 3PXSD 4DNUA 3CIKB 3IURA 3EQ9A 4O45A 5IGOA 2HKRA 3N0DA 4A11B 2H6NA 4XEIC 4AMZA 4DNVA 3EMHA 3UVNA 2AQ5A 2YMUA 3RLMD 3SBQA 5CXBB 4IA9A 4ZOYA 3ZE1A 4O2WA 4FA5D 4GMBA 4J82A 1YR2A 3V4PA 4FHLA 4UM9A 3A0FA 2VDMA 2CE9A 5GSAA 4PBYA 3MZKA 4QL1A 4FAVD 5FFOA 2B5MA 2H9PA 4LG8A 2AH0A 2P9UC 3VGZA 3UVOA 2CE8A 3SFZA 4CZXA 1L0QA 2AGWA 1XKSA 4I79A 2UZXB 2P9IC 5E6RA 3DXKC 3PXTD 2YB8B 5M61A 3EI1B 5EM2A 4A2MA 1H2WA 5IT9g 5FKSA 5EALA 4CI2A 4A0BB 4K3JB 4G1MA 2UZYB 3NVQA 3VI4A 3OKWA 4J84A 4WJKA 4J0XA 2BKLA 3OKYB 3T3PA 4CZVA 2VDNA 3DM0A 3ZDZA 4NAAA 2VZ1A 5K1CC 4HDJA 4D9SA 4OZUA 5JWZA 2H14A 1VZ2A 2YBAA 4JSVC 2XL3A 3NVNA 3AL9A 5FQDA 2IURA 3ULEC 1QNIA 1JMXB 4JSNC 1VE6A 3K27A 4JT6C 4MMZA 4RE5A 5KDOB 2EIEA 4AEZA 4IRZA 1U2VC 3EQ8A 3IJEA 3KRXB 3PXWD 3I7KA 4NBMA 2OVQB 1PBYB 2PM9A 5THAA 1SQ9A 3EG6A 1OMWB 3QHYB 4XYIA 3ZWLB 4U7AA 3IUJA 4CY2A 2B4EA 4GM3A 4X60B 4FA4D 2Z2PA 2Z2NA 2G9AA 5I5JA 5H14A 4JD2C 1E8NA 2QXVA 2HU8A 1E5TA 3O4IA 3IIWA 2W18A 3MZLA 2XE4A 3V5WB 1H2XA 2PM7B 2BBKH 3UR4A 4A09A 4OWRA 5C86A 3C99A 2EBSA 1N6EA 3VI3A 4BCBA 1UOQA 4ZOZA 3MUOA 4J77A 4RE6A 1GOTB 4J78A 4FA1D 3NVXA 4NSXA 3K26A 1SHYB 4X3EA 3PE7A 4R7AB 1JMZB 2XYIA 3EI4B 2EIBA 2I3SA 4ERQA 1JJUB 4J87A 3RRMC 5M5RA 4Z7QA 2OVRB 3BWSA 3UVLA 5HQGA 5HE3B 4A2LA 3OL2A 4BCCA 3DXMC 5EMMB 3NIGA 3RFGA 2O9KA 3OKYA 2J57G 3IJ1A 3JZNA 2B5LA 1QFMA 3IUMA 4GM8A 5I5MA 4JXMA 3GREA 5IJ7E 3J81g 2QZPA 4CI8A 4L3HD 3EI1A 3EI3B 4E5ZA 3AL8B 5HE1B 2IWKA 1GXRA 4Z7NA 1QFSA 2WQ8A 3MMYA 2XL2A 2H6KA 2AH1A 3OL2B 5HE2B 4G55A 1H2ZA 1K32A 5EMJB 1O6FA 5CXCA 1A0RB 5CXBA 4L1QD 2HU7A 4UI9R 4UM8A 4X61B 4ESGA 4GQ1A 2AGYA 3EU7A 5AMSA 3OF7A 5FKQA 3JAMg 2GC4A 1VZ3A 1M1XA 4Y7RA 5E6SA 4ES0A 3B7FA 3K72A 2VDOA 4BP8A 1XHMA 2I0SA 4J79A 2B5NA 5FLXg 4ZN4A 3I7HA 1GP2B 3F3FA 3SWSD 2EICA 1PGUA 3JROA 1R5MA 5CYKB 5IC7A 3SHFA 4JSXC 3O4JA 5GMKn 3CFVA 2XU7A 4FAND 3EQ7A 2TRCB 2VC2A 5K19A 3UVKA 4Z7OA 1SQJA 3I8EA 3I7LA 5AJAA 2I0TA 3I7NA 3P4FA 1TYEA 4J8BA 5C2WB 4ZOVA 5CXCB 2H6QA 4O9DA 5FXYA 4FA9D 2GC7A 5C92A 2P9KC 4A0AB 5M5TA 3KCIA 2AGXA 4O3TB 1TYQC 5TEEA 4CY3A 2AGZA 3JB9L 3SXTD 5C9ZB 1OLZA 4A0BA 1TBGA 3JRPA 3EI2B 3I7OA 5EAMA 2OVPB 4ERZA 2VDRA 1C9LA 5B4WA 5EM2B 1B9XA 3MUNA 1K8KC 1I2MB 2OK4A 4WK2A 4J86A 4J81A 2I3TA 4CI3A 2Z2OA 2HXCA 3ZE2A 3PVWB 4G1EA 4O3UB 2I0RA 4D6VA 2HYEA 4NC4A 2VDKA 4PC0A 4GGDA 3U4YA 3F3PA 3E0CA 3UKRC 1E8MA 2IUPA 2YNNA 2CNXA 2XDWA 4BH6A 3EWEA 1C9IA 1NEXB 3NIFA 4D0KA 1PI6A 4A08B 3AH8B 5H17A 2IUVA 2P9LC 4GM9A 2PBIB 5HYNB 1MG2A 4J0WA 1S4UX 1XIPA 4A09B 4LG9A 2P9SC 2QC5A 2BCJB 2H9MA 3ZDYA 3SBPA 4AX4A 4J8GA 3QI0A 3IJCA 3UVMA 3I8CA 5FFGA 4QT8A 3L4OD 4A7JA 3PVUB 1UOPA 1U8CA 4AMYA 4J73A 2G99A 4TZ4A 2H68A 3JZGA 4MMYA 3OTTA 3RSEC 3IUQA 2H9NA 3IKOA 4PBZA 4XYHA 5FA5B 4X63B 3AFCA 2PM6B 1NR0A 3RN1D 2P9NC 5IGQA 1UOOA 4H5JA 3BG0A 4K3ID 3V4VA 4BP9A 3NIDA 2VDQA 4A08A 4U1EI 4AN0A 4Z8LA 3F3GA 1GOGA 3FRXA 2EIDA 5FKRA 1N6FA 2YNPA 3I7PA 3FCUA 3RFHA 3C5MA 5H1MA 5IJ8E 3SMRA 3I89A 5M5SA 3JZHA 3N0EA 3PSCB 4CY5A 3EI4A 5TF2A 1N6DA 2CN3A 4G56B 4BUJC 1BPOA 4O1QD 2Q7QA 3MVDK 2GNQA 4H5IA 3EI3A 4QQEA 3SJLD 4GGAA 4MMXA 5HE0B 3UKUC 4E5ZB 5TEFA 5M5VA 3MXXA 5EAPA 2JKXA 3GFCA 2VDPA 4N14A 5AFU3 4GGCA 4GZ8A 3BG1A 4Y5RD 4O02A 4FB1D 2J55H 4NENA 5FKTA 3KRWB 3O4HA 4LGNA 2CN2A 3I2NA 1P22A 1RI6A 4JHPC 3VA6A 2HU5A 1MDAH 4L1MA 1A12A 2IWFA 3SBRA 2XZGA 4CY1A 2H3XA 2MTAH 1GG2B 1YFQA 3MKQA 4BL0A 2VDLA 5EMKB 3EI2A 4KFMB 3FM0A 4JSPC 4GQBB 1FWXA 2HKMA 1GOHA 1VE7A 4E54A 5SXMA 3OW8A 2AGLA 3ZDXA 2QR5A 2HJBA 3IIYA 1U4CA 4GQ2P 3T3MA 4L3GD 3VH0A 3RMZD 3DWLC 1H2YA 3IULA 3SN6B 3ZE0A 3PSLA 1VYHC 2IAAA 3SLED 5HDBA 2PM9B 4QAMA 2J56H 2P9PC 5M5UA 3C9CA 3MKSB 5EARA 3ORVD 5A2Qg 2IUQA 3O4GA 4FWWA 3RN0D 3OKTA 4JHNA 4L9OA 4YVDA 5E6UA 1JV2A 4CC9A 4QRJA 3IJ0A 4JT5C 1JTDB 3HFQA 3SCYA 3V7DB 1PEVA 2CO0A 4IMMA 2OIZA 3IVMA 4ZOXA 4EWRA 5C2VB 5I5IA 4AN1A 1O6GA 3V9FA 3K6SA 4AOWA 1ERJA 3DDUA 1L5GA 4CI1A 2CO0C 3JPXA 4DNWA 4ERYA 1JOFA 2YNOA 2OK6A 2HESX 3AL8A 3K71A 1UTCA 3GD1I 3CFSB 3IUNA 4PSXB 3W15A 4WK4A 2H9LA 4PNKB 1MG3A 3C75H 3SVWD 3GC3B 4A0AA 1B9YA 1T2XA
chains in the Genus database with same CATH topology
5GXIA 4MK0B 5GXHA 4PXWA 1Q47A 3ODTA 4CZYA 4E54B 3FGBA 5TDHB 5CYKA 2H13A 5EMLB 3J80g 3DSMA 3L4MD 4PSWB 2H47A 2HJ4A 2OJYA 4A11A 3PXSD 3CIKB 5IGOA 4O45A 2HKRA 3N0DA 4A11B 2H6NA 4XEIC 3EMHA 3UVNA 2AQ5A 2YMUA 3RLMD 3SBQA 5CXBB 4IA9A 4ZOYA 4FA5D 4GMBA 4J82A 4FHLA 3A0FA 2CE9A 5GSAA 4PBYA 3MZKA 4QL1A 4FAVD 2B5MA 2H9PA 4LG8A 2AH0A 2P9UC 3VGZA 3UVOA 2CE8A 3SFZA 4CZXA 1L0QA 2AGWA 1XKSA 4I79A 2UZXB 2P9IC 3DXKC 3PXTD 2YB8B 3EI1B 5EM2A 4A2MA 5IT9g 5FKSA 5EALA 4CI2A 4A0BB 4K3JB 2UZYB 3NVQA 3OKWA 4J84A 4J0XA 3OKYB 4CZVA 3DM0A 5K1CC 4HDJA 4OZUA 5JWZA 2H14A 2YBAA 4JSVC 2XL3A 3NVNA 3AL9A 5FQDA 2IURA 3ULEC 1QNIA 1JMXB 4JSNC 3K27A 4JT6C 5KDOB 4AEZA 1U2VC 3KRXB 3PXWD 3I7KA 2OVQB 1PBYB 2PM9A 5THAA 1SQ9A 3EG6A 1OMWB 4XYIA 3ZWLB 4U7AA 4CY2A 2B4EA 4GM3A 4X60B 4FA4D 2Z2PA 2Z2NA 2G9AA 5I5JA 5H14A 4JD2C 2QXVA 3IIWA 2W18A 3MZLA 3V5WB 2PM7B 2BBKH 3UR4A 4A09A 4OWRA 3C99A 2EBSA 1N6EA 4ZOZA 4J77A 1GOTB 4J78A 4FA1D 3NVXA 4NSXA 3K26A 1SHYB 4X3EA 3PE7A 4R7AB 1JMZB 2XYIA 3EI4B 2I3SA 4ERQA 1JJUB 4J87A 3RRMC 2OVRB 3BWSA 3UVLA 5HQGA 5HE3B 4A2LA 3OL2A 5EMMB 3DXMC 3RFGA 2O9KA 3OKYA 2J57G 3IJ1A 3JZNA 2B5LA 4GM8A 5I5MA 4JXMA 3GREA 5IJ7E 3J81g 4CI8A 4L3HD 3EI1A 3EI3B 4E5ZA 3AL8B 5HE1B 2IWKA 1GXRA 3MMYA 2XL2A 2H6KA 2AH1A 3OL2B 5HE2B 1K32A 5EMJB 5CXCA 1A0RB 5CXBA 4L1QD 4UI9R 4X61B 4ESGA 4GQ1A 2AGYA 3EU7A 5AMSA 5FKQA 3JAMg 2GC4A 4ES0A 4Y7RA 3B7FA 1XHMA 2I0SA 4J79A 2B5NA 5FLXg 4ZN4A 3I7HA 1GP2B 3F3FA 3SWSD 1PGUA 3JROA 1R5MA 5CYKB 5IC7A 3SHFA 4JSXC 5GMKn 3CFVA 2XU7A 4FAND 2TRCB 5K19A 3UVKA 1SQJA 3I8EA 3I7LA 5AJAA 2I0TA 3I7NA 3P4FA 4J8BA 5C2WB 4ZOVA 5CXCB 2H6QA 4O9DA 5FXYA 4FA9D 2GC7A 2P9KC 4A0AB 2AGXA 4O3TB 1TYQC 5TEEA 4CY3A 2AGZA 3JB9L 3SXTD 5C9ZB 1OLZA 4A0BA 1TBGA 3JRPA 3EI2B 3I7OA 5EAMA 2OVPB 4ERZA 5B4WA 5EM2B 1B9XA 1K8KC 2OK4A 4J86A 4J81A 2I3TA 4CI3A 2Z2OA 2HXCA 3PVWB 4O3UB 2I0RA 4D6VA 2HYEA 4PC0A 4GGDA 3U4YA 3F3PA 3E0CA 3UKRC 2YNNA 2IUPA 2CNXA 4BH6A 3EWEA 1NEXB 4D0KA 1PI6A 4A08B 3AH8B 5H17A 2IUVA 2P9LC 4GM9A 2PBIB 5HYNB 1MG2A 4J0WA 1S4UX 1XIPA 4A09B 4LG9A 2P9SC 2QC5A 2BCJB 2H9MA 3SBPA 4J8GA 3IJCA 3UVMA 3I8CA 4QT8A 3L4OD 4A7JA 3PVUB 4J73A 2G99A 4TZ4A 2H68A 3JZGA 3OTTA 3RSEC 2H9NA 3IKOA 4PBZA 4XYHA 5FA5B 4X63B 3AFCA 2PM6B 1NR0A 3RN1D 2P9NC 5IGQA 4H5JA 3BG0A 4K3ID 4A08A 4U1EI 4Z8LA 3F3GA 3FRXA 5FKRA 1N6FA 2YNPA 3I7PA 3RFHA 3C5MA 5H1MA 5IJ8E 3SMRA 3I89A 3JZHA 3N0EA 3PSCB 4CY5A 3EI4A 5TF2A 1N6DA 2CN3A 4G56B 4BUJC 4O1QD 2Q7QA 2GNQA 4H5IA 3EI3A 4QQEA 3SJLD 4GGAA 5HE0B 3UKUC 4E5ZB 5TEFA 3MXXA 5EAPA 3GFCA 4N14A 5AFU3 4GGCA 4GZ8A 3BG1A 4Y5RD 4FB1D 2J55H 5FKTA 3KRWB 4LGNA 2CN2A 3I2NA 1P22A 1RI6A 3VA6A 1MDAH 2IWFA 3SBRA 4CY1A 2H3XA 2MTAH 1GG2B 1YFQA 3MKQA 4BL0A 5EMKB 3EI2A 4KFMB 3FM0A 4JSPC 4GQBB 1FWXA 2HKMA 4E54A 5SXMA 3OW8A 2AGLA 2HJBA 3IIYA 1U4CA 4GQ2P 4L3GD 3VH0A 3RMZD 3DWLC 3SN6B 3PSLA 1VYHC 2IAAA 3SLED 2PM9B 2J56H 2P9PC 3C9CA 3MKSB 5EARA 3ORVD 5A2Qg 2IUQA 4FWWA 3RN0D 3OKTA 4L9OA 4YVDA 4CC9A 4QRJA 3IJ0A 4JT5C 3HFQA 3SCYA 3V7DB 1PEVA 2CO0A 4IMMA 2OIZA 4ZOXA 4EWRA 5C2VB 5I5IA 3V9FA 4AOWA 1ERJA 4CI1A 2CO0C 3JPXA 4ERYA 1JOFA 2YNOA 2OK6A 2HESX 3AL8A 3CFSB 4PSXB 3W15A 2H9LA 4PNKB 1MG3A 3C75H 3SVWD 4A0AA 1B9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GXI A;  4MK0 B;  5GXH A;  4PXW A;  1Q47 A;  3ODT A;  4CZY A;  4E54 B;  3FGB A;  5TDH B;  5CYK A;  2H13 A;  5EML B;  3J80 g;  3DSM A;  3L4M D;  4PSW B;  2H47 A;  2HJ4 A;  2OJY A;  4A11 A;  3PXS D;  3CIK B;  5IGO A;  4O45 A;  2HKR A;  3N0D A;  4A11 B;  2H6N A;  4XEI C;  3EMH A;  3UVN A;  2AQ5 A;  2YMU A;  3RLM D;  3SBQ A;  5CXB B;  4IA9 A;  4ZOY A;  4FA5 D;  4GMB A;  4J82 A;  4FHL A;  3A0F A;  2CE9 A;  5GSA A;  4PBY A;  3MZK A;  4QL1 A;  4FAV D;  2B5M A;  2H9P A;  4LG8 A;  2AH0 A;  2P9U C;  3VGZ A;  3UVO A;  2CE8 A;  3SFZ A;  4CZX A;  1L0Q A;  2AGW A;  1XKS A;  4I79 A;  2UZX B;  2P9I C;  3DXK C;  3PXT D;  2YB8 B;  3EI1 B;  5EM2 A;  4A2M A;  5IT9 g;  5FKS A;  5EAL A;  4CI2 A;  4A0B B;  4K3J B;  2UZY B;  3NVQ A;  3OKW A;  4J84 A;  4J0X A;  3OKY B;  4CZV A;  3DM0 A;  5K1C C;  4HDJ A;  4OZU A;  5JWZ A;  2H14 A;  2YBA A;  4JSV C;  2XL3 A;  3NVN A;  3AL9 A;  5FQD A;  2IUR A;  3ULE C;  1QNI A;  1JMX B;  4JSN C;  3K27 A;  4JT6 C;  5KDO B;  4AEZ A;  1U2V C;  3KRX B;  3PXW D;  3I7K A;  2OVQ B;  1PBY B;  2PM9 A;  5THA A;  1SQ9 A;  3EG6 A;  1OMW B;  4XYI A;  3ZWL B;  4U7A A;  4CY2 A;  2B4E A;  4GM3 A;  4X60 B;  4FA4 D;  2Z2P A;  2Z2N A;  2G9A A;  5I5J A;  5H14 A;  4JD2 C;  2QXV A;  3IIW A;  2W18 A;  3MZL A;  3V5W B;  2PM7 B;  2BBK H;  3UR4 A;  4A09 A;  4OWR A;  3C99 A;  2EBS A;  1N6E A;  4ZOZ A;  4J77 A;  1GOT B;  4J78 A;  4FA1 D;  3NVX A;  4NSX A;  3K26 A;  1SHY B;  4X3E A;  3PE7 A;  4R7A B;  1JMZ B;  2XYI A;  3EI4 B;  2I3S A;  4ERQ A;  1JJU B;  4J87 A;  3RRM C;  2OVR B;  3BWS A;  3UVL A;  5HQG A;  5HE3 B;  4A2L A;  3OL2 A;  5EMM B;  3DXM C;  3RFG A;  2O9K A;  3OKY A;  2J57 G;  3IJ1 A;  3JZN A;  2B5L A;  4GM8 A;  5I5M A;  4JXM A;  3GRE A;  5IJ7 E;  3J81 g;  4CI8 A;  4L3H D;  3EI1 A;  3EI3 B;  4E5Z A;  3AL8 B;  5HE1 B;  2IWK A;  1GXR A;  3MMY A;  2XL2 A;  2H6K A;  2AH1 A;  3OL2 B;  5HE2 B;  1K32 A;  5EMJ B;  5CXC A;  1A0R B;  5CXB A;  4L1Q D;  4UI9 R;  4X61 B;  4ESG A;  4GQ1 A;  2AGY A;  3EU7 A;  5AMS A;  5FKQ A;  3JAM g;  2GC4 A;  4ES0 A;  4Y7R A;  3B7F A;  1XHM A;  2I0S A;  4J79 A;  2B5N A;  5FLX g;  4ZN4 A;  3I7H A;  1GP2 B;  3F3F A;  3SWS D;  1PGU A;  3JRO A;  1R5M A;  5CYK B;  5IC7 A;  3SHF A;  4JSX C;  5GMK n;  3CFV A;  2XU7 A;  4FAN D;  2TRC B;  5K19 A;  3UVK A;  1SQJ A;  3I8E A;  3I7L A;  5AJA A;  2I0T A;  3I7N A;  3P4F A;  4J8B A;  5C2W B;  4ZOV A;  5CXC B;  2H6Q A;  4O9D A;  5FXY A;  4FA9 D;  2GC7 A;  2P9K C;  4A0A B;  2AGX A;  4O3T B;  1TYQ C;  5TEE A;  4CY3 A;  2AGZ A;  3JB9 L;  3SXT D;  5C9Z B;  1OLZ A;  4A0B A;  1TBG A;  3JRP A;  3EI2 B;  3I7O A;  5EAM A;  2OVP B;  4ERZ A;  5B4W A;  5EM2 B;  1B9X A;  1K8K C;  2OK4 A;  4J86 A;  4J81 A;  2I3T A;  4CI3 A;  2Z2O A;  2HXC A;  3PVW B;  4O3U B;  2I0R A;  4D6V A;  2HYE A;  4PC0 A;  4GGD A;  3U4Y A;  3F3P A;  3E0C A;  3UKR C;  2YNN A;  2IUP A;  2CNX A;  4BH6 A;  3EWE A;  1NEX B;  4D0K A;  1PI6 A;  4A08 B;  3AH8 B;  5H17 A;  2IUV A;  2P9L C;  4GM9 A;  2PBI B;  5HYN B;  1MG2 A;  4J0W A;  1S4U X;  1XIP A;  4A09 B;  4LG9 A;  2P9S C;  2QC5 A;  2BCJ B;  2H9M A;  3SBP A;  4J8G A;  3IJC A;  3UVM A;  3I8C A;  4QT8 A;  3L4O D;  4A7J A;  3PVU B;  4J73 A;  2G99 A;  4TZ4 A;  2H68 A;  3JZG A;  3OTT A;  3RSE C;  2H9N A;  3IKO A;  4PBZ A;  4XYH A;  5FA5 B;  4X63 B;  3AFC A;  2PM6 B;  1NR0 A;  3RN1 D;  2P9N C;  5IGQ A;  4H5J A;  3BG0 A;  4K3I D;  4A08 A;  4U1E I;  4Z8L A;  3F3G A;  3FRX A;  5FKR A;  1N6F A;  2YNP A;  3I7P A;  3RFH A;  3C5M A;  5H1M A;  5IJ8 E;  3SMR A;  3I89 A;  3JZH A;  3N0E A;  3PSC B;  4CY5 A;  3EI4 A;  5TF2 A;  1N6D A;  2CN3 A;  4G56 B;  4BUJ C;  4O1Q D;  2Q7Q A;  2GNQ A;  4H5I A;  3EI3 A;  4QQE A;  3SJL D;  4GGA A;  5HE0 B;  3UKU C;  4E5Z B;  5TEF A;  3MXX A;  5EAP A;  3GFC A;  4N14 A;  5AFU 3;  4GGC A;  4GZ8 A;  3BG1 A;  4Y5R D;  4FB1 D;  2J55 H;  5FKT A;  3KRW B;  4LGN A;  2CN2 A;  3I2N A;  1P22 A;  1RI6 A;  3VA6 A;  1MDA H;  2IWF A;  3SBR A;  4CY1 A;  2H3X A;  2MTA H;  1GG2 B;  1YFQ A;  3MKQ A;  4BL0 A;  5EMK B;  3EI2 A;  4KFM B;  3FM0 A;  4JSP C;  4GQB B;  1FWX A;  2HKM A;  4E54 A;  5SXM A;  3OW8 A;  2AGL A;  2HJB A;  3IIY A;  1U4C A;  4GQ2 P;  4L3G D;  3VH0 A;  3RMZ D;  3DWL C;  3SN6 B;  3PSL A;  1VYH C;  2IAA A;  3SLE D;  2PM9 B;  2J56 H;  2P9P C;  3C9C A;  3MKS B;  5EAR A;  3ORV D;  5A2Q g;  2IUQ A;  4FWW A;  3RN0 D;  3OKT A;  4L9O A;  4YVD A;  4CC9 A;  4QRJ A;  3IJ0 A;  4JT5 C;  3HFQ A;  3SCY A;  3V7D B;  1PEV A;  2CO0 A;  4IMM A;  2OIZ A;  4ZOX A;  4EWR A;  5C2V B;  5I5I A;  3V9F A;  4AOW A;  1ERJ A;  4CI1 A;  2CO0 C;  3JPX A;  4ERY A;  1JOF A;  2YNO A;  2OK6 A;  2HES X;  3AL8 A;  3CFS B;  4PSX B;  3W15 A;  2H9L A;  4PNK B;  1MG3 A;  3C75 H;  3SVW D;  4A0A A;  1B9Y A; 
#chains in the Genus database with same CATH topology
 4BCD A;  3FCS A;  5GXI A;  4MK0 B;  5GXH A;  4PXW A;  1Q47 A;  3ODT A;  4CZY A;  4WK0 A;  4E54 B;  3FGB A;  5TDH B;  5CYK A;  2H13 A;  5EML B;  3J80 g;  3DSM A;  1GOF A;  3L4M D;  4PSW B;  1K3I A;  2H47 A;  2HJ4 A;  2OJY A;  2VZ3 A;  4A11 A;  3PXS D;  4DNU A;  3CIK B;  3IUR A;  3EQ9 A;  4O45 A;  5IGO A;  2HKR A;  3N0D A;  4A11 B;  2H6N A;  4XEI C;  4AMZ A;  4DNV A;  3EMH A;  3UVN A;  2AQ5 A;  2YMU A;  3RLM D;  3SBQ A;  5CXB B;  4IA9 A;  4ZOY A;  3ZE1 A;  4O2W A;  4FA5 D;  4GMB A;  4J82 A;  1YR2 A;  3V4P A;  4FHL A;  4UM9 A;  3A0F A;  2VDM A;  2CE9 A;  5GSA A;  4PBY A;  3MZK A;  4QL1 A;  4FAV D;  5FFO A;  2B5M A;  2H9P A;  4LG8 A;  2AH0 A;  2P9U C;  3VGZ A;  3UVO A;  2CE8 A;  3SFZ A;  4CZX A;  1L0Q A;  2AGW A;  1XKS A;  4I79 A;  2UZX B;  2P9I C;  5E6R A;  3DXK C;  3PXT D;  2YB8 B;  5M61 A;  3EI1 B;  5EM2 A;  4A2M A;  1H2W A;  5IT9 g;  5FKS A;  5EAL A;  4CI2 A;  4A0B B;  4K3J B;  4G1M A;  2UZY B;  3NVQ A;  3VI4 A;  3OKW A;  4J84 A;  4WJK A;  4J0X A;  2BKL A;  3OKY B;  3T3P A;  4CZV A;  2VDN A;  3DM0 A;  3ZDZ A;  4NAA A;  2VZ1 A;  5K1C C;  4HDJ A;  4D9S A;  4OZU A;  5JWZ A;  2H14 A;  1VZ2 A;  2YBA A;  4JSV C;  2XL3 A;  3NVN A;  3AL9 A;  5FQD A;  2IUR A;  3ULE C;  1QNI A;  1JMX B;  4JSN C;  1VE6 A;  3K27 A;  4JT6 C;  4MMZ A;  4RE5 A;  5KDO B;  2EIE A;  4AEZ A;  4IRZ A;  1U2V C;  3EQ8 A;  3IJE A;  3KRX B;  3PXW D;  3I7K A;  4NBM A;  2OVQ B;  1PBY B;  2PM9 A;  5THA A;  1SQ9 A;  3EG6 A;  1OMW B;  3QHY B;  4XYI A;  3ZWL B;  4U7A A;  3IUJ A;  4CY2 A;  2B4E A;  4GM3 A;  4X60 B;  4FA4 D;  2Z2P A;  2Z2N A;  2G9A A;  5I5J A;  5H14 A;  4JD2 C;  1E8N A;  2QXV A;  2HU8 A;  1E5T A;  3O4I A;  3IIW A;  2W18 A;  3MZL A;  2XE4 A;  3V5W B;  1H2X A;  2PM7 B;  2BBK H;  3UR4 A;  4A09 A;  4OWR A;  5C86 A;  3C99 A;  2EBS A;  1N6E A;  3VI3 A;  4BCB A;  1UOQ A;  4ZOZ A;  3MUO A;  4J77 A;  4RE6 A;  1GOT B;  4J78 A;  4FA1 D;  3NVX A;  4NSX A;  3K26 A;  1SHY B;  4X3E A;  3PE7 A;  4R7A B;  1JMZ B;  2XYI A;  3EI4 B;  2EIB A;  2I3S A;  4ERQ A;  1JJU B;  4J87 A;  3RRM C;  5M5R A;  4Z7Q A;  2OVR B;  3BWS A;  3UVL A;  5HQG A;  5HE3 B;  4A2L A;  3OL2 A;  4BCC A;  3DXM C;  5EMM B;  3NIG A;  3RFG A;  2O9K A;  3OKY A;  2J57 G;  3IJ1 A;  3JZN A;  2B5L A;  1QFM A;  3IUM A;  4GM8 A;  5I5M A;  4JXM A;  3GRE A;  5IJ7 E;  3J81 g;  2QZP A;  4CI8 A;  4L3H D;  3EI1 A;  3EI3 B;  4E5Z A;  3AL8 B;  5HE1 B;  2IWK A;  1GXR A;  4Z7N A;  1QFS A;  2WQ8 A;  3MMY A;  2XL2 A;  2H6K A;  2AH1 A;  3OL2 B;  5HE2 B;  4G55 A;  1H2Z A;  1K32 A;  5EMJ B;  1O6F A;  5CXC A;  1A0R B;  5CXB A;  4L1Q D;  2HU7 A;  4UI9 R;  4UM8 A;  4X61 B;  4ESG A;  4GQ1 A;  2AGY A;  3EU7 A;  5AMS A;  3OF7 A;  5FKQ A;  3JAM g;  2GC4 A;  1VZ3 A;  1M1X A;  4Y7R A;  5E6S A;  4ES0 A;  3B7F A;  3K72 A;  2VDO A;  4BP8 A;  1XHM A;  2I0S A;  4J79 A;  2B5N A;  5FLX g;  4ZN4 A;  3I7H A;  1GP2 B;  3F3F A;  3SWS D;  2EIC A;  1PGU A;  3JRO A;  1R5M A;  5CYK B;  5IC7 A;  3SHF A;  4JSX C;  3O4J A;  5GMK n;  3CFV A;  2XU7 A;  4FAN D;  3EQ7 A;  2TRC B;  2VC2 A;  5K19 A;  3UVK A;  4Z7O A;  1SQJ A;  3I8E A;  3I7L A;  5AJA A;  2I0T A;  3I7N A;  3P4F A;  1TYE A;  4J8B A;  5C2W B;  4ZOV A;  5CXC B;  2H6Q A;  4O9D A;  5FXY A;  4FA9 D;  2GC7 A;  5C92 A;  2P9K C;  4A0A B;  5M5T A;  3KCI A;  2AGX A;  4O3T B;  1TYQ C;  5TEE A;  4CY3 A;  2AGZ A;  3JB9 L;  3SXT D;  5C9Z B;  1OLZ A;  4A0B A;  1TBG A;  3JRP A;  3EI2 B;  3I7O A;  5EAM A;  2OVP B;  4ERZ A;  2VDR A;  1C9L A;  5B4W A;  5EM2 B;  1B9X A;  3MUN A;  1K8K C;  1I2M B;  2OK4 A;  4WK2 A;  4J86 A;  4J81 A;  2I3T A;  4CI3 A;  2Z2O A;  2HXC A;  3ZE2 A;  3PVW B;  4G1E A;  4O3U B;  2I0R A;  4D6V A;  2HYE A;  4NC4 A;  2VDK A;  4PC0 A;  4GGD A;  3U4Y A;  3F3P A;  3E0C A;  3UKR C;  1E8M A;  2IUP A;  2YNN A;  2CNX A;  2XDW A;  4BH6 A;  3EWE A;  1C9I A;  1NEX B;  3NIF A;  4D0K A;  1PI6 A;  4A08 B;  3AH8 B;  5H17 A;  2IUV A;  2P9L C;  4GM9 A;  2PBI B;  5HYN B;  1MG2 A;  4J0W A;  1S4U X;  1XIP A;  4A09 B;  4LG9 A;  2P9S C;  2QC5 A;  2BCJ B;  2H9M A;  3ZDY A;  3SBP A;  4AX4 A;  4J8G A;  3QI0 A;  3IJC A;  3UVM A;  3I8C A;  5FFG A;  4QT8 A;  3L4O D;  4A7J A;  3PVU B;  1UOP A;  1U8C A;  4AMY A;  4J73 A;  2G99 A;  4TZ4 A;  2H68 A;  3JZG A;  4MMY A;  3OTT A;  3RSE C;  3IUQ A;  2H9N A;  3IKO A;  4PBZ A;  4XYH A;  5FA5 B;  4X63 B;  3AFC A;  2PM6 B;  1NR0 A;  3RN1 D;  2P9N C;  5IGQ A;  1UOO A;  4H5J A;  3BG0 A;  4K3I D;  3V4V A;  4BP9 A;  3NID A;  2VDQ A;  4A08 A;  4U1E I;  4AN0 A;  4Z8L A;  3F3G A;  1GOG A;  3FRX A;  2EID A;  5FKR A;  1N6F A;  2YNP A;  3I7P A;  3FCU A;  3RFH A;  3C5M A;  5H1M A;  5IJ8 E;  3SMR A;  3I89 A;  5M5S A;  3JZH A;  3N0E A;  3PSC B;  4CY5 A;  3EI4 A;  5TF2 A;  1N6D A;  2CN3 A;  4G56 B;  4BUJ C;  1BPO A;  4O1Q D;  2Q7Q A;  3MVD K;  2GNQ A;  4H5I A;  3EI3 A;  4QQE A;  3SJL D;  4GGA A;  4MMX A;  5HE0 B;  3UKU C;  4E5Z B;  5TEF A;  5M5V A;  3MXX A;  5EAP A;  2JKX A;  3GFC A;  2VDP A;  4N14 A;  5AFU 3;  4GGC A;  4GZ8 A;  3BG1 A;  4Y5R D;  4O02 A;  4FB1 D;  2J55 H;  4NEN A;  5FKT A;  3KRW B;  3O4H A;  4LGN A;  2CN2 A;  3I2N A;  1P22 A;  1RI6 A;  4JHP C;  3VA6 A;  2HU5 A;  1MDA H;  4L1M A;  1A12 A;  2IWF A;  3SBR A;  2XZG A;  4CY1 A;  2H3X A;  2MTA H;  1GG2 B;  1YFQ A;  3MKQ A;  4BL0 A;  2VDL A;  5EMK B;  3EI2 A;  4KFM B;  3FM0 A;  4JSP C;  4GQB B;  1FWX A;  2HKM A;  1GOH A;  1VE7 A;  4E54 A;  5SXM A;  3OW8 A;  2AGL A;  3ZDX A;  2QR5 A;  2HJB A;  3IIY A;  1U4C A;  4GQ2 P;  3T3M A;  4L3G D;  3VH0 A;  3RMZ D;  3DWL C;  1H2Y A;  3IUL A;  3SN6 B;  3ZE0 A;  3PSL A;  1VYH C;  2IAA A;  3SLE D;  5HDB A;  2PM9 B;  4QAM A;  2J56 H;  2P9P C;  5M5U A;  3C9C A;  3MKS B;  5EAR A;  3ORV D;  5A2Q g;  2IUQ A;  3O4G A;  4FWW A;  3RN0 D;  3OKT A;  4JHN A;  4L9O A;  4YVD A;  5E6U A;  1JV2 A;  4CC9 A;  4QRJ A;  3IJ0 A;  4JT5 C;  1JTD B;  3HFQ A;  3SCY A;  3V7D B;  1PEV A;  2CO0 A;  4IMM A;  2OIZ A;  3IVM A;  4ZOX A;  4EWR A;  5C2V B;  5I5I A;  4AN1 A;  1O6G A;  3V9F A;  3K6S A;  4AOW A;  1ERJ A;  3DDU A;  1L5G A;  4CI1 A;  2CO0 C;  3JPX A;  4DNW A;  4ERY A;  1JOF A;  2YNO A;  2OK6 A;  2HES X;  3AL8 A;  3K71 A;  1UTC A;  3GD1 I;  3CFS B;  3IUN A;  4PSX B;  3W15 A;  4WK4 A;  2H9L A;  4PNK B;  1MG3 A;  3C75 H;  3SVW D;  3GC3 B;  4A0A A;  1B9Y A;  1T2X A; 
#chains in the Genus database with same CATH homology
 5GXI A;  4MK0 B;  5GXH A;  4PXW A;  1Q47 A;  3ODT A;  4CZY A;  4E54 B;  3FGB A;  5TDH B;  5CYK A;  2H13 A;  5EML B;  3J80 g;  3DSM A;  3L4M D;  4PSW B;  2H47 A;  2HJ4 A;  2OJY A;  4A11 A;  3PXS D;  3CIK B;  5IGO A;  4O45 A;  2HKR A;  3N0D A;  4A11 B;  2H6N A;  4XEI C;  3EMH A;  3UVN A;  2AQ5 A;  2YMU A;  3RLM D;  3SBQ A;  5CXB B;  4IA9 A;  4ZOY A;  4FA5 D;  4GMB A;  4J82 A;  4FHL A;  3A0F A;  2CE9 A;  5GSA A;  4PBY A;  3MZK A;  4QL1 A;  4FAV D;  2B5M A;  2H9P A;  4LG8 A;  2AH0 A;  2P9U C;  3VGZ A;  3UVO A;  2CE8 A;  3SFZ A;  4CZX A;  1L0Q A;  2AGW A;  1XKS A;  4I79 A;  2UZX B;  2P9I C;  3DXK C;  3PXT D;  2YB8 B;  3EI1 B;  5EM2 A;  4A2M A;  5IT9 g;  5FKS A;  5EAL A;  4CI2 A;  4A0B B;  4K3J B;  2UZY B;  3NVQ A;  3OKW A;  4J84 A;  4J0X A;  3OKY B;  4CZV A;  3DM0 A;  5K1C C;  4HDJ A;  4OZU A;  5JWZ A;  2H14 A;  2YBA A;  4JSV C;  2XL3 A;  3NVN A;  3AL9 A;  5FQD A;  2IUR A;  3ULE C;  1QNI A;  1JMX B;  4JSN C;  3K27 A;  4JT6 C;  5KDO B;  4AEZ A;  1U2V C;  3KRX B;  3PXW D;  3I7K A;  2OVQ B;  1PBY B;  2PM9 A;  5THA A;  1SQ9 A;  3EG6 A;  1OMW B;  4XYI A;  3ZWL B;  4U7A A;  4CY2 A;  2B4E A;  4GM3 A;  4X60 B;  4FA4 D;  2Z2P A;  2Z2N A;  2G9A A;  5I5J A;  5H14 A;  4JD2 C;  2QXV A;  3IIW A;  2W18 A;  3MZL A;  3V5W B;  2PM7 B;  2BBK H;  3UR4 A;  4A09 A;  4OWR A;  3C99 A;  2EBS A;  1N6E A;  4ZOZ A;  4J77 A;  1GOT B;  4J78 A;  4FA1 D;  3NVX A;  4NSX A;  3K26 A;  1SHY B;  4X3E A;  3PE7 A;  4R7A B;  1JMZ B;  2XYI A;  3EI4 B;  2I3S A;  4ERQ A;  1JJU B;  4J87 A;  3RRM C;  2OVR B;  3BWS A;  3UVL A;  5HQG A;  5HE3 B;  4A2L A;  3OL2 A;  5EMM B;  3DXM C;  3RFG A;  2O9K A;  3OKY A;  2J57 G;  3IJ1 A;  3JZN A;  2B5L A;  4GM8 A;  5I5M A;  4JXM A;  3GRE A;  5IJ7 E;  3J81 g;  4CI8 A;  4L3H D;  3EI1 A;  3EI3 B;  4E5Z A;  3AL8 B;  5HE1 B;  2IWK A;  1GXR A;  3MMY A;  2XL2 A;  2H6K A;  2AH1 A;  3OL2 B;  5HE2 B;  1K32 A;  5EMJ B;  5CXC A;  1A0R B;  5CXB A;  4L1Q D;  4UI9 R;  4X61 B;  4ESG A;  4GQ1 A;  2AGY A;  3EU7 A;  5AMS A;  5FKQ A;  3JAM g;  2GC4 A;  4ES0 A;  4Y7R A;  3B7F A;  1XHM A;  2I0S A;  4J79 A;  2B5N A;  5FLX g;  4ZN4 A;  3I7H A;  1GP2 B;  3F3F A;  3SWS D;  1PGU A;  3JRO A;  1R5M A;  5CYK B;  5IC7 A;  3SHF A;  4JSX C;  5GMK n;  3CFV A;  2XU7 A;  4FAN D;  2TRC B;  5K19 A;  3UVK A;  1SQJ A;  3I8E A;  3I7L A;  5AJA A;  2I0T A;  3I7N A;  3P4F A;  4J8B A;  5C2W B;  4ZOV A;  5CXC B;  2H6Q A;  4O9D A;  5FXY A;  4FA9 D;  2GC7 A;  2P9K C;  4A0A B;  2AGX A;  4O3T B;  1TYQ C;  5TEE A;  4CY3 A;  2AGZ A;  3JB9 L;  3SXT D;  5C9Z B;  1OLZ A;  4A0B A;  1TBG A;  3JRP A;  3EI2 B;  3I7O A;  5EAM A;  2OVP B;  4ERZ A;  5B4W A;  5EM2 B;  1B9X A;  1K8K C;  2OK4 A;  4J86 A;  4J81 A;  2I3T A;  4CI3 A;  2Z2O A;  2HXC A;  3PVW B;  4O3U B;  2I0R A;  4D6V A;  2HYE A;  4PC0 A;  4GGD A;  3U4Y A;  3F3P A;  3E0C A;  3UKR C;  2YNN A;  2IUP A;  2CNX A;  4BH6 A;  3EWE A;  1NEX B;  4D0K A;  1PI6 A;  4A08 B;  3AH8 B;  5H17 A;  2IUV A;  2P9L C;  4GM9 A;  2PBI B;  5HYN B;  1MG2 A;  4J0W A;  1S4U X;  1XIP A;  4A09 B;  4LG9 A;  2P9S C;  2QC5 A;  2BCJ B;  2H9M A;  3SBP A;  4J8G A;  3IJC A;  3UVM A;  3I8C A;  4QT8 A;  3L4O D;  4A7J A;  3PVU B;  4J73 A;  2G99 A;  4TZ4 A;  2H68 A;  3JZG A;  3OTT A;  3RSE C;  2H9N A;  3IKO A;  4PBZ A;  4XYH A;  5FA5 B;  4X63 B;  3AFC A;  2PM6 B;  1NR0 A;  3RN1 D;  2P9N C;  5IGQ A;  4H5J A;  3BG0 A;  4K3I D;  4A08 A;  4U1E I;  4Z8L A;  3F3G A;  3FRX A;  5FKR A;  1N6F A;  2YNP A;  3I7P A;  3RFH A;  3C5M A;  5H1M A;  5IJ8 E;  3SMR A;  3I89 A;  3JZH A;  3N0E A;  3PSC B;  4CY5 A;  3EI4 A;  5TF2 A;  1N6D A;  2CN3 A;  4G56 B;  4BUJ C;  4O1Q D;  2Q7Q A;  2GNQ A;  4H5I A;  3EI3 A;  4QQE A;  3SJL D;  4GGA A;  5HE0 B;  3UKU C;  4E5Z B;  5TEF A;  3MXX A;  5EAP A;  3GFC A;  4N14 A;  5AFU 3;  4GGC A;  4GZ8 A;  3BG1 A;  4Y5R D;  4FB1 D;  2J55 H;  5FKT A;  3KRW B;  4LGN A;  2CN2 A;  3I2N A;  1P22 A;  1RI6 A;  3VA6 A;  1MDA H;  2IWF A;  3SBR A;  4CY1 A;  2H3X A;  2MTA H;  1GG2 B;  1YFQ A;  3MKQ A;  4BL0 A;  5EMK B;  3EI2 A;  4KFM B;  3FM0 A;  4JSP C;  4GQB B;  1FWX A;  2HKM A;  4E54 A;  5SXM A;  3OW8 A;  2AGL A;  2HJB A;  3IIY A;  1U4C A;  4GQ2 P;  4L3G D;  3VH0 A;  3RMZ D;  3DWL C;  3SN6 B;  3PSL A;  1VYH C;  2IAA A;  3SLE D;  2PM9 B;  2J56 H;  2P9P C;  3C9C A;  3MKS B;  5EAR A;  3ORV D;  5A2Q g;  2IUQ A;  4FWW A;  3RN0 D;  3OKT A;  4L9O A;  4YVD A;  4CC9 A;  4QRJ A;  3IJ0 A;  4JT5 C;  3HFQ A;  3SCY A;  3V7D B;  1PEV A;  2CO0 A;  4IMM A;  2OIZ A;  4ZOX A;  4EWR A;  5C2V B;  5I5I A;  3V9F A;  4AOW A;  1ERJ A;  4CI1 A;  2CO0 C;  3JPX A;  4ERY A;  1JOF A;  2YNO A;  2OK6 A;  2HES X;  3AL8 A;  3CFS B;  4PSX B;  3W15 A;  2H9L A;  4PNK B;  1MG3 A;  3C75 H;  3SVW D;  4A0A A;  1B9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...