2J5IA

Crystal structure of hydroxycinnamoyl-coa hydratase-lyase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
247
structure length
247
Chain Sequence
TYEGRWKTVKVEIEDGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYFREVDAGPEILQEKIRREASQWQWKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPGNLVSKAMADTVGHRQSLMYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKHGFKRCRELTWEQNEDYLYAKLDQSRLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.8 A Resolution Structure of Hydroxycinnamoyl- Coenzyme a Hydratase-Lyase (Hchl) from Pseudomonas Fluorescens, an Enzyme that Catalyses the Transformation of Feruloyl-Coenzyme a to Vanillin.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
total genus 99
structure length 247
sequence length 247
ec nomenclature ec 4.1.2.41: Vanillin synthase.
pdb deposition date 2006-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2j5iA01
3KTIA 1Y7OA 4EMPA 5C90A 3KTGA 4MXIA 3LKEA 4MOUA 1W2XA 3K50A 2WTBA 2D3TA 2HW5A 2W3PA 5DTWA 1WZ8A 4U0GH 3T89A 3H81A 1RJNA 1OD4A 3GLMA 4JYJA 1N6EA 3QK8A 5E0SH 1WDLA 3QREA 3H0SA 3RSIA 4B3JA 3V5IA 4FJWD 1ON9A 3BPPA 5INFA 3TT6A 3ZWBA 3KTHA 3PEAA 3GF3A 4U1AA 3IB9A 1VRGA 3H0UA 2A7SA 3OC7A 1FC7A 3R9TA 4ZDCA 5KJPA 2F9IA 4RYFA 3BF0A 2J5II 4FZWA 2VX2A 3H0JA 3ZWCA 4JCRA 1DCIA 3MOYA 4QIIA 3HP0A 4ZU2A 1YG6A 1X0UA 5JBWA 3ZWAA 3OMEA 4L8KA 4JOTA 3L3SA 1UIYA 3P2LA 1N6FA 5G1QA 1UYRA 3M6NA 1HNOA 2ZQQA 3P5MA 3TLFA 3H0QA 4JYLA 4F47A 1OD2A 5DU8A 2F9YA 3PGQA 3U9SB 4YLHA 5DZKA 1EF8A 3SWXA 4JFCA 2IEXA 4LK5A 4JCSA 2A81A 2QQ3A 4ELWA 2F9IB 4L6WA 2VREA 2ZL4A 2VSUE 4JCQA 2VSUC 3DORA 5DU6A 4RCNA 2CE3A 3HLN1 1K32A 3I47A 3KQFA 4ZDEA 5KDRA 5IKLB 3U9TB 4ELSA 4IZBA 1XNVA 4WYOB 5FUSA 5KDRB 4U18A 3WG5A 3NJDA 3HE2A 3Q1TA 4RYFH 4Z0MA 5INGA 4ZDDA 3Q0JA 1WDMA 3TV5A 3Q0GA 5INIA 2ZL3A 4B3HA 4NNQA 2F6IA 1XNWA 4JJTA 1DUBA 4U19A 1N6DA 4WCZA 1WDKA 4FN8A 3BEZA 4U0GA 5G1RA 2X58A 3TVWA 2C8TA 5DU4A 5DUCA 1PIXA 4I4ZA 2Q35A 2FBMA 1FC9A 2ZQRA 5E0NX 3T88A 3T3WA 4HC8A 1XX4A 4FNBA 2J5IA 3G64A 2PG8A 3HRXA 1HNUA 3TDCA 2F6QA 1PJHA 2DUBA 4IZCA 4NEKA 5FIFA 2PBPA 5DKPA 3IAVA 5CTBA 2ZL0A 3ZW8A 3K8XA 3STAA 4EMLA 2NP9A 4G2RA 3PE8A 4I42A 1XNYA 1O8UA 1YG8A 3FF6A 4QIJA 5MGBA 4FZWC 1SZOA 4GM2A 2VSSF 1UYTA 5DTPA 2FZSA 1UYSA 3ZW9A 2UZFA 4KD6A 4ASIA 1FCFA 3QKAA 1Q51A 1RJMA 3JU1A 2J5GA 4KWBA 4Q1IA 4ZDFA 4OLQA 3PZKA 1ON3A 1HZDA 3SLLA 2VSSA 3QMJA 3T8AA 3DJAA 1TG6A 4U0HA 3GKBA 3NJBA 1UYVA 1FC6A 3QXZA 3M6MA 3KTKA 4Q0GA 4MI2A 1EY3A 1TYFA 5G1SA 2X24A 5CTCA 1JXZA 3TVUA 5DZKH 3HINA 3ST9A 3GMAA 3QYRA 4JSBA 4OG1A 1NZYA 1MJ3A 4GHNA 3MYBA 3TRRA 1K39A 4B3IA 1EF9A 5DL1A 3MFMA 4HNKA 4FN7A 2Q34A 2BZRA 1Q52A 4JCTA 3TT7A 2J5GD 3VIVA 3ISAA 3P85A 4EMMA 3R6HA 3V5EA 2J5SA 1XO6A 3R9QA 3LAOA 4FNDA 3N6RB 3U9RB 4WZ8B 4K2NA 4ZDBA 3KTJA 1SG4A 3RRVA 4KNPA 3Q7HA 3MT6A 2PPYA 3OT6A 4JWVA 2A7KA 4JVTA 4ELXA 5JBXA 4FB8A 2VSUA 4K3WA 3T8BA 2DEOA 4DI1A 3TZ3A 1NZYB 5C9GA 4OMRA 2F9YB 2VSSE 5E0SA 5DUFA 3QWDA 3H02A 2CBYA 1J7XA 2Q2XA 2ZL2A 3IBBA 3R9SA 4I52A 4QFEA 3FDUA 4IZDA 4KPKA 3R0OA 4K29A 2J5IB 3RSTA 2FW2A 2VSUF 2EJ5A 3GF7A 2GTRA 3QXIA
chains in the Genus database with same CATH superfamily
3KTIA 1Y7OA 4EMPA 5C90A 3KTGA 4J2UA 4MXIA 3LKEA 4MOUA 1W2XA 3K50A 2WTBA 2D3TA 2HW5A 2W3PA 5DTWA 1WZ8A 4U0GH 3T89A 3H81A 1RJNA 1OD4A 3GLMA 4JYJA 1N6EA 3QK8A 4HDTA 5E0SH 1WDLA 3QREA 3H0SA 3RSIA 4B3JA 3V5IA 4FJWD 1ON9A 3BPPA 5INFA 3TT6A 3ZWBA 3KTHA 3PEAA 3GF3A 4U1AA 3IB9A 1VRGA 3H0UA 2A7SA 3OC7A 2YJGA 1FC7A 3R9TA 4ZDCA 5KJPA 2F9IA 4RYFA 3BF0A 2J5II 4FZWA 2VX2A 3H0JA 3ZWCA 4JCRA 1DCIA 3MOYA 4QIIA 3HP0A 4ZU2A 1YG6A 1X0UA 5JBWA 3ZWAA 3OMEA 4L8KA 4JOTA 3L3SA 1UIYA 3P2LA 1N6FA 5G1QA 1UYRA 3M6NA 1HNOA 2ZQQA 3P5MA 3TLFA 3H0QA 4JYLA 4F47A 1OD2A 4NARA 5DU8A 2F9YA 3PGQA 3U9SB 4YLHA 5DZKA 1EF8A 3SWXA 4JFCA 2IEXA 4LK5A 4JCSA 2A81A 2QQ3A 4ELWA 2F9IB 4L6WA 2VREA 2ZL4A 2VSUE 4JCQA 2VSUC 3DORA 5DU6A 4RCNA 2CE3A 3HLN1 1K32A 3I47A 3KQFA 4ZDEA 5KDRA 5IKLB 3U9TB 4ELSA 4IZBA 1XNVA 4WYOB 5FUSA 5KDRB 4U18A 3WG5A 3NJDA 3HE2A 3Q1TA 4RYFH 4Z0MA 5INGA 4ZDDA 3Q0JA 1WDMA 3TV5A 3Q0GA 5INIA 2ZL3A 4B3HA 4NNQA 2F6IA 1XNWA 4JJTA 1DUBA 4U19A 1N6DA 4WCZA 1WDKA 4FN8A 3BEZA 4U0GA 5G1RA 2X58A 3TVWA 2C8TA 5DU4A 5DUCA 1PIXA 4I4ZA 2Q35A 2FBMA 1FC9A 2ZQRA 5E0NX 3T88A 3T3WA 4HC8A 1XX4A 4FNBA 2J5IA 3G64A 2PG8A 3HRXA 1HNUA 3TDCA 2F6QA 1PJHA 2DUBA 4IZCA 4NEKA 5FIFA 2PBPA 5DKPA 3IAVA 5CTBA 2ZL0A 3ZW8A 3K8XA 3STAA 4EMLA 2NP9A 4G2RA 3PE8A 4I42A 1XNYA 1O8UA 1YG8A 3FF6A 4QIJA 5MGBA 4FZWC 1SZOA 4GM2A 2VSSF 1UYTA 5DTPA 2FZSA 1UYSA 3ZW9A 2UZFA 4KD6A 4ASIA 1FCFA 3QKAA 1Q51A 1RJMA 3JU1A 2J5GA 4KWBA 4Q1IA 4ZDFA 4OLQA 3PZKA 1ON3A 1HZDA 3SLLA 2VSSA 3QMJA 3T8AA 3DJAA 1TG6A 4U0HA 5HUQA 3GKBA 3NJBA 1UYVA 1FC6A 3BPTA 3QXZA 3M6MA 3KTKA 4Q0GA 4MI2A 1EY3A 1TYFA 5G1SA 2X24A 5CTCA 1JXZA 3TVUA 5DZKH 3HINA 3ST9A 3GMAA 3QYRA 4JSBA 4OG1A 1NZYA 1MJ3A 4GHNA 3MYBA 3TRRA 1K39A 4B3IA 1EF9A 5DL1A 3MFMA 4HNKA 4FN7A 2Q34A 2BZRA 1Q52A 4JCTA 3TT7A 2J5GD 3VIVA 3ISAA 3P85A 4EMMA 3R6HA 3V5EA 2J5SA 1XO6A 3R9QA 3LAOA 4FNDA 3N6RB 3U9RB 4WZ8B 4K2NA 4ZDBA 3KTJA 1SG4A 3RRVA 4KNPA 3Q7HA 3MT6A 2PPYA 3OT6A 4JWVA 2A7KA 4JVTA 4ELXA 5JBXA 4FB8A 2VSUA 4K3WA 3T8BA 2DEOA 4DI1A 3TZ3A 1NZYB 5C9GA 4OMRA 2F9YB 2VSSE 5E0SA 5DUFA 3QWDA 3H02A 2CBYA 1J7XA 2Q2XA 2ZL2A 3IBBA 3R9SA 4I52A 4QFEA 3FDUA 4IZDA 4KPKA 3R0OA 4K29A 2J5IB 3RSTA 2FW2A 2VSUF 2EJ5A 3GF7A 2GTRA 3QXIA
chains in the Genus database with same CATH topology
3KTIA 1Y7OA 4EMPA 5C90A 3KTGA 4J2UA 4MXIA 3LKEA 4MOUA 1W2XA 3K50A 2WTBA 2D3TA 2HW5A 2W3PA 5DTWA 1WZ8A 4U0GH 3T89A 3H81A 1RJNA 1OD4A 3GLMA 4JYJA 1N6EA 3QK8A 4HDTA 5E0SH 1WDLA 3QREA 3H0SA 3RSIA 4B3JA 3V5IA 4FJWD 1ON9A 3BPPA 5INFA 3TT6A 3ZWBA 3KTHA 3PEAA 3GF3A 4U1AA 3IB9A 1VRGA 3H0UA 2A7SA 3OC7A 2YJGA 1FC7A 3R9TA 4ZDCA 5KJPA 2F9IA 4RYFA 3BF0A 2J5II 4FZWA 2VX2A 3H0JA 3ZWCA 4JCRA 1DCIA 3MOYA 4QIIA 3HP0A 4ZU2A 1YG6A 1X0UA 5JBWA 3ZWAA 3OMEA 4L8KA 4JOTA 3L3SA 1UIYA 3P2LA 1N6FA 5G1QA 1UYRA 3M6NA 1HNOA 2ZQQA 3P5MA 3TLFA 3H0QA 4JYLA 4F47A 1OD2A 4NARA 5DU8A 2F9YA 3PGQA 3U9SB 4YLHA 5DZKA 1EF8A 3SWXA 4JFCA 2IEXA 4LK5A 4JCSA 2A81A 2QQ3A 4ELWA 2F9IB 4L6WA 2VREA 2ZL4A 2VSUE 4JCQA 2VSUC 3DORA 5DU6A 4RCNA 2CE3A 3HLN1 1K32A 3I47A 3KQFA 4ZDEA 5KDRA 5IKLB 3U9TB 4ELSA 4IZBA 1XNVA 4WYOB 5FUSA 5KDRB 4U18A 3WG5A 3NJDA 3HE2A 3Q1TA 4RYFH 4Z0MA 5INGA 4ZDDA 3Q0JA 1WDMA 3TV5A 3Q0GA 5INIA 2ZL3A 4B3HA 4NNQA 2F6IA 1XNWA 4JJTA 1DUBA 4U19A 1N6DA 4WCZA 1WDKA 4FN8A 3BEZA 4U0GA 5G1RA 2X58A 3TVWA 2C8TA 5DU4A 5DUCA 1PIXA 4I4ZA 2Q35A 2FBMA 1FC9A 2ZQRA 5E0NX 3T88A 3T3WA 4HC8A 1XX4A 4FNBA 2J5IA 3G64A 2PG8A 3HRXA 1HNUA 3TDCA 2F6QA 1PJHA 2DUBA 4IZCA 4NEKA 5FIFA 2PBPA 5DKPA 3IAVA 5CTBA 2ZL0A 3ZW8A 3K8XA 3STAA 4EMLA 2NP9A 4G2RA 3PE8A 4I42A 1XNYA 1O8UA 1YG8A 3FF6A 4QIJA 5MGBA 4FZWC 1SZOA 4GM2A 2VSSF 1UYTA 5DTPA 2FZSA 1UYSA 3ZW9A 2UZFA 4KD6A 4ASIA 1FCFA 3QKAA 1Q51A 1RJMA 3JU1A 2J5GA 4KWBA 4Q1IA 4ZDFA 4OLQA 3PZKA 1ON3A 1HZDA 3SLLA 2VSSA 3QMJA 3T8AA 3DJAA 1TG6A 4U0HA 5HUQA 3GKBA 3NJBA 1UYVA 1FC6A 3BPTA 3QXZA 3M6MA 3KTKA 4Q0GA 4MI2A 1EY3A 1TYFA 5G1SA 2X24A 5CTCA 1JXZA 3TVUA 5DZKH 3HINA 3ST9A 3GMAA 3QYRA 4JSBA 4OG1A 1NZYA 1MJ3A 4GHNA 3MYBA 3TRRA 1K39A 4B3IA 1EF9A 5DL1A 3MFMA 4HNKA 4FN7A 2Q34A 2BZRA 1Q52A 4JCTA 3TT7A 2J5GD 3VIVA 3ISAA 3P85A 4EMMA 3R6HA 3V5EA 2J5SA 1XO6A 3R9QA 3LAOA 4FNDA 3N6RB 3U9RB 4WZ8B 4K2NA 4ZDBA 3KTJA 1SG4A 3RRVA 4KNPA 3Q7HA 3MT6A 2PPYA 3OT6A 4JWVA 2A7KA 4JVTA 4ELXA 5JBXA 4FB8A 2VSUA 4K3WA 3T8BA 2DEOA 4DI1A 3TZ3A 1NZYB 5C9GA 4OMRA 2F9YB 2VSSE 5E0SA 5DUFA 3QWDA 3H02A 2CBYA 1J7XA 2Q2XA 2ZL2A 3IBBA 3R9SA 4I52A 4QFEA 3FDUA 4IZDA 4KPKA 3R0OA 4K29A 2J5IB 3RSTA 2FW2A 2VSUF 2EJ5A 3GF7A 2GTRA 3QXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KTI A;  1Y7O A;  4EMP A;  5C90 A;  3KTG A;  4MXI A;  3LKE A;  4MOU A;  1W2X A;  3K50 A;  2WTB A;  2D3T A;  2HW5 A;  2W3P A;  5DTW A;  1WZ8 A;  4U0G H;  3T89 A;  3H81 A;  1RJN A;  1OD4 A;  3GLM A;  4JYJ A;  1N6E A;  3QK8 A;  5E0S H;  1WDL A;  3QRE A;  3H0S A;  3RSI A;  4B3J A;  3V5I A;  4FJW D;  1ON9 A;  3BPP A;  5INF A;  3TT6 A;  3ZWB A;  3KTH A;  3PEA A;  3GF3 A;  4U1A A;  3IB9 A;  1VRG A;  3H0U A;  2A7S A;  3OC7 A;  1FC7 A;  3R9T A;  4ZDC A;  5KJP A;  2F9I A;  4RYF A;  3BF0 A;  2J5I I;  4FZW A;  2VX2 A;  3H0J A;  3ZWC A;  4JCR A;  1DCI A;  3MOY A;  4QII A;  3HP0 A;  4ZU2 A;  1YG6 A;  1X0U A;  5JBW A;  3ZWA A;  3OME A;  4L8K A;  4JOT A;  3L3S A;  1UIY A;  3P2L A;  1N6F A;  5G1Q A;  1UYR A;  3M6N A;  1HNO A;  2ZQQ A;  3P5M A;  3TLF A;  3H0Q A;  4JYL A;  4F47 A;  1OD2 A;  5DU8 A;  2F9Y A;  3PGQ A;  3U9S B;  4YLH A;  5DZK A;  1EF8 A;  3SWX A;  4JFC A;  2IEX A;  4LK5 A;  4JCS A;  2A81 A;  2QQ3 A;  4ELW A;  2F9I B;  4L6W A;  2VRE A;  2ZL4 A;  2VSU E;  4JCQ A;  2VSU C;  3DOR A;  5DU6 A;  4RCN A;  2CE3 A;  3HLN 1;  1K32 A;  3I47 A;  3KQF A;  4ZDE A;  5KDR A;  5IKL B;  3U9T B;  4ELS A;  4IZB A;  1XNV A;  4WYO B;  5FUS A;  5KDR B;  4U18 A;  3WG5 A;  3NJD A;  3HE2 A;  3Q1T A;  4RYF H;  4Z0M A;  5ING A;  4ZDD A;  3Q0J A;  1WDM A;  3TV5 A;  3Q0G A;  5INI A;  2ZL3 A;  4B3H A;  4NNQ A;  2F6I A;  1XNW A;  4JJT A;  1DUB A;  4U19 A;  1N6D A;  4WCZ A;  1WDK A;  4FN8 A;  3BEZ A;  4U0G A;  5G1R A;  2X58 A;  3TVW A;  2C8T A;  5DU4 A;  5DUC A;  1PIX A;  4I4Z A;  2Q35 A;  2FBM A;  1FC9 A;  2ZQR A;  5E0N X;  3T88 A;  3T3W A;  4HC8 A;  1XX4 A;  4FNB A;  2J5I A;  3G64 A;  2PG8 A;  3HRX A;  1HNU A;  3TDC A;  2F6Q A;  1PJH A;  2DUB A;  4IZC A;  4NEK A;  5FIF A;  2PBP A;  5DKP A;  3IAV A;  5CTB A;  2ZL0 A;  3ZW8 A;  3K8X A;  3STA A;  4EML A;  2NP9 A;  4G2R A;  3PE8 A;  4I42 A;  1XNY A;  1O8U A;  1YG8 A;  3FF6 A;  4QIJ A;  5MGB A;  4FZW C;  1SZO A;  4GM2 A;  2VSS F;  1UYT A;  5DTP A;  2FZS A;  1UYS A;  3ZW9 A;  2UZF A;  4KD6 A;  4ASI A;  1FCF A;  3QKA A;  1Q51 A;  1RJM A;  3JU1 A;  2J5G A;  4KWB A;  4Q1I A;  4ZDF A;  4OLQ A;  3PZK A;  1ON3 A;  1HZD A;  3SLL A;  2VSS A;  3QMJ A;  3T8A A;  3DJA A;  1TG6 A;  4U0H A;  3GKB A;  3NJB A;  1UYV A;  1FC6 A;  3QXZ A;  3M6M A;  3KTK A;  4Q0G A;  4MI2 A;  1EY3 A;  1TYF A;  5G1S A;  2X24 A;  5CTC A;  1JXZ A;  3TVU A;  5DZK H;  3HIN A;  3ST9 A;  3GMA A;  3QYR A;  4JSB A;  4OG1 A;  1NZY A;  1MJ3 A;  4GHN A;  3MYB A;  3TRR A;  1K39 A;  4B3I A;  1EF9 A;  5DL1 A;  3MFM A;  4HNK A;  4FN7 A;  2Q34 A;  2BZR A;  1Q52 A;  4JCT A;  3TT7 A;  2J5G D;  3VIV A;  3ISA A;  3P85 A;  4EMM A;  3R6H A;  3V5E A;  2J5S A;  1XO6 A;  3R9Q A;  3LAO A;  4FND A;  3N6R B;  3U9R B;  4WZ8 B;  4K2N A;  4ZDB A;  3KTJ A;  1SG4 A;  3RRV A;  4KNP A;  3Q7H A;  3MT6 A;  2PPY A;  3OT6 A;  4JWV A;  2A7K A;  4JVT A;  4ELX A;  5JBX A;  4FB8 A;  2VSU A;  4K3W A;  3T8B A;  2DEO A;  4DI1 A;  3TZ3 A;  1NZY B;  5C9G A;  4OMR A;  2F9Y B;  2VSS E;  5E0S A;  5DUF A;  3QWD A;  3H02 A;  2CBY A;  1J7X A;  2Q2X A;  2ZL2 A;  3IBB A;  3R9S A;  4I52 A;  4QFE A;  3FDU A;  4IZD A;  4KPK A;  3R0O A;  4K29 A;  2J5I B;  3RST A;  2FW2 A;  2VSU F;  2EJ5 A;  3GF7 A;  2GTR A;  3QXI A; 
#chains in the Genus database with same CATH topology
 3KTI A;  1Y7O A;  4EMP A;  5C90 A;  3KTG A;  4J2U A;  4MXI A;  3LKE A;  4MOU A;  1W2X A;  3K50 A;  2WTB A;  2D3T A;  2HW5 A;  2W3P A;  5DTW A;  1WZ8 A;  4U0G H;  3T89 A;  3H81 A;  1RJN A;  1OD4 A;  3GLM A;  4JYJ A;  1N6E A;  3QK8 A;  4HDT A;  5E0S H;  1WDL A;  3QRE A;  3H0S A;  3RSI A;  4B3J A;  3V5I A;  4FJW D;  1ON9 A;  3BPP A;  5INF A;  3TT6 A;  3ZWB A;  3KTH A;  3PEA A;  3GF3 A;  4U1A A;  3IB9 A;  1VRG A;  3H0U A;  2A7S A;  3OC7 A;  2YJG A;  1FC7 A;  3R9T A;  4ZDC A;  5KJP A;  2F9I A;  4RYF A;  3BF0 A;  2J5I I;  4FZW A;  2VX2 A;  3H0J A;  3ZWC A;  4JCR A;  1DCI A;  3MOY A;  4QII A;  3HP0 A;  4ZU2 A;  1YG6 A;  1X0U A;  5JBW A;  3ZWA A;  3OME A;  4L8K A;  4JOT A;  3L3S A;  1UIY A;  3P2L A;  1N6F A;  5G1Q A;  1UYR A;  3M6N A;  1HNO A;  2ZQQ A;  3P5M A;  3TLF A;  3H0Q A;  4JYL A;  4F47 A;  1OD2 A;  4NAR A;  5DU8 A;  2F9Y A;  3PGQ A;  3U9S B;  4YLH A;  5DZK A;  1EF8 A;  3SWX A;  4JFC A;  2IEX A;  4LK5 A;  4JCS A;  2A81 A;  2QQ3 A;  4ELW A;  2F9I B;  4L6W A;  2VRE A;  2ZL4 A;  2VSU E;  4JCQ A;  2VSU C;  3DOR A;  5DU6 A;  4RCN A;  2CE3 A;  3HLN 1;  1K32 A;  3I47 A;  3KQF A;  4ZDE A;  5KDR A;  5IKL B;  3U9T B;  4ELS A;  4IZB A;  1XNV A;  4WYO B;  5FUS A;  5KDR B;  4U18 A;  3WG5 A;  3NJD A;  3HE2 A;  3Q1T A;  4RYF H;  4Z0M A;  5ING A;  4ZDD A;  3Q0J A;  1WDM A;  3TV5 A;  3Q0G A;  5INI A;  2ZL3 A;  4B3H A;  4NNQ A;  2F6I A;  1XNW A;  4JJT A;  1DUB A;  4U19 A;  1N6D A;  4WCZ A;  1WDK A;  4FN8 A;  3BEZ A;  4U0G A;  5G1R A;  2X58 A;  3TVW A;  2C8T A;  5DU4 A;  5DUC A;  1PIX A;  4I4Z A;  2Q35 A;  2FBM A;  1FC9 A;  2ZQR A;  5E0N X;  3T88 A;  3T3W A;  4HC8 A;  1XX4 A;  4FNB A;  2J5I A;  3G64 A;  2PG8 A;  3HRX A;  1HNU A;  3TDC A;  2F6Q A;  1PJH A;  2DUB A;  4IZC A;  4NEK A;  5FIF A;  2PBP A;  5DKP A;  3IAV A;  5CTB A;  2ZL0 A;  3ZW8 A;  3K8X A;  3STA A;  4EML A;  2NP9 A;  4G2R A;  3PE8 A;  4I42 A;  1XNY A;  1O8U A;  1YG8 A;  3FF6 A;  4QIJ A;  5MGB A;  4FZW C;  1SZO A;  4GM2 A;  2VSS F;  1UYT A;  5DTP A;  2FZS A;  1UYS A;  3ZW9 A;  2UZF A;  4KD6 A;  4ASI A;  1FCF A;  3QKA A;  1Q51 A;  1RJM A;  3JU1 A;  2J5G A;  4KWB A;  4Q1I A;  4ZDF A;  4OLQ A;  3PZK A;  1ON3 A;  1HZD A;  3SLL A;  2VSS A;  3QMJ A;  3T8A A;  3DJA A;  1TG6 A;  4U0H A;  5HUQ A;  3GKB A;  3NJB A;  1UYV A;  1FC6 A;  3BPT A;  3QXZ A;  3M6M A;  3KTK A;  4Q0G A;  4MI2 A;  1EY3 A;  1TYF A;  5G1S A;  2X24 A;  5CTC A;  1JXZ A;  3TVU A;  5DZK H;  3HIN A;  3ST9 A;  3GMA A;  3QYR A;  4JSB A;  4OG1 A;  1NZY A;  1MJ3 A;  4GHN A;  3MYB A;  3TRR A;  1K39 A;  4B3I A;  1EF9 A;  5DL1 A;  3MFM A;  4HNK A;  4FN7 A;  2Q34 A;  2BZR A;  1Q52 A;  4JCT A;  3TT7 A;  2J5G D;  3VIV A;  3ISA A;  3P85 A;  4EMM A;  3R6H A;  3V5E A;  2J5S A;  1XO6 A;  3R9Q A;  3LAO A;  4FND A;  3N6R B;  3U9R B;  4WZ8 B;  4K2N A;  4ZDB A;  3KTJ A;  1SG4 A;  3RRV A;  4KNP A;  3Q7H A;  3MT6 A;  2PPY A;  3OT6 A;  4JWV A;  2A7K A;  4JVT A;  4ELX A;  5JBX A;  4FB8 A;  2VSU A;  4K3W A;  3T8B A;  2DEO A;  4DI1 A;  3TZ3 A;  1NZY B;  5C9G A;  4OMR A;  2F9Y B;  2VSS E;  5E0S A;  5DUF A;  3QWD A;  3H02 A;  2CBY A;  1J7X A;  2Q2X A;  2ZL2 A;  3IBB A;  3R9S A;  4I52 A;  4QFE A;  3FDU A;  4IZD A;  4KPK A;  3R0O A;  4K29 A;  2J5I B;  3RST A;  2FW2 A;  2VSU F;  2EJ5 A;  3GF7 A;  2GTR A;  3QXI A; 
#chains in the Genus database with same CATH homology
 3KTI A;  1Y7O A;  4EMP A;  5C90 A;  3KTG A;  4J2U A;  4MXI A;  3LKE A;  4MOU A;  1W2X A;  3K50 A;  2WTB A;  2D3T A;  2HW5 A;  2W3P A;  5DTW A;  1WZ8 A;  4U0G H;  3T89 A;  3H81 A;  1RJN A;  1OD4 A;  3GLM A;  4JYJ A;  1N6E A;  3QK8 A;  4HDT A;  5E0S H;  1WDL A;  3QRE A;  3H0S A;  3RSI A;  4B3J A;  3V5I A;  4FJW D;  1ON9 A;  3BPP A;  5INF A;  3TT6 A;  3ZWB A;  3KTH A;  3PEA A;  3GF3 A;  4U1A A;  3IB9 A;  1VRG A;  3H0U A;  2A7S A;  3OC7 A;  2YJG A;  1FC7 A;  3R9T A;  4ZDC A;  5KJP A;  2F9I A;  4RYF A;  3BF0 A;  2J5I I;  4FZW A;  2VX2 A;  3H0J A;  3ZWC A;  4JCR A;  1DCI A;  3MOY A;  4QII A;  3HP0 A;  4ZU2 A;  1YG6 A;  1X0U A;  5JBW A;  3ZWA A;  3OME A;  4L8K A;  4JOT A;  3L3S A;  1UIY A;  3P2L A;  1N6F A;  5G1Q A;  1UYR A;  3M6N A;  1HNO A;  2ZQQ A;  3P5M A;  3TLF A;  3H0Q A;  4JYL A;  4F47 A;  1OD2 A;  4NAR A;  5DU8 A;  2F9Y A;  3PGQ A;  3U9S B;  4YLH A;  5DZK A;  1EF8 A;  3SWX A;  4JFC A;  2IEX A;  4LK5 A;  4JCS A;  2A81 A;  2QQ3 A;  4ELW A;  2F9I B;  4L6W A;  2VRE A;  2ZL4 A;  2VSU E;  4JCQ A;  2VSU C;  3DOR A;  5DU6 A;  4RCN A;  2CE3 A;  3HLN 1;  1K32 A;  3I47 A;  3KQF A;  4ZDE A;  5KDR A;  5IKL B;  3U9T B;  4ELS A;  4IZB A;  1XNV A;  4WYO B;  5FUS A;  5KDR B;  4U18 A;  3WG5 A;  3NJD A;  3HE2 A;  3Q1T A;  4RYF H;  4Z0M A;  5ING A;  4ZDD A;  3Q0J A;  1WDM A;  3TV5 A;  3Q0G A;  5INI A;  2ZL3 A;  4B3H A;  4NNQ A;  2F6I A;  1XNW A;  4JJT A;  1DUB A;  4U19 A;  1N6D A;  4WCZ A;  1WDK A;  4FN8 A;  3BEZ A;  4U0G A;  5G1R A;  2X58 A;  3TVW A;  2C8T A;  5DU4 A;  5DUC A;  1PIX A;  4I4Z A;  2Q35 A;  2FBM A;  1FC9 A;  2ZQR A;  5E0N X;  3T88 A;  3T3W A;  4HC8 A;  1XX4 A;  4FNB A;  2J5I A;  3G64 A;  2PG8 A;  3HRX A;  1HNU A;  3TDC A;  2F6Q A;  1PJH A;  2DUB A;  4IZC A;  4NEK A;  5FIF A;  2PBP A;  5DKP A;  3IAV A;  5CTB A;  2ZL0 A;  3ZW8 A;  3K8X A;  3STA A;  4EML A;  2NP9 A;  4G2R A;  3PE8 A;  4I42 A;  1XNY A;  1O8U A;  1YG8 A;  3FF6 A;  4QIJ A;  5MGB A;  4FZW C;  1SZO A;  4GM2 A;  2VSS F;  1UYT A;  5DTP A;  2FZS A;  1UYS A;  3ZW9 A;  2UZF A;  4KD6 A;  4ASI A;  1FCF A;  3QKA A;  1Q51 A;  1RJM A;  3JU1 A;  2J5G A;  4KWB A;  4Q1I A;  4ZDF A;  4OLQ A;  3PZK A;  1ON3 A;  1HZD A;  3SLL A;  2VSS A;  3QMJ A;  3T8A A;  3DJA A;  1TG6 A;  4U0H A;  5HUQ A;  3GKB A;  3NJB A;  1UYV A;  1FC6 A;  3BPT A;  3QXZ A;  3M6M A;  3KTK A;  4Q0G A;  4MI2 A;  1EY3 A;  1TYF A;  5G1S A;  2X24 A;  5CTC A;  1JXZ A;  3TVU A;  5DZK H;  3HIN A;  3ST9 A;  3GMA A;  3QYR A;  4JSB A;  4OG1 A;  1NZY A;  1MJ3 A;  4GHN A;  3MYB A;  3TRR A;  1K39 A;  4B3I A;  1EF9 A;  5DL1 A;  3MFM A;  4HNK A;  4FN7 A;  2Q34 A;  2BZR A;  1Q52 A;  4JCT A;  3TT7 A;  2J5G D;  3VIV A;  3ISA A;  3P85 A;  4EMM A;  3R6H A;  3V5E A;  2J5S A;  1XO6 A;  3R9Q A;  3LAO A;  4FND A;  3N6R B;  3U9R B;  4WZ8 B;  4K2N A;  4ZDB A;  3KTJ A;  1SG4 A;  3RRV A;  4KNP A;  3Q7H A;  3MT6 A;  2PPY A;  3OT6 A;  4JWV A;  2A7K A;  4JVT A;  4ELX A;  5JBX A;  4FB8 A;  2VSU A;  4K3W A;  3T8B A;  2DEO A;  4DI1 A;  3TZ3 A;  1NZY B;  5C9G A;  4OMR A;  2F9Y B;  2VSS E;  5E0S A;  5DUF A;  3QWD A;  3H02 A;  2CBY A;  1J7X A;  2Q2X A;  2ZL2 A;  3IBB A;  3R9S A;  4I52 A;  4QFE A;  3FDU A;  4IZD A;  4KPK A;  3R0O A;  4K29 A;  2J5I B;  3RST A;  2FW2 A;  2VSU F;  2EJ5 A;  3GF7 A;  2GTR A;  3QXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...