2J5OA

Pseudomonas aeruginosa ftsk gamma domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
72
structure length
72
Chain Sequence
b'GSEGSEDDPLYDEAVRFVTESRRASISAVQRKLKIGYNRAARMIEAMEMAGVVTPMNTNGSREVIAPAPVRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA TRANSLOCASE FTSK
publication title The Ftsk Gamma Domain Directs Oriented DNA Translocation by Interacting with Kops.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Recombination
total genus 14
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09397 FtsK_gamma Ftsk gamma domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2j5oA01
1LEAA 1WQ2A 1IF1A 5ILUA 4PDKA 1ZH5A 1I6XA 3F22A 2LDUA 4HX4A 5F6FA 1ZG5A 3E5UA 4HAMA 3ECHA 3I53A 4Q5SF 2IT0A 3GZ5A 2PJPA 3EETA 4M9ZA 1ZARA 3LA2A 3QP6A 3GO5A 5H6QA 4RB1A 1YW9A 4M72A 1RNLA 5L3CA 2BEOA 2CG4A 3GVAA 2Z9OA 3P7NA 2D2WA 4CYDA 1AOYA 5HLGA 1IRGA 1BBYA 2Z3YA 2RQPA 1SMYF 3K1PA 2VONA 3JSOA 2DAOA 2RV8A 4KIBA 3L2CA 4JK1X 3RDIA 2KKOA 4O5VA 2XAFA 5LRSA 2PI0A 5D8LB 1J75A 1TNTA 2DLLA 2O3FA 1TW3A 4CICA 4WXDA 3LSTA 5D5UB 1W7PA 3B73A 1KA8A 4KN4X 4EJTA 1MDMB 3D5LA 1F4KA 2GWRA 2H09A 1S7OA 2PLYA 1Z7UA 4ON0A 3HHGA 2W85A 1D8KA 1STZA 2O03A 1L3LA 3RJPA 5A2QZ 1U2WA 2H94A 3FM3A 1LVAA 2FBHA 2QQBA 3GFLA 4GXOA 4XRFA 1LB2A 2H6CA 2XASA 3SQNA 2ADUA 1FBUA 3G73A 1OYYA 4GGGA 1WRJA 2HWVA 2RKHA 1P4XA 2DK8A 3SZTA 2EFPA 4OMYA 2OZUA 5FO5A 1IUYA 2QQAA 2VC0A 1JHHA 4U7BA 4BHPA 1BC7C 4XLNF 1T2KA 1IXSB 2VE9A 1Z91A 2F2EA 2DK5A 3KP3A 3U1DA 2BGCA 1W7PB 1TBXA 4ASNA 3TKYA 1SMTA 2XAJA 1MZBA 4TV7A 3TGNA 2BBYA 2FU4A 2FBKA 1I1GA 2QWWA 1R1VA 1IN4A 3BJOA 2Q2EA 2VBXA 3TDZC 4E70A 4L0YB 1DPRA 2QQ9A 5F64A 2ZCWA 5BOXA 4BHCA 3VEPA 3F23A 1MJ9A 1MD0A 1YS7A 4YIFA 5LHIA 1G6NA 2UZKA 4GCVA 4IPAA 1RUNA 1KQ9A 3CUQB 5L3EA 1P4AA 4L9TA 3HYIA 1BJAA 2VOPA 2OAZA 2VBWA 3I5UA 2XRNA 1XGOA 2ZJ2A 1O57A 1BN5A 3ULQB 1ON2A 1S3JA 3MCZA 2GXBA 1IXCA 1T0FA 3HHHA 1JXSA 4XSXF 5L3BA 2GQQA 5DCMA 1MJAA 1DDNA 1USTA 3LQQA 4EM1A 1ONVA 3RIRA 1J5YA 5E1ZB 1IAWA 2WWYA 4KFCA 1FT9A 2P4WA 4LLNA 3I71A 5CVIA 3JTGA 2GAUA 3DXJF 3R0AA 5D8KB 1IN8A 3E6MA 3BWGA 2V1UA 3OOPA 2IRFG 5D6FA 3R6SA 3FXUA 2DQLA 4L9JA 3RKXA 2RGVA 3GX4X 2EK5A 4HF2A 3CUQC 3B02A 4EJUA 1XSXA 1IN5A 1SFUA 1V3FA 1A04A 2ZKZA 2E7WA 2HDCA 2STWA 1FYKA 2VOOA 5IT9Z 2QZ8A 3LFKA 1KQ8A 3PQJA 2ZMEA 1HW1A 2ELHA 2ZXJA 4CHUA 5LHGA 3GXOA 3WTTC 2R7FA 3QRFF 4MNUA 3KP6A 2LF8A 2EA2A 3ZPLA 3E97A 1YG2A 3M7GA 2J5PA 2FOKA 1FYMA 3COAC 2MLGA 2P8TA 1I1SA 2QYOA 1GVJA 3WODF 3GLXA 1QBJA 5LGNA 5EEGA 4OIRF 2COMA 4YFNF 2EV5A 4MTDA 3WTWC 2P6TA 4DNCA 5HS8A 4IRGA 1QGPA 1D3YA 3DV8A 2MLKA 5CLSA 3WGIA 3R61A 3F8MA 3PQKA 2HYFA 2B0LA 1T98A 3BP8A 3EYIA 2K4JA 4MGRA 2VE8A 4ZYHA 3IKTA 2PQ8A 4DQ2A 4U0VA 2FE3A 2W24A 5FD6A 2L3DA 4HYEA 3P9CA 4OIQF 4BNCA 4LG0A 2KIUA 5JR3A 2O6GE 2EB7A 1QZZA 2FRHA 1ZLKA 3FF5A 2ACJA 1UB9A 3WTYC 2GZWA 2W57A 4RAZA 3VODA 1KU9A 4ZYGA 1YFHA 1XGSA 1G3YA 2PMHA 5DDGA 1J2XA 4RB3C 3K1MA 5L3FA 2VBZA 2GA1A 3MZYA 2DQRA 2XAGA 1SD5A 3V7CA 4WF2A 3J81K 4R1HA 4NHJA 1QPMA 1DUXC 3LWFA 2OBPA 4H0EA 2HYGD 4CDGA 1G4DA 3GUDA 1R5HA 2XUBA 3DF8A 2A6HF 4ESJA 5HVQC 2G7UA 1GHCA 2V79A 3F8NA 4OIOF 4LG0B 4IHSA 1REPC 1WWXA 1E2XA 3ELKA 1BI3A 2QBYA 1XSVA 2YR2A 1TLHB 4CZZA 2D1HA 4Y13A 5HDNA 5BQTA 3TOAA 1KQ0A 4MTEA 1KGSA 3H3ZA 3RYRA 2FXAA 4YFKF 4IVNA 5DUKA 2D1VA 4UVAA 2UXNA 2IJLA 4BYYA 5CJ9A 2NNYA 4KIGA 5J8FA 1G3TA 1U6GA 3KEQA 3CDHA 4GYIA 1QQIA 5LBQA 5LHHA 2Z99A 4D0PA 4A0XA 2OU2A 3KETA 4YIIA 4EVIA 3O3KA 5D5VB 4I09A 1LDDA 4L5JA 4IRHA 4G9YA 3DQVC 1UFMA 3FXRA 4A6DA 4BXUA 1P92A 3I59A 3V7SA 3J80Z 3F8BA 3K0LA 4KMFA 3GEZA 4EQQA 1FNNA 1FWZA 2EFOA 1EH6A 4KYWA 1QZYA 5HDGA 2W84A 2IA0A 1B6AA 1WKMA 3BPVA 2D45A 2K7LA 4XSZF 1HW2A 3BY6A 5FLXK 1FLIA 4ZZDA 3I64A 1RZ4A 5FB2A 2VN2A 2Y0MA 3EUHA 5D5WB 5DUIA 3KZZA 1AWCA 3V8KA 1O3TA 3CO7C 2RNJA 3EDPA 5E1WA 1Y0UA 4RGRA 5DYMA 1HXDA 1U5TA 3T0YA 2V9VA 4KN7X 1HBXG 4WWCA 2P5KA 5LEKA 2M8EA 1HSJA 3HRSA 2FQ3A 4HZFA 4KICA 2EFNA 2X0LA 3WTZA 4F7ZA 5TJJA 2EWNA 1JGSA 1XMAA 1J59A 2KJCA 4I02A 4ZH4F 2EFWA 5K1YA 4KMUX 4XBFA 1QO0D 1OYWA 1TW2A 2JPCA 1IN6A 2F5DA 4L5IA 3I4PA 3FM5A 1IW7F 1ZAOA 2A68F 1KU2A 2PFBA 3JAMK 2Z5UA 4N0BA 5DD8A 2K27A 1B9MA 3NEUA 2NYXA 1XGNA 2F5EA 2ZO4A 4BAYA 1Z9CA 1YLFA 5AIPA 1K7AA 1S6LA 3RI4A 2DU9A 3JW4A 5L3GA 4RGUA 5DEQA 5CVUA 2QM3A 2Z33A 3R0JA 4U0WA 3MQ0A 4A12A 5IT3A 1LQ1A 2DPUA 2DFIA 3JSPA 4ESFA 3TO6A 2XAQA 1CF7A 1H9GA 3IC7A 1T39A 3HRUA 5F1RA 1R58A 1QNTA 1MJBA 4ZZLA 1WSUA 2RDPA 3E6BA 1PDNC 4ZYDA 4HX8A 1I27A 5CYVA 3C7JA 1LEBA 1YS6A 3GWZA 1ZG3A 2RC4A 4IHTA 2QENA 4BQAA 1XD7A 1GXPA 2OQRA 3W6KB 5LEJA 3K1NA 3ZMZA 2A3SA 5ERIA 2EV0A 1P2FA 3IRRA 4QLCU 2M45A 3E3VA 5H20A 1L0OC 1O3RA 2FNAA 4LK1F 1FP2A 3V4GA 4B8XA 1ZLJA 4AIJA 2YX4A 4HA8A 1KYWA 3O6BB 4O3MA 2XV4S 3BPXA 1U8RA 5BPIA 5D6EA 1IRFA 2HQNA 3C3WA 4GYGA 1IN7A 3KLNA 1ZRFA 4L9VA 4LB5A 1O7FA 2HKXA 1F5TA 3D0SA 1YQAA 2JPBA 5TRDA 2QLZA 2XGXA 2VC1A 4GO1A 1R7JA 5LGUA 4AIKA 3T5XA 3F8FA 3M8EA 3VB2A 4HOBA 3F72A 4UVCA 2DBBA 3FX3A 3TO7A 1K78A 2HZTA 5DV5A 4WXCA 4LGWA 1J7KA 1W5SA 2VT3A 2KJBA 2CGPA 3JTHA 3RKWA 2IPQX 3IWFA 2YX7A 4P5OA 3PFIA 4WCGA 4UNOA 2LF7A 1FSEA 4UUVA 3LA7A 3REOA 2PN6A 4LK0F 2HFHA 1HKQA 1HSTA 2A69F 2JRTA 5DCMB 2ZNZA 2CWEA 1VTNC 5K5QA 2VODA 3KP7A 2CYYA 4P9UA 2R3SA 3E5QA 1UHMA 4FX0A 4R8HA 1J0RA 1KYZA 3L09A 4S04A 2BYVE 3WU0A 3MFKA 1T38A 3Q9SA 4N9IA 1R1TA 2ISZA 1B59A 4RAYA 5DCFA 4IRIA 1F1ZA 2NNNA 2KIFA 3BROA 4LLGF 1R23A 1YIOA 2KIMA 3F8CA 4WX9A 2ZBKA 1ZHFA 4WXHA 2ESHA 4LFUA 4AIHA 3IHUA 4MQ9F 1SD7A 1O3SA 2P5LC 5LLQA 1XCBA 4KNYA 4ENKA 1OR7A 1U78A 3WTVC 1ZGAA 5EEHA 4L9NA 4P9FA 4A0ZA 4B09A 5ICEA 4HBLA 4Z2YA 2XIGA 1G3WA 2YSRA 3SFZA 3CO6C 2FBIA 4KUMA 3I0TA 4LLLA 3FMRA 4CO8A 4MHGA 2ZMEB 2VXZA 4EM2A 1TQIA 4PGGA 2Y48A 2PG4A 3DP7A 5ICGA 2MBFA 1OPCA 3GF2A 2IW5A 4HQMA 5FGMA 2M87A 4I01A 4ETSA 3SZPA 3ROUA 2XHKA 1R22A 1HW5A 3F21A 1Q1HA 3NRVA 3K2ZA 4RGXA 4AWXB 2EV6A 3MZHA 3MWMA 2P7CB 2PEXA 1UCRA 3ABTA 3L9FA 1PP8F 3WGHA 3J80K 1Z1DA 3HSRA 5K5RA 5HS9A 4LMYA 4EV0A 4ENMA 1JE8A 3V8LA 1ZGJA 3ZN0A 3CUOA 1XB4A 5AIQA 1YO5C 3IWZA 3O2PE 3E6CC 3FZVA 4HF1A 4FT8A 3ECOA 1PP7U 4KDPA 4QWQA 1YW8A 1ZG1A 4OMZA 2PMUA 4A0YA 2HOEA 3TDUC 1S8NA 4IJAA 4PGHA 2L01A 3W6JB 2WV0A 3V8JA 2IP2A 3ERED 2L4MA 3KCCA 1SD6A 4Y15A 3TQNA 3RYPA 3U2RA 1BIBA 2LNBA 1CGPA 3HOSA 3IRQA 4I2OA 1XGMA 5LGTA 2F5CA 3FHZA 2K4BA 2DI3A 2Y75A 4L0ZB 3KLOA 3BDDA 5HDKA 2XVCA 2GA2A 5K5OA 3FWEA 2G7HA 3WE2A 3WG9A 3R60A 5A2QK 1B9NA 4WK8F 1P6RA 3VFZA 3NQOA 2V6CA 2KRFA 1B4AA 5CVVA 1HQCA 1WI9A 3S2WA 4PCQA 3QU6A 4EJWA 1HKTA 2IA2A 1FP1D 3C1DA 2O0YA 4EM0B 3MAJA 2JTVA 2J5OA 4XLPF 3K69A 3GFIA 2QBYB 3ML6A 1SFXA 2H6BA 1BIAA 4A5NA 3P9IA 4M74A 1MDMA 4EMSA 4M6XA 5DD4A 1FX7A 2HR3A 5ICFA 1KU7A 3RPUA 4RGSA 3AAFA 1USSA 3L7WA 5H6RA 4Q47A 5E17F 1B1BA 3BJAA 1ZREA 3J81Z 4MEXF 4IXAA 2XKOA 3OV8A 1ZYRF 4I7HA 2V1DA 3DPLC 3CTAA 3KFWX 1D5VA 3KEOA 3HIFA 3BZ6A 2ZNYA 2X4HA 5ICCA 1Z05A 5ED4A 1BC8C 1MKMA 3LQRA 3I59B 3F6VA 1ZRDA 5HLIA 3QP5A 4CXFA 3M1EA 3RTRA 1FBSA 2VBYA 1V4RA 3QOPA 1BI0A 2HS5A 3FMSA 4AVPA 2PBIA 3HSEA 1FYLA 3WGGA 3HSFA 3T8RA 1XDUA 1ON1A 3TOBA 1BM9A 2E1CA 2M5WA 2QUFA 3IKVA 2DW4A 1FC3A 3WTXC 2A6EF 3HRMA 4HV6A 4G6DA 5E20A 1TNSA 2MA3A 3CLOA 1XCVA 2GXGA 1W7PD 2MH9A 1U5TB 2QVOA 4LD5A 2OA4A 3HUGA 4BH9A 2P6SA 3K9TA 4HW0A 3WU1B 5JVTA 2G9WA 1XSDA 4ENNA 3WTUC 3CUQA 4HF0A 1FBQA 2ZFWA 3EYYA 2CW0F 5LRRA 3HRTA 2DT5A 3FXQA 3HTSB 2JT1A 5D4SA 2K86A 3ABUA 4Y17A 4HDVA 1F9NA 2IA1A 2Q0OA 3ZMSA 4A2UA 5FLXZ 4G6QA 2AXLA 5JFRA 2OD5A 3LAJA 5JHUA 1C0WA 4A6EA 4G7HF 2ISYA 3I54A 3GW2A 5IT9K 2BE5F 4I0BA 5E8IA 5FD5A 1TQPA 2UXXA 1JHFA 3IL2A 3T8TA 1T6SA 1Z6RA 2YU3A 1SFEA 4R79A 4Q48A 2IVMA 4K2EA 3BOQA 1EV7A 4NQWA 3VOEA 4BHBA 4G94A 2WC2A 2CSOA 4ZYEA 2MC3A 3FMQA 1OYIA 4FX4A 1CF7B 1U5TC 4PZJA 3SXYA 2E1NA 1LNWA 1W5TA 2E7XA 4EJVA 1FY7A 5E8GA 3F3XA 4CGZA 1E17A 4ESBA 2HKOA 3L00A 3ZMVA 1DP7P 2R7DA 1LDJA 4UV8A 3QAHA 1J9IA 1BOAA 1XMKA 2O61A 1S29A 2A07F 2P5VA 3JAMZ 4EJOA 2MH2A 3Q5FA 4YG2F 3WTSC 4UVBA 4HX7A 1TQMA 4JQFA 3ZQ7A 2NRAC 1U3EM 1OMIA 5FFZA 3E6DA 1RUOA 2C6YA 2BV6A 5E1XA 1RIOH 4OU0A 3P9KA 1I5ZA 3U9GA 3N97A 4M9SA 2M30A 2AS5F 3WE3A 2M1BA 4NB5A 3TO9A 3V7RA 4G7OF 4IF4A 2FA5A 2DO7A 1R1UA 4P55A 4AD9A 3EQLF 4UV9A 5JI6A 4M6YA 1KU3A 2FMLA 2A5YB 2H27A 5FFXA 3DPTA 3GYHX 2A61A 3ZMTA 3KP4A 5L3DA 2YPRA 1TTYA 1YYVA 1ZRCA 1K78B 5BS6A 2FF4A 2HGCA 1W4MA 4LB6B 5D4RA 4KA4A 1EH8A 4OOIA 3E5XA 2RN7A 4YFXF 5AONA 1YW7A 1R00A 1G3SA 5J8CA 3KE2A 2NAZA 2LKPA 3HOTA 4U88A 1Z6TA 4RB0A 2P7VB 1O3QA 4L18B 3H3UA 3J7AO 1R36A 2EA4A 1BI1A 4M71A 1S7AA 2OQGA 2HTSA 1HKSA 4OINF 4HLXA 1DPUA 1OKRA 5HOOA 1FPQA 3QPHA 6PAXA 4LJZF 1ZN2A 1ULYA 3GFMA 4I0AA 4JBAA 2VT2A 3DKWA 4G7ZF 3MEXA 1FOKA 1D8JA 3ZP5A 1FSHA 2WTEA 4KIFA 3RKYA 4RS8A 4EGYA 3C18A 3R4KA 3Q9VA 4G8XA 3ZN1A 3DFGA 1UHWA 3T1BA 2FNPA 2HQRA 5HS7A 5HLHA 1ODDA 2Q8KA 2V1XA 3M9AA 4A5MA 4ENJA 3CJNA 2HEOA 1IZ1A 2W25A 2DPDA 3ZMUA 2TDXA 1PUEE 2UWMA 4M73A 3ISPA 2L54A 3BJ6A 1EH7A 4HDUA 1H0MA 2K02A 4UHTA 3I58A 2FMYA 2DTRA 3F6OA 1P4WA 3DEUA 3GFJA 1R5GA 3SHFA 4FHTA 2O8XA 1SAXA 1XN7A 2JZYA 2FEZA 4MEYF 4Q4ZF 1LJ9A 3N4MA 4KT5C 1SD4A 3ZMDA 3M8FA 5KK1A 3QPTA 2L02A 5CVRA 2XROA 1X3UA 2EJRA 2MD5A 2ETHA 2NS0A 5BPDA 4MQVA 2FSWA 2CO5A 2OZ6A 4RB2C 2GIVA 4N9HA 1LDKB 1IXRC 1K79A 3G3ZA 1YTYA 5KVRA 2CQKA 5ILVA 4HLYA 1GXQA 4I98B 4O6JA 1XDSA 5E18F 2F5FA 4EGZA 1MGTA 2XKPA 3KP5A 2LSOA 4UXNA 5ILSA 2HTJA 4S05A 1NHAA 3LA3A 2CFXA 4OIPF 5J6XA 2JSCA 3H92A 2STTA 3GZ6A 1H9TA 4U0YA 2RVCA 5D5XB 2ESNA 5BMZA 1BI2A 2EFQA 4U7DA 4M9XA 3LAPA 4HV5A 1K6OA 3RPQA 3KP2A 2L4AA 1O7LA 4HQEA 2XAHA 3HTUA 3QU3A 1RI7A 1FZPB 5CVJA 4P96A 3KZYA
chains in the Genus database with same CATH superfamily
1X4PA 1BR2A 1LEAA 2KHMA 1WQ2A 4B48A 1K83J 1YJNI 1IF1A 4DZPA 5ILUA 4BE0A 1WPKA 3HOVJ 4PDKA 2WY7Q 1ZH5A 1VQKI 2XPUA 1I6XA 3F22A 2ELKA 2LDUA 3NWTA 4HX4A 2VJJA 5F6FA 1ZG5A 3E5UA 4HAMA 3OYLA 5F0HA 1ETVA 2DMNA 2CMPA 4BE1A 2VQGA 3ECHA 1LE8A 2X1EA 5IP9J 3I53A 3DTIA 4AIDA 4Q5SF 4UUTA 2IT0A 3M3YJ 3QWLA 3GZ5A 2BXYA 2PJPA 2G0EA 3EETA 4ANJA 4M9ZA 2V4JC 1ZARA 4BQNA 4RA2A 1NK2P 2JVHA 3LA2A 3QP6A 4HEA2 3GO5A 2TCTA 5H6QA 4RB1A 3IH2A 1YW9A 3IUOA 2F5VA 4M72A 1RNLA 2JN6A 3BR0A 5L3CA 2KRCA 2BEOA 2CG4A 3DCFA 4I99C 1Y0NA 3GVAA 2Z9OA 3HZJA 3P7NA 1A6QA 2D2WA 3QOEA 2Y69H 3ERMA 4CYDA 1AOYA 5HLGA 2DJNA 3AFHA 2M8GX 4FE7A 1IRGA 1BBYA 1JUMA 2M9HA 1IRXA 2Z3YA 1RKWA 2RQPA 1SMYF 3JR9A 1S7EA 3L2WA 3K1PA 2VONA 1GLNA 3JSOA 2BW3A 2DAOA 2PMZN 2RV8A 5DS9A 1PVEA 4KIBA 2GXAA 3MN2A 3L2CA 3W2AA 3HOWJ 5EZGA 2EZIA 2NXNB 4JK1X 3RDIA 2KKOA 3DTKA 4O5VA 5J4VA 2JA7J 2XAFA 2KIQA 2IAIA 5LRSA 2PI0A 5D8LB 3ZRGA 1J75A 2JWTA 1TNTA 2DLLA 3E1SA 4A3FJ 3CC7I 1GT0C 2XGEA 2O3FA 1TW3A 4CICA 4CCJA 1VQ5I 4WXDA 3LSTA 2FD5A 5D5UB 1W7PA 3B73A 3OYIA 3F0CA 3K4BA 1KA8A 1OCOH 4KN4X 4EJTA 3FISA 1XS9A 1MDMB 2K85A 2KISA 3Q0VA 2X51A 3D5LA 4NC7A 1F4KA 1NTCA 2GWRA 2H09A 1S7OA 3G6EI 2PLYA 1Z7UA 3CZ6A 4ON0A 2EQRA 1WCMJ 3HHGA 2E35A 2W85A 1D8KA 3ZR8X 1STZA 2OF7A 3CCMI 2LY1A 2KP6A 1Y56A 5B1BH 1OQYA 1CQTA 2O03A 3CCSI 1L3LA 3RJPA 5A2QZ 1U2WA 2H94A 3FM3A 1LVAA 2XDVA 2FBHA 2LOOA 3BC8A 4JOMA 1X2NA 1SANA 3BR2A 1HCRA 3JREA 3PSIA 1IC8A 2QQBA 3GFLA 4GXOA 4XN0A 4XRFA 1LB2A 3H1CA 2H6CA 2KQRA 2XASA 3OOUA 3SZGA 4C3JJ 3SQNA 2ADUA 1FBUA 4KT6A 1MH3A 1OYYA 2AHQA 3I3LA 3G73A 3S3MA 4GGGA 1MMAA 2WB1A 1WRJA 2HWVA 5IP7J 1FTTA 4XRSA 2IGNA 2RKHA 2OTLI 3H35A 1P4XA 3GCMA 2DK8A 2ZC2A 4CCMA 3KYCB 3SZTA 4IHXA 2DOEA 2EFPA 4OMYA 1J09A 2OZUA 4DIQA 5F1JA 2PX9A 3BZCA 5FO5A 1IUYA 2QQAA 2XGCA 3H0GJ 2VC0A 1JHHA 4U7BA 4XLEA 4BHPA 1BC7C 4XLNF 1T2KA 1IXSB 5EDNA 3HKZA 1X1PA 2R7SA 2VE9A 4PSXA 4E7HA 1Z91A 1SFKA 2F2EA 4C3IJ 3AL0B 2DK5A 3KP3A 3U1DA 3GLLA 2BGCA 1TZLA 1W7PB 3ZGKA 1VFCA 4UB8C 4XLCA 4F3QA 1TBXA 2R7ZJ 4ASNA 1MSFC 2YUSA 3CDLA 3O8GA 3TKYA 2PJRB 1XX5A 1SMTA 2XAJA 1MZBA 4TV7A 3TGNA 2GBYA 2I5UA 2BBYA 2FU4A 2FBKA 4IHYA 2VJIA 2KDZA 1VZ0A 2MFZA 3ZXSA 1I1GA 2QWWA 1ORKA 1R1VA 1IN4A 3BJOA 2Q2EA 2VBXA 1WJDA 1X19A 3TDZC 4E70A 4Y4RA 4L0YB 4UUSA 2JQ7A 1DPRA 1WJBA 4C2TA 2CV0A 1MBEA 3PUBA 3PNVA 2R7RA 2QQ9A 4B4CA 3FKIJ 2P81A 3HUGB 4DW6A 1WJFA 5F64A 2UUZA 2ZCWA 2DMQA 5BOXA 2CQNA 4BHCA 3BR3A 3VEPA 4A93J 1MMNA 3F23A 1MJ9A 1MD0A 1YS7A 4F55A 2DOFA 5K7ZA 1NG6A 5EEAA 4YIFA 3IV5A 3D5RC 5LHIA 1G6NA 1TWFJ 2UZKA 4GCVA 4IPAA 1RUNA 3DBHB 1KQ9A 3PUFA 3RZOJ 3BCAA 1DGRM 1Z67A 1P7JA 4XIDA 4XOPA 1E0EA 1G8XA 3CUQB 5L3EA 1P4AA 1FMWA 2X1DA 4L9TA 3HC7A 3HYIA 2W4SA 1OCPA 4BQOA 1OCRH 5GTIC 3QQAA 1BJAA 2VOPA 1UG2A 2DMUA 2OAZA 1NG7A 2VBWA 3I5UA 1UELB 1QVUA 2Y30A 2XRNA 2KRHA 1XGOA 3ESWB 2ZJ2A 1O57A 3CLQA 3CJQB 2PMZA 3I4NJ 1BN5A 3ZQQA 3ULQB 1Y8RB 2K3PA 4BJTA 3LNQA 2O5RA 1ON2A 1S3JA 3VWBA 3MCZA 3AL0C 3ZQIA 5DM6F 1IXCA 2GXBA 1T0FA 2X6OA 3HHHA 1JXSA 1RETA 4XSXF 1MNEA 4BS9A 5L3BA 2GQQA 4F91B 5DCMA 1MJAA 1DDNA 4BBRJ 2NVXJ 1USTA 2OCEA 2LKSA 1EA3A 3LQQA 4EM1A 1ONVA 4AVZA 3RIRA 1TWGJ 1J5YA 4UUSB 5E1ZB 4IOAF 2EZHA 2E2JJ 1IAWA 2B7EA 1WJCA 2WWYA 4KFCA 1D1CA 4W1UA 1FT9A 4NQWB 2P4WA 1OISA 4LLNA 3I71A 5M5YJ 3MKWB 3BG5A 5CVIA 3EPZA 3TW6A 1N77A 2HDWA 3JTGA 2MC4A 1JKQC 2GAUA 3DXJF 1GUUA 3R0AA 4ABZA 1Y1VJ 2HZDA 5D8KB 1IN8A 3DPUA 3BG7A 3BWGA 3E6MA 4P1WA 2V1UA 3OOPA 2IRFG 1BA5A 4CCOA 2R7WA 5D6FA 3BQYA 2YS9A 3R6SA 4KJZA 2HPMA 2VJ5A 1POGA 2ID3A 1VNDA 2DQLA 2R7OA 3FXUA 1B72B 3CC2I 3WHBA 4L9JA 1YJ9I 4FQGA 1BW6A 3RKXA 1SFOJ 3FBIB 2MD0A 2ZXIA 1O4XA 2P0WA 1PUFB 2RGVA 2RAEA 2DA4A 2IGOA 4I6ZA 3GX4X 2EK5A 4HF2A 5HNFA 4IX7A 3CUQC 3B02A 4EJUA 1XSXA 2YU9J 2XAUA 4DGWB 1IN5A 2HQAA 1V3FA 1A04A 3VDXA 1SFUA 1TWHJ 3OYDA 2ELJA 2LC2A 2E7WA 2ZKZA 2HDCA 2VXDA 3OMYA 2STWA 4JX4A 1FYKA 2E36A 3CC4I 2VOOA 5IT9Z 2QZ8A 2FQ4A 1MMGA 2V1NA 4E7IA 1R5ID 3LFKA 2M4KA 1KQ8A 3MKYB 3PQJA 5M3FJ 3VYSB 2ZMEA 4Y52J 1HW1A 2ELHA 1UG0A 2ZXJA 2Z2SB 4CHUA 2EILH 5LHGA 3GXOA 1X1CA 2R7XA 2DDAA 1RR8C 3WTTC 1TT0A 2K9MA 3CCLI 4FETA 2ICWG 2R7FA 2V9KA 3QRFF 3FBNB 4MNUA 3KP6A 1YHQI 2LF8A 2EA2A 4PJ0C 3ZPLA 4NNJA 3E97A 3GZNB 2FOWA 2UV1A 2X1CA 4DYCA 4N4NB 2BY1A 3LL7A 2XSJC 1QA6A 3J7AY 5E3OA 1YG2A 3PO2J 3M7GA 3S8PA 3CJRB 2W82A 2K9LA 4S0HB 4N4OB 2J5PA 2KT0A 2FOKA 2DCEA 2M4GA 3VSLA 1FYMA 3ASNH 4E7ZA 2W1OA 2MLGA 3COAC 4PFPA 2P8TA 2VB6A 4V2FA 1I1SA 2LBFA 1SVMA 2QYOA 4DYRA 3K70D 1AA7A 1GVJA 3WODF 3KZIC 1SAUA 3GLXA 1QBJA 5CQEA 2OTJI 2Y9ZA 5LGNA 4G6TB 5EEGA 4OIRF 1AHDP 2DXIA 2COMA 4YFNF 2EV5A 4MTDA 3OYKA 3WTWC 1B8IB 4BXXJ 4XKVA 2P6TA 4C9YA 2HQ5A 4DNCA 5JLWA 2O7OA 5HS8A 2ZJRF 4IRGA 1QGPA 1D3YA 3DV8A 3HM5A 2MLKA 3S15J 5CLSA 3WGIA 2QSGX 2F6CA 3F8MA 3PQKA 2HYFA 3R61A 2B0LA 1D0ZA 1H88C 1T98A 3BP8A 3EYIA 1T0FC 2K4JA 3FXMA 4ZDOA 4MGRA 4A3KJ 2VE8A 4ZYHA 3IKTA 2WADA 2PQ8A 3MD2A 4XK4A 3L2VA 4DQ2A 3TP3A 3QYEA 4U0VA 2FE3A 2W24A 3S3OA 5FD6A 2L3DA 4HYEA 3UKGA 2CJJA 2JK3A 3P9CA 2QSHX 2NVYJ 4BNCA 4OIQF 4LG0A 2KIUA 1Z77A 2DJIA 5JR3A 2D5VA 1VI0A 2DA5A 4A3GJ 4HG2A 4XM3A 2QF7A 2O6GE 5IYCJ 2EB7A 4XRMA 1X4OA 1RPWA 3PIPF 1QZZA 2FRHA 3VSKA 2M7BA 2L5QA 4D7MA 4NUBA 3RCOA 2Z16A 2K9QA 1ZLKA 3FF5A 2ACJA 1UB9A 3WTYC 2GZWA 2W57A 1VQ4I 3PNYA 2DMPA 4FTHA 5J4YA 4RAZA 3VODA 3OL4A 1WH5A 1KU9A 3WHCA 4ZYGA 4QPOA 1K4TA 1U8BA 1YFHA 1XGSA 1G3YA 1YE9A 2PMHA 5DDGA 1J2XA 3S2DJ 3MKLA 4RB3C 1QRYA 3BR6A 3K1MA 4RM3A 5L3FA 4CSWA 2VBZA 4A3LJ 2GA1A 3L2RA 3MZYA 1KONA 2DQRA 2XAGA 1GV2A 4L5EA 2COBA 1SD5A 3V7CA 2IS6A 4WF2A 3J81K 1XTAA 4R1HA 1I6HJ 4NHJA 2F4OB 1R6RA 2L9RA 1MBGA 1N78A 1QPMA 1DUXC 4PUSA 4CYCA 2LKXA 4D7NA 3LWFA 2OBPA 4YRVA 4H0EA 2O8KA 2HYGD 4CDGA 1G4DA 3GUDA 1R5HA 2XUBA 3DF8A 1QHGA 3VPRA 2A6HF 3Q3SA 4ESJA 2HVRA 5HVQC 2G7UA 1UHSA 1GHCA 1W1WE 2V79A 3MZ8A 1IG7A 3F8NA 2X6YA 2QCOA 4OIOF 1DU6A 1DP3A 1MBFA 3EUKL 4IHSA 4LG0B 1REPC 1WWXA 1E2XA 3ELKA 1BI3A 3OSFA 1XSVA 2L7MP 1TLHB 2YR2A 2D1HA 4CZZA 4Y13A 5HDNA 2QBYA 2LH9A 5BQTA 3TOAA 3GTLJ 3DU6A 1KQ0A 2XC7A 4MTEA 1T95A 1LKXA 1KGSA 3H3ZA 4XLFA 1JJ6C 3BT9A 3RYRA 2FXAA 3DBRB 4YFKF 4IVNA 1TC3C 1WJEA 5DUKA 2D1VA 2MGQA 2VIXA 2BZTA 4RMNA 2CRGA 1RESA 4UVAA 3CCRI 2UXNA 2IJLA 4BYYA 5CJ9A 4C30A 2NNYA 2TRTA 4KIGA 5J8FA 1V55H 1G3TA 1U6GA 3JRCA 1K61A 2LFBA 3KEQA 3CDHA 4GYIA 3A0HC 1QQIA 5LBQA 5LHHA 2Z99A 4D0PA 4A0XA 1ZQ3P 2BVMA 2OU2A 3FKJA 3KETA 2VKVA 4YIIA 3LSRA 2FJ1A 4EVIA 3CP2A 2CUFA 3O3KA 5D5VB 4I09A 1LDDA 4L5JA 4IRHA 4G9YA 3DQVC 3TMOA 1OCTC 2L9SA 1QPIA 3VYUB 2V26A 1UFMA 3FXRA 9ANTA 4A6DA 4FE4A 2XF5A 4BXUA 1P92A 1X58A 3I59A 3FHNA 2XF6A 5EF6A 3V7SA 1Y8QB 4B3AA 3J80Z 3F8BA 3K0LA 1AKHB 4KMFA 2R5ZA 3GEZA 4A3DJ 4EQQA 1FNNA 1FWZA 1LPQA 2EFOA 1EH6A 4KYWA 2DOAA 3B6AA 4PJMA 1QZYA 5HDGA 3O8HA 2W84A 1SC7A 3KPHA 2IA0A 1B6AA 1WKMA 2LVSA 4M3BA 3BPVA 1FOWA 2D45A 2K7LA 3CD6I 4XSZF 3RQIA 3BY6A 4A3JJ 1HW2A 5FLXK 1FLIA 4ZZDA 3I64A 2MG4A 3KYLA 1RZ4A 1JKRC 5FB2A 2MSYA 2VN2A 1GV5A 1ENHA 2Y0MA 2HVSA 3EUHA 1MMDA 3CCJI 3CF5F 3K2AA 1LVKA 2W7NA 5D5WB 5FLVA 5DUIA 3KZZA 1AWCA 3V8KA 1NH3A 1O3TA 4IHWA 1UAAA 5CQGA 3CO7C 2RNJA 2LY2A 3EDPA 5E1WA 1Y0UA 4RGRA 5DYMA 2XSDC 1HXDA 3OS0A 1U5TA 1A6IA 3T0YA 3RKQA 2V9VA 2KPMA 3H9QA 4KN7X 1OCZH 1HBXG 2E2HJ 2M7AA 4WWCA 2P5KA 3CMMA 5LEKA 2M8EA 4E7SA 1HSJA 3NARA 3HRSA 2FQ3A 4HZFA 4KICA 3RPUD 2EFNA 2X0LA 2ZSIB 2M0CA 3WTZA 4C3HJ 4F7ZA 1XPXA 4JX6A 2HXIA 2QSFX 4AYBN 1YX3A 5TJJA 2EWNA 1JGSA 2K40A 1XMAA 1J59A 2KJCA 3BG6A 4I02A 4ZH4F 1LE8B 3W2VA 5GPAA 3S93A 2EFWA 4BGDA 2R7VA 4LIUA 1YOVB 3BG3A 2VUMJ 5K1YA 4KMUX 4XBFA 1WFXA 1QO0D 1OYWA 2VKDA 2FX0A 1TW2A 1MBJA 2JPCA 1IN6A 1SVOA 3CCYA 2F5DA 4L5IA 5TISC 3I4PA 3FM5A 5J3LA 1IW7F 1ZAOA 2A68F 2ZB9A 3JRDA 1KU2A 3CMAI 2PFBA 4NC8A 1HF0A 4BDYA 1W0TA 3S3NA 2CH0A 4BKXA 3JAMK 2Z5UA 3H36A 4N0BA 5DD8A 2K27A 1B9MA 3NEUA 2NYXA 3W3CA 1XGNA 3ASOH 2F5EA 2ZO4A 4BAYA 1Z9CA 3S1MJ 1YLFA 5AIPA 1K7AA 1S6LA 2BW3B 3RI4A 1H8AC 1S72I 3BTLA 2DU9A 3BQZA 3JW4A 2DYSH 2ZJQF 5L3GA 3A01A 2CQQA 4RGUA 2E5NA 3AG1H 5DEQA 5C44J 2E34A 4RBOA 3GTKJ 5CVUA 2QM3A 2Z33A 2V6EA 3A02A 3DTEA 3R0JA 4U0WA 3MQ0A 1ZTRA 4A12A 1VQLI 1E3PA 5IT3A 1LQ1A 2DPUA 2DFIA 2BHYA 3JSPA 5M5WJ 4ESFA 3TO6A 2XAQA 4QIWN 1WZ2A 1MNMC 1CF7A 1H9GA 3IC7A 1T39A 1UJ8A 3HRUA 5F1RA 1R58A 1QNTA 3QPSA 1MJBA 5CKTA 2JUGA 4ZZLA 1WSUA 3KEYA 2RDPA 2V9PA 3E6BA 1G2HA 2HXOA 4MIMA 1PDNC 2EINH 2LREA 4B47A 4ZYDA 4HX8A 1I27A 3HPGA 5CYVA 3C7JA 3D1NI 1LEBA 1YS6A 3GWZA 1ZG3A 1IO2A 4NC6A 2RC4A 3TBIA 2JA8J 1X1DA 4IHTA 2R92J 2QENA 4BQAA 1XD7A 1GXPA 4NBQA 3S14J 4XNFA 3HL2A 2HI3A 2ECBA 4BJ6C 2QEXI 2OQRA 3W6KB 5LEJA 2OPTA 2M3AA 3BTIA 3K1NA 1IGNA 3ZMZA 2A3SA 3HDDA 3DU5A 3G1LA 2EV0A 5ERIA 4AU7A 3K4CA 1P2FA 3IRRA 4KITB 4QLCU 2M45A 3E3VA 5H20A 1RRJA 3A01B 1L0OC 1IRZA 4DYQA 3JCUC 2L0KA 1O3RA 2FNAA 4LK1F 1FP2A 3V4GA 4B8XA 1EJ9A 2XRLA 1ZLJA 4AIJA 3M4OJ 2DMTA 2GIZA 2EZLA 4RM2A 2OCCH 5EGOA 2YX4A 4HA8A 1KYWA 3O6BB 2VKHA 4O3MA 5FJ8J 3HJEA 2XV4S 3BPXA 1U8RA 5BPIA 3OYEA 5D6EA 4D5FA 2VJ4A 2QKLB 1IRFA 2HQNA 2JUCA 3C3WA 4GYGA 3D5SC 1FEXA 3I55I 3MKZA 4CCKA 2DN0A 1IN7A 1PJRA 3KLNA 1ZRFA 2HOTA 4L9VA 1XG1A 4LB5A 4BBSJ 3DEWA 3L2UA 1O7FA 2HKXA 1F5TA 3D0SA 1YQAA 2Q2EB 2RREA 3HPHA 2JPBA 4AYBA 1ETOA 1S9HA 5TRDA 2QLZA 1F36A 3LSHA 1X3WB 3BZKA 2GOMA 2XGXA 2VC1A 4GO1A 2BVLA 1ZK8A 2HVQA 4XONA 4Z6YA 1R7JA 4FASD 5LGUA 3F8FA 3T5XA 4AIKA 2QGUA 3M8EA 3VB2A 2IEKA 4V2GA 1W36D 1JTXA 1ACIA 1IV8A 4HOBA 3F72A 4M3GA 4UVCA 2DBBA 3FX3A 3I56I 3TO7A 1K78A 2HZTA 5DV5A 1RR7A 4WXCA 2OJED 3DEEA 1E3OC 1DGWY 3FK6A 5H2FC 4LGWA 3IP4B 2VASA 2WAQN 2L9NA 3OYHA 1J7KA 1W5SA 4BXFA 4BY7J 4PJNA 5F27A 2VT3A 2KJBA 3SJMA 4QPQA 2CGPA 1FTZA 1Z21A 4MFEA 2KDOA 4II2A 4A69C 3JTHA 3RKWA 4A3EJ 4BE2A 1T33A 2JA6J 3A1YA 2F4IA 2IPQX 3IWFA 2YX7A 4P5OA 5C4JJ 3PFIA 4WCGA 4UNOA 2LF7A 1FSEA 2OV7A 4UUVA 3LA7A 3REOA 1BR1A 2PN6A 1M1EB 2EH3A 1K4SA 4LK0F 2HFHA 4CA0A 1HKQA 4OAZA 4HSTA 1HA8A 1HSTA 1ZKGA 1E3HA 1VF9A 5IY5H 1A36A 2A69F 3HOZJ 3HG9A 3CCEI 1U9OA 1IDYA 2JRTA 4BEHA 5J47A 4A3MJ 5DCMB 2LP0A 2ZNZA 2CWEA 1VTNC 5J1RA 5K5QA 1BW5A 3I4MJ 3Q0WA 5KCMA 1HDPA 4LITA 3KP7A 2CYYA 3OIQA 5GTHC 4P9UA 2JA5J 2VODA 5CPRB 2R3SA 3H0DA 4W97A 2MW8A 3E5QA 1UHMA 1GDTA 3QYFA 4FX0A 4R8HA 2A05A 2VLAA 1J0RA 1KYZA 3L09A 4S04A 2BYVE 3WU0A 4G12A 4ZDLA 3MFKA 1ETXA 4XICA 1T38A 3OYNA 3Q9SA 4N9IA 1R1TA 3VYRB 2ISZA 1B59A 5HLTA 5F0CA 4RAYA 3U1KA 5DCFA 4IRIA 1F1ZA 2VPLA 3QPLA 2NNNA 3GTPJ 3K7AJ 2KIFA 3BROA 4LLGF 1R23A 1YIOA 2KIMA 3F8CA 4WX9A 2ZBKA 2K9SA 1ZHFA 4WXHA 4D9JA 4PFOA 2ESHA 4LFUA 4AIHA 3IHUA 2HOAA 4MQ9F 5EZHA 2HPIA 1SD7A 2VQCA 1O3SA 2P5LC 5FKNA 5LLQA 1XCBA 4KNYA 1P9QC 4XQFA 4ENKA 5IOZA 2L7KA 1OR7A 3C2BA 1U78A 2KMUA 3GMEA 4D5CA 3KX2A 2R5YA 3PNTA 3WTVC 1ZGAA 1R9TJ 5EEHA 5HODA 4L9NA 4P9FA 3S1QJ 4A0ZA 3DKXA 1Y1WJ 4B09A 1Z7LA 4LG3A 5ICEA 1JTYA 1HOMA 4IQJA 4HBLA 3PL8A 4Z2YA 2XIGA 2W00A 1G3WA 3KIOA 3G2BA 2E1OA 2HNHA 4XR6A 1BJZA 2YSRA 3SFZA 1DU0A 2XF7A 3CO6C 1FOYA 2FBIA 4HNVA 4KUMA 3I0TA 4LLLA 3FMRA 2CUEA 4J00A 1VQ8I 4CO8A 2JSPA 4MHGA 2ZMEB 4MO7A 2VL8A 3OYAA 2VXZA 4EM2A 1MBHA 1TQIA 1LFBA 4PGGA 4E6KG 4GDFA 5J40A 3FXLA 5GPCA 2IS1A 2Y48A 5EG0A 2PG4A 3DP7A 3ZQHA 2MBFA 1OPCA 3OIOA 5ICGA 3CESA 5IOYA 2WV1A 3GF2A 3I9V2 2IW5A 2Q1ZB 2DA6A 3RSNA 1QVTA 4HQMA 5M5XJ 5FGMA 4HRIA 2M87A 2KZGA 4I01A 2K9NA 4ETSA 2BY3A 3TW7A 2DFEA 3EUAA 3SZPA 2IBDA 3ROUA 2XHKA 1R22A 5KAFC 1HW5A 2DODA 3F21A 4MFDA 1Q1HA 4IKFA 3NRVA 1WI3A 3K2ZA 3RZDJ 2BY0A 4RGXA 4AWXB 2EV6A 3MZHA 3ZQGA 4XOTA 1F43A 4M3FA 3MWMA 4XMYA 2ZXWH 3IAS2 3ZQCA 2P7CB 4PJJA 2PEXA 5F0FA 4BJ5C 1UCRA 3ABTA 2LBFB 3L9FA 2E19A 1PP8F 2K5CA 3WGHA 3J80K 5IPAA 1Z1DA 3HSRA 5K5RA 4XLHA 5HS9A 4J19A 2WAQA 4LMYA 4FISA 4ZYAA 4EV0A 4ENMA 1JE8A 3V8LA 1ZGJA 4XRSG 3ZN0A 3CUOA 4GRIA 3S1RJ 2MYSA 1XB4A 5AIQA 1T08B 1YO5C 3IWZA 1ZELA 3O2PE 1WGXA 3E6CC 2R93J 3FZVA 4HF1A 4FT8A 3ECOA 1PP7U 2BHZA 2R0QC 2CUZA 4KDPA 2QQ8A 2IS4A 3GBGA 4QWQA 1YW8A 1ZG1A 2DT7B 3ABLH 4OMZA 2PMUA 4A0YA 5B5EC 2HOEA 3OSGA 3TDUC 1S8NA 4IJAA 4PGHA 3Q0UA 4M6VA 3JRFA 1D1AA 2L01A 3IAM2 3W6JB 2WV0A 3V8JA 2IP2A 4IO9F 1OFCX 3ERED 2L4MA 2ZMEC 3KCCA 4J01A 1SD6A 4Y15A 3ABKH 3SDBA 3TQNA 3B6CA 3RYPA 3U2RA 3GTJJ 1BIBA 3H5NA 4DOZA 3HOYJ 1TL8A 3QYBA 2LNBA 1CGPA 3HOSA 2HOSA 3IRQA 5JVGF 4I2OA 1FOXA 3K70C 3CCQI 5TGTA 1XGMA 5LGTA 3H9GA 3TEDA 4UY8I 2F5CA 3FHZA 1KZHA 2K4BA 4ZTFA 2DI3A 1D0XA 2Y75A 2DFHA 3L2QA 2E2IJ 4L0ZB 3HOUJ 3KLOA 4ZC3A 3BDDA 5HDKA 2XVCA 2HYJA 1UZCA 2GA2A 4NDLA 5K5OA 4IHVA 3FXJA 3A2KA 5K7HA 3FWEA 3BR5A 5FKKA 2G7HA 3CF2A 4PJLA 3WE2A 3WG9A 4UB6C 2BXZA 3R60A 5A2QK 1U0JA 1B9NA 3C2HA 3H5RA 4WK8F 1QU3A 2CQ7A 1P6RA 2Y2ZA 2Y31A 3BTJA 2V6CA 3NQOA 3VFZA 2KRFA 1B4AA 2VKEA 5CVVA 1HQCA 1WI9A 2DA1A 1Z3XA 3S2WA 1K6YA 2BY2A 2KZVA 2KLOA 1QHHD 3MMYB 4CYCB 2ZFUA 1YI2I 4PCQA 4QTRA 5KAIC 4BU2A 3H9JA 3QU6A 4EJWA 1HKTA 4D1QA 2IA2A 2EIKH 1FP1D 3JRHA 2CS3A 3C1DA 2O0YA 4IEJA 4EM0B 3MAJA 1FIPA 2NOGA 2JTVA 1VQ9I 1V5FA 1IV6A 3QODA 2J5OA 3OYJA 4EEFG 4A3IJ 4XLPF 3K69A 3M07A 1ETQA 3GFIA 5B66C 2QBYB 3CMYA 4BDZA 2DFFA 4F92B 1ETYA 1I50J 2LD5A 1I3AA 3ML6A 3PSFA 2L7ZA 1SFXA 4JX5A 3UNGC 4YIRX 3LSKA 2H6BA 4B1RA 3HOXJ 1YJWI 4M3DA 2RNGA 1BIAA 3IH4A 3OIPA 1EKEA 3OS1A 4A5NA 3P9IA 2DDBA 2WAEA 4M74A 1MDMA 2GM4A 2LY9A 2ME0A 4EMSA 3OS2A 1IUFA 5FKOA 5J1UA 4M6XA 5E3MA 1H89C 5DD4A 1FX7A 2HR3A 5ICFA 1KU7A 3RPUA 5FRNA 4RGSA 3AAFA 4CUGA 4HNUA 1XC5A 1USSA 3L7WA 4XKBA 5H6RA 4Q47A 5E17F 1B1BA 2VQHA 3BJAA 4AC0A 1ZREA 3J81Z 4MEXF 4IOCF 4IXAA 4XL9A 2XKOA 3OV8A 1ZYRF 3ZQFA 4GFBA 4OAYA 4I7HA 3GTMJ 2V1DA 2IGMA 5FKMA 3DPLC 3CTAA 4E7JA 3KFWX 1D5VA 3KEOA 3HIFA 3BZ6A 2ZNYA 1P7IA 2X4HA 5ICCA 1Z05A 4I76A 2OC6A 2W48A 5ED4A 1BC8C 3LSIA 2GOXB 1MKMA 3LQRA 4RAFA 3X2QH 3I59B 1YIJI 3F6VA 1ZRDA 5HLIA 5DM7F 2MABA 3QP5A 3K4MA 2CV2A 1WHUA 4CXFA 3M1EA 1R4MB 3RTRA 2R5ZB 1FBSA 2I8DA 2NS8A 2VBYA 3W2WA 2IS2A 4PSWA 2QA4I 1V4RA 3QOPA 1BI0A 2HS5A 2EIMH 3FMSA 4AVPA 3F9KA 3ABMH 5EJCA 1OCCH 1YRNA 1WJAA 2PBIA 2CUJA 3HSEA 2WY8Q 3E7LA 3WGGA 2NOJB 2VI6A 3HSFA 1FYLA 3T8RA 1XDUA 2A5WA 1ON1A 3OL3A 3BCBA 3HBLA 3JRAA 1HC8A 2V7FA 2AXTC 3TOBA 4IZZA 1BM9A 4YEJA 2E1CA 2M5WA 2QUFA 3IKVA 4U87A 1LFUP 2DW4A 2JMWA 1FC3A 3WTXC 2A6EF 2PJRA 3HRMA 4HV6A 3PJRA 1OLTA 1JT6A 3PFYA 3KYDB 4G6DA 5E20A 1TNSA 1VQ6I 5B3SH 2MA3A 3G1MA 3CLOA 4B44A 1X1AA 1XCVA 4KISA 5GAEJ 4Y3OA 2GXGA 3CDIA 1W7PD 3LSJA 2MH9A 1IDZA 3AG4H 1ETKA 1U5TB 4Y33A 4B3XA 2QVOA 5KHDA 1IJWC 4LD5A 2Z1DA 2OA4A 1MBKA 1N25A 3HUGA 3DLAA 4BH9A 3G4SI 2QKMB 2P6SA 4LOCA 2LK2A 3A0BC 3K9TA 2M2EA 1MSEC 4HW0A 4ZTJA 3ZOBA 2XB0X 2R4GA 5JVTA 3WU1B 3OYCA 4BL0B 4BQQA 2NVQJ 5GAGJ 2G9WA 1FIAA 1XSDA 4ENNA 2NVTJ 3WTUC 3CUQA 4HF0A 1FBQA 2ECCA 2ZFWA 3EYYA 5F08A 2R7TA 3K10A 1YRNB 2CW0F 5LRRA 3L1PA 1JJ8C 3HRTA 2DT5A 2KL4A 3FXQA 3HTSB 2JT1A 5D4SA 2K86A 2AQEA 3ABUA 4Y17A 3GTQJ 3SYTA 3OY9A 1YITI 4HDVA 1F9NA 2IA1A 1VQMI 2Q0OA 4JYKA 4A2UA 3ZMSA 3FXOA 5FLXZ 4G6QA 2DYRH 1TT5B 2AXLA 5JFRA 2OD5A 1V54H 3LAJA 3CP8A 5JHUA 1C0WA 4A6EA 5E79C 3LFUA 3CJTB 2M0MA 1JKOC 4G7HF 2ISYA 3I54A 3GW2A 5IT9K 1TP4A 2BE5F 4I0BA 5E8IA 1V5EA 3J7ZI 4PK4A 5FD5A 1TQPA 2UXXA 4BY1J 1OJLA 1U9NA 5LFAA 1JHFA 4RAGA 3K4NA 3FK7A 3IL2A 3EUHC 3T8TA 5IYBJ 1T6SA 1Z6RA 2YU3A 2ID6A 1SFEA 2EZKA 2LG4A 2WA0A 4Q48A 4ZDPA 4R79A 1T56A 5K7FA 1A35A 2IVMA 4V19K 2N8GA 4K2EA 5DTDA 4XN3A 1R71A 3BOQA 3P5JA 1EV7A 4NQWA 3VOEA 2AQFA 1MIJA 4AUXA 4BHBA 5C4XJ 4G94A 2WC2A 2HU9A 2CSOA 4ZYEA 2MC3A 1GVDA 2ZJPF 1JT0A 3DWLE 2KFDA 3H5AA 3FMQA 1OYIA 1MMSA 2ZSHB 4FX4A 1CF7B 1U5TC 2X48A 2LR8A 4PZJA 3SXYA 5IYDJ 4CZCA 2E1NA 1LNWA 2DT6A 3FIWA 1W5TA 2E7XA 4EJVA 4ZJZA 1FY7A 2X9DA 5E8GA 3F3XA 2B9SA 3CMEI 1HDDC 4CGZA 1EF4A 1B72A 1JUPA 1E17A 4X6AJ 4ESBA 2HKOA 5J1YA 3LMMA 1I39A 3L00A 1PUFA 5EYRA 3ZMVA 3MVPA 1ZR2A 1DP7P 5JLXA 1FMVA 2R7DA 3AG2H 2Y9YA 4X1EA 1LDJA 2I10A 4UV8A 3QAHA 4M3EA 1J9IA 1BOAA 1XMKA 2O61A 1S29A 5FKLA 2Y0SN 2A07F 3G1OA 2P5VA 1V5GA 5B1AH 3JAMZ 4EJOA 2MH2A 3Q5FA 4YG2F 4X0GA 3WTSC 1TWCJ 2B63J 4UVBA 2A6TA 4E4HA 4DBRA 4HX7A 1ZR4A 4BACA 1TQMA 4JQFA 4XORA 3ZQ7A 1MH4A 1ZGWA 2NRAC 1U3EM 3PO3J 1OMIA 5FFZA 3PIOF 1BOBA 2XPWA 2LYCA 3E6DA 1WVRA 1RUOA 2CQXA 4RLQA 1JKPC 3FXKA 2BV6A 2C6YA 5E1XA 5EGOB 1RIOH 4OU0A 3K6GA 3P9KA 1I5ZA 3U9GA 3K4KA 3N97A 2DA7A 4M9SA 2M30A 2XPVA 4YELA 5E3NA 2AS5F 3WE3A 2M1BA 2VPRA 1N75A 2H1LA 2BOLA 4NB5A 3TO9A 3V7RA 4G7OF 1SEUA 4CH7A 4IF4A 2FA5A 1R1UA 2DO7A 4P55A 1JI8A 2L9VA 4AD9A 2E60A 2L7FP 3EQLF 4UV9A 5JI6A 3OYFA 4M6YA 1MW7A 1KU3A 3JRBA 3OYBA 2FMLA 3BR1A 5LD2C 2A5YB 3HEFA 3C2GA 2H27A 2WAFA 2JRMA 4F52A 5FFXA 2CW7A 3LSPA 3DPTA 1B8IA 3GYHX 3U21A 3E0JB 2A61A 3ZMTA 5GAHJ 2EBIA 3M8JA 3KP4A 5L3DA 2YPRA 1G59A 3ZQLA 2RQQA 2IGKA 2DA3A 4H4KC 1TTYA 2NVUB 1YYVA 1VQ7I 1ZRCA 1K78B 1D1BA 4DZJA 3GTGJ 5BS6A 2FF4A 2HGCA 2XB5A 3S16J 4HNTA 1W4MA 4XKWA 4LB6B 4DBQA 4IQ4A 5D4RA 5C3EJ 3H3VK 4ITVA 4KA4A 1EH8A 1YX5A 4OOIA 3E5XA 2H1KA 2CU7A 1X2MA 1LUJB 2RN7A 1ERDA 4YFXF 5AONA 1W5CC 3S1NJ 2O9LA 1WH7A 3SEQA 1YW7A 3G71I 1R00A 3A4CA 1G3SA 5J8CA 3CCUI 3KE2A 5HNHA 1QZEA 2NAZA 2LKPA 3HOTA 5KNLA 4U88A 3LSGA 3W6VA 1Z6TA 4RB0A 2P7VB 3ZCOA 1O3QA 4L18B 3H3UA 2E71A 3J7AO 1R36A 2EA4A 1BI1A 4M71A 1S7AA 2OQGA 2HTSA 4BEHB 1HKSA 4OINF 4QSHA 4HLXA 1DPUA 4OWRB 1OKRA 5HOOA 1A31A 4II3A 3JRIA 1FPQA 3QPHA 1JGGA 1R49A 2ME6A 6PAXA 4LJZF 3GTOJ 1LFPA 3RQ4A 4CCNA 1ZN2A 5E3LA 1W36C 1ULYA 3GFMA 4I0AA 5FLMJ 2FUG2 4JBAA 2VT2A 3DKWA 4AM3A 4HSRA 4G7ZF 1PYVA 3MEXA 1FOKA 1ETWA 2H8WA 1D8JA 3ZP5A 1FSHA 1DQUA 1MNDA 2WTEA 4KIFA 3RKYA 3WU2C 4RS8A 1WJ5A 3CQZJ 4EGYA 2IXSA 3C18A 3R4KA 3Q9VA 3OYGA 3BTCA 4G8XA 3BG9A 3ZN1A 3DFGA 1UHWA 3T1BA 2FNPA 2HQRA 5HS7A 5HLHA 1JUSA 1ODDA 3M1CA 2K3FA 2Q8KA 2V1XA 2Y0SA 3M9AA 4C2UA 2XGDA 5F04A 4A5MA 4ENJA 3CJNA 2HEOA 3A03A 1IZ1A 2W25A 4RLFA 3PM1A 1RKTA 3LOCA 3ONQA 2DPDA 1APLC 3ZMUA 5M3MJ 2TDXA 2R5YB 1PUEE 2UWMA 4M73A 2GLOA 4Y7NJ 3ISPA 2LTPA 4RDUA 2L54A 1D0YA 1Z0XA 3BJ6A 1EH7A 4HDUA 2WBMA 1H0MA 3S17J 3LSMA 1S5LC 1X1BA 2K02A 4UHTA 3HGGA 3I58A 2E1MB 2FMYA 2DTRA 3F6OA 4HPQA 2X6WA 3AG3H 1P4WA 3DEUA 2EIJH 1R5GA 3GFJA 4F93B 3SHFA 4MLOA 2F4MB 1VQOI 4FHTA 1T8IA 2H8RA 2JVGA 4B43A 3OR2C 2O8XA 1SAXA 1XN7A 1W0UA 2JZYA 3SFIA 1I3QJ 2FEZA 4MEYF 4Q4ZF 5EG0B 5FROA 2E5ZA 3AKZA 3OYMA 3TL4X 1LJ9A 3WG7H 3OWTA 3V42A 2VQLA 4XKCA 3N4MA 4KT5C 2OUMA 5GP9A 1SD4A 3ZMDA 3DLLF 3M8FA 5KK1A 5FRMA 3QPTA 2CV1A 4A3CJ 3VYTB 2L02A 5CVRA 2XROA 3FDYA 1X3UA 2EJRA 2MD5A 2ETHA 1Y6IA 1BR4A 2NS0A 1RC9A 2L2OA 3UR3C 1HLVA 1D5YA 1Y39A 5BPDA 4MQVA 1AU7A 2FSWA 2CO5A 2CFOA 3TP0A 2OZ6A 4RB2C 2GIVA 4DJAA 1TWAJ 2R7QA 4N9HA 2CW8A 2LRDA 3N05A 1LDKB 1IXRC 1K79A 1VQPI 3G3ZA 2DTZA 1YTYA 5KVRA 2CQKA 3OR1C 5ILVA 4FCYA 4A3BJ 1AKHA 4HLYA 1GXQA 3HXLA 4I98B 4O6JA 1XDSA 2JJ7A 1SVLA 5E18F 2F5FA 4EATA 4CCLA 4EGZA 1MGTA 2HDDA 3K4LA 2WB1N 2XKPA 3J7YJ 3KP5A 2X6XA 2LSOA 4UXNA 5ILSA 3CCVI 1OR7C 2HTJA 4S05A 1NHAA 3LA3A 2CFXA 4OIPF 2R7UA 2JSCA 2EPFA 2LMDA 5J6XA 3H92A 2STTA 3GZ6A 4E7LA 1H9TA 4U0YA 2RVCA 1Z3YA 3BLYA 3SEZA 3IH3A 4IL6C 2JA2A 5D5XB 5IP6A 5GADJ 3DKYA 2NS7A 2AO9A 4XLAA 1A5JA 4C2MJ 3HGYA 2ESNA 5BMZA 1BI2A 2EFQA 3HB9A 3NAUA 2E1MC 3DBLB 3SDGA 1VQNI 1ITYA 3HKZN 4BUPA 4U7DA 1X3ZB 4M9XA 1NK3P 3LAPA 4LIVA 4HV5A 1K6OA 2M34A 1FJLA 3NWSA 3RPQA 3KP2A 3S2HJ 2F48A 2L4AA 1O7LA 1R4NB 2DA2A 2X85A 1UMQA 3S32A 4HQEA 2XAHA 3HTUA 4E7KA 2LLKA 3QU3A 1RI7A 3JRGA 5JHFA 1FZPB 5CVJA 1Q1VA 4P96A 3KZYA 1BL0A 3K4JA 1XMXA 5BNGA 4JP0A 2ZXHA
chains in the Genus database with same CATH topology
1LEAA 1WQ2A 1IF1A 5ILUA 4PDKA 1ZH5A 1I6XA 3F22A 2LDUA 4HX4A 5F6FA 1ZG5A 3E5UA 4HAMA 3ECHA 3I53A 4Q5SF 2IT0A 3GZ5A 2PJPA 3EETA 4M9ZA 1ZARA 3LA2A 3QP6A 3GO5A 5H6QA 4RB1A 1YW9A 4M72A 1RNLA 5L3CA 2BEOA 2CG4A 3GVAA 2Z9OA 3P7NA 2D2WA 4CYDA 1AOYA 5HLGA 1IRGA 1BBYA 2Z3YA 2RQPA 1SMYF 3K1PA 2VONA 3JSOA 2DAOA 2RV8A 4KIBA 3L2CA 4JK1X 3RDIA 2KKOA 4O5VA 2XAFA 5LRSA 2PI0A 5D8LB 1J75A 1TNTA 2DLLA 2O3FA 1TW3A 4CICA 4WXDA 3LSTA 5D5UB 1W7PA 3B73A 1KA8A 4KN4X 4EJTA 1MDMB 3D5LA 1F4KA 2GWRA 2H09A 1S7OA 2PLYA 1Z7UA 4ON0A 3HHGA 2W85A 1D8KA 1STZA 2O03A 1L3LA 3RJPA 5A2QZ 1U2WA 2H94A 3FM3A 1LVAA 2FBHA 2QQBA 3GFLA 4GXOA 4XRFA 1LB2A 2H6CA 2XASA 3SQNA 2ADUA 1FBUA 3G73A 1OYYA 4GGGA 1WRJA 2HWVA 2RKHA 1P4XA 2DK8A 3SZTA 2EFPA 4OMYA 2OZUA 5FO5A 1IUYA 2QQAA 2VC0A 1JHHA 4U7BA 4BHPA 1BC7C 4XLNF 1T2KA 1IXSB 2VE9A 1Z91A 2F2EA 2DK5A 3KP3A 3U1DA 2BGCA 1W7PB 1TBXA 4ASNA 3TKYA 1SMTA 2XAJA 1MZBA 4TV7A 3TGNA 2BBYA 2FU4A 2FBKA 1I1GA 2QWWA 1R1VA 1IN4A 3BJOA 2Q2EA 2VBXA 3TDZC 4E70A 4L0YB 1DPRA 2QQ9A 5F64A 2ZCWA 5BOXA 4BHCA 3VEPA 3F23A 1MJ9A 1MD0A 1YS7A 4YIFA 5LHIA 1G6NA 2UZKA 4GCVA 4IPAA 1RUNA 1KQ9A 3CUQB 5L3EA 1P4AA 4L9TA 3HYIA 1BJAA 2VOPA 2OAZA 2VBWA 3I5UA 2XRNA 1XGOA 2ZJ2A 1O57A 1BN5A 3ULQB 1ON2A 1S3JA 3MCZA 2GXBA 1IXCA 1T0FA 3HHHA 1JXSA 4XSXF 5L3BA 2GQQA 5DCMA 1MJAA 1DDNA 1USTA 3LQQA 4EM1A 1ONVA 3RIRA 1J5YA 5E1ZB 1IAWA 2WWYA 4KFCA 1FT9A 2P4WA 4LLNA 3I71A 5CVIA 3JTGA 2GAUA 3DXJF 3R0AA 5D8KB 1IN8A 3E6MA 3BWGA 2V1UA 3OOPA 2IRFG 5D6FA 3R6SA 3FXUA 2DQLA 4L9JA 3RKXA 2RGVA 3GX4X 2EK5A 4HF2A 3CUQC 3B02A 4EJUA 1XSXA 1IN5A 1SFUA 1V3FA 1A04A 2ZKZA 2E7WA 2HDCA 2STWA 1FYKA 2VOOA 5IT9Z 2QZ8A 3LFKA 1KQ8A 3PQJA 2ZMEA 1HW1A 2ELHA 2ZXJA 4CHUA 5LHGA 3GXOA 3WTTC 2R7FA 3QRFF 4MNUA 3KP6A 2LF8A 2EA2A 3ZPLA 3E97A 1YG2A 3M7GA 2J5PA 2FOKA 1FYMA 3COAC 2MLGA 2P8TA 1I1SA 2QYOA 1GVJA 3WODF 3GLXA 1QBJA 5LGNA 5EEGA 4OIRF 2COMA 4YFNF 2EV5A 4MTDA 3WTWC 2P6TA 4DNCA 5HS8A 4IRGA 1QGPA 1D3YA 3DV8A 2MLKA 5CLSA 3WGIA 3R61A 3F8MA 3PQKA 2HYFA 2B0LA 1T98A 3BP8A 3EYIA 2K4JA 4MGRA 2VE8A 4ZYHA 3IKTA 2PQ8A 4DQ2A 4U0VA 2FE3A 2W24A 5FD6A 2L3DA 4HYEA 3P9CA 4OIQF 4BNCA 4LG0A 2KIUA 5JR3A 2O6GE 2EB7A 1QZZA 2FRHA 1ZLKA 3FF5A 2ACJA 1UB9A 3WTYC 2GZWA 2W57A 4RAZA 3VODA 1KU9A 4ZYGA 1YFHA 1XGSA 1G3YA 2PMHA 5DDGA 1J2XA 4RB3C 3K1MA 5L3FA 2VBZA 2GA1A 3MZYA 2DQRA 2XAGA 1SD5A 3V7CA 4WF2A 3J81K 4R1HA 4NHJA 1QPMA 1DUXC 3LWFA 2OBPA 4H0EA 2HYGD 4CDGA 1G4DA 3GUDA 1R5HA 2XUBA 3DF8A 2A6HF 4ESJA 5HVQC 2G7UA 1GHCA 2V79A 3F8NA 4OIOF 4LG0B 4IHSA 1REPC 1WWXA 1E2XA 3ELKA 1BI3A 2QBYA 1XSVA 2YR2A 1TLHB 4CZZA 2D1HA 4Y13A 5HDNA 5BQTA 3TOAA 1KQ0A 4MTEA 1KGSA 3H3ZA 3RYRA 2FXAA 4YFKF 4IVNA 5DUKA 2D1VA 4UVAA 2UXNA 2IJLA 4BYYA 5CJ9A 2NNYA 4KIGA 5J8FA 1G3TA 1U6GA 3KEQA 3CDHA 4GYIA 1QQIA 5LBQA 5LHHA 2Z99A 4D0PA 4A0XA 2OU2A 3KETA 4YIIA 4EVIA 3O3KA 5D5VB 4I09A 1LDDA 4L5JA 4IRHA 4G9YA 3DQVC 1UFMA 3FXRA 4A6DA 4BXUA 1P92A 3I59A 3V7SA 3J80Z 3F8BA 3K0LA 4KMFA 3GEZA 4EQQA 1FNNA 1FWZA 2EFOA 1EH6A 4KYWA 1QZYA 5HDGA 2W84A 2IA0A 1B6AA 1WKMA 3BPVA 2D45A 2K7LA 4XSZF 1HW2A 3BY6A 5FLXK 1FLIA 4ZZDA 3I64A 1RZ4A 5FB2A 2VN2A 2Y0MA 3EUHA 5D5WB 5DUIA 3KZZA 1AWCA 3V8KA 1O3TA 3CO7C 2RNJA 3EDPA 5E1WA 1Y0UA 4RGRA 5DYMA 1HXDA 1U5TA 3T0YA 2V9VA 4KN7X 1HBXG 4WWCA 2P5KA 5LEKA 2M8EA 1HSJA 3HRSA 2FQ3A 4HZFA 4KICA 2EFNA 2X0LA 3WTZA 4F7ZA 5TJJA 2EWNA 1JGSA 1XMAA 1J59A 2KJCA 4I02A 4ZH4F 2EFWA 5K1YA 4KMUX 4XBFA 1QO0D 1OYWA 1TW2A 2JPCA 1IN6A 2F5DA 4L5IA 3I4PA 3FM5A 1IW7F 1ZAOA 2A68F 1KU2A 2PFBA 3JAMK 2Z5UA 4N0BA 5DD8A 2K27A 1B9MA 3NEUA 2NYXA 1XGNA 2F5EA 2ZO4A 4BAYA 1Z9CA 1YLFA 5AIPA 1K7AA 1S6LA 3RI4A 2DU9A 3JW4A 5L3GA 4RGUA 5DEQA 5CVUA 2QM3A 2Z33A 3R0JA 4U0WA 3MQ0A 4A12A 5IT3A 1LQ1A 2DPUA 2DFIA 3JSPA 4ESFA 3TO6A 2XAQA 1CF7A 1H9GA 3IC7A 1T39A 3HRUA 5F1RA 1R58A 1QNTA 1MJBA 4ZZLA 1WSUA 2RDPA 3E6BA 1PDNC 4ZYDA 4HX8A 1I27A 5CYVA 3C7JA 1LEBA 1YS6A 3GWZA 1ZG3A 2RC4A 4IHTA 2QENA 4BQAA 1XD7A 1GXPA 2OQRA 3W6KB 5LEJA 3K1NA 3ZMZA 2A3SA 5ERIA 2EV0A 1P2FA 3IRRA 4QLCU 2M45A 3E3VA 5H20A 1L0OC 1O3RA 2FNAA 4LK1F 1FP2A 3V4GA 4B8XA 1ZLJA 4AIJA 2YX4A 4HA8A 1KYWA 3O6BB 4O3MA 2XV4S 3BPXA 1U8RA 5BPIA 5D6EA 1IRFA 2HQNA 3C3WA 4GYGA 1IN7A 3KLNA 1ZRFA 4L9VA 4LB5A 1O7FA 2HKXA 1F5TA 3D0SA 1YQAA 2JPBA 5TRDA 2QLZA 2XGXA 2VC1A 4GO1A 1R7JA 5LGUA 4AIKA 3T5XA 3F8FA 3M8EA 3VB2A 4HOBA 3F72A 4UVCA 2DBBA 3FX3A 3TO7A 1K78A 2HZTA 5DV5A 4WXCA 4LGWA 1J7KA 1W5SA 2VT3A 2KJBA 2CGPA 3JTHA 3RKWA 2IPQX 3IWFA 2YX7A 4P5OA 3PFIA 4WCGA 4UNOA 2LF7A 1FSEA 4UUVA 3LA7A 3REOA 2PN6A 4LK0F 2HFHA 1HKQA 1HSTA 2A69F 2JRTA 5DCMB 2ZNZA 2CWEA 1VTNC 5K5QA 2VODA 3KP7A 2CYYA 4P9UA 2R3SA 3E5QA 1UHMA 4FX0A 4R8HA 1J0RA 1KYZA 3L09A 4S04A 2BYVE 3WU0A 3MFKA 1T38A 3Q9SA 4N9IA 1R1TA 2ISZA 1B59A 4RAYA 5DCFA 4IRIA 1F1ZA 2NNNA 2KIFA 3BROA 4LLGF 1R23A 1YIOA 2KIMA 3F8CA 4WX9A 2ZBKA 1ZHFA 4WXHA 2ESHA 4LFUA 4AIHA 3IHUA 4MQ9F 1SD7A 1O3SA 2P5LC 5LLQA 1XCBA 4KNYA 4ENKA 1OR7A 1U78A 3WTVC 1ZGAA 5EEHA 4L9NA 4P9FA 4A0ZA 4B09A 5ICEA 4HBLA 4Z2YA 2XIGA 1G3WA 2YSRA 3SFZA 3CO6C 2FBIA 4KUMA 3I0TA 4LLLA 3FMRA 4CO8A 4MHGA 2ZMEB 2VXZA 4EM2A 1TQIA 4PGGA 2Y48A 2PG4A 3DP7A 5ICGA 2MBFA 1OPCA 3GF2A 2IW5A 4HQMA 5FGMA 2M87A 4I01A 4ETSA 3SZPA 3ROUA 2XHKA 1R22A 1HW5A 3F21A 1Q1HA 3NRVA 3K2ZA 4RGXA 4AWXB 2EV6A 3MZHA 3MWMA 2P7CB 2PEXA 1UCRA 3ABTA 3L9FA 1PP8F 3WGHA 3J80K 1Z1DA 3HSRA 5K5RA 5HS9A 4LMYA 4EV0A 4ENMA 1JE8A 3V8LA 1ZGJA 3ZN0A 3CUOA 1XB4A 5AIQA 1YO5C 3IWZA 3O2PE 3E6CC 3FZVA 4HF1A 4FT8A 3ECOA 1PP7U 4KDPA 4QWQA 1YW8A 1ZG1A 4OMZA 2PMUA 4A0YA 2HOEA 3TDUC 1S8NA 4IJAA 4PGHA 2L01A 3W6JB 2WV0A 3V8JA 2IP2A 3ERED 2L4MA 3KCCA 1SD6A 4Y15A 3TQNA 3RYPA 3U2RA 1BIBA 2LNBA 1CGPA 3HOSA 3IRQA 4I2OA 1XGMA 5LGTA 2F5CA 3FHZA 2K4BA 2DI3A 2Y75A 4L0ZB 3KLOA 3BDDA 5HDKA 2XVCA 2GA2A 5K5OA 3FWEA 2G7HA 3WE2A 3WG9A 3R60A 5A2QK 1B9NA 4WK8F 1P6RA 3VFZA 3NQOA 2V6CA 2KRFA 1B4AA 5CVVA 1HQCA 1WI9A 3S2WA 4PCQA 3QU6A 4EJWA 1HKTA 2IA2A 1FP1D 3C1DA 2O0YA 4EM0B 3MAJA 2JTVA 2J5OA 4XLPF 3K69A 3GFIA 2QBYB 3ML6A 1SFXA 2H6BA 1BIAA 4A5NA 3P9IA 4M74A 1MDMA 4EMSA 4M6XA 5DD4A 1FX7A 2HR3A 5ICFA 1KU7A 3RPUA 4RGSA 3AAFA 1USSA 3L7WA 5H6RA 4Q47A 5E17F 1B1BA 3BJAA 1ZREA 3J81Z 4MEXF 4IXAA 2XKOA 3OV8A 1ZYRF 4I7HA 2V1DA 3DPLC 3CTAA 3KFWX 1D5VA 3KEOA 3HIFA 3BZ6A 2ZNYA 2X4HA 5ICCA 1Z05A 5ED4A 1BC8C 1MKMA 3LQRA 3I59B 3F6VA 1ZRDA 5HLIA 3QP5A 4CXFA 3M1EA 3RTRA 1FBSA 2VBYA 1V4RA 3QOPA 1BI0A 2HS5A 3FMSA 4AVPA 2PBIA 3HSEA 1FYLA 3WGGA 3HSFA 3T8RA 1XDUA 1ON1A 3TOBA 1BM9A 2E1CA 2M5WA 2QUFA 3IKVA 2DW4A 1FC3A 3WTXC 2A6EF 3HRMA 4HV6A 4G6DA 5E20A 1TNSA 2MA3A 3CLOA 1XCVA 2GXGA 1W7PD 2MH9A 1U5TB 2QVOA 4LD5A 2OA4A 3HUGA 4BH9A 2P6SA 3K9TA 4HW0A 3WU1B 5JVTA 2G9WA 1XSDA 4ENNA 3WTUC 3CUQA 4HF0A 1FBQA 2ZFWA 3EYYA 2CW0F 5LRRA 3HRTA 2DT5A 3FXQA 3HTSB 2JT1A 5D4SA 2K86A 3ABUA 4Y17A 4HDVA 1F9NA 2IA1A 2Q0OA 3ZMSA 4A2UA 5FLXZ 4G6QA 2AXLA 5JFRA 2OD5A 3LAJA 5JHUA 1C0WA 4A6EA 4G7HF 2ISYA 3I54A 3GW2A 5IT9K 2BE5F 4I0BA 5E8IA 5FD5A 1TQPA 2UXXA 1JHFA 3IL2A 3T8TA 1T6SA 1Z6RA 2YU3A 1SFEA 4R79A 4Q48A 2IVMA 4K2EA 3BOQA 1EV7A 4NQWA 3VOEA 4BHBA 4G94A 2WC2A 2CSOA 4ZYEA 2MC3A 3FMQA 1OYIA 4FX4A 1CF7B 1U5TC 4PZJA 3SXYA 2E1NA 1LNWA 1W5TA 2E7XA 4EJVA 1FY7A 5E8GA 3F3XA 4CGZA 1E17A 4ESBA 2HKOA 3L00A 3ZMVA 1DP7P 2R7DA 1LDJA 4UV8A 3QAHA 1J9IA 1BOAA 1XMKA 2O61A 1S29A 2A07F 2P5VA 3JAMZ 4EJOA 2MH2A 3Q5FA 4YG2F 3WTSC 4UVBA 4HX7A 1TQMA 4JQFA 3ZQ7A 2NRAC 1U3EM 1OMIA 5FFZA 3E6DA 1RUOA 2C6YA 2BV6A 5E1XA 1RIOH 4OU0A 3P9KA 1I5ZA 3U9GA 3N97A 4M9SA 2M30A 2AS5F 3WE3A 2M1BA 4NB5A 3TO9A 3V7RA 4G7OF 4IF4A 2FA5A 2DO7A 1R1UA 4P55A 4AD9A 3EQLF 4UV9A 5JI6A 4M6YA 1KU3A 2FMLA 2A5YB 2H27A 5FFXA 3DPTA 3GYHX 2A61A 3ZMTA 3KP4A 5L3DA 2YPRA 1TTYA 1YYVA 1ZRCA 1K78B 5BS6A 2FF4A 2HGCA 1W4MA 4LB6B 5D4RA 4KA4A 1EH8A 4OOIA 3E5XA 2RN7A 4YFXF 5AONA 1YW7A 1R00A 1G3SA 5J8CA 3KE2A 2NAZA 2LKPA 3HOTA 4U88A 1Z6TA 4RB0A 2P7VB 1O3QA 4L18B 3H3UA 3J7AO 1R36A 2EA4A 1BI1A 4M71A 1S7AA 2OQGA 2HTSA 1HKSA 4OINF 4HLXA 1DPUA 1OKRA 5HOOA 1FPQA 3QPHA 6PAXA 4LJZF 1ZN2A 1ULYA 3GFMA 4I0AA 4JBAA 2VT2A 3DKWA 4G7ZF 3MEXA 1FOKA 1D8JA 3ZP5A 1FSHA 2WTEA 4KIFA 3RKYA 4RS8A 4EGYA 3C18A 3R4KA 3Q9VA 4G8XA 3ZN1A 3DFGA 1UHWA 3T1BA 2FNPA 2HQRA 5HS7A 5HLHA 1ODDA 2Q8KA 2V1XA 3M9AA 4A5MA 4ENJA 3CJNA 2HEOA 1IZ1A 2W25A 2DPDA 3ZMUA 2TDXA 1PUEE 2UWMA 4M73A 3ISPA 2L54A 3BJ6A 1EH7A 4HDUA 1H0MA 2K02A 4UHTA 3I58A 2FMYA 2DTRA 3F6OA 1P4WA 3DEUA 3GFJA 1R5GA 3SHFA 4FHTA 2O8XA 1SAXA 1XN7A 2JZYA 2FEZA 4MEYF 4Q4ZF 1LJ9A 3N4MA 4KT5C 1SD4A 3ZMDA 3M8FA 5KK1A 3QPTA 2L02A 5CVRA 2XROA 1X3UA 2EJRA 2MD5A 2ETHA 2NS0A 5BPDA 4MQVA 2FSWA 2CO5A 2OZ6A 4RB2C 2GIVA 4N9HA 1LDKB 1IXRC 1K79A 3G3ZA 1YTYA 5KVRA 2CQKA 5ILVA 4HLYA 1GXQA 4I98B 4O6JA 1XDSA 5E18F 2F5FA 4EGZA 1MGTA 2XKPA 3KP5A 2LSOA 4UXNA 5ILSA 2HTJA 4S05A 1NHAA 3LA3A 2CFXA 4OIPF 5J6XA 2JSCA 3H92A 2STTA 3GZ6A 1H9TA 4U0YA 2RVCA 5D5XB 2ESNA 5BMZA 1BI2A 2EFQA 4U7DA 4M9XA 3LAPA 4HV5A 1K6OA 3RPQA 3KP2A 2L4AA 1O7LA 4HQEA 2XAHA 3HTUA 3QU3A 1RI7A 1FZPB 5CVJA 4P96A 3KZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LEA A;  1WQ2 A;  1IF1 A;  5ILU A;  4PDK A;  1ZH5 A;  1I6X A;  3F22 A;  2LDU A;  4HX4 A;  5F6F A;  1ZG5 A;  3E5U A;  4HAM A;  3ECH A;  3I53 A;  4Q5S F;  2IT0 A;  3GZ5 A;  2PJP A;  3EET A;  4M9Z A;  1ZAR A;  3LA2 A;  3QP6 A;  3GO5 A;  5H6Q A;  4RB1 A;  1YW9 A;  4M72 A;  1RNL A;  5L3C A;  2BEO A;  2CG4 A;  3GVA A;  2Z9O A;  3P7N A;  2D2W A;  4CYD A;  1AOY A;  5HLG A;  1IRG A;  1BBY A;  2Z3Y A;  2RQP A;  1SMY F;  3K1P A;  2VON A;  3JSO A;  2DAO A;  2RV8 A;  4KIB A;  3L2C A;  4JK1 X;  3RDI A;  2KKO A;  4O5V A;  2XAF A;  5LRS A;  2PI0 A;  5D8L B;  1J75 A;  1TNT A;  2DLL A;  2O3F A;  1TW3 A;  4CIC A;  4WXD A;  3LST A;  5D5U B;  1W7P A;  3B73 A;  1KA8 A;  4KN4 X;  4EJT A;  1MDM B;  3D5L A;  1F4K A;  2GWR A;  2H09 A;  1S7O A;  2PLY A;  1Z7U A;  4ON0 A;  3HHG A;  2W85 A;  1D8K A;  1STZ A;  2O03 A;  1L3L A;  3RJP A;  5A2Q Z;  1U2W A;  2H94 A;  3FM3 A;  1LVA A;  2FBH A;  2QQB A;  3GFL A;  4GXO A;  4XRF A;  1LB2 A;  2H6C A;  2XAS A;  3SQN A;  2ADU A;  1FBU A;  3G73 A;  1OYY A;  4GGG A;  1WRJ A;  2HWV A;  2RKH A;  1P4X A;  2DK8 A;  3SZT A;  2EFP A;  4OMY A;  2OZU A;  5FO5 A;  1IUY A;  2QQA A;  2VC0 A;  1JHH A;  4U7B A;  4BHP A;  1BC7 C;  4XLN F;  1T2K A;  1IXS B;  2VE9 A;  1Z91 A;  2F2E A;  2DK5 A;  3KP3 A;  3U1D A;  2BGC A;  1W7P B;  1TBX A;  4ASN A;  3TKY A;  1SMT A;  2XAJ A;  1MZB A;  4TV7 A;  3TGN A;  2BBY A;  2FU4 A;  2FBK A;  1I1G A;  2QWW A;  1R1V A;  1IN4 A;  3BJO A;  2Q2E A;  2VBX A;  3TDZ C;  4E70 A;  4L0Y B;  1DPR A;  2QQ9 A;  5F64 A;  2ZCW A;  5BOX A;  4BHC A;  3VEP A;  3F23 A;  1MJ9 A;  1MD0 A;  1YS7 A;  4YIF A;  5LHI A;  1G6N A;  2UZK A;  4GCV A;  4IPA A;  1RUN A;  1KQ9 A;  3CUQ B;  5L3E A;  1P4A A;  4L9T A;  3HYI A;  1BJA A;  2VOP A;  2OAZ A;  2VBW A;  3I5U A;  2XRN A;  1XGO A;  2ZJ2 A;  1O57 A;  1BN5 A;  3ULQ B;  1ON2 A;  1S3J A;  3MCZ A;  2GXB A;  1IXC A;  1T0F A;  3HHH A;  1JXS A;  4XSX F;  5L3B A;  2GQQ A;  5DCM A;  1MJA A;  1DDN A;  1UST A;  3LQQ A;  4EM1 A;  1ONV A;  3RIR A;  1J5Y A;  5E1Z B;  1IAW A;  2WWY A;  4KFC A;  1FT9 A;  2P4W A;  4LLN A;  3I71 A;  5CVI A;  3JTG A;  2GAU A;  3DXJ F;  3R0A A;  5D8K B;  1IN8 A;  3E6M A;  3BWG A;  2V1U A;  3OOP A;  2IRF G;  5D6F A;  3R6S A;  3FXU A;  2DQL A;  4L9J A;  3RKX A;  2RGV A;  3GX4 X;  2EK5 A;  4HF2 A;  3CUQ C;  3B02 A;  4EJU A;  1XSX A;  1IN5 A;  1SFU A;  1V3F A;  1A04 A;  2ZKZ A;  2E7W A;  2HDC A;  2STW A;  1FYK A;  2VOO A;  5IT9 Z;  2QZ8 A;  3LFK A;  1KQ8 A;  3PQJ A;  2ZME A;  1HW1 A;  2ELH A;  2ZXJ A;  4CHU A;  5LHG A;  3GXO A;  3WTT C;  2R7F A;  3QRF F;  4MNU A;  3KP6 A;  2LF8 A;  2EA2 A;  3ZPL A;  3E97 A;  1YG2 A;  3M7G A;  2J5P A;  2FOK A;  1FYM A;  3COA C;  2MLG A;  2P8T A;  1I1S A;  2QYO A;  1GVJ A;  3WOD F;  3GLX A;  1QBJ A;  5LGN A;  5EEG A;  4OIR F;  2COM A;  4YFN F;  2EV5 A;  4MTD A;  3WTW C;  2P6T A;  4DNC A;  5HS8 A;  4IRG A;  1QGP A;  1D3Y A;  3DV8 A;  2MLK A;  5CLS A;  3WGI A;  3R61 A;  3F8M A;  3PQK A;  2HYF A;  2B0L A;  1T98 A;  3BP8 A;  3EYI A;  2K4J A;  4MGR A;  2VE8 A;  4ZYH A;  3IKT A;  2PQ8 A;  4DQ2 A;  4U0V A;  2FE3 A;  2W24 A;  5FD6 A;  2L3D A;  4HYE A;  3P9C A;  4OIQ F;  4BNC A;  4LG0 A;  2KIU A;  5JR3 A;  2O6G E;  2EB7 A;  1QZZ A;  2FRH A;  1ZLK A;  3FF5 A;  2ACJ A;  1UB9 A;  3WTY C;  2GZW A;  2W57 A;  4RAZ A;  3VOD A;  1KU9 A;  4ZYG A;  1YFH A;  1XGS A;  1G3Y A;  2PMH A;  5DDG A;  1J2X A;  4RB3 C;  3K1M A;  5L3F A;  2VBZ A;  2GA1 A;  3MZY A;  2DQR A;  2XAG A;  1SD5 A;  3V7C A;  4WF2 A;  3J81 K;  4R1H A;  4NHJ A;  1QPM A;  1DUX C;  3LWF A;  2OBP A;  4H0E A;  2HYG D;  4CDG A;  1G4D A;  3GUD A;  1R5H A;  2XUB A;  3DF8 A;  2A6H F;  4ESJ A;  5HVQ C;  2G7U A;  1GHC A;  2V79 A;  3F8N A;  4OIO F;  4LG0 B;  4IHS A;  1REP C;  1WWX A;  1E2X A;  3ELK A;  1BI3 A;  2QBY A;  1XSV A;  2YR2 A;  1TLH B;  4CZZ A;  2D1H A;  4Y13 A;  5HDN A;  5BQT A;  3TOA A;  1KQ0 A;  4MTE A;  1KGS A;  3H3Z A;  3RYR A;  2FXA A;  4YFK F;  4IVN A;  5DUK A;  2D1V A;  4UVA A;  2UXN A;  2IJL A;  4BYY A;  5CJ9 A;  2NNY A;  4KIG A;  5J8F A;  1G3T A;  1U6G A;  3KEQ A;  3CDH A;  4GYI A;  1QQI A;  5LBQ A;  5LHH A;  2Z99 A;  4D0P A;  4A0X A;  2OU2 A;  3KET A;  4YII A;  4EVI A;  3O3K A;  5D5V B;  4I09 A;  1LDD A;  4L5J A;  4IRH A;  4G9Y A;  3DQV C;  1UFM A;  3FXR A;  4A6D A;  4BXU A;  1P92 A;  3I59 A;  3V7S A;  3J80 Z;  3F8B A;  3K0L A;  4KMF A;  3GEZ A;  4EQQ A;  1FNN A;  1FWZ A;  2EFO A;  1EH6 A;  4KYW A;  1QZY A;  5HDG A;  2W84 A;  2IA0 A;  1B6A A;  1WKM A;  3BPV A;  2D45 A;  2K7L A;  4XSZ F;  1HW2 A;  3BY6 A;  5FLX K;  1FLI A;  4ZZD A;  3I64 A;  1RZ4 A;  5FB2 A;  2VN2 A;  2Y0M A;  3EUH A;  5D5W B;  5DUI A;  3KZZ A;  1AWC A;  3V8K A;  1O3T A;  3CO7 C;  2RNJ A;  3EDP A;  5E1W A;  1Y0U A;  4RGR A;  5DYM A;  1HXD A;  1U5T A;  3T0Y A;  2V9V A;  4KN7 X;  1HBX G;  4WWC A;  2P5K A;  5LEK A;  2M8E A;  1HSJ A;  3HRS A;  2FQ3 A;  4HZF A;  4KIC A;  2EFN A;  2X0L A;  3WTZ A;  4F7Z A;  5TJJ A;  2EWN A;  1JGS A;  1XMA A;  1J59 A;  2KJC A;  4I02 A;  4ZH4 F;  2EFW A;  5K1Y A;  4KMU X;  4XBF A;  1QO0 D;  1OYW A;  1TW2 A;  2JPC A;  1IN6 A;  2F5D A;  4L5I A;  3I4P A;  3FM5 A;  1IW7 F;  1ZAO A;  2A68 F;  1KU2 A;  2PFB A;  3JAM K;  2Z5U A;  4N0B A;  5DD8 A;  2K27 A;  1B9M A;  3NEU A;  2NYX A;  1XGN A;  2F5E A;  2ZO4 A;  4BAY A;  1Z9C A;  1YLF A;  5AIP A;  1K7A A;  1S6L A;  3RI4 A;  2DU9 A;  3JW4 A;  5L3G A;  4RGU A;  5DEQ A;  5CVU A;  2QM3 A;  2Z33 A;  3R0J A;  4U0W A;  3MQ0 A;  4A12 A;  5IT3 A;  1LQ1 A;  2DPU A;  2DFI A;  3JSP A;  4ESF A;  3TO6 A;  2XAQ A;  1CF7 A;  1H9G A;  3IC7 A;  1T39 A;  3HRU A;  5F1R A;  1R58 A;  1QNT A;  1MJB A;  4ZZL A;  1WSU A;  2RDP A;  3E6B A;  1PDN C;  4ZYD A;  4HX8 A;  1I27 A;  5CYV A;  3C7J A;  1LEB A;  1YS6 A;  3GWZ A;  1ZG3 A;  2RC4 A;  4IHT A;  2QEN A;  4BQA A;  1XD7 A;  1GXP A;  2OQR A;  3W6K B;  5LEJ A;  3K1N A;  3ZMZ A;  2A3S A;  5ERI A;  2EV0 A;  1P2F A;  3IRR A;  4QLC U;  2M45 A;  3E3V A;  5H20 A;  1L0O C;  1O3R A;  2FNA A;  4LK1 F;  1FP2 A;  3V4G A;  4B8X A;  1ZLJ A;  4AIJ A;  2YX4 A;  4HA8 A;  1KYW A;  3O6B B;  4O3M A;  2XV4 S;  3BPX A;  1U8R A;  5BPI A;  5D6E A;  1IRF A;  2HQN A;  3C3W A;  4GYG A;  1IN7 A;  3KLN A;  1ZRF A;  4L9V A;  4LB5 A;  1O7F A;  2HKX A;  1F5T A;  3D0S A;  1YQA A;  2JPB A;  5TRD A;  2QLZ A;  2XGX A;  2VC1 A;  4GO1 A;  1R7J A;  5LGU A;  4AIK A;  3T5X A;  3F8F A;  3M8E A;  3VB2 A;  4HOB A;  3F72 A;  4UVC A;  2DBB A;  3FX3 A;  3TO7 A;  1K78 A;  2HZT A;  5DV5 A;  4WXC A;  4LGW A;  1J7K A;  1W5S A;  2VT3 A;  2KJB A;  2CGP A;  3JTH A;  3RKW A;  2IPQ X;  3IWF A;  2YX7 A;  4P5O A;  3PFI A;  4WCG A;  4UNO A;  2LF7 A;  1FSE A;  4UUV A;  3LA7 A;  3REO A;  2PN6 A;  4LK0 F;  2HFH A;  1HKQ A;  1HST A;  2A69 F;  2JRT A;  5DCM B;  2ZNZ A;  2CWE A;  1VTN C;  5K5Q A;  2VOD A;  3KP7 A;  2CYY A;  4P9U A;  2R3S A;  3E5Q A;  1UHM A;  4FX0 A;  4R8H A;  1J0R A;  1KYZ A;  3L09 A;  4S04 A;  2BYV E;  3WU0 A;  3MFK A;  1T38 A;  3Q9S A;  4N9I A;  1R1T A;  2ISZ A;  1B59 A;  4RAY A;  5DCF A;  4IRI A;  1F1Z A;  2NNN A;  2KIF A;  3BRO A;  4LLG F;  1R23 A;  1YIO A;  2KIM A;  3F8C A;  4WX9 A;  2ZBK A;  1ZHF A;  4WXH A;  2ESH A;  4LFU A;  4AIH A;  3IHU A;  4MQ9 F;  1SD7 A;  1O3S A;  2P5L C;  5LLQ A;  1XCB A;  4KNY A;  4ENK A;  1OR7 A;  1U78 A;  3WTV C;  1ZGA A;  5EEH A;  4L9N A;  4P9F A;  4A0Z A;  4B09 A;  5ICE A;  4HBL A;  4Z2Y A;  2XIG A;  1G3W A;  2YSR A;  3SFZ A;  3CO6 C;  2FBI A;  4KUM A;  3I0T A;  4LLL A;  3FMR A;  4CO8 A;  4MHG A;  2ZME B;  2VXZ A;  4EM2 A;  1TQI A;  4PGG A;  2Y48 A;  2PG4 A;  3DP7 A;  5ICG A;  2MBF A;  1OPC A;  3GF2 A;  2IW5 A;  4HQM A;  5FGM A;  2M87 A;  4I01 A;  4ETS A;  3SZP A;  3ROU A;  2XHK A;  1R22 A;  1HW5 A;  3F21 A;  1Q1H A;  3NRV A;  3K2Z A;  4RGX A;  4AWX B;  2EV6 A;  3MZH A;  3MWM A;  2P7C B;  2PEX A;  1UCR A;  3ABT A;  3L9F A;  1PP8 F;  3WGH A;  3J80 K;  1Z1D A;  3HSR A;  5K5R A;  5HS9 A;  4LMY A;  4EV0 A;  4ENM A;  1JE8 A;  3V8L A;  1ZGJ A;  3ZN0 A;  3CUO A;  1XB4 A;  5AIQ A;  1YO5 C;  3IWZ A;  3O2P E;  3E6C C;  3FZV A;  4HF1 A;  4FT8 A;  3ECO A;  1PP7 U;  4KDP A;  4QWQ A;  1YW8 A;  1ZG1 A;  4OMZ A;  2PMU A;  4A0Y A;  2HOE A;  3TDU C;  1S8N A;  4IJA A;  4PGH A;  2L01 A;  3W6J B;  2WV0 A;  3V8J A;  2IP2 A;  3ERE D;  2L4M A;  3KCC A;  1SD6 A;  4Y15 A;  3TQN A;  3RYP A;  3U2R A;  1BIB A;  2LNB A;  1CGP A;  3HOS A;  3IRQ A;  4I2O A;  1XGM A;  5LGT A;  2F5C A;  3FHZ A;  2K4B A;  2DI3 A;  2Y75 A;  4L0Z B;  3KLO A;  3BDD A;  5HDK A;  2XVC A;  2GA2 A;  5K5O A;  3FWE A;  2G7H A;  3WE2 A;  3WG9 A;  3R60 A;  5A2Q K;  1B9N A;  4WK8 F;  1P6R A;  3VFZ A;  3NQO A;  2V6C A;  2KRF A;  1B4A A;  5CVV A;  1HQC A;  1WI9 A;  3S2W A;  4PCQ A;  3QU6 A;  4EJW A;  1HKT A;  2IA2 A;  1FP1 D;  3C1D A;  2O0Y A;  4EM0 B;  3MAJ A;  2JTV A;  2J5O A;  4XLP F;  3K69 A;  3GFI A;  2QBY B;  3ML6 A;  1SFX A;  2H6B A;  1BIA A;  4A5N A;  3P9I A;  4M74 A;  1MDM A;  4EMS A;  4M6X A;  5DD4 A;  1FX7 A;  2HR3 A;  5ICF A;  1KU7 A;  3RPU A;  4RGS A;  3AAF A;  1USS A;  3L7W A;  5H6R A;  4Q47 A;  5E17 F;  1B1B A;  3BJA A;  1ZRE A;  3J81 Z;  4MEX F;  4IXA A;  2XKO A;  3OV8 A;  1ZYR F;  4I7H A;  2V1D A;  3DPL C;  3CTA A;  3KFW X;  1D5V A;  3KEO A;  3HIF A;  3BZ6 A;  2ZNY A;  2X4H A;  5ICC A;  1Z05 A;  5ED4 A;  1BC8 C;  1MKM A;  3LQR A;  3I59 B;  3F6V A;  1ZRD A;  5HLI A;  3QP5 A;  4CXF A;  3M1E A;  3RTR A;  1FBS A;  2VBY A;  1V4R A;  3QOP A;  1BI0 A;  2HS5 A;  3FMS A;  4AVP A;  2PBI A;  3HSE A;  1FYL A;  3WGG A;  3HSF A;  3T8R A;  1XDU A;  1ON1 A;  3TOB A;  1BM9 A;  2E1C A;  2M5W A;  2QUF A;  3IKV A;  2DW4 A;  1FC3 A;  3WTX C;  2A6E F;  3HRM A;  4HV6 A;  4G6D A;  5E20 A;  1TNS A;  2MA3 A;  3CLO A;  1XCV A;  2GXG A;  1W7P D;  2MH9 A;  1U5T B;  2QVO A;  4LD5 A;  2OA4 A;  3HUG A;  4BH9 A;  2P6S A;  3K9T A;  4HW0 A;  3WU1 B;  5JVT A;  2G9W A;  1XSD A;  4ENN A;  3WTU C;  3CUQ A;  4HF0 A;  1FBQ A;  2ZFW A;  3EYY A;  2CW0 F;  5LRR A;  3HRT A;  2DT5 A;  3FXQ A;  3HTS B;  2JT1 A;  5D4S A;  2K86 A;  3ABU A;  4Y17 A;  4HDV A;  1F9N A;  2IA1 A;  2Q0O A;  3ZMS A;  4A2U A;  5FLX Z;  4G6Q A;  2AXL A;  5JFR A;  2OD5 A;  3LAJ A;  5JHU A;  1C0W A;  4A6E A;  4G7H F;  2ISY A;  3I54 A;  3GW2 A;  5IT9 K;  2BE5 F;  4I0B A;  5E8I A;  5FD5 A;  1TQP A;  2UXX A;  1JHF A;  3IL2 A;  3T8T A;  1T6S A;  1Z6R A;  2YU3 A;  1SFE A;  4R79 A;  4Q48 A;  2IVM A;  4K2E A;  3BOQ A;  1EV7 A;  4NQW A;  3VOE A;  4BHB A;  4G94 A;  2WC2 A;  2CSO A;  4ZYE A;  2MC3 A;  3FMQ A;  1OYI A;  4FX4 A;  1CF7 B;  1U5T C;  4PZJ A;  3SXY A;  2E1N A;  1LNW A;  1W5T A;  2E7X A;  4EJV A;  1FY7 A;  5E8G A;  3F3X A;  4CGZ A;  1E17 A;  4ESB A;  2HKO A;  3L00 A;  3ZMV A;  1DP7 P;  2R7D A;  1LDJ A;  4UV8 A;  3QAH A;  1J9I A;  1BOA A;  1XMK A;  2O61 A;  1S29 A;  2A07 F;  2P5V A;  3JAM Z;  4EJO A;  2MH2 A;  3Q5F A;  4YG2 F;  3WTS C;  4UVB A;  4HX7 A;  1TQM A;  4JQF A;  3ZQ7 A;  2NRA C;  1U3E M;  1OMI A;  5FFZ A;  3E6D A;  1RUO A;  2C6Y A;  2BV6 A;  5E1X A;  1RIO H;  4OU0 A;  3P9K A;  1I5Z A;  3U9G A;  3N97 A;  4M9S A;  2M30 A;  2AS5 F;  3WE3 A;  2M1B A;  4NB5 A;  3TO9 A;  3V7R A;  4G7O F;  4IF4 A;  2FA5 A;  2DO7 A;  1R1U A;  4P55 A;  4AD9 A;  3EQL F;  4UV9 A;  5JI6 A;  4M6Y A;  1KU3 A;  2FML A;  2A5Y B;  2H27 A;  5FFX A;  3DPT A;  3GYH X;  2A61 A;  3ZMT A;  3KP4 A;  5L3D A;  2YPR A;  1TTY A;  1YYV A;  1ZRC A;  1K78 B;  5BS6 A;  2FF4 A;  2HGC A;  1W4M A;  4LB6 B;  5D4R A;  4KA4 A;  1EH8 A;  4OOI A;  3E5X A;  2RN7 A;  4YFX F;  5AON A;  1YW7 A;  1R00 A;  1G3S A;  5J8C A;  3KE2 A;  2NAZ A;  2LKP A;  3HOT A;  4U88 A;  1Z6T A;  4RB0 A;  2P7V B;  1O3Q A;  4L18 B;  3H3U A;  3J7A O;  1R36 A;  2EA4 A;  1BI1 A;  4M71 A;  1S7A A;  2OQG A;  2HTS A;  1HKS A;  4OIN F;  4HLX A;  1DPU A;  1OKR A;  5HOO A;  1FPQ A;  3QPH A;  6PAX A;  4LJZ F;  1ZN2 A;  1ULY A;  3GFM A;  4I0A A;  4JBA A;  2VT2 A;  3DKW A;  4G7Z F;  3MEX A;  1FOK A;  1D8J A;  3ZP5 A;  1FSH A;  2WTE A;  4KIF A;  3RKY A;  4RS8 A;  4EGY A;  3C18 A;  3R4K A;  3Q9V A;  4G8X A;  3ZN1 A;  3DFG A;  1UHW A;  3T1B A;  2FNP A;  2HQR A;  5HS7 A;  5HLH A;  1ODD A;  2Q8K A;  2V1X A;  3M9A A;  4A5M A;  4ENJ A;  3CJN A;  2HEO A;  1IZ1 A;  2W25 A;  2DPD A;  3ZMU A;  2TDX A;  1PUE E;  2UWM A;  4M73 A;  3ISP A;  2L54 A;  3BJ6 A;  1EH7 A;  4HDU A;  1H0M A;  2K02 A;  4UHT A;  3I58 A;  2FMY A;  2DTR A;  3F6O A;  1P4W A;  3DEU A;  3GFJ A;  1R5G A;  3SHF A;  4FHT A;  2O8X A;  1SAX A;  1XN7 A;  2JZY A;  2FEZ A;  4MEY F;  4Q4Z F;  1LJ9 A;  3N4M A;  4KT5 C;  1SD4 A;  3ZMD A;  3M8F A;  5KK1 A;  3QPT A;  2L02 A;  5CVR A;  2XRO A;  1X3U A;  2EJR A;  2MD5 A;  2ETH A;  2NS0 A;  5BPD A;  4MQV A;  2FSW A;  2CO5 A;  2OZ6 A;  4RB2 C;  2GIV A;  4N9H A;  1LDK B;  1IXR C;  1K79 A;  3G3Z A;  1YTY A;  5KVR A;  2CQK A;  5ILV A;  4HLY A;  1GXQ A;  4I98 B;  4O6J A;  1XDS A;  5E18 F;  2F5F A;  4EGZ A;  1MGT A;  2XKP A;  3KP5 A;  2LSO A;  4UXN A;  5ILS A;  2HTJ A;  4S05 A;  1NHA A;  3LA3 A;  2CFX A;  4OIP F;  5J6X A;  2JSC A;  3H92 A;  2STT A;  3GZ6 A;  1H9T A;  4U0Y A;  2RVC A;  5D5X B;  2ESN A;  5BMZ A;  1BI2 A;  2EFQ A;  4U7D A;  4M9X A;  3LAP A;  4HV5 A;  1K6O A;  3RPQ A;  3KP2 A;  2L4A A;  1O7L A;  4HQE A;  2XAH A;  3HTU A;  3QU3 A;  1RI7 A;  1FZP B;  5CVJ A;  4P96 A;  3KZY A; 
#chains in the Genus database with same CATH topology
 1X4P A;  1BR2 A;  1LEA A;  2KHM A;  1WQ2 A;  4B48 A;  1K83 J;  1YJN I;  1IF1 A;  4DZP A;  5ILU A;  4BE0 A;  1WPK A;  3HOV J;  4PDK A;  2WY7 Q;  1ZH5 A;  1VQK I;  2XPU A;  1I6X A;  3F22 A;  2ELK A;  2LDU A;  3NWT A;  4HX4 A;  2VJJ A;  5F6F A;  1ZG5 A;  3E5U A;  4HAM A;  3OYL A;  5F0H A;  1ETV A;  2DMN A;  2CMP A;  4BE1 A;  2VQG A;  3ECH A;  1LE8 A;  2X1E A;  5IP9 J;  3I53 A;  3DTI A;  4AID A;  4Q5S F;  4UUT A;  2IT0 A;  3M3Y J;  3QWL A;  3GZ5 A;  2BXY A;  2PJP A;  2G0E A;  3EET A;  4ANJ A;  4M9Z A;  2V4J C;  1ZAR A;  4BQN A;  4RA2 A;  1NK2 P;  2JVH A;  3LA2 A;  3QP6 A;  4HEA 2;  3GO5 A;  2TCT A;  5H6Q A;  4RB1 A;  3IH2 A;  1YW9 A;  3IUO A;  2F5V A;  4M72 A;  1RNL A;  2JN6 A;  3BR0 A;  5L3C A;  2KRC A;  2BEO A;  2CG4 A;  3DCF A;  4I99 C;  1Y0N A;  3GVA A;  2Z9O A;  3HZJ A;  3P7N A;  1A6Q A;  2D2W A;  3QOE A;  2Y69 H;  3ERM A;  4CYD A;  1AOY A;  5HLG A;  2DJN A;  3AFH A;  2M8G X;  4FE7 A;  1IRG A;  1BBY A;  1JUM A;  2M9H A;  1IRX A;  2Z3Y A;  1RKW A;  2RQP A;  1SMY F;  3JR9 A;  1S7E A;  3L2W A;  3K1P A;  2VON A;  1GLN A;  3JSO A;  2BW3 A;  2DAO A;  2PMZ N;  2RV8 A;  5DS9 A;  1PVE A;  4KIB A;  2GXA A;  3MN2 A;  3L2C A;  3W2A A;  3HOW J;  5EZG A;  2EZI A;  2NXN B;  4JK1 X;  3RDI A;  2KKO A;  3DTK A;  4O5V A;  5J4V A;  2JA7 J;  2XAF A;  2KIQ A;  2IAI A;  5LRS A;  2PI0 A;  5D8L B;  3ZRG A;  1J75 A;  2JWT A;  1TNT A;  2DLL A;  3E1S A;  4A3F J;  3CC7 I;  1GT0 C;  2XGE A;  2O3F A;  1TW3 A;  4CIC A;  4CCJ A;  1VQ5 I;  4WXD A;  3LST A;  2FD5 A;  5D5U B;  1W7P A;  3B73 A;  3OYI A;  3F0C A;  3K4B A;  1KA8 A;  1OCO H;  4KN4 X;  4EJT A;  3FIS A;  1XS9 A;  1MDM B;  2K85 A;  2KIS A;  3Q0V A;  2X51 A;  3D5L A;  4NC7 A;  1F4K A;  1NTC A;  2GWR A;  2H09 A;  1S7O A;  3G6E I;  2PLY A;  1Z7U A;  3CZ6 A;  4ON0 A;  2EQR A;  1WCM J;  3HHG A;  2E35 A;  2W85 A;  1D8K A;  3ZR8 X;  1STZ A;  2OF7 A;  3CCM I;  2LY1 A;  2KP6 A;  1Y56 A;  5B1B H;  1OQY A;  1CQT A;  2O03 A;  3CCS I;  1L3L A;  3RJP A;  5A2Q Z;  1U2W A;  2H94 A;  3FM3 A;  1LVA A;  2XDV A;  2FBH A;  2LOO A;  3BC8 A;  4JOM A;  1X2N A;  1SAN A;  3BR2 A;  1HCR A;  3JRE A;  3PSI A;  1IC8 A;  2QQB A;  3GFL A;  4GXO A;  4XN0 A;  4XRF A;  1LB2 A;  3H1C A;  2H6C A;  2KQR A;  2XAS A;  3OOU A;  3SZG A;  4C3J J;  3SQN A;  2ADU A;  1FBU A;  4KT6 A;  1MH3 A;  1OYY A;  2AHQ A;  3I3L A;  3G73 A;  3S3M A;  4GGG A;  1MMA A;  2WB1 A;  1WRJ A;  2HWV A;  5IP7 J;  1FTT A;  4XRS A;  2IGN A;  2RKH A;  2OTL I;  3H35 A;  1P4X A;  3GCM A;  2DK8 A;  2ZC2 A;  4CCM A;  3KYC B;  3SZT A;  4IHX A;  2DOE A;  2EFP A;  4OMY A;  1J09 A;  2OZU A;  4DIQ A;  5F1J A;  2PX9 A;  3BZC A;  5FO5 A;  1IUY A;  2QQA A;  2XGC A;  3H0G J;  2VC0 A;  1JHH A;  4U7B A;  4XLE A;  4BHP A;  1BC7 C;  4XLN F;  1T2K A;  1IXS B;  5EDN A;  3HKZ A;  1X1P A;  2R7S A;  2VE9 A;  4PSX A;  4E7H A;  1Z91 A;  1SFK A;  2F2E A;  4C3I J;  3AL0 B;  2DK5 A;  3KP3 A;  3U1D A;  3GLL A;  2BGC A;  1TZL A;  1W7P B;  3ZGK A;  1VFC A;  4UB8 C;  4XLC A;  4F3Q A;  1TBX A;  2R7Z J;  4ASN A;  1MSF C;  2YUS A;  3CDL A;  3O8G A;  3TKY A;  2PJR B;  1XX5 A;  1SMT A;  2XAJ A;  1MZB A;  4TV7 A;  3TGN A;  2GBY A;  2I5U A;  2BBY A;  2FU4 A;  2FBK A;  4IHY A;  2VJI A;  2KDZ A;  1VZ0 A;  2MFZ A;  3ZXS A;  1I1G A;  2QWW A;  1ORK A;  1R1V A;  1IN4 A;  3BJO A;  2Q2E A;  2VBX A;  1WJD A;  1X19 A;  3TDZ C;  4E70 A;  4Y4R A;  4L0Y B;  4UUS A;  2JQ7 A;  1DPR A;  1WJB A;  4C2T A;  2CV0 A;  1MBE A;  3PUB A;  3PNV A;  2R7R A;  2QQ9 A;  4B4C A;  3FKI J;  2P81 A;  3HUG B;  4DW6 A;  1WJF A;  5F64 A;  2UUZ A;  2ZCW A;  2DMQ A;  5BOX A;  2CQN A;  4BHC A;  3BR3 A;  3VEP A;  4A93 J;  1MMN A;  3F23 A;  1MJ9 A;  1MD0 A;  1YS7 A;  4F55 A;  2DOF A;  5K7Z A;  1NG6 A;  5EEA A;  4YIF A;  3IV5 A;  3D5R C;  5LHI A;  1G6N A;  1TWF J;  2UZK A;  4GCV A;  4IPA A;  1RUN A;  3DBH B;  1KQ9 A;  3PUF A;  3RZO J;  3BCA A;  1DGR M;  1Z67 A;  1P7J A;  4XID A;  4XOP A;  1E0E A;  1G8X A;  3CUQ B;  5L3E A;  1P4A A;  1FMW A;  2X1D A;  4L9T A;  3HC7 A;  3HYI A;  2W4S A;  1OCP A;  4BQO A;  1OCR H;  5GTI C;  3QQA A;  1BJA A;  2VOP A;  1UG2 A;  2DMU A;  2OAZ A;  1NG7 A;  2VBW A;  3I5U A;  1UEL B;  1QVU A;  2Y30 A;  2XRN A;  2KRH A;  1XGO A;  3ESW B;  2ZJ2 A;  1O57 A;  3CLQ A;  3CJQ B;  2PMZ A;  3I4N J;  1BN5 A;  3ZQQ A;  3ULQ B;  1Y8R B;  2K3P A;  4BJT A;  3LNQ A;  2O5R A;  1ON2 A;  1S3J A;  3VWB A;  3MCZ A;  3AL0 C;  3ZQI A;  5DM6 F;  1IXC A;  2GXB A;  1T0F A;  2X6O A;  3HHH A;  1JXS A;  1RET A;  4XSX F;  1MNE A;  4BS9 A;  5L3B A;  2GQQ A;  4F91 B;  5DCM A;  1MJA A;  1DDN A;  4BBR J;  2NVX J;  1UST A;  2OCE A;  2LKS A;  1EA3 A;  3LQQ A;  4EM1 A;  1ONV A;  4AVZ A;  3RIR A;  1TWG J;  1J5Y A;  4UUS B;  5E1Z B;  4IOA F;  2EZH A;  2E2J J;  1IAW A;  2B7E A;  1WJC A;  2WWY A;  4KFC A;  1D1C A;  4W1U A;  1FT9 A;  4NQW B;  2P4W A;  1OIS A;  4LLN A;  3I71 A;  5M5Y J;  3MKW B;  3BG5 A;  5CVI A;  3EPZ A;  3TW6 A;  1N77 A;  2HDW A;  3JTG A;  2MC4 A;  1JKQ C;  2GAU A;  3DXJ F;  1GUU A;  3R0A A;  4ABZ A;  1Y1V J;  2HZD A;  5D8K B;  1IN8 A;  3DPU A;  3BG7 A;  3BWG A;  3E6M A;  4P1W A;  2V1U A;  3OOP A;  2IRF G;  1BA5 A;  4CCO A;  2R7W A;  5D6F A;  3BQY A;  2YS9 A;  3R6S A;  4KJZ A;  2HPM A;  2VJ5 A;  1POG A;  2ID3 A;  1VND A;  2DQL A;  2R7O A;  3FXU A;  1B72 B;  3CC2 I;  3WHB A;  4L9J A;  1YJ9 I;  4FQG A;  1BW6 A;  3RKX A;  1SFO J;  3FBI B;  2MD0 A;  2ZXI A;  1O4X A;  2P0W A;  1PUF B;  2RGV A;  2RAE A;  2DA4 A;  2IGO A;  4I6Z A;  3GX4 X;  2EK5 A;  4HF2 A;  5HNF A;  4IX7 A;  3CUQ C;  3B02 A;  4EJU A;  1XSX A;  2YU9 J;  2XAU A;  4DGW B;  1IN5 A;  2HQA A;  1V3F A;  1A04 A;  3VDX A;  1SFU A;  1TWH J;  3OYD A;  2ELJ A;  2LC2 A;  2E7W A;  2ZKZ A;  2HDC A;  2VXD A;  3OMY A;  2STW A;  4JX4 A;  1FYK A;  2E36 A;  3CC4 I;  2VOO A;  5IT9 Z;  2QZ8 A;  2FQ4 A;  1MMG A;  2V1N A;  4E7I A;  1R5I D;  3LFK A;  2M4K A;  1KQ8 A;  3MKY B;  3PQJ A;  5M3F J;  3VYS B;  2ZME A;  4Y52 J;  1HW1 A;  2ELH A;  1UG0 A;  2ZXJ A;  2Z2S B;  4CHU A;  2EIL H;  5LHG A;  3GXO A;  1X1C A;  2R7X A;  2DDA A;  1RR8 C;  3WTT C;  1TT0 A;  2K9M A;  3CCL I;  4FET A;  2ICW G;  2R7F A;  2V9K A;  3QRF F;  3FBN B;  4MNU A;  3KP6 A;  1YHQ I;  2LF8 A;  2EA2 A;  4PJ0 C;  3ZPL A;  4NNJ A;  3E97 A;  3GZN B;  2FOW A;  2UV1 A;  2X1C A;  4DYC A;  4N4N B;  2BY1 A;  3LL7 A;  2XSJ C;  1QA6 A;  3J7A Y;  5E3O A;  1YG2 A;  3PO2 J;  3M7G A;  3S8P A;  3CJR B;  2W82 A;  2K9L A;  4S0H B;  4N4O B;  2J5P A;  2KT0 A;  2FOK A;  2DCE A;  2M4G A;  3VSL A;  1FYM A;  3ASN H;  4E7Z A;  2W1O A;  2MLG A;  3COA C;  4PFP A;  2P8T A;  2VB6 A;  4V2F A;  1I1S A;  2LBF A;  1SVM A;  2QYO A;  4DYR A;  3K70 D;  1AA7 A;  1GVJ A;  3WOD F;  3KZI C;  1SAU A;  3GLX A;  1QBJ A;  5CQE A;  2OTJ I;  2Y9Z A;  5LGN A;  4G6T B;  5EEG A;  4OIR F;  1AHD P;  2DXI A;  2COM A;  4YFN F;  2EV5 A;  4MTD A;  3OYK A;  3WTW C;  1B8I B;  4BXX J;  4XKV A;  2P6T A;  4C9Y A;  2HQ5 A;  4DNC A;  5JLW A;  2O7O A;  5HS8 A;  2ZJR F;  4IRG A;  1QGP A;  1D3Y A;  3DV8 A;  3HM5 A;  2MLK A;  3S15 J;  5CLS A;  3WGI A;  2QSG X;  2F6C A;  3F8M A;  3PQK A;  2HYF A;  3R61 A;  2B0L A;  1D0Z A;  1H88 C;  1T98 A;  3BP8 A;  3EYI A;  1T0F C;  2K4J A;  3FXM A;  4ZDO A;  4MGR A;  4A3K J;  2VE8 A;  4ZYH A;  3IKT A;  2WAD A;  2PQ8 A;  3MD2 A;  4XK4 A;  3L2V A;  4DQ2 A;  3TP3 A;  3QYE A;  4U0V A;  2FE3 A;  2W24 A;  3S3O A;  5FD6 A;  2L3D A;  4HYE A;  3UKG A;  2CJJ A;  2JK3 A;  3P9C A;  2QSH X;  2NVY J;  4BNC A;  4OIQ F;  4LG0 A;  2KIU A;  1Z77 A;  2DJI A;  5JR3 A;  2D5V A;  1VI0 A;  2DA5 A;  4A3G J;  4HG2 A;  4XM3 A;  2QF7 A;  2O6G E;  5IYC J;  2EB7 A;  4XRM A;  1X4O A;  1RPW A;  3PIP F;  1QZZ A;  2FRH A;  3VSK A;  2M7B A;  2L5Q A;  4D7M A;  4NUB A;  3RCO A;  2Z16 A;  2K9Q A;  1ZLK A;  3FF5 A;  2ACJ A;  1UB9 A;  3WTY C;  2GZW A;  2W57 A;  1VQ4 I;  3PNY A;  2DMP A;  4FTH A;  5J4Y A;  4RAZ A;  3VOD A;  3OL4 A;  1WH5 A;  1KU9 A;  3WHC A;  4ZYG A;  4QPO A;  1K4T A;  1U8B A;  1YFH A;  1XGS A;  1G3Y A;  1YE9 A;  2PMH A;  5DDG A;  1J2X A;  3S2D J;  3MKL A;  4RB3 C;  1QRY A;  3BR6 A;  3K1M A;  4RM3 A;  5L3F A;  4CSW A;  2VBZ A;  4A3L J;  2GA1 A;  3L2R A;  3MZY A;  1KON A;  2DQR A;  2XAG A;  1GV2 A;  4L5E A;  2COB A;  1SD5 A;  3V7C A;  2IS6 A;  4WF2 A;  3J81 K;  1XTA A;  4R1H A;  1I6H J;  4NHJ A;  2F4O B;  1R6R A;  2L9R A;  1MBG A;  1N78 A;  1QPM A;  1DUX C;  4PUS A;  4CYC A;  2LKX A;  4D7N A;  3LWF A;  2OBP A;  4YRV A;  4H0E A;  2O8K A;  2HYG D;  4CDG A;  1G4D A;  3GUD A;  1R5H A;  2XUB A;  3DF8 A;  1QHG A;  3VPR A;  2A6H F;  3Q3S A;  4ESJ A;  2HVR A;  5HVQ C;  2G7U A;  1UHS A;  1GHC A;  1W1W E;  2V79 A;  3MZ8 A;  1IG7 A;  3F8N A;  2X6Y A;  2QCO A;  4OIO F;  1DU6 A;  1DP3 A;  1MBF A;  3EUK L;  4IHS A;  4LG0 B;  1REP C;  1WWX A;  1E2X A;  3ELK A;  1BI3 A;  3OSF A;  1XSV A;  2L7M P;  1TLH B;  2YR2 A;  2D1H A;  4CZZ A;  4Y13 A;  5HDN A;  2QBY A;  2LH9 A;  5BQT A;  3TOA A;  3GTL J;  3DU6 A;  1KQ0 A;  2XC7 A;  4MTE A;  1T95 A;  1LKX A;  1KGS A;  3H3Z A;  4XLF A;  1JJ6 C;  3BT9 A;  3RYR A;  2FXA A;  3DBR B;  4YFK F;  4IVN A;  1TC3 C;  1WJE A;  5DUK A;  2D1V A;  2MGQ A;  2VIX A;  2BZT A;  4RMN A;  2CRG A;  1RES A;  4UVA A;  3CCR I;  2UXN A;  2IJL A;  4BYY A;  5CJ9 A;  4C30 A;  2NNY A;  2TRT A;  4KIG A;  5J8F A;  1V55 H;  1G3T A;  1U6G A;  3JRC A;  1K61 A;  2LFB A;  3KEQ A;  3CDH A;  4GYI A;  3A0H C;  1QQI A;  5LBQ A;  5LHH A;  2Z99 A;  4D0P A;  4A0X A;  1ZQ3 P;  2BVM A;  2OU2 A;  3FKJ A;  3KET A;  2VKV A;  4YII A;  3LSR A;  2FJ1 A;  4EVI A;  3CP2 A;  2CUF A;  3O3K A;  5D5V B;  4I09 A;  1LDD A;  4L5J A;  4IRH A;  4G9Y A;  3DQV C;  3TMO A;  1OCT C;  2L9S A;  1QPI A;  3VYU B;  2V26 A;  1UFM A;  3FXR A;  9ANT A;  4A6D A;  4FE4 A;  2XF5 A;  4BXU A;  1P92 A;  1X58 A;  3I59 A;  3FHN A;  2XF6 A;  5EF6 A;  3V7S A;  1Y8Q B;  4B3A A;  3J80 Z;  3F8B A;  3K0L A;  1AKH B;  4KMF A;  2R5Z A;  3GEZ A;  4A3D J;  4EQQ A;  1FNN A;  1FWZ A;  1LPQ A;  2EFO A;  1EH6 A;  4KYW A;  2DOA A;  3B6A A;  4PJM A;  1QZY A;  5HDG A;  3O8H A;  2W84 A;  1SC7 A;  3KPH A;  2IA0 A;  1B6A A;  1WKM A;  2LVS A;  4M3B A;  3BPV A;  1FOW A;  2D45 A;  2K7L A;  3CD6 I;  4XSZ F;  3RQI A;  3BY6 A;  4A3J J;  1HW2 A;  5FLX K;  1FLI A;  4ZZD A;  3I64 A;  2MG4 A;  3KYL A;  1RZ4 A;  1JKR C;  5FB2 A;  2MSY A;  2VN2 A;  1GV5 A;  1ENH A;  2Y0M A;  2HVS A;  3EUH A;  1MMD A;  3CCJ I;  3CF5 F;  3K2A A;  1LVK A;  2W7N A;  5D5W B;  5FLV A;  5DUI A;  3KZZ A;  1AWC A;  3V8K A;  1NH3 A;  1O3T A;  4IHW A;  1UAA A;  5CQG A;  3CO7 C;  2RNJ A;  2LY2 A;  3EDP A;  5E1W A;  1Y0U A;  4RGR A;  5DYM A;  2XSD C;  1HXD A;  3OS0 A;  1U5T A;  1A6I A;  3T0Y A;  3RKQ A;  2V9V A;  2KPM A;  3H9Q A;  4KN7 X;  1OCZ H;  1HBX G;  2E2H J;  2M7A A;  4WWC A;  2P5K A;  3CMM A;  5LEK A;  2M8E A;  4E7S A;  1HSJ A;  3NAR A;  3HRS A;  2FQ3 A;  4HZF A;  4KIC A;  3RPU D;  2EFN A;  2X0L A;  2ZSI B;  2M0C A;  3WTZ A;  4C3H J;  4F7Z A;  1XPX A;  4JX6 A;  2HXI A;  2QSF X;  4AYB N;  1YX3 A;  5TJJ A;  2EWN A;  1JGS A;  2K40 A;  1XMA A;  1J59 A;  2KJC A;  3BG6 A;  4I02 A;  4ZH4 F;  1LE8 B;  3W2V A;  5GPA A;  3S93 A;  2EFW A;  4BGD A;  2R7V A;  4LIU A;  1YOV B;  3BG3 A;  2VUM J;  5K1Y A;  4KMU X;  4XBF A;  1WFX A;  1QO0 D;  1OYW A;  2VKD A;  2FX0 A;  1TW2 A;  1MBJ A;  2JPC A;  1IN6 A;  1SVO A;  3CCY A;  2F5D A;  4L5I A;  5TIS C;  3I4P A;  3FM5 A;  5J3L A;  1IW7 F;  1ZAO A;  2A68 F;  2ZB9 A;  3JRD A;  1KU2 A;  3CMA I;  2PFB A;  4NC8 A;  1HF0 A;  4BDY A;  1W0T A;  3S3N A;  2CH0 A;  4BKX A;  3JAM K;  2Z5U A;  3H36 A;  4N0B A;  5DD8 A;  2K27 A;  1B9M A;  3NEU A;  2NYX A;  3W3C A;  1XGN A;  3ASO H;  2F5E A;  2ZO4 A;  4BAY A;  1Z9C A;  3S1M J;  1YLF A;  5AIP A;  1K7A A;  1S6L A;  2BW3 B;  3RI4 A;  1H8A C;  1S72 I;  3BTL A;  2DU9 A;  3BQZ A;  3JW4 A;  2DYS H;  2ZJQ F;  5L3G A;  3A01 A;  2CQQ A;  4RGU A;  2E5N A;  3AG1 H;  5DEQ A;  5C44 J;  2E34 A;  4RBO A;  3GTK J;  5CVU A;  2QM3 A;  2Z33 A;  2V6E A;  3A02 A;  3DTE A;  3R0J A;  4U0W A;  3MQ0 A;  1ZTR A;  4A12 A;  1VQL I;  1E3P A;  5IT3 A;  1LQ1 A;  2DPU A;  2DFI A;  2BHY A;  3JSP A;  5M5W J;  4ESF A;  3TO6 A;  2XAQ A;  4QIW N;  1WZ2 A;  1MNM C;  1CF7 A;  1H9G A;  3IC7 A;  1T39 A;  1UJ8 A;  3HRU A;  5F1R A;  1R58 A;  1QNT A;  3QPS A;  1MJB A;  5CKT A;  2JUG A;  4ZZL A;  1WSU A;  3KEY A;  2RDP A;  2V9P A;  3E6B A;  1G2H A;  2HXO A;  4MIM A;  1PDN C;  2EIN H;  2LRE A;  4B47 A;  4ZYD A;  4HX8 A;  1I27 A;  3HPG A;  5CYV A;  3C7J A;  3D1N I;  1LEB A;  1YS6 A;  3GWZ A;  1ZG3 A;  1IO2 A;  4NC6 A;  2RC4 A;  3TBI A;  2JA8 J;  1X1D A;  4IHT A;  2R92 J;  2QEN A;  4BQA A;  1XD7 A;  1GXP A;  4NBQ A;  3S14 J;  4XNF A;  3HL2 A;  2HI3 A;  2ECB A;  4BJ6 C;  2QEX I;  2OQR A;  3W6K B;  5LEJ A;  2OPT A;  2M3A A;  3BTI A;  3K1N A;  1IGN A;  3ZMZ A;  2A3S A;  3HDD A;  3DU5 A;  3G1L A;  2EV0 A;  5ERI A;  4AU7 A;  3K4C A;  1P2F A;  3IRR A;  4KIT B;  4QLC U;  2M45 A;  3E3V A;  5H20 A;  1RRJ A;  3A01 B;  1L0O C;  1IRZ A;  4DYQ A;  3JCU C;  2L0K A;  1O3R A;  2FNA A;  4LK1 F;  1FP2 A;  3V4G A;  4B8X A;  1EJ9 A;  2XRL A;  1ZLJ A;  4AIJ A;  3M4O J;  2DMT A;  2GIZ A;  2EZL A;  4RM2 A;  2OCC H;  5EGO A;  2YX4 A;  4HA8 A;  1KYW A;  3O6B B;  2VKH A;  4O3M A;  5FJ8 J;  3HJE A;  2XV4 S;  3BPX A;  1U8R A;  5BPI A;  3OYE A;  5D6E A;  4D5F A;  2VJ4 A;  2QKL B;  1IRF A;  2HQN A;  2JUC A;  3C3W A;  4GYG A;  3D5S C;  1FEX A;  3I55 I;  3MKZ A;  4CCK A;  2DN0 A;  1IN7 A;  1PJR A;  3KLN A;  1ZRF A;  2HOT A;  4L9V A;  1XG1 A;  4LB5 A;  4BBS J;  3DEW A;  3L2U A;  1O7F A;  2HKX A;  1F5T A;  3D0S A;  1YQA A;  2Q2E B;  2RRE A;  3HPH A;  2JPB A;  4AYB A;  1ETO A;  1S9H A;  5TRD A;  2QLZ A;  1F36 A;  3LSH A;  1X3W B;  3BZK A;  2GOM A;  2XGX A;  2VC1 A;  4GO1 A;  2BVL A;  1ZK8 A;  2HVQ A;  4XON A;  4Z6Y A;  1R7J A;  4FAS D;  5LGU A;  3F8F A;  3T5X A;  4AIK A;  2QGU A;  3M8E A;  3VB2 A;  2IEK A;  4V2G A;  1W36 D;  1JTX A;  1ACI A;  1IV8 A;  4HOB A;  3F72 A;  4M3G A;  4UVC A;  2DBB A;  3FX3 A;  3I56 I;  3TO7 A;  1K78 A;  2HZT A;  5DV5 A;  1RR7 A;  4WXC A;  2OJE D;  3DEE A;  1E3O C;  1DGW Y;  3FK6 A;  5H2F C;  4LGW A;  3IP4 B;  2VAS A;  2WAQ N;  2L9N A;  3OYH A;  1J7K A;  1W5S A;  4BXF A;  4BY7 J;  4PJN A;  5F27 A;  2VT3 A;  2KJB A;  3SJM A;  4QPQ A;  2CGP A;  1FTZ A;  1Z21 A;  4MFE A;  2KDO A;  4II2 A;  4A69 C;  3JTH A;  3RKW A;  4A3E J;  4BE2 A;  1T33 A;  2JA6 J;  3A1Y A;  2F4I A;  2IPQ X;  3IWF A;  2YX7 A;  4P5O A;  5C4J J;  3PFI A;  4WCG A;  4UNO A;  2LF7 A;  1FSE A;  2OV7 A;  4UUV A;  3LA7 A;  3REO A;  1BR1 A;  2PN6 A;  1M1E B;  2EH3 A;  1K4S A;  4LK0 F;  2HFH A;  4CA0 A;  1HKQ A;  4OAZ A;  4HST A;  1HA8 A;  1HST A;  1ZKG A;  1E3H A;  1VF9 A;  5IY5 H;  1A36 A;  2A69 F;  3HOZ J;  3HG9 A;  3CCE I;  1U9O A;  1IDY A;  2JRT A;  4BEH A;  5J47 A;  4A3M J;  5DCM B;  2LP0 A;  2ZNZ A;  2CWE A;  1VTN C;  5J1R A;  5K5Q A;  1BW5 A;  3I4M J;  3Q0W A;  5KCM A;  1HDP A;  4LIT A;  3KP7 A;  2CYY A;  3OIQ A;  5GTH C;  4P9U A;  2JA5 J;  2VOD A;  5CPR B;  2R3S A;  3H0D A;  4W97 A;  2MW8 A;  3E5Q A;  1UHM A;  1GDT A;  3QYF A;  4FX0 A;  4R8H A;  2A05 A;  2VLA A;  1J0R A;  1KYZ A;  3L09 A;  4S04 A;  2BYV E;  3WU0 A;  4G12 A;  4ZDL A;  3MFK A;  1ETX A;  4XIC A;  1T38 A;  3OYN A;  3Q9S A;  4N9I A;  1R1T A;  3VYR B;  2ISZ A;  1B59 A;  5HLT A;  5F0C A;  4RAY A;  3U1K A;  5DCF A;  4IRI A;  1F1Z A;  2VPL A;  3QPL A;  2NNN A;  3GTP J;  3K7A J;  2KIF A;  3BRO A;  4LLG F;  1R23 A;  1YIO A;  2KIM A;  3F8C A;  4WX9 A;  2ZBK A;  2K9S A;  1ZHF A;  4WXH A;  4D9J A;  4PFO A;  2ESH A;  4LFU A;  4AIH A;  3IHU A;  2HOA A;  4MQ9 F;  5EZH A;  2HPI A;  1SD7 A;  2VQC A;  1O3S A;  2P5L C;  5FKN A;  5LLQ A;  1XCB A;  4KNY A;  1P9Q C;  4XQF A;  4ENK A;  5IOZ A;  2L7K A;  1OR7 A;  3C2B A;  1U78 A;  2KMU A;  3GME A;  4D5C A;  3KX2 A;  2R5Y A;  3PNT A;  3WTV C;  1ZGA A;  1R9T J;  5EEH A;  5HOD A;  4L9N A;  4P9F A;  3S1Q J;  4A0Z A;  3DKX A;  1Y1W J;  4B09 A;  1Z7L A;  4LG3 A;  5ICE A;  1JTY A;  1HOM A;  4IQJ A;  4HBL A;  3PL8 A;  4Z2Y A;  2XIG A;  2W00 A;  1G3W A;  3KIO A;  3G2B A;  2E1O A;  2HNH A;  4XR6 A;  1BJZ A;  2YSR A;  3SFZ A;  1DU0 A;  2XF7 A;  3CO6 C;  1FOY A;  2FBI A;  4HNV A;  4KUM A;  3I0T A;  4LLL A;  3FMR A;  2CUE A;  4J00 A;  1VQ8 I;  4CO8 A;  2JSP A;  4MHG A;  2ZME B;  4MO7 A;  2VL8 A;  3OYA A;  2VXZ A;  4EM2 A;  1MBH A;  1TQI A;  1LFB A;  4PGG A;  4E6K G;  4GDF A;  5J40 A;  3FXL A;  5GPC A;  2IS1 A;  2Y48 A;  5EG0 A;  2PG4 A;  3DP7 A;  3ZQH A;  2MBF A;  1OPC A;  3OIO A;  5ICG A;  3CES A;  5IOY A;  2WV1 A;  3GF2 A;  3I9V 2;  2IW5 A;  2Q1Z B;  2DA6 A;  3RSN A;  1QVT A;  4HQM A;  5M5X J;  5FGM A;  4HRI A;  2M87 A;  2KZG A;  4I01 A;  2K9N A;  4ETS A;  2BY3 A;  3TW7 A;  2DFE A;  3EUA A;  3SZP A;  2IBD A;  3ROU A;  2XHK A;  1R22 A;  5KAF C;  1HW5 A;  2DOD A;  3F21 A;  4MFD A;  1Q1H A;  4IKF A;  3NRV A;  1WI3 A;  3K2Z A;  3RZD J;  2BY0 A;  4RGX A;  4AWX B;  2EV6 A;  3MZH A;  3ZQG A;  4XOT A;  1F43 A;  4M3F A;  3MWM A;  4XMY A;  2ZXW H;  3IAS 2;  3ZQC A;  2P7C B;  4PJJ A;  2PEX A;  5F0F A;  4BJ5 C;  1UCR A;  3ABT A;  2LBF B;  3L9F A;  2E19 A;  1PP8 F;  2K5C A;  3WGH A;  3J80 K;  5IPA A;  1Z1D A;  3HSR A;  5K5R A;  4XLH A;  5HS9 A;  4J19 A;  2WAQ A;  4LMY A;  4FIS A;  4ZYA A;  4EV0 A;  4ENM A;  1JE8 A;  3V8L A;  1ZGJ A;  4XRS G;  3ZN0 A;  3CUO A;  4GRI A;  3S1R J;  2MYS A;  1XB4 A;  5AIQ A;  1T08 B;  1YO5 C;  3IWZ A;  1ZEL A;  3O2P E;  1WGX A;  3E6C C;  2R93 J;  3FZV A;  4HF1 A;  4FT8 A;  3ECO A;  1PP7 U;  2BHZ A;  2R0Q C;  2CUZ A;  4KDP A;  2QQ8 A;  2IS4 A;  3GBG A;  4QWQ A;  1YW8 A;  1ZG1 A;  2DT7 B;  3ABL H;  4OMZ A;  2PMU A;  4A0Y A;  5B5E C;  2HOE A;  3OSG A;  3TDU C;  1S8N A;  4IJA A;  4PGH A;  3Q0U A;  4M6V A;  3JRF A;  1D1A A;  2L01 A;  3IAM 2;  3W6J B;  2WV0 A;  3V8J A;  2IP2 A;  4IO9 F;  1OFC X;  3ERE D;  2L4M A;  2ZME C;  3KCC A;  4J01 A;  1SD6 A;  4Y15 A;  3ABK H;  3SDB A;  3TQN A;  3B6C A;  3RYP A;  3U2R A;  3GTJ J;  1BIB A;  3H5N A;  4DOZ A;  3HOY J;  1TL8 A;  3QYB A;  2LNB A;  1CGP A;  3HOS A;  2HOS A;  3IRQ A;  5JVG F;  4I2O A;  1FOX A;  3K70 C;  3CCQ I;  5TGT A;  1XGM A;  5LGT A;  3H9G A;  3TED A;  4UY8 I;  2F5C A;  3FHZ A;  1KZH A;  2K4B A;  4ZTF A;  2DI3 A;  1D0X A;  2Y75 A;  2DFH A;  3L2Q A;  2E2I J;  4L0Z B;  3HOU J;  3KLO A;  4ZC3 A;  3BDD A;  5HDK A;  2XVC A;  2HYJ A;  1UZC A;  2GA2 A;  4NDL A;  5K5O A;  4IHV A;  3FXJ A;  3A2K A;  5K7H A;  3FWE A;  3BR5 A;  5FKK A;  2G7H A;  3CF2 A;  4PJL A;  3WE2 A;  3WG9 A;  4UB6 C;  2BXZ A;  3R60 A;  5A2Q K;  1U0J A;  1B9N A;  3C2H A;  3H5R A;  4WK8 F;  1QU3 A;  2CQ7 A;  1P6R A;  2Y2Z A;  2Y31 A;  3BTJ A;  2V6C A;  3NQO A;  3VFZ A;  2KRF A;  1B4A A;  2VKE A;  5CVV A;  1HQC A;  1WI9 A;  2DA1 A;  1Z3X A;  3S2W A;  1K6Y A;  2BY2 A;  2KZV A;  2KLO A;  1QHH D;  3MMY B;  4CYC B;  2ZFU A;  1YI2 I;  4PCQ A;  4QTR A;  5KAI C;  4BU2 A;  3H9J A;  3QU6 A;  4EJW A;  1HKT A;  4D1Q A;  2IA2 A;  2EIK H;  1FP1 D;  3JRH A;  2CS3 A;  3C1D A;  2O0Y A;  4IEJ A;  4EM0 B;  3MAJ A;  1FIP A;  2NOG A;  2JTV A;  1VQ9 I;  1V5F A;  1IV6 A;  3QOD A;  2J5O A;  3OYJ A;  4EEF G;  4A3I J;  4XLP F;  3K69 A;  3M07 A;  1ETQ A;  3GFI A;  5B66 C;  2QBY B;  3CMY A;  4BDZ A;  2DFF A;  4F92 B;  1ETY A;  1I50 J;  2LD5 A;  1I3A A;  3ML6 A;  3PSF A;  2L7Z A;  1SFX A;  4JX5 A;  3UNG C;  4YIR X;  3LSK A;  2H6B A;  4B1R A;  3HOX J;  1YJW I;  4M3D A;  2RNG A;  1BIA A;  3IH4 A;  3OIP A;  1EKE A;  3OS1 A;  4A5N A;  3P9I A;  2DDB A;  2WAE A;  4M74 A;  1MDM A;  2GM4 A;  2LY9 A;  2ME0 A;  4EMS A;  3OS2 A;  1IUF A;  5FKO A;  5J1U A;  4M6X A;  5E3M A;  1H89 C;  5DD4 A;  1FX7 A;  2HR3 A;  5ICF A;  1KU7 A;  3RPU A;  5FRN A;  4RGS A;  3AAF A;  4CUG A;  4HNU A;  1XC5 A;  1USS A;  3L7W A;  4XKB A;  5H6R A;  4Q47 A;  5E17 F;  1B1B A;  2VQH A;  3BJA A;  4AC0 A;  1ZRE A;  3J81 Z;  4MEX F;  4IOC F;  4IXA A;  4XL9 A;  2XKO A;  3OV8 A;  1ZYR F;  3ZQF A;  4GFB A;  4OAY A;  4I7H A;  3GTM J;  2V1D A;  2IGM A;  5FKM A;  3DPL C;  3CTA A;  4E7J A;  3KFW X;  1D5V A;  3KEO A;  3HIF A;  3BZ6 A;  2ZNY A;  1P7I A;  2X4H A;  5ICC A;  1Z05 A;  4I76 A;  2OC6 A;  2W48 A;  5ED4 A;  1BC8 C;  3LSI A;  2GOX B;  1MKM A;  3LQR A;  4RAF A;  3X2Q H;  3I59 B;  1YIJ I;  3F6V A;  1ZRD A;  5HLI A;  5DM7 F;  2MAB A;  3QP5 A;  3K4M A;  2CV2 A;  1WHU A;  4CXF A;  3M1E A;  1R4M B;  3RTR A;  2R5Z B;  1FBS A;  2I8D A;  2NS8 A;  2VBY A;  3W2W A;  2IS2 A;  4PSW A;  2QA4 I;  1V4R A;  3QOP A;  1BI0 A;  2HS5 A;  2EIM H;  3FMS A;  4AVP A;  3F9K A;  3ABM H;  5EJC A;  1OCC H;  1YRN A;  1WJA A;  2PBI A;  2CUJ A;  3HSE A;  2WY8 Q;  3E7L A;  3WGG A;  2NOJ B;  2VI6 A;  3HSF A;  1FYL A;  3T8R A;  1XDU A;  2A5W A;  1ON1 A;  3OL3 A;  3BCB A;  3HBL A;  3JRA A;  1HC8 A;  2V7F A;  2AXT C;  3TOB A;  4IZZ A;  1BM9 A;  4YEJ A;  2E1C A;  2M5W A;  2QUF A;  3IKV A;  4U87 A;  1LFU P;  2DW4 A;  2JMW A;  1FC3 A;  3WTX C;  2A6E F;  2PJR A;  3HRM A;  4HV6 A;  3PJR A;  1OLT A;  1JT6 A;  3PFY A;  3KYD B;  4G6D A;  5E20 A;  1TNS A;  1VQ6 I;  5B3S H;  2MA3 A;  3G1M A;  3CLO A;  4B44 A;  1X1A A;  1XCV A;  4KIS A;  5GAE J;  4Y3O A;  2GXG A;  3CDI A;  1W7P D;  3LSJ A;  2MH9 A;  1IDZ A;  3AG4 H;  1ETK A;  1U5T B;  4Y33 A;  4B3X A;  2QVO A;  5KHD A;  1IJW C;  4LD5 A;  2Z1D A;  2OA4 A;  1MBK A;  1N25 A;  3HUG A;  3DLA A;  4BH9 A;  3G4S I;  2QKM B;  2P6S A;  4LOC A;  2LK2 A;  3A0B C;  3K9T A;  2M2E A;  1MSE C;  4HW0 A;  4ZTJ A;  3ZOB A;  2XB0 X;  2R4G A;  5JVT A;  3WU1 B;  3OYC A;  4BL0 B;  4BQQ A;  2NVQ J;  5GAG J;  2G9W A;  1FIA A;  1XSD A;  4ENN A;  2NVT J;  3WTU C;  3CUQ A;  4HF0 A;  1FBQ A;  2ECC A;  2ZFW A;  3EYY A;  5F08 A;  2R7T A;  3K10 A;  1YRN B;  2CW0 F;  5LRR A;  3L1P A;  1JJ8 C;  3HRT A;  2DT5 A;  2KL4 A;  3FXQ A;  3HTS B;  2JT1 A;  5D4S A;  2K86 A;  2AQE A;  3ABU A;  4Y17 A;  3GTQ J;  3SYT A;  3OY9 A;  1YIT I;  4HDV A;  1F9N A;  2IA1 A;  1VQM I;  2Q0O A;  4JYK A;  4A2U A;  3ZMS A;  3FXO A;  5FLX Z;  4G6Q A;  2DYR H;  1TT5 B;  2AXL A;  5JFR A;  2OD5 A;  1V54 H;  3LAJ A;  3CP8 A;  5JHU A;  1C0W A;  4A6E A;  5E79 C;  3LFU A;  3CJT B;  2M0M A;  1JKO C;  4G7H F;  2ISY A;  3I54 A;  3GW2 A;  5IT9 K;  1TP4 A;  2BE5 F;  4I0B A;  5E8I A;  1V5E A;  3J7Z I;  4PK4 A;  5FD5 A;  1TQP A;  2UXX A;  4BY1 J;  1OJL A;  1U9N A;  5LFA A;  1JHF A;  4RAG A;  3K4N A;  3FK7 A;  3IL2 A;  3EUH C;  3T8T A;  5IYB J;  1T6S A;  1Z6R A;  2YU3 A;  2ID6 A;  1SFE A;  2EZK A;  2LG4 A;  2WA0 A;  4Q48 A;  4ZDP A;  4R79 A;  1T56 A;  5K7F A;  1A35 A;  2IVM A;  4V19 K;  2N8G A;  4K2E A;  5DTD A;  4XN3 A;  1R71 A;  3BOQ A;  3P5J A;  1EV7 A;  4NQW A;  3VOE A;  2AQF A;  1MIJ A;  4AUX A;  4BHB A;  5C4X J;  4G94 A;  2WC2 A;  2HU9 A;  2CSO A;  4ZYE A;  2MC3 A;  1GVD A;  2ZJP F;  1JT0 A;  3DWL E;  2KFD A;  3H5A A;  3FMQ A;  1OYI A;  1MMS A;  2ZSH B;  4FX4 A;  1CF7 B;  1U5T C;  2X48 A;  2LR8 A;  4PZJ A;  3SXY A;  5IYD J;  4CZC A;  2E1N A;  1LNW A;  2DT6 A;  3FIW A;  1W5T A;  2E7X A;  4EJV A;  4ZJZ A;  1FY7 A;  2X9D A;  5E8G A;  3F3X A;  2B9S A;  3CME I;  1HDD C;  4CGZ A;  1EF4 A;  1B72 A;  1JUP A;  1E17 A;  4X6A J;  4ESB A;  2HKO A;  5J1Y A;  3LMM A;  1I39 A;  3L00 A;  1PUF A;  5EYR A;  3ZMV A;  3MVP A;  1ZR2 A;  1DP7 P;  5JLX A;  1FMV A;  2R7D A;  3AG2 H;  2Y9Y A;  4X1E A;  1LDJ A;  2I10 A;  4UV8 A;  3QAH A;  4M3E A;  1J9I A;  1BOA A;  1XMK A;  2O61 A;  1S29 A;  5FKL A;  2Y0S N;  2A07 F;  3G1O A;  2P5V A;  1V5G A;  5B1A H;  3JAM Z;  4EJO A;  2MH2 A;  3Q5F A;  4YG2 F;  4X0G A;  3WTS C;  1TWC J;  2B63 J;  4UVB A;  2A6T A;  4E4H A;  4DBR A;  4HX7 A;  1ZR4 A;  4BAC A;  1TQM A;  4JQF A;  4XOR A;  3ZQ7 A;  1MH4 A;  1ZGW A;  2NRA C;  1U3E M;  3PO3 J;  1OMI A;  5FFZ A;  3PIO F;  1BOB A;  2XPW A;  2LYC A;  3E6D A;  1WVR A;  1RUO A;  2CQX A;  4RLQ A;  1JKP C;  3FXK A;  2BV6 A;  2C6Y A;  5E1X A;  5EGO B;  1RIO H;  4OU0 A;  3K6G A;  3P9K A;  1I5Z A;  3U9G A;  3K4K A;  3N97 A;  2DA7 A;  4M9S A;  2M30 A;  2XPV A;  4YEL A;  5E3N A;  2AS5 F;  3WE3 A;  2M1B A;  2VPR A;  1N75 A;  2H1L A;  2BOL A;  4NB5 A;  3TO9 A;  3V7R A;  4G7O F;  1SEU A;  4CH7 A;  4IF4 A;  2FA5 A;  1R1U A;  2DO7 A;  4P55 A;  1JI8 A;  2L9V A;  4AD9 A;  2E60 A;  2L7F P;  3EQL F;  4UV9 A;  5JI6 A;  3OYF A;  4M6Y A;  1MW7 A;  1KU3 A;  3JRB A;  3OYB A;  2FML A;  3BR1 A;  5LD2 C;  2A5Y B;  3HEF A;  3C2G A;  2H27 A;  2WAF A;  2JRM A;  4F52 A;  5FFX A;  2CW7 A;  3LSP A;  3DPT A;  1B8I A;  3GYH X;  3U21 A;  3E0J B;  2A61 A;  3ZMT A;  5GAH J;  2EBI A;  3M8J A;  3KP4 A;  5L3D A;  2YPR A;  1G59 A;  3ZQL A;  2RQQ A;  2IGK A;  2DA3 A;  4H4K C;  1TTY A;  2NVU B;  1YYV A;  1VQ7 I;  1ZRC A;  1K78 B;  1D1B A;  4DZJ A;  3GTG J;  5BS6 A;  2FF4 A;  2HGC A;  2XB5 A;  3S16 J;  4HNT A;  1W4M A;  4XKW A;  4LB6 B;  4DBQ A;  4IQ4 A;  5D4R A;  5C3E J;  3H3V K;  4ITV A;  4KA4 A;  1EH8 A;  1YX5 A;  4OOI A;  3E5X A;  2H1K A;  2CU7 A;  1X2M A;  1LUJ B;  2RN7 A;  1ERD A;  4YFX F;  5AON A;  1W5C C;  3S1N J;  2O9L A;  1WH7 A;  3SEQ A;  1YW7 A;  3G71 I;  1R00 A;  3A4C A;  1G3S A;  5J8C A;  3CCU I;  3KE2 A;  5HNH A;  1QZE A;  2NAZ A;  2LKP A;  3HOT A;  5KNL A;  4U88 A;  3LSG A;  3W6V A;  1Z6T A;  4RB0 A;  2P7V B;  3ZCO A;  1O3Q A;  4L18 B;  3H3U A;  2E71 A;  3J7A O;  1R36 A;  2EA4 A;  1BI1 A;  4M71 A;  1S7A A;  2OQG A;  2HTS A;  4BEH B;  1HKS A;  4OIN F;  4QSH A;  4HLX A;  1DPU A;  4OWR B;  1OKR A;  5HOO A;  1A31 A;  4II3 A;  3JRI A;  1FPQ A;  3QPH A;  1JGG A;  1R49 A;  2ME6 A;  6PAX A;  4LJZ F;  3GTO J;  1LFP A;  3RQ4 A;  4CCN A;  1ZN2 A;  5E3L A;  1W36 C;  1ULY A;  3GFM A;  4I0A A;  5FLM J;  2FUG 2;  4JBA A;  2VT2 A;  3DKW A;  4AM3 A;  4HSR A;  4G7Z F;  1PYV A;  3MEX A;  1FOK A;  1ETW A;  2H8W A;  1D8J A;  3ZP5 A;  1FSH A;  1DQU A;  1MND A;  2WTE A;  4KIF A;  3RKY A;  3WU2 C;  4RS8 A;  1WJ5 A;  3CQZ J;  4EGY A;  2IXS A;  3C18 A;  3R4K A;  3Q9V A;  3OYG A;  3BTC A;  4G8X A;  3BG9 A;  3ZN1 A;  3DFG A;  1UHW A;  3T1B A;  2FNP A;  2HQR A;  5HS7 A;  5HLH A;  1JUS A;  1ODD A;  3M1C A;  2K3F A;  2Q8K A;  2V1X A;  2Y0S A;  3M9A A;  4C2U A;  2XGD A;  5F04 A;  4A5M A;  4ENJ A;  3CJN A;  2HEO A;  3A03 A;  1IZ1 A;  2W25 A;  4RLF A;  3PM1 A;  1RKT A;  3LOC A;  3ONQ A;  2DPD A;  1APL C;  3ZMU A;  5M3M J;  2TDX A;  2R5Y B;  1PUE E;  2UWM A;  4M73 A;  2GLO A;  4Y7N J;  3ISP A;  2LTP A;  4RDU A;  2L54 A;  1D0Y A;  1Z0X A;  3BJ6 A;  1EH7 A;  4HDU A;  2WBM A;  1H0M A;  3S17 J;  3LSM A;  1S5L C;  1X1B A;  2K02 A;  4UHT A;  3HGG A;  3I58 A;  2E1M B;  2FMY A;  2DTR A;  3F6O A;  4HPQ A;  2X6W A;  3AG3 H;  1P4W A;  3DEU A;  2EIJ H;  1R5G A;  3GFJ A;  4F93 B;  3SHF A;  4MLO A;  2F4M B;  1VQO I;  4FHT A;  1T8I A;  2H8R A;  2JVG A;  4B43 A;  3OR2 C;  2O8X A;  1SAX A;  1XN7 A;  1W0U A;  2JZY A;  3SFI A;  1I3Q J;  2FEZ A;  4MEY F;  4Q4Z F;  5EG0 B;  5FRO A;  2E5Z A;  3AKZ A;  3OYM A;  3TL4 X;  1LJ9 A;  3WG7 H;  3OWT A;  3V42 A;  2VQL A;  4XKC A;  3N4M A;  4KT5 C;  2OUM A;  5GP9 A;  1SD4 A;  3ZMD A;  3DLL F;  3M8F A;  5KK1 A;  5FRM A;  3QPT A;  2CV1 A;  4A3C J;  3VYT B;  2L02 A;  5CVR A;  2XRO A;  3FDY A;  1X3U A;  2EJR A;  2MD5 A;  2ETH A;  1Y6I A;  1BR4 A;  2NS0 A;  1RC9 A;  2L2O A;  3UR3 C;  1HLV A;  1D5Y A;  1Y39 A;  5BPD A;  4MQV A;  1AU7 A;  2FSW A;  2CO5 A;  2CFO A;  3TP0 A;  2OZ6 A;  4RB2 C;  2GIV A;  4DJA A;  1TWA J;  2R7Q A;  4N9H A;  2CW8 A;  2LRD A;  3N05 A;  1LDK B;  1IXR C;  1K79 A;  1VQP I;  3G3Z A;  2DTZ A;  1YTY A;  5KVR A;  2CQK A;  3OR1 C;  5ILV A;  4FCY A;  4A3B J;  1AKH A;  4HLY A;  1GXQ A;  3HXL A;  4I98 B;  4O6J A;  1XDS A;  2JJ7 A;  1SVL A;  5E18 F;  2F5F A;  4EAT A;  4CCL A;  4EGZ A;  1MGT A;  2HDD A;  3K4L A;  2WB1 N;  2XKP A;  3J7Y J;  3KP5 A;  2X6X A;  2LSO A;  4UXN A;  5ILS A;  3CCV I;  1OR7 C;  2HTJ A;  4S05 A;  1NHA A;  3LA3 A;  2CFX A;  4OIP F;  2R7U A;  2JSC A;  2EPF A;  2LMD A;  5J6X A;  3H92 A;  2STT A;  3GZ6 A;  4E7L A;  1H9T A;  4U0Y A;  2RVC A;  1Z3Y A;  3BLY A;  3SEZ A;  3IH3 A;  4IL6 C;  2JA2 A;  5D5X B;  5IP6 A;  5GAD J;  3DKY A;  2NS7 A;  2AO9 A;  4XLA A;  1A5J A;  4C2M J;  3HGY A;  2ESN A;  5BMZ A;  1BI2 A;  2EFQ A;  3HB9 A;  3NAU A;  2E1M C;  3DBL B;  3SDG A;  1VQN I;  1ITY A;  3HKZ N;  4BUP A;  4U7D A;  1X3Z B;  4M9X A;  1NK3 P;  3LAP A;  4LIV A;  4HV5 A;  1K6O A;  2M34 A;  1FJL A;  3NWS A;  3RPQ A;  3KP2 A;  3S2H J;  2F48 A;  2L4A A;  1O7L A;  1R4N B;  2DA2 A;  2X85 A;  1UMQ A;  3S32 A;  4HQE A;  2XAH A;  3HTU A;  4E7K A;  2LLK A;  3QU3 A;  1RI7 A;  3JRG A;  5JHF A;  1FZP B;  5CVJ A;  1Q1V A;  4P96 A;  3KZY A;  1BL0 A;  3K4J A;  1XMX A;  5BNG A;  4JP0 A;  2ZXH A; 
#chains in the Genus database with same CATH homology
 1LEA A;  1WQ2 A;  1IF1 A;  5ILU A;  4PDK A;  1ZH5 A;  1I6X A;  3F22 A;  2LDU A;  4HX4 A;  5F6F A;  1ZG5 A;  3E5U A;  4HAM A;  3ECH A;  3I53 A;  4Q5S F;  2IT0 A;  3GZ5 A;  2PJP A;  3EET A;  4M9Z A;  1ZAR A;  3LA2 A;  3QP6 A;  3GO5 A;  5H6Q A;  4RB1 A;  1YW9 A;  4M72 A;  1RNL A;  5L3C A;  2BEO A;  2CG4 A;  3GVA A;  2Z9O A;  3P7N A;  2D2W A;  4CYD A;  1AOY A;  5HLG A;  1IRG A;  1BBY A;  2Z3Y A;  2RQP A;  1SMY F;  3K1P A;  2VON A;  3JSO A;  2DAO A;  2RV8 A;  4KIB A;  3L2C A;  4JK1 X;  3RDI A;  2KKO A;  4O5V A;  2XAF A;  5LRS A;  2PI0 A;  5D8L B;  1J75 A;  1TNT A;  2DLL A;  2O3F A;  1TW3 A;  4CIC A;  4WXD A;  3LST A;  5D5U B;  1W7P A;  3B73 A;  1KA8 A;  4KN4 X;  4EJT A;  1MDM B;  3D5L A;  1F4K A;  2GWR A;  2H09 A;  1S7O A;  2PLY A;  1Z7U A;  4ON0 A;  3HHG A;  2W85 A;  1D8K A;  1STZ A;  2O03 A;  1L3L A;  3RJP A;  5A2Q Z;  1U2W A;  2H94 A;  3FM3 A;  1LVA A;  2FBH A;  2QQB A;  3GFL A;  4GXO A;  4XRF A;  1LB2 A;  2H6C A;  2XAS A;  3SQN A;  2ADU A;  1FBU A;  3G73 A;  1OYY A;  4GGG A;  1WRJ A;  2HWV A;  2RKH A;  1P4X A;  2DK8 A;  3SZT A;  2EFP A;  4OMY A;  2OZU A;  5FO5 A;  1IUY A;  2QQA A;  2VC0 A;  1JHH A;  4U7B A;  4BHP A;  1BC7 C;  4XLN F;  1T2K A;  1IXS B;  2VE9 A;  1Z91 A;  2F2E A;  2DK5 A;  3KP3 A;  3U1D A;  2BGC A;  1W7P B;  1TBX A;  4ASN A;  3TKY A;  1SMT A;  2XAJ A;  1MZB A;  4TV7 A;  3TGN A;  2BBY A;  2FU4 A;  2FBK A;  1I1G A;  2QWW A;  1R1V A;  1IN4 A;  3BJO A;  2Q2E A;  2VBX A;  3TDZ C;  4E70 A;  4L0Y B;  1DPR A;  2QQ9 A;  5F64 A;  2ZCW A;  5BOX A;  4BHC A;  3VEP A;  3F23 A;  1MJ9 A;  1MD0 A;  1YS7 A;  4YIF A;  5LHI A;  1G6N A;  2UZK A;  4GCV A;  4IPA A;  1RUN A;  1KQ9 A;  3CUQ B;  5L3E A;  1P4A A;  4L9T A;  3HYI A;  1BJA A;  2VOP A;  2OAZ A;  2VBW A;  3I5U A;  2XRN A;  1XGO A;  2ZJ2 A;  1O57 A;  1BN5 A;  3ULQ B;  1ON2 A;  1S3J A;  3MCZ A;  2GXB A;  1IXC A;  1T0F A;  3HHH A;  1JXS A;  4XSX F;  5L3B A;  2GQQ A;  5DCM A;  1MJA A;  1DDN A;  1UST A;  3LQQ A;  4EM1 A;  1ONV A;  3RIR A;  1J5Y A;  5E1Z B;  1IAW A;  2WWY A;  4KFC A;  1FT9 A;  2P4W A;  4LLN A;  3I71 A;  5CVI A;  3JTG A;  2GAU A;  3DXJ F;  3R0A A;  5D8K B;  1IN8 A;  3E6M A;  3BWG A;  2V1U A;  3OOP A;  2IRF G;  5D6F A;  3R6S A;  3FXU A;  2DQL A;  4L9J A;  3RKX A;  2RGV A;  3GX4 X;  2EK5 A;  4HF2 A;  3CUQ C;  3B02 A;  4EJU A;  1XSX A;  1IN5 A;  1SFU A;  1V3F A;  1A04 A;  2ZKZ A;  2E7W A;  2HDC A;  2STW A;  1FYK A;  2VOO A;  5IT9 Z;  2QZ8 A;  3LFK A;  1KQ8 A;  3PQJ A;  2ZME A;  1HW1 A;  2ELH A;  2ZXJ A;  4CHU A;  5LHG A;  3GXO A;  3WTT C;  2R7F A;  3QRF F;  4MNU A;  3KP6 A;  2LF8 A;  2EA2 A;  3ZPL A;  3E97 A;  1YG2 A;  3M7G A;  2J5P A;  2FOK A;  1FYM A;  3COA C;  2MLG A;  2P8T A;  1I1S A;  2QYO A;  1GVJ A;  3WOD F;  3GLX A;  1QBJ A;  5LGN A;  5EEG A;  4OIR F;  2COM A;  4YFN F;  2EV5 A;  4MTD A;  3WTW C;  2P6T A;  4DNC A;  5HS8 A;  4IRG A;  1QGP A;  1D3Y A;  3DV8 A;  2MLK A;  5CLS A;  3WGI A;  3R61 A;  3F8M A;  3PQK A;  2HYF A;  2B0L A;  1T98 A;  3BP8 A;  3EYI A;  2K4J A;  4MGR A;  2VE8 A;  4ZYH A;  3IKT A;  2PQ8 A;  4DQ2 A;  4U0V A;  2FE3 A;  2W24 A;  5FD6 A;  2L3D A;  4HYE A;  3P9C A;  4OIQ F;  4BNC A;  4LG0 A;  2KIU A;  5JR3 A;  2O6G E;  2EB7 A;  1QZZ A;  2FRH A;  1ZLK A;  3FF5 A;  2ACJ A;  1UB9 A;  3WTY C;  2GZW A;  2W57 A;  4RAZ A;  3VOD A;  1KU9 A;  4ZYG A;  1YFH A;  1XGS A;  1G3Y A;  2PMH A;  5DDG A;  1J2X A;  4RB3 C;  3K1M A;  5L3F A;  2VBZ A;  2GA1 A;  3MZY A;  2DQR A;  2XAG A;  1SD5 A;  3V7C A;  4WF2 A;  3J81 K;  4R1H A;  4NHJ A;  1QPM A;  1DUX C;  3LWF A;  2OBP A;  4H0E A;  2HYG D;  4CDG A;  1G4D A;  3GUD A;  1R5H A;  2XUB A;  3DF8 A;  2A6H F;  4ESJ A;  5HVQ C;  2G7U A;  1GHC A;  2V79 A;  3F8N A;  4OIO F;  4LG0 B;  4IHS A;  1REP C;  1WWX A;  1E2X A;  3ELK A;  1BI3 A;  2QBY A;  1XSV A;  2YR2 A;  1TLH B;  4CZZ A;  2D1H A;  4Y13 A;  5HDN A;  5BQT A;  3TOA A;  1KQ0 A;  4MTE A;  1KGS A;  3H3Z A;  3RYR A;  2FXA A;  4YFK F;  4IVN A;  5DUK A;  2D1V A;  4UVA A;  2UXN A;  2IJL A;  4BYY A;  5CJ9 A;  2NNY A;  4KIG A;  5J8F A;  1G3T A;  1U6G A;  3KEQ A;  3CDH A;  4GYI A;  1QQI A;  5LBQ A;  5LHH A;  2Z99 A;  4D0P A;  4A0X A;  2OU2 A;  3KET A;  4YII A;  4EVI A;  3O3K A;  5D5V B;  4I09 A;  1LDD A;  4L5J A;  4IRH A;  4G9Y A;  3DQV C;  1UFM A;  3FXR A;  4A6D A;  4BXU A;  1P92 A;  3I59 A;  3V7S A;  3J80 Z;  3F8B A;  3K0L A;  4KMF A;  3GEZ A;  4EQQ A;  1FNN A;  1FWZ A;  2EFO A;  1EH6 A;  4KYW A;  1QZY A;  5HDG A;  2W84 A;  2IA0 A;  1B6A A;  1WKM A;  3BPV A;  2D45 A;  2K7L A;  4XSZ F;  1HW2 A;  3BY6 A;  5FLX K;  1FLI A;  4ZZD A;  3I64 A;  1RZ4 A;  5FB2 A;  2VN2 A;  2Y0M A;  3EUH A;  5D5W B;  5DUI A;  3KZZ A;  1AWC A;  3V8K A;  1O3T A;  3CO7 C;  2RNJ A;  3EDP A;  5E1W A;  1Y0U A;  4RGR A;  5DYM A;  1HXD A;  1U5T A;  3T0Y A;  2V9V A;  4KN7 X;  1HBX G;  4WWC A;  2P5K A;  5LEK A;  2M8E A;  1HSJ A;  3HRS A;  2FQ3 A;  4HZF A;  4KIC A;  2EFN A;  2X0L A;  3WTZ A;  4F7Z A;  5TJJ A;  2EWN A;  1JGS A;  1XMA A;  1J59 A;  2KJC A;  4I02 A;  4ZH4 F;  2EFW A;  5K1Y A;  4KMU X;  4XBF A;  1QO0 D;  1OYW A;  1TW2 A;  2JPC A;  1IN6 A;  2F5D A;  4L5I A;  3I4P A;  3FM5 A;  1IW7 F;  1ZAO A;  2A68 F;  1KU2 A;  2PFB A;  3JAM K;  2Z5U A;  4N0B A;  5DD8 A;  2K27 A;  1B9M A;  3NEU A;  2NYX A;  1XGN A;  2F5E A;  2ZO4 A;  4BAY A;  1Z9C A;  1YLF A;  5AIP A;  1K7A A;  1S6L A;  3RI4 A;  2DU9 A;  3JW4 A;  5L3G A;  4RGU A;  5DEQ A;  5CVU A;  2QM3 A;  2Z33 A;  3R0J A;  4U0W A;  3MQ0 A;  4A12 A;  5IT3 A;  1LQ1 A;  2DPU A;  2DFI A;  3JSP A;  4ESF A;  3TO6 A;  2XAQ A;  1CF7 A;  1H9G A;  3IC7 A;  1T39 A;  3HRU A;  5F1R A;  1R58 A;  1QNT A;  1MJB A;  4ZZL A;  1WSU A;  2RDP A;  3E6B A;  1PDN C;  4ZYD A;  4HX8 A;  1I27 A;  5CYV A;  3C7J A;  1LEB A;  1YS6 A;  3GWZ A;  1ZG3 A;  2RC4 A;  4IHT A;  2QEN A;  4BQA A;  1XD7 A;  1GXP A;  2OQR A;  3W6K B;  5LEJ A;  3K1N A;  3ZMZ A;  2A3S A;  5ERI A;  2EV0 A;  1P2F A;  3IRR A;  4QLC U;  2M45 A;  3E3V A;  5H20 A;  1L0O C;  1O3R A;  2FNA A;  4LK1 F;  1FP2 A;  3V4G A;  4B8X A;  1ZLJ A;  4AIJ A;  2YX4 A;  4HA8 A;  1KYW A;  3O6B B;  4O3M A;  2XV4 S;  3BPX A;  1U8R A;  5BPI A;  5D6E A;  1IRF A;  2HQN A;  3C3W A;  4GYG A;  1IN7 A;  3KLN A;  1ZRF A;  4L9V A;  4LB5 A;  1O7F A;  2HKX A;  1F5T A;  3D0S A;  1YQA A;  2JPB A;  5TRD A;  2QLZ A;  2XGX A;  2VC1 A;  4GO1 A;  1R7J A;  5LGU A;  4AIK A;  3T5X A;  3F8F A;  3M8E A;  3VB2 A;  4HOB A;  3F72 A;  4UVC A;  2DBB A;  3FX3 A;  3TO7 A;  1K78 A;  2HZT A;  5DV5 A;  4WXC A;  4LGW A;  1J7K A;  1W5S A;  2VT3 A;  2KJB A;  2CGP A;  3JTH A;  3RKW A;  2IPQ X;  3IWF A;  2YX7 A;  4P5O A;  3PFI A;  4WCG A;  4UNO A;  2LF7 A;  1FSE A;  4UUV A;  3LA7 A;  3REO A;  2PN6 A;  4LK0 F;  2HFH A;  1HKQ A;  1HST A;  2A69 F;  2JRT A;  5DCM B;  2ZNZ A;  2CWE A;  1VTN C;  5K5Q A;  2VOD A;  3KP7 A;  2CYY A;  4P9U A;  2R3S A;  3E5Q A;  1UHM A;  4FX0 A;  4R8H A;  1J0R A;  1KYZ A;  3L09 A;  4S04 A;  2BYV E;  3WU0 A;  3MFK A;  1T38 A;  3Q9S A;  4N9I A;  1R1T A;  2ISZ A;  1B59 A;  4RAY A;  5DCF A;  4IRI A;  1F1Z A;  2NNN A;  2KIF A;  3BRO A;  4LLG F;  1R23 A;  1YIO A;  2KIM A;  3F8C A;  4WX9 A;  2ZBK A;  1ZHF A;  4WXH A;  2ESH A;  4LFU A;  4AIH A;  3IHU A;  4MQ9 F;  1SD7 A;  1O3S A;  2P5L C;  5LLQ A;  1XCB A;  4KNY A;  4ENK A;  1OR7 A;  1U78 A;  3WTV C;  1ZGA A;  5EEH A;  4L9N A;  4P9F A;  4A0Z A;  4B09 A;  5ICE A;  4HBL A;  4Z2Y A;  2XIG A;  1G3W A;  2YSR A;  3SFZ A;  3CO6 C;  2FBI A;  4KUM A;  3I0T A;  4LLL A;  3FMR A;  4CO8 A;  4MHG A;  2ZME B;  2VXZ A;  4EM2 A;  1TQI A;  4PGG A;  2Y48 A;  2PG4 A;  3DP7 A;  5ICG A;  2MBF A;  1OPC A;  3GF2 A;  2IW5 A;  4HQM A;  5FGM A;  2M87 A;  4I01 A;  4ETS A;  3SZP A;  3ROU A;  2XHK A;  1R22 A;  1HW5 A;  3F21 A;  1Q1H A;  3NRV A;  3K2Z A;  4RGX A;  4AWX B;  2EV6 A;  3MZH A;  3MWM A;  2P7C B;  2PEX A;  1UCR A;  3ABT A;  3L9F A;  1PP8 F;  3WGH A;  3J80 K;  1Z1D A;  3HSR A;  5K5R A;  5HS9 A;  4LMY A;  4EV0 A;  4ENM A;  1JE8 A;  3V8L A;  1ZGJ A;  3ZN0 A;  3CUO A;  1XB4 A;  5AIQ A;  1YO5 C;  3IWZ A;  3O2P E;  3E6C C;  3FZV A;  4HF1 A;  4FT8 A;  3ECO A;  1PP7 U;  4KDP A;  4QWQ A;  1YW8 A;  1ZG1 A;  4OMZ A;  2PMU A;  4A0Y A;  2HOE A;  3TDU C;  1S8N A;  4IJA A;  4PGH A;  2L01 A;  3W6J B;  2WV0 A;  3V8J A;  2IP2 A;  3ERE D;  2L4M A;  3KCC A;  1SD6 A;  4Y15 A;  3TQN A;  3RYP A;  3U2R A;  1BIB A;  2LNB A;  1CGP A;  3HOS A;  3IRQ A;  4I2O A;  1XGM A;  5LGT A;  2F5C A;  3FHZ A;  2K4B A;  2DI3 A;  2Y75 A;  4L0Z B;  3KLO A;  3BDD A;  5HDK A;  2XVC A;  2GA2 A;  5K5O A;  3FWE A;  2G7H A;  3WE2 A;  3WG9 A;  3R60 A;  5A2Q K;  1B9N A;  4WK8 F;  1P6R A;  3VFZ A;  3NQO A;  2V6C A;  2KRF A;  1B4A A;  5CVV A;  1HQC A;  1WI9 A;  3S2W A;  4PCQ A;  3QU6 A;  4EJW A;  1HKT A;  2IA2 A;  1FP1 D;  3C1D A;  2O0Y A;  4EM0 B;  3MAJ A;  2JTV A;  2J5O A;  4XLP F;  3K69 A;  3GFI A;  2QBY B;  3ML6 A;  1SFX A;  2H6B A;  1BIA A;  4A5N A;  3P9I A;  4M74 A;  1MDM A;  4EMS A;  4M6X A;  5DD4 A;  1FX7 A;  2HR3 A;  5ICF A;  1KU7 A;  3RPU A;  4RGS A;  3AAF A;  1USS A;  3L7W A;  5H6R A;  4Q47 A;  5E17 F;  1B1B A;  3BJA A;  1ZRE A;  3J81 Z;  4MEX F;  4IXA A;  2XKO A;  3OV8 A;  1ZYR F;  4I7H A;  2V1D A;  3DPL C;  3CTA A;  3KFW X;  1D5V A;  3KEO A;  3HIF A;  3BZ6 A;  2ZNY A;  2X4H A;  5ICC A;  1Z05 A;  5ED4 A;  1BC8 C;  1MKM A;  3LQR A;  3I59 B;  3F6V A;  1ZRD A;  5HLI A;  3QP5 A;  4CXF A;  3M1E A;  3RTR A;  1FBS A;  2VBY A;  1V4R A;  3QOP A;  1BI0 A;  2HS5 A;  3FMS A;  4AVP A;  2PBI A;  3HSE A;  1FYL A;  3WGG A;  3HSF A;  3T8R A;  1XDU A;  1ON1 A;  3TOB A;  1BM9 A;  2E1C A;  2M5W A;  2QUF A;  3IKV A;  2DW4 A;  1FC3 A;  3WTX C;  2A6E F;  3HRM A;  4HV6 A;  4G6D A;  5E20 A;  1TNS A;  2MA3 A;  3CLO A;  1XCV A;  2GXG A;  1W7P D;  2MH9 A;  1U5T B;  2QVO A;  4LD5 A;  2OA4 A;  3HUG A;  4BH9 A;  2P6S A;  3K9T A;  4HW0 A;  3WU1 B;  5JVT A;  2G9W A;  1XSD A;  4ENN A;  3WTU C;  3CUQ A;  4HF0 A;  1FBQ A;  2ZFW A;  3EYY A;  2CW0 F;  5LRR A;  3HRT A;  2DT5 A;  3FXQ A;  3HTS B;  2JT1 A;  5D4S A;  2K86 A;  3ABU A;  4Y17 A;  4HDV A;  1F9N A;  2IA1 A;  2Q0O A;  3ZMS A;  4A2U A;  5FLX Z;  4G6Q A;  2AXL A;  5JFR A;  2OD5 A;  3LAJ A;  5JHU A;  1C0W A;  4A6E A;  4G7H F;  2ISY A;  3I54 A;  3GW2 A;  5IT9 K;  2BE5 F;  4I0B A;  5E8I A;  5FD5 A;  1TQP A;  2UXX A;  1JHF A;  3IL2 A;  3T8T A;  1T6S A;  1Z6R A;  2YU3 A;  1SFE A;  4R79 A;  4Q48 A;  2IVM A;  4K2E A;  3BOQ A;  1EV7 A;  4NQW A;  3VOE A;  4BHB A;  4G94 A;  2WC2 A;  2CSO A;  4ZYE A;  2MC3 A;  3FMQ A;  1OYI A;  4FX4 A;  1CF7 B;  1U5T C;  4PZJ A;  3SXY A;  2E1N A;  1LNW A;  1W5T A;  2E7X A;  4EJV A;  1FY7 A;  5E8G A;  3F3X A;  4CGZ A;  1E17 A;  4ESB A;  2HKO A;  3L00 A;  3ZMV A;  1DP7 P;  2R7D A;  1LDJ A;  4UV8 A;  3QAH A;  1J9I A;  1BOA A;  1XMK A;  2O61 A;  1S29 A;  2A07 F;  2P5V A;  3JAM Z;  4EJO A;  2MH2 A;  3Q5F A;  4YG2 F;  3WTS C;  4UVB A;  4HX7 A;  1TQM A;  4JQF A;  3ZQ7 A;  2NRA C;  1U3E M;  1OMI A;  5FFZ A;  3E6D A;  1RUO A;  2C6Y A;  2BV6 A;  5E1X A;  1RIO H;  4OU0 A;  3P9K A;  1I5Z A;  3U9G A;  3N97 A;  4M9S A;  2M30 A;  2AS5 F;  3WE3 A;  2M1B A;  4NB5 A;  3TO9 A;  3V7R A;  4G7O F;  4IF4 A;  2FA5 A;  2DO7 A;  1R1U A;  4P55 A;  4AD9 A;  3EQL F;  4UV9 A;  5JI6 A;  4M6Y A;  1KU3 A;  2FML A;  2A5Y B;  2H27 A;  5FFX A;  3DPT A;  3GYH X;  2A61 A;  3ZMT A;  3KP4 A;  5L3D A;  2YPR A;  1TTY A;  1YYV A;  1ZRC A;  1K78 B;  5BS6 A;  2FF4 A;  2HGC A;  1W4M A;  4LB6 B;  5D4R A;  4KA4 A;  1EH8 A;  4OOI A;  3E5X A;  2RN7 A;  4YFX F;  5AON A;  1YW7 A;  1R00 A;  1G3S A;  5J8C A;  3KE2 A;  2NAZ A;  2LKP A;  3HOT A;  4U88 A;  1Z6T A;  4RB0 A;  2P7V B;  1O3Q A;  4L18 B;  3H3U A;  3J7A O;  1R36 A;  2EA4 A;  1BI1 A;  4M71 A;  1S7A A;  2OQG A;  2HTS A;  1HKS A;  4OIN F;  4HLX A;  1DPU A;  1OKR A;  5HOO A;  1FPQ A;  3QPH A;  6PAX A;  4LJZ F;  1ZN2 A;  1ULY A;  3GFM A;  4I0A A;  4JBA A;  2VT2 A;  3DKW A;  4G7Z F;  3MEX A;  1FOK A;  1D8J A;  3ZP5 A;  1FSH A;  2WTE A;  4KIF A;  3RKY A;  4RS8 A;  4EGY A;  3C18 A;  3R4K A;  3Q9V A;  4G8X A;  3ZN1 A;  3DFG A;  1UHW A;  3T1B A;  2FNP A;  2HQR A;  5HS7 A;  5HLH A;  1ODD A;  2Q8K A;  2V1X A;  3M9A A;  4A5M A;  4ENJ A;  3CJN A;  2HEO A;  1IZ1 A;  2W25 A;  2DPD A;  3ZMU A;  2TDX A;  1PUE E;  2UWM A;  4M73 A;  3ISP A;  2L54 A;  3BJ6 A;  1EH7 A;  4HDU A;  1H0M A;  2K02 A;  4UHT A;  3I58 A;  2FMY A;  2DTR A;  3F6O A;  1P4W A;  3DEU A;  3GFJ A;  1R5G A;  3SHF A;  4FHT A;  2O8X A;  1SAX A;  1XN7 A;  2JZY A;  2FEZ A;  4MEY F;  4Q4Z F;  1LJ9 A;  3N4M A;  4KT5 C;  1SD4 A;  3ZMD A;  3M8F A;  5KK1 A;  3QPT A;  2L02 A;  5CVR A;  2XRO A;  1X3U A;  2EJR A;  2MD5 A;  2ETH A;  2NS0 A;  5BPD A;  4MQV A;  2FSW A;  2CO5 A;  2OZ6 A;  4RB2 C;  2GIV A;  4N9H A;  1LDK B;  1IXR C;  1K79 A;  3G3Z A;  1YTY A;  5KVR A;  2CQK A;  5ILV A;  4HLY A;  1GXQ A;  4I98 B;  4O6J A;  1XDS A;  5E18 F;  2F5F A;  4EGZ A;  1MGT A;  2XKP A;  3KP5 A;  2LSO A;  4UXN A;  5ILS A;  2HTJ A;  4S05 A;  1NHA A;  3LA3 A;  2CFX A;  4OIP F;  5J6X A;  2JSC A;  3H92 A;  2STT A;  3GZ6 A;  1H9T A;  4U0Y A;  2RVC A;  5D5X B;  2ESN A;  5BMZ A;  1BI2 A;  2EFQ A;  4U7D A;  4M9X A;  3LAP A;  4HV5 A;  1K6O A;  3RPQ A;  3KP2 A;  2L4A A;  1O7L A;  4HQE A;  2XAH A;  3HTU A;  3QU3 A;  1RI7 A;  1FZP B;  5CVJ A;  4P96 A;  3KZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...