2J5OA

Pseudomonas aeruginosa ftsk gamma domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
72
structure length
72
Chain Sequence
GSEGSEDDPLYDEAVRFVTESRRASISAVQRKLKIGYNRAARMIEAMEMAGVVTPMNTNGSREVIAPAPVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA TRANSLOCASE FTSK
publication title The Ftsk Gamma Domain Directs Oriented DNA Translocation by Interacting with Kops.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Recombination
total genus 14
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09397 FtsK_gamma Ftsk gamma domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2j5oA01
4ZYGA 1P92A 2ISZA 4M6XA 5D5UB 1QGPA 3S2WA 3TO9A 4A0YA 2UXXA 4R79A 3FMRA 1YS6A 1FPQA 2DPUA 2VC1A 2XV4S 3RI4A 5CLSA 1L3LA 3WTUC 2L02A 2HGCA 2TDXA 1NHAA 1DPRA 3D5LA 5ICFA 4OIOF 3I54A 2EFNA 2G7UA 2P6SA 2L3DA 3VOEA 2XVCA 1RZ4A 2HDCA 3DP7A 1R7JA 5JFRA 3KE2A 2QVOA 4IRHA 4OINF 4WX9A 1PP7U 1WKMA 2CQKA 3I59B 5IT3A 2G9WA 3WTXC 4IF4A 2VC0A 4YIFA 4MTEA 2PBIA 5KVRA 3E5UA 5BOXA 1E2XA 4P9UA 5E1WA 4OMYA 2RVCA 3WTSC 1Q1HA 3K1NA 4ZH4F 2XKOA 5FLXK 4M6YA 3KEQA 4RGXA 3RPUA 3WU0A 5J8FA 1FYLA 1R58A 2QENA 4RB2C 4EM1A 2D45A 4IHSA 4XLNF 4HYEA 1G3TA 1ZRDA 4M74A 1ZHFA 4GCVA 2E1NA 3GX4X 1P4XA 3ZP5A 4HX7A 1QPMA 5F6FA 3E6CC 3BOQA 2FBIA 5AIQA 2O03A 3IHUA 3LFKA 1ZH5A 1SD6A 4BHBA 5FD6A 4M9SA 1R36A 5A2QK 3T5XA 4KIGA 1HSTA 1OYWA 3FM3A 2IA0A 1BM9A 1UB9A 3FM5A 4IVNA 3JW4A 2FQ3A 4CDGA 3WGIA 3VEPA 2CG4A 2O61A 4S04A 3P7NA 4MQVA 4I02A 3K1PA 3DKWA 4LB6B 3TDUC 1B4AA 1KYWA 4A2UA 3WU1B 5HS9A 3CDHA 3HTSB 2XKPA 3HYIA 2M45A 3C3WA 2OZUA 4HW0A 2EFPA 4ASNA 1R1UA 2G7HA 2PJPA 1DDNA 2P6TA 4Q5SF 3FZVA 4U0WA 1SMTA 2P4WA 1MDMB 3ELKA 2VBYA 2DO7A 2M87A 1FP2A 3ZPLA 2MA3A 5L3CA 2WWYA 3HUGA 5LBQA 3O6BB 2IVMA 2QM3A 2ISYA 1D8JA 3SZPA 2FBKA 3IWFA 1T0FA 3WG9A 1UCRA 4XSXF 4ESJA 3P9KA 4EM0B 3HTUA 3IC7A 3KLOA 2L54A 3RKWA 3J80K 2W57A 3FHZA 5D5XB 2HYGD 2W84A 5E1ZB 3CUOA 3JTHA 5BPIA 4YFXF 2EJRA 5FO5A 3GXOA 2DW4A 1P4WA 4I09A 3N4MA 2RNJA 1XDSA 1SMYF 1MKMA 1IN5A 1T6SA 3MQ0A 3RYRA 3B02A 2KKOA 2DU9A 1BC8C 3GFLA 1REPC 4RGSA 2RN7A 3E97A 3OV8A 1S29A 3U1DA 1J5YA 3LQRA 2VT2A 2KJCA 4JBAA 1USTA 4RS8A 1IN7A 2F5EA 1XMKA 3WODF 4K2EA 4HLYA 3HSEA 1UHWA 3H92A 2XIGA 2ZCWA 1HKTA 4A0XA 4I7HA 2BEOA 2YX7A 4WWCA 3ABTA 5DYMA 4RAYA 4P5OA 1JHHA 4EVIA 2XAFA 2Q8KA 1U5TA 5L3GA 2BYVE 4ENNA 3GFIA 2XROA 1BC7C 5LHIA 1MJAA 4XSZF 4CO8A 4PGGA 3NQOA 4MQ9F 5FFZA 3GEZA 1K7AA 1J7KA 2EFQA 1B6AA 3BZ6A 1W7PA 3BPXA 5L3FA 2GA2A 1OYYA 1YW7A 4EGYA 4HQMA 4MNUA 4EM2A 4N9IA 1TNSA 2ZJ2A 4WF2A 1U8RA 1DUXC 4G7OF 3ZMDA 3EYYA 4HOBA 1F1ZA 4RGRA 1EV7A 4A6DA 3K2ZA 4L9NA 2P5VA 5KK1A 2HOEA 2R7DA 1O3TA 1ZREA 4Y17A 4O6JA 1HBXG 1Y0UA 2NNNA 5LEJA 3VODA 3C7JA 4ZYDA 2IPQX 1XGMA 2VXZA 1U2WA 3WTTC 1GHCA 4KN7X 4L0YB 2CGPA 2H27A 2CO5A 4BNCA 1FSHA 3RDIA 2X0LA 5LLQA 3V8JA 2H94A 1Z91A 3EQLF 3QOPA 4RAZA 3WE2A 5E8GA 3FF5A 1XCVA 1DP7P 1RNLA 1J2XA 1YS7A 3GW2A 3KP3A 2VOPA 2YU3A 3WTYC 5D6FA 1OYIA 1LB2A 1CF7A 2IW5A 2DAOA 2O6GE 1A04A 3QP6A 1ZRFA 1T2KA 4WXDA 2OBPA 1I1GA 3BY6A 1ZGAA 2NRAC 2QQBA 4HQEA 2P7VB 2F5DA 2XHKA 5CJ9A 4ENKA 4M9XA 2EV0A 1G3YA 2XGXA 1ON2A 1P6RA 2K7LA 1H9TA 5IT9K 1DPUA 4ENJA 3WTWC 1FBQA 1LEAA 4L9VA 1BI3A 2HR3A 1QO0D 3W6JB 3HOTA 3RKYA 4Q48A 1KGSA 2FMYA 4R1HA 2VT3A 2LSOA 3KP7A 4L5IA 3V4GA 2IP2A 4GYIA 2QBYA 1E17A 1UHMA 2NS0A 4IRGA 4ENMA 1KU7A 4EGZA 4LLLA 1HXDA 1LQ1A 2IT0A 5HVQC 1FSEA 2CYYA 3DPTA 5E17F 2MC3A 4XRFA 3MAJA 4LD5A 1R00A 4EV0A 1R23A 1LNWA 2F5CA 2A69F 3R4KA 5D6EA 1B9MA 1AWCA 3M1EA 4B8XA 5E8IA 3ISPA 1IAWA 4M9ZA 4A5NA 2HQNA 4DNCA 2KIMA 3ML6A 4M71A 1SD7A 3QRFF 1FX7A 4HX8A 3LAPA 3WTVC 3ZMZA 3GLXA 3KP6A 3V7CA 1ZG3A 3ECOA 3F8NA 5E18F 1TQPA 3TO6A 3MFKA 2CWEA 3GVAA 1MD0A 3ROUA 1FYMA 3HRSA 1P2FA 4P96A 4UVCA 4O3MA 2A68F 2ESNA 3DF8A 4KIFA 4WK8F 1HW5A 2EA4A 1TLHB 2XAGA 1SFUA 5ILVA 2IRFG 2HKOA 2K02A 3E6BA 4LLGF 1HW1A 3ZMSA 3D0SA 2YPRA 2HTSA 1IZ1A 2B0LA 2OAZA 4CYDA 1U5TB 2JZYA 4G6DA 1ZGJA 1TQIA 1V4RA 3J7AO 2MBFA 4ESFA 1XN7A 4IRIA 3JTGA 5TRDA 4AIJA 2ZO4A 2MD5A 5LEKA 2L01A 4OMZA 3P9CA 5LRSA 1W7PB 5DD4A 5L3DA 1ZYRF 3FMSA 3V8LA 1T38A 1S7AA 4AIKA 1IUYA 4G8XA 3ECHA 1OR7A 3ULQB 3QPTA 5HDKA 4FX0A 1KU9A 4QLCU 2EK5A 3H3ZA 2FF4A 5LHHA 2VBZA 3IL2A 5TJJA 3TDZC 2IJLA 3IRRA 3ZMTA 1L0OC 4H0EA 2HS5A 2FE3A 3IWZA 1XGSA 3ZMVA 2E1CA 1WI9A 1LJ9A 2YR2A 4S05A 5ILSA 2GA1A 2Z33A 1ULYA 2GWRA 3Q9VA 3GFMA 5LRRA 2ZXJA 5FD5A 3RYPA 3BWGA 1EH8A 4KUMA 1I5ZA 2M1BA 4KA4A 1TTYA 1W5SA 4GXOA 5D4RA 4A12A 1J0RA 5E1XA 3L2CA 2WV0A 3GYHX 2Y0MA 1USSA 3GZ6A 3N97A 1XSDA 2GZWA 3HHGA 4HF0A 3I71A 5DUKA 1CF7B 2UXNA 4R8HA 4G9YA 3E5QA 5BMZA 2DI3A 4FT8A 1FP1D 2AXLA 4HZFA 1KQ8A 3P9IA 2Z3YA 4BH9A 2MH9A 5CVVA 3ERED 4YFKF 3KFWX 2FXAA 1FBSA 2EV6A 4XLPF 3F21A 4LGWA 1O3SA 1ZAOA 4L9JA 2M5WA 1H9GA 3HOSA 1P4AA 1KQ9A 4U7BA 2E7WA 1J9IA 1BI0A 2M8EA 1FZPB 3DXJF 1XD7A 1Z1DA 1S8NA 4YFNF 2ADUA 4F7ZA 2CSOA 1KQ0A 2W24A 3EETA 2VE8A 2QBYB 1U6GA 3KLNA 3CO6C 2NYXA 2LF7A 3HRMA 1FT9A 1WWXA 2BGCA 1HSJA 4L0ZB 4LFUA 1TW2A 3RJPA 2KJBA 2H09A 3CTAA 1QBJA 2QWWA 5CVUA 3FXUA 2DK8A 2V1DA 1B59A 2P5LC 4EJVA 3BDDA 1OPCA 4MTDA 3PFIA 2EV5A 1IN4A 2HTJA 2QQAA 1STZA 1XSXA 5AONA 3R0AA 3WTZA 3CO7C 3RKXA 3LSTA 1J75A 1XSVA 2MH2A 3IKTA 5LGUA 4I0BA 4AD9A 4EMSA 2ZKZA 1MGTA 1IXCA 1LDDA 3K9TA 5ICGA 1FNNA 5E20A 2OQRA 2AS5F 1IRGA 4KNYA 3JAMK 2ZBKA 4MHGA 2BE5F 3PQJA 1Z7UA 4ZYHA 4KFCA 3CJNA 1ZRCA 2VONA 1BI1A 3FXQA 1O3QA 1D8KA 1TQMA 2K86A 1B1BA 2HZTA 3V8KA 4L5JA 2OZ6A 2FNAA 4EJTA 4AVPA 2COMA 1HKSA 2OD5A 2A07F 1YQAA 2A6EF 3TKYA 1G3WA 5HDGA 3EYIA 2XAHA 4L9TA 5ICEA 1ZG5A 1FC3A 3TOBA 2Y48A 4P9FA 4Q4ZF 3TOAA 3REOA 1QZYA 3J81Z 1GVJA 3GZ5A 2EWNA 4UV9A 4HDVA 1BJAA 2Q2EA 2YX4A 3M8FA 1O57A 3BJ6A 4M72A 4MEXF 3WE3A 1LDKB 3SHFA 5BPDA 4CZZA 3KCCA 4YG2F 2VN2A 3RTRA 2PI0A 1JGSA 4OIPF 4QWQA 4IJAA 1LEBA 2CW0F 2EFWA 3O3KA 4NQWA 3TGNA 1JHFA 1V3FA 5J6XA 1T39A 3ZN1A 1ZLKA 2WTEA 3I53A 1R5HA 2JTVA 1YW8A 3O2PE 1VTNC 3SQNA 1ZN2A 3COAC 2FSWA 1IN8A 3R0JA 3VB2A 1YIOA 1GXPA 2W25A 1UFMA 5EEHA 1BOAA 1ON1A 1KYZA 3LQQA 5HS8A 2V6CA 2DLLA 1Z9CA 4ON0A 3I0TA 1XDUA 2ZNYA 2QZ8A 3GFJA 1I27A 1S3JA 3FX3A 3HRTA 1ZG1A 3F8BA 3R60A 3V7RA 3DV8A 1YW9A 3KP5A 4LK1F 3L00A 4HF2A 4LK0F 2VBWA 2EA2A 3M7GA 4M73A 3F6OA 3MZHA 4GO1A 5JVTA 2XUBA 2O0YA 5DD8A 1ZLJA 3JSPA 3DFGA 2K27A 5FGMA 3Q5FA 4EJWA 4JK1X 4GYGA 4OIRF 3K1MA 5HLHA 4HX4A 4RB0A 4Q47A 1JE8A 1X3UA 1XCBA 4RB1A 2QYOA 4HAMA 2XRNA 5JR3A 3QP5A 1K6OA 2W85A 2DQLA 4PGHA 1SD4A 1SFEA 4LG0A 4AIHA 3QAHA 1IRFA 5DCMB 3RIRA 5L3BA 1SD5A 4HA8A 4G94A 4OOIA 1IN6A 2ZMEA 3V7SA 2QUFA 3QPHA 2FMLA 4EQQA 2V1XA 5LGNA 4I98B 4BQAA 2CFXA 1I1SA 1W4MA 3MCZA 3FMQA 1SAXA 3DEUA 4OIQF 2KIUA 4UNOA 2IA1A 1IXSB 3F8MA 1KA8A 5H6QA 4PDKA 2PMUA 3I64A 1FY7A 3QU3A 1ODDA 1HQCA 2STTA 4KMUX 3ZQ7A 1G6NA 1YO5C 4HLXA 2Q0OA 3GF2A 2GIVA 3F22A 1TW3A 3HHHA 2XAQA 2NAZA 1EH6A 1Z6RA 2BBYA 1TNTA 2D2WA 3I58A 4HV6A 2DBBA 2P5KA 1XGNA 2LDUA 2ETHA 4Y15A 3M9AA 2GXGA 3F8CA 3GWZA 5BS6A 5ICCA 2UZKA 5K5RA 2R7FA 2PEXA 1BIBA 2F2EA 3I4PA 3F23A 4UXNA 4KDPA 3LWFA 4A5MA 4RB3C 2DPDA 2PLYA 2FU4A 3RPQA 4UUVA 1K78A 1GXQA 2RKHA 1MJBA 2XASA 4BHPA 3F8FA 3HSRA 4EJOA 2LNBA 3IKVA 1YYVA 3R61A 1Z6TA 5BQTA 3NRVA 3WGHA 1I6XA 3TQNA 4UV8A 1PDNC 4KICA 3NEUA 1MZBA 5AIPA 4ZYEA 2MLGA 3SXYA 3SFZA 3T0YA 4BXUA 1K79A 1F5TA 4JQFA 3F72A 4HF1A 4A0ZA 5FLXZ 2VE9A 5FFXA 3SZTA 2DK5A 4U7DA 4BAYA 3H3UA 1RUOA 2RGVA 5DUIA 1BIAA 1T98A 3DPLC 5JI6A 4GGGA 3U2RA 4ZZDA 2L4MA 4KN4X 1B9NA 2H6CA 4PCQA 1YLFA 1IXRC 1IW7F 4UVAA 1O7LA 3E3VA 5DDGA 3HSFA 4KT5C 2PFBA 5ED4A 4KYWA 3MZYA 2JSCA 1WRJA 2A61A 5A2QZ 4PZJA 2HWVA 3CUQA 2A6HF 4BHCA 1ZARA 4A6EA 4CGZA 4Z2YA 2MLKA 4HDUA 6PAXA 2L4AA 4N0BA 1FOKA 1J59A 3OOPA 1Z05A 1BN5A 2DQRA 3KEOA 1D3YA 2RQPA 4WXCA 1R1VA 4XBFA 5H6RA 2FEZA 3G73A 4LLNA 2HQRA 4MGRA 4CICA 2DFIA 2QQ9A 3T8RA 1G4DA 2D1HA 1CGPA 2P7CB 2STWA 2J5OA 5DCMA 2C6YA 3ZMUA 1BI2A 2KIFA 2M30A 2LKPA 2X4HA 2HFHA 5CVIA 2E7XA 5HOOA 2NNYA 5D4SA 1F9NA 5CVRA 1MJ9A 5DCFA 5ERIA 5D5VB 5LGTA 2PN6A 2Z99A 4LG0B 2Z9OA 3PQKA 2OQGA 2DTRA 2OU2A 2K4BA 4IHTA 2V79A 2V9VA 2ZMEB 4U0YA 1HKQA 2A5YB 5D8LB 4UHTA 5L3EA 2KRFA 2JPCA 2VBXA 2R3SA 3E6DA 3K0LA 3J80Z 3JSOA 1YTYA 1XMAA 1FLIA 1FBUA 2HKXA 1U3EM 1TBXA 5LHGA 3VFZA 2GXBA 3T8TA 4KMFA 5F1RA 2JPBA 1RIOH 5CVJA 2QLZA 5HDNA 3KP2A 4KIBA 3G3ZA 3KZYA 2FNPA 4G7HF 5HLIA 3K69A 3I5UA 2ZFWA 2BV6A 1R5GA 3HIFA 3IRQA 1BBYA 3I59A 3KP4A 4E70A 1C0WA 2LF8A 4P55A 3F6VA 1PP8F 2PG4A 1EH7A 3GUDA 2ACJA 5HLGA 2FBHA 3J81K 1QQIA 1SFXA 2V1UA 3F3XA 3CUQC 2WC2A 3C18A 3AAFA 3JAMZ 3ABUA 1QNTA 4LB5A 4LMYA 3BROA 3TO7A 2RDPA 1O3RA 3KETA 2PMHA 4I2OA 2FOKA 5DV5A 1K78B 3L9FA 3BP8A 3U9GA 1RI7A 2EFOA 3W6KB 4N9HA 4AWXB 4FHTA 4NB5A 1XGOA 5H20A 1FWZA 1XB4A 5DEQA 2P8TA 1S7OA 5K5QA 1ONVA 3BJOA 2DT5A 4IXAA 3LA2A 4UVBA 4FX4A 3MWMA 4WXHA 4IPAA 4O5VA 2UWMA 4D0PA 3EDPA 2F5FA 4G7ZF 4I0AA 4I01A 2J5PA 3GO5A 3QU6A 3FXRA 2JRTA 1R1TA 2A3SA 2ESHA 2HEOA 1JXSA 4HV5A 1U78A 5F64A 3BJAA 2O3FA 3MEXA 2VOOA 1G3SA 3LAJA 2GQQA 4WCGA 2FRHA 3LA7A 1WSUA 5D5WB 1IF1A 2OA4A 2ZNZA 3DQVC 4ESBA 2EB7A 5CYVA 2VODA 4EJUA 4NHJA 1RUNA 4CHUA 1S6LA 3FWEA 1MDMA 1AOYA 3CUQB 2Y75A 4LJZF 5HS7A 2FA5A 5JHUA 2XAJA 3EUHA 2H6BA 4TV7A 1YG2A 4HBLA 1WQ2A 1H0MA 5D8KB 3LA3A 4OU0A 1OKRA 4B09A 5K5OA 1LVAA 2K4JA 3Q9SA 1HW2A 3E5XA 4U88A 3R6SA 3B73A 3HRUA 5J8CA 2IA2A 2RC4A 4MEYF 1O7FA 3C1DA 2Z5UA 2RV8A 2D1VA 4ETSA 1W7PD 1OMIA 2ELHA 1PUEE 3BPVA 4BYYA 4U0VA 4DQ2A 2YSRA 3E6MA 4YIIA 3CLOA 5IT9Z 4RGUA 1U5TC 5K1YA 2O8XA 5EEGA 3ZN0A 2PQ8A 1R22A 3T1BA 4CXFA 2HYFA 1QZZA 1YFHA 3L7WA 4ZZLA 1KU2A 3KZZA 1D5VA 3M8EA 1KU3A 4Y13A 3WGGA 5ILUA 1W5TA 2JT1A 3L09A 1F4KA 1LDJA 4G6QA 4L18B 1FYKA 2GAUA 5FB2A
chains in the Genus database with same CATH superfamily
1WJBA 4CCLA 1MBGA 1S7EA 3HOZJ 4MLOA 4ZYGA 2HNHA 1IO2A 1P92A 2LTPA 2LR8A 4AYBN 1VQ8I 3LSGA 2ISZA 1R4MB 1FMVA 5FKMA 4M6XA 1FIPA 4E4HA 3L2WA 1K4SA 5D5UB 1QGPA 4XLEA 3TP3A 4G12A 3S2WA 2TRTA 3FKJA 3TO9A 3L2UA 4A0YA 2UXXA 1SEUA 4R79A 3FMRA 1YS6A 3ZR8X 1Z77A 2DFHA 1FPQA 4PSWA 2DPUA 3K70D 1V55H 4A3FJ 3GBGA 3CCLI 1JUPA 2VC1A 2XV4S 3RI4A 5CLSA 1JKOC 2WADA 3I4MJ 1WHUA 5CKTA 1L3LA 3WTUC 2L02A 2HGCA 2PMZN 5GAHJ 2TDXA 1NHAA 1DPRA 3D5LA 5ICFA 4IQ4A 4RAFA 4FASD 4OIOF 3I54A 5EJCA 3MKYB 1NK3P 2EFNA 4FE4A 1HA8A 1X1CA 2G7UA 2P6SA 2L3DA 3VOEA 2VJ4A 1HOMA 2XVCA 1RZ4A 2HDCA 3DP7A 1R7JA 5JFRA 2K9NA 4AC0A 3KE2A 2ZSHB 4KISA 2QVOA 2X6YA 4IRHA 4OINF 4WX9A 1PP7U 3H3VK 2L7FP 1WKMA 3OY9A 2CQKA 3I59B 5IT3A 2G9WA 3WTXC 4IF4A 3GTMJ 4JX4A 2BXZA 2VC0A 2CW8A 4F55A 4YIFA 1A31A 3G71I 1UZCA 1GVDA 4MTEA 2PBIA 2E1MB 5KVRA 3ZQCA 1ZR2A 2H8RA 3KYDB 4EEFG 3E5UA 2O9LA 4U87A 2I5UA 5BOXA 2BY2A 3L2VA 1E2XA 3GZNB 4P9UA 3GTQJ 5E1WA 2KMUA 4OMYA 2RVCA 2A6TA 3WTSC 5KCMA 5C3EJ 1S9HA 2XGCA 5KNLA 1Q1HA 3ZQLA 1TL8A 3K1NA 1G2HA 4ZH4F 4BE0A 2XKOA 5FLXK 4M6YA 3KEQA 4RGXA 4ZDLA 3A02A 3RPUA 3WU0A 3OYFA 3RKQA 5J8FA 4II2A 1FYLA 3DU6A 2LG4A 1R58A 2QENA 4RB2C 5DM7F 2R7RA 2MGQA 4EM1A 3H5AA 4PJLA 2D45A 2VJ5A 2R7UA 3HC7A 4E7ZA 4M3BA 4QSHA 3JRFA 3S1MJ 2XF7A 2NVQJ 2JA2A 4IHSA 2Q1ZB 2XC7A 4XLNF 4OWRB 5K7FA 4HYEA 1G3TA 1ZRDA 4M74A 2I8DA 1ZHFA 4GCVA 5F0FA 2E1NA 4PSXA 1BJZA 1ZKGA 3CLQA 3GX4X 1P4XA 3ZP5A 5CPRB 1QPIA 3CCSI 3BTCA 4HX7A 1K4TA 2PJRA 3PFYA 1QPMA 2IS6A 5F6FA 4B44A 3E6CC 2GOMA 3BOQA 3LOCA 2FBIA 3HZJA 5AIQA 5C4XJ 2O03A 3M07A 3IHUA 3LFKA 2B63J 3S2HJ 5EZGA 1ZH5A 3IAM2 3VSKA 4W97A 3UKGA 1SD6A 2M0MA 5CQGA 4BHBA 5FD6A 4M9SA 1Z21A 1R36A 4CSWA 3ZQIA 1ORKA 1MBEA 4OAZA 5A2QK 3T5XA 1Z7LA 4KIGA 2LC2A 1HSTA 1FJLA 1TWCJ 1OYWA 1A6QA 2IA0A 3FM3A 1BM9A 3Q0VA 4DBQA 3BR1A 2R5ZA 1UB9A 2OV7A 4XR6A 3FM5A 2R7SA 4IVNA 3JW4A 2FQ3A 1AKHB 3MKLA 4CDGA 1FTTA 3WGIA 1JTYA 1YX3A 3TBIA 3VEPA 2CG4A 2O61A 4BS9A 3K7AJ 4S04A 4Z6YA 4IL6C 5EG0A 3P7NA 3S1NJ 4MQVA 4I02A 3K1PA 2KDZA 5FLMJ 3DKWA 4CZCA 4LB6B 3TDUC 3L1PA 1B4AA 1KYWA 4A2UA 3WU1B 5HS9A 3CDHA 3HTSB 1R9TJ 2DT6A 2HVSA 4XKWA 2XKPA 4BY1J 1IRZA 3HG9A 3HYIA 2M45A 1M1EB 3FBNB 2VASA 3C3WA 5K7ZA 2DOAA 2R7OA 2OZUA 2OJED 4HW0A 2CV2A 3JRHA 1MSFC 2EFPA 4ASNA 1R1UA 2G7HA 4IHWA 2PJPA 1DDNA 4B47A 2P6TA 4Q5SF 3FZVA 3LSHA 2LP0A 5J4VA 4U0WA 1SMTA 2LY2A 2P4WA 4CYCB 3IH3A 1MDMB 4BDZA 3ELKA 2E34A 2RREA 2VBYA 2DO7A 2M87A 1FP2A 3ZPLA 2MA3A 3AL0C 5L3CA 2QGUA 2WWYA 2LD5A 3HUGA 5LBQA 1U9OA 1YRNA 3O6BB 2TCTA 2X9DA 1DU6A 1N77A 2RNGA 2IVMA 1YX5A 2QM3A 2ISYA 2DMQA 1D8JA 3FXKA 3I4NJ 4HSRA 3SZPA 1VQ5I 2FBKA 3IWFA 2OTJI 4HNUA 1T0FA 3WG9A 2H8WA 3HOWJ 3QYBA 3MVPA 1UCRA 4XSXF 3S15J 4ESJA 3P9KA 4EM0B 5GTHC 1B72B 3K4KA 3HTUA 3DEWA 2L7ZA 3IC7A 2R7WA 4V2GA 3KLOA 1XMXA 5LFAA 4D5CA 2L54A 1E0EA 3RKWA 3CDIA 3J80K 3CC2I 2A5WA 2W57A 3FHZA 3ABKH 3NARA 5D5XB 2QSGX 2HYGD 2W84A 5E1ZB 2N8GA 3CUOA 3JTHA 5BPIA 4YFXF 2R7ZJ 3G1MA 3PJRA 2EJRA 4GRIA 2AO9A 2OCCH 2KHMA 2Z2SB 3GXOA 5FO5A 2DW4A 1P4WA 4I09A 2YUSA 3N4MA 3M3YJ 3BZCA 3ZQGA 4XOPA 4XIDA 2RNJA 1OCOH 5JLWA 1XDSA 1SMYF 1MKMA 3H9GA 3S3MA 1IN5A 1T6SA 2IGKA 5GP9A 4P1WA 3MQ0A 3RYRA 3B02A 4IZZA 4X6AJ 2IS4A 4KITB 1ZQ3P 3JRIA 4NC8A 2KKOA 2DU9A 5EZHA 1BC8C 3DWLE 3GFLA 2K85A 2BW3A 1REPC 3EPZA 5FKNA 2CQ7A 4RGSA 2RN7A 3BR6A 3S17J 3FISA 3E97A 2RAEA 4ZTFA 5K7HA 3OV8A 1W5CC 1S29A 2EINH 3U1DA 2LKXA 1J5YA 3LQRA 2VT2A 2KJCA 4JBAA 2VUMJ 1USTA 4DW6A 4BEHA 3CCYA 4RS8A 2UUZA 3ONQA 2KPMA 1IN7A 1XX5A 2HI3A 2F48A 1BOBA 4PJMA 2F5EA 4B4CA 1XMKA 5F27A 3WODF 4K2EA 4HLYA 3HSEA 4F3QA 3S2DJ 3VYSB 1UHWA 3L2RA 1MMAA 3H92A 2XIGA 3JRCA 2ZCWA 1HKTA 1BW6A 1FEXA 4E7LA 2XAUA 4A0XA 1LKXA 1Y56A 4HPQA 1N78A 2KRCA 3VWBA 1Z3XA 3AL0B 5FRNA 3OR1C 2BEOA 4I7HA 2E2IJ 2YX7A 4WWCA 5GPAA 5J1YA 3ZRGA 3OYMA 3ABTA 5DYMA 1QVTA 1WCMJ 4RAYA 4P5OA 1JHHA 3DCFA 4EVIA 2XAFA 4UB6C 1W36D 2Q8KA 1U5TA 5H2FC 3BCAA 1ZTRA 2BYVE 5L3GA 3GFIA 4ENNA 2JN6A 3K10A 2XROA 3JREA 1BC7C 5LHIA 3NAUA 5IOYA 1MJAA 4XSZF 3CMYA 3HPHA 5JHFA 1MW7A 4CO8A 4PGGA 4XKBA 3NQOA 4MQ9F 2BHYA 5J1UA 2K3FA 1OCRH 5FFZA 3GTJJ 4HEA2 1ACIA 3GEZA 2R7XA 3GTLJ 3M1CA 1K7AA 1J7KA 3VYTB 2EFQA 2CV0A 2HVRA 1B6AA 2VLAA 1U8BA 1R6RA 3BZ6A 1W7PA 3BPXA 5L3FA 1MMNA 1OYYA 2GA2A 1YW7A 3CF2A 4EGYA 4HQMA 5E3LA 4MNUA 2KL4A 3W6VA 4EM2A 4N9IA 1TNSA 2ZJ2A 3C2GA 4WF2A 1W36C 1U8RA 4LG3A 1ETYA 1DUXC 4G7OF 3ZMDA 3EYYA 4HOBA 1IUFA 3IP4B 1E3HA 1F1ZA 4RGRA 1EV7A 2M0CA 1JTXA 3K2ZA 4LITA 4A6DA 2GBYA 3ZQFA 4L9NA 4DZPA 2P5VA 3OIPA 5KK1A 4IHVA 1U9NA 2HOEA 2R7DA 1O3TA 1ZREA 1QHHD 3DEEA 4Y17A 2QQ8A 4O6JA 1HBXG 4XKVA 1Y0UA 3JRAA 2NNNA 5LEJA 4YELA 3VODA 3C7JA 2M34A 4ZYDA 2IPQX 1XGMA 2PJRB 2MFZA 1U2WA 2VXZA 3WTTC 1GHCA 4KN7X 3O8HA 4L0YB 2KIQA 1X19A 2DJIA 2CGPA 1JI8A 2H27A 2HZDA 2CO5A 4BNCA 1FSHA 4RDUA 3RDIA 2X0LA 5LLQA 2QSHX 5LD2C 4IHYA 1ITYA 3V8JA 2H94A 3AG2H 4HNTA 1Z91A 3EQLF 3QOPA 4IX7A 2DMUA 4RAZA 3WE2A 5M3MJ 5E8GA 2KZGA 3FF5A 1XCVA 5DM6F 2OTLI 1DP7P 1V54H 1RNLA 2LVSA 1J2XA 1YS7A 3GLLA 3GW2A 3KP3A 2VOPA 2XSJC 3KZIC 3J7ZI 1JT0A 2YU3A 1WFXA 4C3IJ 4PUSA 3H5NA 3WTYC 5D6FA 5HODA 1GDTA 1OYIA 4AVZA 3SEQA 1LB2A 1CF7A 1S5LC 1WJ5A 1LFUP 2V26A 2JQ7A 2IW5A 2DAOA 4PFOA 2L9RA 3CC7I 1BR1A 2FQ4A 5EG0B 5M5XJ 3RQ4A 4XORA 2O6GE 3RCOA 1B8IB 4G6TB 2HDDA 1A04A 3QP6A 1ZRFA 1T2KA 4WXDA 4C3HJ 2OBPA 4IO9F 4IQJA 1MBFA 4DYRA 1I1GA 3BY6A 1ZGAA 2NRAC 4A3DJ 4DGWB 2QQBA 4HQEA 1WJAA 2P7VB 2F5DA 3BQYA 2AQFA 2XHKA 2QKLB 5CJ9A 4ENKA 1UHSA 2LFBA 4M9XA 2EV0A 1UELB 1G3YA 2XGXA 2GIZA 1ON2A 3PO2J 3BR3A 1P6RA 2K7LA 1H9TA 4C3JJ 3MMYB 4AIDA 5IT9K 4PFPA 3CF5F 1DPUA 5IOZA 2E5NA 1WJEA 2ZB9A 3FXJA 4ENJA 3WTWC 1FBQA 2A05A 1LEAA 3EUKL 4L9VA 3H35A 4DBRA 3OYDA 3D1NI 3GTKJ 1BI3A 1Y8QB 2HR3A 3S14J 4A93J 2OCEA 4UUSA 1QO0D 3W6JB 2D5VA 2LY1A 2V9PA 5HLTA 3HOTA 2EZHA 4XRSG 3RKYA 4Q48A 3HUGB 1YRNB 1KGSA 4XL9A 2FMYA 4M3GA 2CUZA 4R1HA 5E79C 2VT3A 2LSOA 2ZJPF 3KP7A 1SVLA 4L5IA 1DP3A 3V4GA 2IP2A 1VQMI 4GYIA 2QBYA 1LPQA 1E17A 1HF0A 1D1CA 3UNGC 1UHMA 2NS0A 4XQFA 2LYCA 4IRGA 4ENMA 3S1QJ 1KU7A 4EGZA 2MSYA 1VQ9I 1R5ID 4LLLA 1HXDA 3DBHB 1LQ1A 3LSKA 1GV2A 2IT0A 3OYEA 5HVQC 1FSEA 2CYYA 3DPTA 5E17F 1I39A 2MC3A 4XRFA 4BJ6C 3A0HC 3MAJA 4LD5A 2M9HA 1R00A 4EV0A 1R23A 1LNWA 2VQLA 3S8PA 1XPXA 2F5CA 2CUEA 1BL0A 4NBQA 3ZXSA 2A69F 3R4KA 3K4LA 1BA5A 5D6EA 3AKZA 4RLFA 3PSFA 3OYGA 2KRHA 1B9MA 1H8AC 1AWCA 3M1EA 4B8XA 1KZHA 5E8IA 1IDZA 1PYVA 3ISPA 1IAWA 1MBKA 4M9ZA 4A5NA 2HQNA 3OYAA 4DNCA 4E7IA 1V5EA 2KIMA 3PSIA 1VNDA 4J00A 3ML6A 4M71A 1OCZH 1VFCA 5EDNA 3JR9A 2K3PA 1SD7A 3PL8A 1D1BA 2L2OA 2DXIA 3QRFF 1FX7A 1H88C 2JJ7A 4HX8A 2BW3B 3LAPA 2O7OA 3WTVC 2YU9J 3ZMZA 3IV5A 3GLXA 3KP6A 3OL4A 3V7CA 5IPAA 1ZG3A 1XG1A 2NVUB 3ECOA 3F8NA 5E18F 1TQPA 3TO6A 3PNVA 3V42A 3MFKA 2CWEA 3GVAA 4RMNA 2VXDA 1RKTA 2R7TA 1X1BA 2KQRA 2H1LA 1MD0A 4BEHB 3ROUA 2XPUA 1FYMA 3HRSA 1P2FA 2B7EA 4BY7J 1OISA 3HPGA 1F36A 4P96A 4UVCA 2LH9A 1I50J 1MNMC 1RR8C 2E71A 4O3MA 2A68F 2ESNA 3DF8A 2NVTJ 4KIFA 5B66C 4WK8F 3DPUA 3O8GA 1HW5A 2EA4A 3W2AA 1TLHB 2XAGA 2NOGA 1SFUA 4FETA 3G6EI 5ILVA 2XF5A 2IRFG 1G59A 4PK4A 5IP6A 2HKOA 4XLAA 3OYHA 4M3EA 2K02A 1T8IA 2VQHA 5IYDJ 1W0UA 3E6BA 3H0GJ 3LFUA 4LLGF 2QF7A 1HW1A 3HEFA 3FK7A 3ZMSA 3D0SA 5IYBJ 2YPRA 3K70C 2HTSA 1IZ1A 3HGYA 3OYJA 3BTLA 2B0LA 2OAZA 4CYDA 1U5TB 2JZYA 4G6DA 3CMMA 2WBMA 2V9KA 4YRVA 1ZGJA 2VJIA 1TQIA 3K2AA 1P7JA 1V4RA 3B6CA 3J7AO 2MBFA 2L9SA 4ESFA 3CCRI 2LRDA 1XN7A 4IRIA 3CCVI 3FDYA 4E7SA 3Q0UA 4PJNA 3JTGA 5TRDA 1MNEA 4RLQA 4BQQA 4AIJA 2ZO4A 4FCYA 4HNVA 2MD5A 5LEKA 2L01A 4OMZA 3P9CA 3W3CA 5LRSA 1W7PB 5DD4A 1HDDC 4A3MJ 5L3DA 5FLVA 1ZYRF 2VB6A 3M8JA 1MBHA 3FMSA 3V8LA 1YHQI 1T38A 1S7AA 4AIKA 1K6YA 1TT5B 2Y0SN 1IUYA 4G8XA 3ECHA 1OR7A 3ULQB 3WHBA 2HXIA 3QPTA 5HDKA 2EZIA 2BXYA 4FX0A 1KU9A 2W00A 2GM4A 3OYIA 4QLCU 4II3A 2EK5A 3HJEA 3H3ZA 2FF4A 5LHHA 1ZELA 2VBZA 3IL2A 1EJ9A 5TJJA 3TDZC 3BG5A 1EKEA 2IJLA 3IRRA 1JUMA 2JVHA 3ZMTA 3TW7A 1L0OC 4H0EA 1R71A 2HS5A 2FE3A 3IWZA 1XGSA 2WY8Q 3ZMVA 1N25A 3I3LA 3K6GA 2E1CA 1WI9A 1LJ9A 2YR2A 4S05A 5ILSA 2GA1A 5B5EC 2IBDA 3DLAA 2Z33A 1ENHA 1ULYA 3ASOH 1QA6A 2WV1A 2BZTA 4UB8C 2GWRA 5C44J 2KFDA 1DQUA 4ZJZA 4DIQA 3CESA 3Q9VA 3GFMA 5LRRA 1O4XA 1EA3A 2HOTA 2ZXJA 2DODA 1B8IA 5FD5A 3RYPA 1Z3YA 3BWGA 1EH8A 3CP2A 3MN2A 1I5ZA 4KUMA 4C2TA 1ZR4A 2M1BA 2DMPA 1FOYA 1TTYA 1W5SA 3VPRA 4GXOA 5D4RA 4KA4A 4A12A 1J0RA 5E1XA 1SFKA 3L2CA 2WV0A 3GYHX 1SC7A 2Y0MA 4BQNA 1D0ZA 1USSA 3GZ6A 4E7HA 3N97A 1XSDA 1UAAA 1J09A 2GZWA 3ABLH 3HHGA 4HF0A 3I71A 3LSJA 5DUKA 2Y0SA 5E3MA 2KP6A 1WH5A 4PJ0C 2NXNB 1CF7B 4ZC3A 4NNJA 1OQYA 2UXNA 3H36A 1VQ4I 2JA8J 1VQLI 2JA7J 1ETQA 4R8HA 4G9YA 1DGRM 2WAFA 2AHQA 5M3FJ 1JKPC 3E5QA 2K9MA 3LSMA 5BMZA 4M3FA 2L5QA 2IAIA 2DI3A 4FT8A 1FP1D 1Q1VA 2K40A 3GTGJ 4PJJA 2DT7B 2AXLA 4HZFA 1KQ8A 3P9IA 2DA7A 2Z3YA 4BH9A 4F93B 1WPKA 2MH9A 5CVVA 3BCBA 3ERED 4FTHA 4YFKF 2R93J 3KFWX 2NOJB 4ZDOA 2FXAA 2LK2A 3HB9A 4QTRA 1FBSA 2EV6A 4XLPF 3F21A 2WAQN 3BQZA 3E1SA 2O5RA 4LGWA 1ZAOA 4L9JA 3K4MA 1O3SA 3QPSA 1JJ8C 2COBA 3HBLA 2M5WA 1H9GA 3E0JB 3HOSA 2E2HJ 1P4AA 1SFOJ 1KQ9A 4XM3A 4U7BA 3LMMA 1MIJA 2E7WA 1J9IA 4JX6A 4A3GJ 1BI0A 2HU9A 1NTCA 1QVUA 4UUSB 2M8EA 1FZPB 3DXJF 1XD7A 1Z1DA 1ETKA 2VKEA 2EPFA 1S8NA 3HOXJ 4YFNF 2ADUA 1LE8A 2DA2A 4F7ZA 2BVLA 2CSOA 1KQ0A 3BT9A 2K5CA 2W24A 3H9QA 3EETA 2VE8A 5EEAA 2QBYB 1U6GA 2BOLA 3KLNA 3OS2A 2NYXA 2LF7A 3CZ6A 3HRMA 4UUTA 3CO6C 1FT9A 3FXLA 1WWXA 2EQRA 1IV8A 2FX0A 4Y4RA 3QOEA 2BGCA 1HSJA 4L0ZB 2HOAA 4LFUA 1K61A 1TW2A 1D1AA 3RJPA 2VIXA 4NC7A 2KJBA 2AQEA 1E3PA 2H09A 3CTAA 2CRGA 5KAFC 1QBJA 2QWWA 5CVUA 3FXUA 2DK8A 2V1DA 5DTDA 2MYSA 4CH7A 3LSIA 1B59A 2P5LC 1P7IA 3S3NA 4ZDPA 4EJVA 3BDDA 1OPCA 2X6WA 4MTDA 3PFIA 2EV5A 1IN4A 1VQOI 2MG4A 5TGTA 4YIRX 2HTJA 2QQAA 1STZA 1XSXA 3NWSA 5AONA 2WAQA 3UR3C 3R0AA 2HPMA 3WTZA 3CO7C 2ME0A 3RKXA 4XICA 3LSTA 1J75A 4F91B 1OR7C 4DYQA 1XSVA 4C9YA 2MH2A 3BR0A 1VQNI 3TP0A 3IKTA 5LGUA 4I0BA 4AD9A 4EMSA 1YITI 2ZKZA 1JUSA 1MGTA 1IXCA 4X0GA 3ZQHA 1LDDA 1RKWA 2CW7A 3E7LA 3K9TA 4XN0A 1Y0NA 5ICGA 4W1UA 2DDBA 5J3LA 1FNNA 1V5FA 5E20A 3CCJI 2Y9YA 3I9V2 3DLLF 2R5YB 1JKRC 2OQRA 2AS5F 1IRGA 4KNYA 3JAMK 2ZBKA 4Y3OA 4MHGA 3OIOA 2EH3A 2EZLA 3RSNA 3BG3A 4IHXA 2ZXHA 2FJ1A 3KYCB 2XB0X 2P0WA 3QODA 2BE5F 3PQJA 2ZJQF 3IAS2 3S93A 2VQGA 1UG2A 2L9NA 2YS9A 3JCUC 1Z7UA 4ZYHA 4XK4A 4KFCA 3CJNA 5IY5H 1CQTA 1QRYA 1ZRCA 2WB1N 2VONA 2M7BA 3GCMA 1AA7A 1BI1A 2DOFA 3FXQA 1GLNA 1O3QA 1VQKI 1D8KA 1TQMA 2K86A 2E60A 1B1BA 1ETVA 3OYKA 2HZTA 2ZXIA 3KPHA 1WJDA 3V8KA 4L5JA 2OZ6A 4GDFA 4CCMA 2FNAA 2VQCA 4EJTA 4AVPA 3FIWA 2COMA 4N4NB 1HKSA 2OD5A 3SYTA 3OS1A 2A07F 1YQAA 2A6EF 3TKYA 1YE9A 1G3WA 4FISA 5HDGA 3EYIA 2XAHA 4L9TA 2NVXJ 4BBSJ 5ICEA 1ZG5A 2DYSH 4BJ5C 1FC3A 3DTEA 3TOBA 3SFIA 3DKXA 2Y48A 4P9FA 4Q4ZF 2R7VA 3TOAA 3REOA 4MIMA 1WI3A 1QZYA 1TZLA 3J81Z 4XKCA 2L9VA 1LFBA 1GVJA 3BG9A 1MH3A 3GZ5A 5GTIC 2EWNA 3BR5A 4UV9A 1UJ8A 2IGMA 3A03A 4HDVA 1BJAA 2X1EA 3TL4X 2Q2EA 4V19K 3AG4H 5BNGA 4Y52J 3RQIA 9ANTA 2YX4A 1GT0C 3HGGA 3OIQA 1YJWI 1RESA 1V5GA 3M8FA 1O57A 3BJ6A 4M72A 2DMNA 4MEXF 3WE3A 4HG2A 1LDKB 1APLC 3SHFA 5BPDA 2IGNA 1BR4A 4CZZA 3KCCA 4CCJA 4D7MA 4YG2F 2P81A 2VN2A 3ABMH 3RZOJ 2WY7Q 1X4PA 3QPLA 3RTRA 2PI0A 1X1DA 2LBFA 1JGSA 4BL0B 1H89C 4OIPF 2BY3A 4QWQA 2WB1A 2ZC2A 4IJAA 3F0CA 1LEBA 2CW0F 2EFWA 2X51A 1NG6A 3O3KA 4NQWA 3TGNA 3C2BA 2DOEA 3CQZJ 2KZVA 2QEXI 1JHFA 1V3FA 5J6XA 1T39A 3ZN1A 1ZLKA 2WTEA 3I53A 1R5HA 2JTVA 1YW8A 3ZCOA 3O2PE 1EF4A 4D7NA 1VTNC 3SQNA 3A0BC 1ZN2A 2RQQA 3COAC 2FSWA 4X1EA 1IN8A 3R0JA 3VB2A 1YIOA 3U21A 3TW6A 1GXPA 4I6ZA 1HLVA 2W25A 1X58A 2FOWA 2XF6A 2E35A 1UFMA 1OCPA 1IV6A 5EEHA 1BOAA 1ON1A 1KYZA 5J40A 1ERDA 5F0HA 3LQQA 5FRMA 3SZGA 5HS8A 1ZGWA 2PX9A 2V6CA 2Y9ZA 1XC5A 2W82A 4DOZA 3IH4A 2MABA 2DLLA 3TMOA 1RETA 1Z9CA 4ON0A 1HCRA 3I0TA 1NH3A 5J4YA 1R4NB 1XDUA 4RAGA 4CCOA 2ZNYA 2QZ8A 3GFJA 4XLFA 1I27A 1S3JA 3FX3A 2ZSIB 3HRTA 1E3OC 2X1DA 3FXOA 1ZG1A 2M2EA 3F8BA 1ETWA 3R60A 3V7RA 5GPCA 4XNFA 3CDLA 3DV8A 3G4SI 1YW9A 5C4JJ 3BG7A 3KP5A 4LK1F 3L00A 2CUFA 1OFCX 4HF2A 4LK0F 1P9QC 2VBWA 3FK6A 3MKWB 2EA2A 3FBIB 3M7GA 4M3DA 2LREA 4M73A 3GMEA 1X3ZB 3F6OA 3MZHA 4GO1A 5JVTA 1SAUA 2O0YA 2XUBA 5DD8A 4HSTA 1ZLJA 3JSPA 3DFGA 2K27A 5FGMA 3FHNA 3Q5FA 3CMEI 4EJWA 4JK1X 4GYGA 3AG1H 4JYKA 4OIRF 3B6AA 4XMYA 2Y2ZA 2HVQA 3K1MA 5HLHA 3CD6I 1IG7A 2XGEA 4DYCA 3PUBA 4F92B 4HX4A 4RB0A 4Q47A 1JE8A 1X3UA 1ETXA 1XCBA 1IRXA 4RB1A 2QYOA 4HAMA 2XRNA 4LIVA 5JR3A 1WH7A 1X1AA 3QP5A 1K6OA 1BW5A 2W85A 2DQLA 1FMWA 3OYCA 2K9SA 2CQXA 4PGHA 1SVOA 1W1WE 3WG7H 5HNHA 4MFEA 4A3KJ 2VL8A 5JLXA 2XDVA 1SD4A 1SFEA 5M5WJ 4LG0A 2ME6A 4AIHA 1I6HJ 4XRMA 3QAHA 1IRFA 5DCMB 1DU0A 2R4GA 3W2VA 3RIRA 2G0EA 1LE8B 2CQNA 5IP9J 2MW8A 5L3BA 1SD5A 4HA8A 4G94A 4OOIA 2VKVA 1IN6A 2ZMEA 3V7SA 1JGGA 1ZK8A 2QUFA 1YIJI 3QPHA 2FMLA 2X6XA 4EQQA 2V1XA 3P5JA 2F5VA 2KLOA 4ZTJA 2JWTA 5LGNA 3H9JA 4I98B 5KHDA 4CCNA 4BQAA 2V6EA 2CFXA 2EILH 1I1SA 1W4MA 3MCZA 4NDLA 3FMQA 1SAXA 3DEUA 4OIQF 2DYRH 2KIUA 4UNOA 2IA1A 1IXSB 3F8MA 1KA8A 1IJWC 5H6QA 3S32A 3DBRB 4PDKA 2WA0A 3IUOA 4QPOA 2PMUA 2GXAA 3I64A 1FY7A 3QU3A 1ODDA 1HQCA 4B3XA 2STTA 4KMUX 1MBJA 1G6NA 3ZQ7A 1YO5C 4HLXA 2Q0OA 3GF2A 2R5YA 1X2MA 2GIVA 1WJFA 2ELJA 1XS9A 4FQGA 1JJ6C 1MNDA 1VZ0A 3F22A 1TW3A 3OOUA 3KIOA 3OL3A 3K4JA 3U1KA 1TP4A 3HHHA 2JVGA 5M5YJ 2XAQA 4BJTA 2NAZA 4IOCF 3K4BA 1VQ6I 1EH6A 3OMYA 2VKHA 2OC6A 1Z6RA 2BBYA 1TNTA 1A6IA 2DA5A 3A4CA 2D2WA 1YJNI 3H0DA 1ETOA 1OCCH 5IP7J 3I58A 4HV6A 2F4IA 4MO7A 3PUFA 2GLOA 2DBBA 3CJRB 3PO3J 2QSFX 2ICWG 2P5KA 4XN3A 2XGDA 1LUJB 1XGNA 2LDUA 3PNYA 3DU5A 3H5RA 4N4OB 3ZQQA 1MMDA 2FD5A 2ETHA 4Y15A 3M9AA 2GXGA 1VQ7I 3F8CA 1FOXA 3GWZA 1MMGA 5BS6A 5ICCA 2MD0A 2UZKA 5K5RA 3LL7A 2KDOA 2R7FA 3JRDA 2VJJA 2PEXA 1LFPA 1BIBA 5HNFA 1TC3C 1IDYA 2F2EA 3I4PA 3Q0WA 4CA0A 3F23A 2ID6A 4UXNA 5EGOB 4KDPA 3HL2A 3LWFA 4A5MA 4RB3C 2LMDA 5EYRA 2DPDA 2PLYA 4A3IJ 2ZFUA 2VPLA 2EBIA 5JVGF 3J7AY 2IS2A 5TISC 5FJ8J 4AYBA 4CUGA 2LKSA 2FU4A 2ZXWH 2CS3A 3ERMA 2L7KA 3RPQA 4UUVA 3DTIA 3G1LA 1K78A 1VF9A 1GXQA 3ESWB 2RKHA 2GOXB 1MJBA 2XASA 4BHPA 2JK3A 2OPTA 3F8FA 3HSRA 4BE1A 4EJOA 2LNBA 3IKVA 1TWHJ 4RM3A 5B1AH 4DJAA 1TT0A 1YYVA 3CCUI 3R61A 3GTOJ 1RPWA 3EUHC 4Y7NJ 1Z6TA 5BQTA 2HQ5A 3NRVA 3WGHA 1I6XA 3TQNA 4UV8A 5F1JA 1PDNC 2NVYJ 2DJNA 4KICA 3NEUA 3MKZA 1MZBA 2E19A 5AIPA 2NS8A 3HOUJ 1Y1WJ 4ZYEA 1XTAA 2MLGA 3SXYA 1GV5A 2PMZA 2Z16A 3T0YA 3SFZA 4BXUA 1K79A 1F5TA 2Q2EB 4JQFA 3F72A 4HF1A 1VQPI 4A0ZA 5FLXZ 2DA4A 2VE9A 3CCMI 3MD2A 2EIJH 5FKKA 2VKDA 3H1CA 5FFXA 3BG6A 1KONA 2CUJA 3SZTA 4A3LJ 2DK5A 2WAEA 4U7DA 4BAYA 3S3OA 3H3UA 1RUOA 2RGVA 4A3BJ 5DUIA 1BIAA 1T98A 5E3OA 4A3EJ 3DPLC 5JI6A 4BDYA 2X85A 5FKOA 1FTZA 4GGGA 2LBFB 3U2RA 1YJ9I 2Z1DA 4ZZDA 2HOSA 1Y39A 2L4MA 4KN4X 1B9NA 2H6CA 4PCQA 2ZMEC 1YLFA 4NQWB 1IXRC 1IW7F 4UVAA 3OWTA 1O7LA 4GFBA 3E3VA 5DDGA 3HSFA 3QWLA 1YI2I 4KT5C 2PFBA 2M8GX 2JSPA 2K9LA 4D5FA 3BC8A 5ED4A 4KYWA 3MZYA 3CJQB 3I56I 4AU7A 1T08B 3A2KA 2BHZA 2IGOA 2JSCA 4S0HB 1WRJA 2ELKA 3OSGA 2O8KA 2V1NA 2DDAA 2A61A 3G1OA 5A2QZ 3A01B 1NK2P 4PZJA 2EIKH 2HWVA 3CUQA 2A6HF 3NWTA 4BHCA 4F52A 1ZARA 4A6EA 3SDBA 2IS1A 4ABZA 1JT6A 4CGZA 4Z2YA 2MLKA 2ECCA 3D5RC 4HDUA 4LIUA 6PAXA 2L4AA 4N0BA 1FOKA 2QKMB 2BY1A 2Y69H 1J59A 3OOPA 1WGXA 1RC9A 1BN5A 1WVRA 1Z05A 2DQRA 3KEOA 4CCKA 1D3YA 4XLCA 2XPVA 4IEJA 2RQPA 4QIWN 1A35A 2HPIA 4WXCA 1R1VA 4XBFA 5H6RA 2FEZA 4B43A 1POGA 3SDGA 4A3JJ 3QQAA 2V7FA 3G73A 4BXFA 3MZ8A 2DFEA 4LLNA 5FROA 2HQRA 4C30A 4MGRA 3J7YJ 4CICA 2DFIA 2QQ9A 1UMQA 2LOOA 3T8RA 2JMWA 1G4DA 2D1HA 1WZ2A 1CGPA 2P7CB 2STWA 2J5OA 1WJCA 5DCMA 3M4OJ 2C6YA 2CFOA 3ZMUA 3VSLA 1BI2A 2KIFA 2M30A 2LKPA 3RPUD 2X4HA 2HFHA 5CVIA 2L7MP 2E7XA 2QA4I 2M4GA 2DTZA 5HOOA 3N05A 2CH0A 2M4KA 2NNYA 3CP8A 3W2WA 2XRLA 5D4SA 1F9NA 3SEZA 5CVRA 1MJ9A 5DCFA 1T33A 4NC6A 2L0KA 5ERIA 5D5VB 4J19A 1HDPA 5LGTA 2PN6A 2Z99A 4LG0B 2Z9OA 3PQKA 1Y6IA 2OQGA 2KISA 2DTRA 4ITVA 2OU2A 2K4BA 1T56A 3JRBA 2R0QC 4IHTA 2V79A 2V9VA 4J01A 2ZMEB 4A69C 4U0YA 2JUGA 1HKQA 2A5YB 5D8LB 4UHTA 5L3EA 2KRFA 2JPCA 2VBXA 2R3SA 3E6DA 3K0LA 3J80Z 3WHCA 3JSOA 2HXOA 4E6KG 1YTYA 1XMAA 4A3CJ 2MC4A 1FLIA 1FBUA 5F04A 3KYLA 2HKXA 4I99C 1TBXA 1U3EM 1PVEA 2F4OB 2K9QA 5LHGA 1PUFB 3S16J 3VFZA 2W7NA 2GXBA 2DA1A 2QCOA 3T8TA 4KMFA 5F1RA 2JPBA 1RIOH 5CVJA 1GUUA 2QLZA 5HDNA 2I10A 1SVMA 2ECBA 5FKLA 2XPWA 3KP2A 4DZJA 5GAEJ 3OSFA 3HDDA 4KIBA 3G3ZA 3KZYA 4E7KA 2FNPA 4OAYA 2CJJA 1A5JA 4G7HF 3HXLA 5HLIA 3K69A 3S1RJ 4EATA 3I5UA 2ZFWA 4JOMA 4QPQA 2BV6A 1R5GA 3HIFA 2JRMA 3IRQA 1BBYA 1UG0A 2HDWA 1X3WB 3I59A 3KP4A 1T95A 1DGWY 3QYFA 3IH2A 2LY9A 3G2BA 4E70A 1C0WA 1I3AA 3K4NA 2LF8A 4P55A 4BQOA 5EGOA 3F6VA 1PP8F 4B48A 2PG4A 4V2FA 2X1CA 4BBRJ 4XONA 3OYLA 2B9SA 1EH7A 2W48A 3GUDA 2ACJA 5HLGA 1G8XA 2FBHA 1QQIA 3J81K 1SFXA 3LSRA 4Y33A 2V1UA 2JUCA 1OJLA 5IYCJ 1FOWA 3F3XA 5B3SH 1Z67A 2R92J 3FKIJ 4C2UA 2F4MB 3CUQC 2WC2A 3C18A 3AAFA 3CMAI 4JP0A 1OLTA 4XLHA 3VDXA 3BR2A 2E1OA 3JAMZ 3DKYA 3ABUA 3PNTA 1QNTA 3OR2C 4LB5A 4D1QA 4LMYA 1W0TA 4C2MJ 3BROA 3TO7A 2RDPA 1O3RA 2M3AA 3ASNH 2CU7A 3KETA 2R7QA 4H4KC 5J1RA 4UY8I 4NUBA 2PMHA 4I2OA 2FOKA 5DV5A 4BKXA 4HRIA 4AM3A 2KT0A 1PJRA 2W1OA 1K78B 2Y31A 2NS7A 2V4JC 1MSEC 2UV1A 1I3QJ 4ZYAA 3L9FA 3BP8A 1IGNA 3U9GA 1RI7A 2EFOA 2IXSA 3W6KB 3CJTB 4N9HA 4AWXB 5E3NA 4FHTA 4NB5A 1RR7A 1XGOA 5H20A 2IEKA 2JA6J 3QYEA 4JX5A 1FWZA 1XB4A 2EZKA 1Z0XA 5DEQA 3PIPF 2P8TA 3OYBA 1QHGA 1S7OA 2ZJRF 2H1KA 5K5QA 1ONVA 3BJOA 1U0JA 4RM2A 2DT5A 3VYUB 4IKFA 4IXAA 2DCEA 3LA2A 3HOVJ 4BGDA 1T0FC 4UVBA 2OF7A 4L5EA 1OCTC 3MWMA 4WXHA 3AG3H 4FX4A 4IPAA 4O5VA 2CV1A 2UWMA 3HKZN 4FE7A 3DTKA 4D0PA 3EDPA 2F5FA 4G7ZF 1F43A 4I0AA 2XB5A 3I55I 4E7JA 4I01A 3ZGKA 3HOYJ 5CQEA 2J5PA 3GO5A 1S72I 1Y1VJ 1MH4A 3QU6A 3FXRA 2JRTA 3SJMA 1R1TA 2VPRA 2A3SA 2ESHA 2HEOA 1JXSA 1AKHA 5EF6A 4HV5A 1QZEA 4BU2A 1U78A 5F64A 3BJAA 4BUPA 2O3FA 3MEXA 4RA2A 2VOOA 1BR2A 2BY0A 2E36A 1R49A 1VI0A 3A01A 2JA5J 1G3SA 2CMPA 3HM5A 3CC4I 3BTIA 3LAJA 4LOCA 1A36A 1N75A 1D0XA 3KX2A 3TEDA 2GQQA 4WCGA 3EUAA 2R5ZB 2DA3A 2FRHA 1HC8A 3LA7A 2CQQA 3DBLB 1WSUA 2W4SA 1D0YA 5D5WB 4BXXJ 1IF1A 1LVKA 2OA4A 2ZNZA 2E5ZA 3DQVC 4ESBA 2X6OA 2DFFA 2EB7A 5CYVA 2VODA 2E2JJ 4EJUA 4I76A 4NHJA 3BTJA 1RUNA 4CHUA 3JRGA 1S6LA 2DA6A 1TWAJ 1TWGJ 3FWEA 3BLYA 4CYCA 1MDMA 4M6VA 3L2QA 1AOYA 5F0CA 3LNQA 3CUQB 3OS0A 2EIMH 1RRJA 2Y75A 4LJZF 5HS7A 2FA5A 2OUMA 5JHUA 2F6CA 2XAJA 3HKZA 3EUHA 2H6BA 1X1PA 4TV7A 1YG2A 4HBLA 1WQ2A 1SANA 1H0MA 5D8KB 3LA3A 2HQAA 4OU0A 2DN0A 1OKRA 1K83J 3RZDJ 2LLKA 3BZKA 4BACA 5KAIC 4B09A 5K5OA 5GADJ 1LVAA 2K4JA 3Q9SA 2Y30A 4XRSA 3LSPA 3E5XA 1AHDP 4U88A 3R6SA 1HW2A 3B73A 5J47A 1QU3A 3HRUA 1B72A 5J8CA 2BVMA 2IA2A 2RC4A 1NG7A 4MEYF 4RBOA 3CCQI 1O7FA 1JKQC 3C1DA 2Z5UA 2RV8A 4BE2A 5GAGJ 2D1VA 3A1YA 4ETSA 1W7PD 1OMIA 4KJZA 5F08A 4B1RA 4AUXA 2ELHA 1PUEE 4MFDA 3BPVA 3AFHA 4BYYA 1X2NA 2E1MC 1TWFJ 4U0VA 1Y8RB 3PM1A 2YSRA 3E6MA 4DQ2A 2XSDC 4YIIA 1MMSA 1FIAA 2AXTC 3D5SC 5DS9A 3CLOA 5IT9Z 4RGUA 1U5TC 3C2HA 5K1YA 1YOVB 3KEYA 2O8XA 1D5YA 3PIOF 5EEGA 3ZN0A 4XOTA 2PQ8A 3OYNA 4KT6A 1R22A 3Q3SA 3T1BA 3K4CA 4B3AA 4CXFA 2HYFA 3ZOBA 2X48A 1AU7A 3CCEI 2FUG2 1QZZA 2ID3A 1X4OA 3FXMA 1YFHA 3VYRB 3L7WA 4ZZLA 1KU2A 4D9JA 3KZZA 3WU2C 3F9KA 5B1BH 1D5VA 3M8EA 3GTPJ 1KU3A 4Y13A 2HYJA 2DMTA 3WGGA 5ILUA 1W5TA 2JT1A 3L09A 1IC8A 1F4KA 3X2QH 1LDJA 4YEJA 4IOAF 4G6QA 4L18B 4ANJA 2VI6A 1PUFA 1FYKA 2GAUA 2M7AA 5FB2A
chains in the Genus database with same CATH topology
4ZYGA 1P92A 2ISZA 4M6XA 5D5UB 1QGPA 3S2WA 3TO9A 4A0YA 2UXXA 4R79A 3FMRA 1YS6A 1FPQA 2DPUA 2VC1A 2XV4S 3RI4A 5CLSA 1L3LA 3WTUC 2L02A 2HGCA 2TDXA 1NHAA 1DPRA 3D5LA 5ICFA 4OIOF 3I54A 2EFNA 2G7UA 2P6SA 2L3DA 3VOEA 2XVCA 1RZ4A 2HDCA 3DP7A 1R7JA 5JFRA 3KE2A 2QVOA 4IRHA 4OINF 4WX9A 1PP7U 1WKMA 2CQKA 3I59B 5IT3A 2G9WA 3WTXC 4IF4A 2VC0A 4YIFA 4MTEA 2PBIA 5KVRA 3E5UA 5BOXA 1E2XA 4P9UA 5E1WA 4OMYA 2RVCA 3WTSC 1Q1HA 3K1NA 4ZH4F 2XKOA 5FLXK 4M6YA 3KEQA 4RGXA 3RPUA 3WU0A 5J8FA 1FYLA 1R58A 2QENA 4RB2C 4EM1A 2D45A 4IHSA 4XLNF 4HYEA 1G3TA 1ZRDA 4M74A 1ZHFA 4GCVA 2E1NA 3GX4X 1P4XA 3ZP5A 4HX7A 1QPMA 5F6FA 3E6CC 3BOQA 2FBIA 5AIQA 2O03A 3IHUA 3LFKA 1ZH5A 1SD6A 4BHBA 5FD6A 4M9SA 1R36A 5A2QK 3T5XA 4KIGA 1HSTA 1OYWA 3FM3A 2IA0A 1BM9A 1UB9A 3FM5A 4IVNA 3JW4A 2FQ3A 4CDGA 3WGIA 3VEPA 2CG4A 2O61A 4S04A 3P7NA 4MQVA 4I02A 3K1PA 3DKWA 4LB6B 3TDUC 1B4AA 1KYWA 4A2UA 3WU1B 5HS9A 3CDHA 3HTSB 2XKPA 3HYIA 2M45A 3C3WA 2OZUA 4HW0A 2EFPA 4ASNA 1R1UA 2G7HA 2PJPA 1DDNA 2P6TA 4Q5SF 3FZVA 4U0WA 1SMTA 2P4WA 1MDMB 3ELKA 2VBYA 2DO7A 2M87A 1FP2A 3ZPLA 2MA3A 5L3CA 2WWYA 3HUGA 5LBQA 3O6BB 2IVMA 2QM3A 2ISYA 1D8JA 3SZPA 2FBKA 3IWFA 1T0FA 3WG9A 1UCRA 4XSXF 4ESJA 3P9KA 4EM0B 3HTUA 3IC7A 3KLOA 2L54A 3RKWA 3J80K 2W57A 3FHZA 5D5XB 2HYGD 2W84A 5E1ZB 3CUOA 3JTHA 5BPIA 4YFXF 2EJRA 5FO5A 3GXOA 2DW4A 1P4WA 4I09A 3N4MA 2RNJA 1XDSA 1SMYF 1MKMA 1IN5A 1T6SA 3MQ0A 3RYRA 3B02A 2KKOA 2DU9A 1BC8C 3GFLA 1REPC 4RGSA 2RN7A 3E97A 3OV8A 1S29A 3U1DA 1J5YA 3LQRA 2VT2A 2KJCA 4JBAA 1USTA 4RS8A 1IN7A 2F5EA 1XMKA 3WODF 4K2EA 4HLYA 3HSEA 1UHWA 3H92A 2XIGA 2ZCWA 1HKTA 4A0XA 4I7HA 2BEOA 2YX7A 4WWCA 3ABTA 5DYMA 4RAYA 4P5OA 1JHHA 4EVIA 2XAFA 2Q8KA 1U5TA 5L3GA 2BYVE 4ENNA 3GFIA 2XROA 1BC7C 5LHIA 1MJAA 4XSZF 4CO8A 4PGGA 3NQOA 4MQ9F 5FFZA 3GEZA 1K7AA 1J7KA 2EFQA 1B6AA 3BZ6A 1W7PA 3BPXA 5L3FA 2GA2A 1OYYA 1YW7A 4EGYA 4HQMA 4MNUA 4EM2A 4N9IA 1TNSA 2ZJ2A 4WF2A 1U8RA 1DUXC 4G7OF 3ZMDA 3EYYA 4HOBA 1F1ZA 4RGRA 1EV7A 4A6DA 3K2ZA 4L9NA 2P5VA 5KK1A 2HOEA 2R7DA 1O3TA 1ZREA 4Y17A 4O6JA 1HBXG 1Y0UA 2NNNA 5LEJA 3VODA 3C7JA 4ZYDA 2IPQX 1XGMA 2VXZA 1U2WA 3WTTC 1GHCA 4KN7X 4L0YB 2CGPA 2H27A 2CO5A 4BNCA 1FSHA 3RDIA 2X0LA 5LLQA 3V8JA 2H94A 1Z91A 3EQLF 3QOPA 4RAZA 3WE2A 5E8GA 3FF5A 1XCVA 1DP7P 1RNLA 1J2XA 1YS7A 3GW2A 3KP3A 2VOPA 2YU3A 3WTYC 5D6FA 1OYIA 1LB2A 1CF7A 2IW5A 2DAOA 2O6GE 1A04A 3QP6A 1ZRFA 1T2KA 4WXDA 2OBPA 1I1GA 3BY6A 1ZGAA 2NRAC 2QQBA 4HQEA 2P7VB 2F5DA 2XHKA 5CJ9A 4ENKA 4M9XA 2EV0A 1G3YA 2XGXA 1ON2A 1P6RA 2K7LA 1H9TA 5IT9K 1DPUA 4ENJA 3WTWC 1FBQA 1LEAA 4L9VA 1BI3A 2HR3A 1QO0D 3W6JB 3HOTA 3RKYA 4Q48A 1KGSA 2FMYA 4R1HA 2VT3A 2LSOA 3KP7A 4L5IA 3V4GA 2IP2A 4GYIA 2QBYA 1E17A 1UHMA 2NS0A 4IRGA 4ENMA 1KU7A 4EGZA 4LLLA 1HXDA 1LQ1A 2IT0A 5HVQC 1FSEA 2CYYA 3DPTA 5E17F 2MC3A 4XRFA 3MAJA 4LD5A 1R00A 4EV0A 1R23A 1LNWA 2F5CA 2A69F 3R4KA 5D6EA 1B9MA 1AWCA 3M1EA 4B8XA 5E8IA 3ISPA 1IAWA 4M9ZA 4A5NA 2HQNA 4DNCA 2KIMA 3ML6A 4M71A 1SD7A 3QRFF 1FX7A 4HX8A 3LAPA 3WTVC 3ZMZA 3GLXA 3KP6A 3V7CA 1ZG3A 3ECOA 3F8NA 5E18F 1TQPA 3TO6A 3MFKA 2CWEA 3GVAA 1MD0A 3ROUA 1FYMA 3HRSA 1P2FA 4P96A 4UVCA 4O3MA 2A68F 2ESNA 3DF8A 4KIFA 4WK8F 1HW5A 2EA4A 1TLHB 2XAGA 1SFUA 5ILVA 2IRFG 2HKOA 2K02A 3E6BA 4LLGF 1HW1A 3ZMSA 3D0SA 2YPRA 2HTSA 1IZ1A 2B0LA 2OAZA 4CYDA 1U5TB 2JZYA 4G6DA 1ZGJA 1TQIA 1V4RA 3J7AO 2MBFA 4ESFA 1XN7A 4IRIA 3JTGA 5TRDA 4AIJA 2ZO4A 2MD5A 5LEKA 2L01A 4OMZA 3P9CA 5LRSA 1W7PB 5DD4A 5L3DA 1ZYRF 3FMSA 3V8LA 1T38A 1S7AA 4AIKA 1IUYA 4G8XA 3ECHA 1OR7A 3ULQB 3QPTA 5HDKA 4FX0A 1KU9A 4QLCU 2EK5A 3H3ZA 2FF4A 5LHHA 2VBZA 3IL2A 5TJJA 3TDZC 2IJLA 3IRRA 3ZMTA 1L0OC 4H0EA 2HS5A 2FE3A 3IWZA 1XGSA 3ZMVA 2E1CA 1WI9A 1LJ9A 2YR2A 4S05A 5ILSA 2GA1A 2Z33A 1ULYA 2GWRA 3Q9VA 3GFMA 5LRRA 2ZXJA 5FD5A 3RYPA 3BWGA 1EH8A 4KUMA 1I5ZA 2M1BA 4KA4A 1TTYA 1W5SA 4GXOA 5D4RA 4A12A 1J0RA 5E1XA 3L2CA 2WV0A 3GYHX 2Y0MA 1USSA 3GZ6A 3N97A 1XSDA 2GZWA 3HHGA 4HF0A 3I71A 5DUKA 1CF7B 2UXNA 4R8HA 4G9YA 3E5QA 5BMZA 2DI3A 4FT8A 1FP1D 2AXLA 4HZFA 1KQ8A 3P9IA 2Z3YA 4BH9A 2MH9A 5CVVA 3ERED 4YFKF 3KFWX 2FXAA 1FBSA 2EV6A 4XLPF 3F21A 4LGWA 1O3SA 1ZAOA 4L9JA 2M5WA 1H9GA 3HOSA 1P4AA 1KQ9A 4U7BA 2E7WA 1J9IA 1BI0A 2M8EA 1FZPB 3DXJF 1XD7A 1Z1DA 1S8NA 4YFNF 2ADUA 4F7ZA 2CSOA 1KQ0A 2W24A 3EETA 2VE8A 2QBYB 1U6GA 3KLNA 3CO6C 2NYXA 2LF7A 3HRMA 1FT9A 1WWXA 2BGCA 1HSJA 4L0ZB 4LFUA 1TW2A 3RJPA 2KJBA 2H09A 3CTAA 1QBJA 2QWWA 5CVUA 3FXUA 2DK8A 2V1DA 1B59A 2P5LC 4EJVA 3BDDA 1OPCA 4MTDA 3PFIA 2EV5A 1IN4A 2HTJA 2QQAA 1STZA 1XSXA 5AONA 3R0AA 3WTZA 3CO7C 3RKXA 3LSTA 1J75A 1XSVA 2MH2A 3IKTA 5LGUA 4I0BA 4AD9A 4EMSA 2ZKZA 1MGTA 1IXCA 1LDDA 3K9TA 5ICGA 1FNNA 5E20A 2OQRA 2AS5F 1IRGA 4KNYA 3JAMK 2ZBKA 4MHGA 2BE5F 3PQJA 1Z7UA 4ZYHA 4KFCA 3CJNA 1ZRCA 2VONA 1BI1A 3FXQA 1O3QA 1D8KA 1TQMA 2K86A 1B1BA 2HZTA 3V8KA 4L5JA 2OZ6A 2FNAA 4EJTA 4AVPA 2COMA 1HKSA 2OD5A 2A07F 1YQAA 2A6EF 3TKYA 1G3WA 5HDGA 3EYIA 2XAHA 4L9TA 5ICEA 1ZG5A 1FC3A 3TOBA 2Y48A 4P9FA 4Q4ZF 3TOAA 3REOA 1QZYA 3J81Z 1GVJA 3GZ5A 2EWNA 4UV9A 4HDVA 1BJAA 2Q2EA 2YX4A 3M8FA 1O57A 3BJ6A 4M72A 4MEXF 3WE3A 1LDKB 3SHFA 5BPDA 4CZZA 3KCCA 4YG2F 2VN2A 3RTRA 2PI0A 1JGSA 4OIPF 4QWQA 4IJAA 1LEBA 2CW0F 2EFWA 3O3KA 4NQWA 3TGNA 1JHFA 1V3FA 5J6XA 1T39A 3ZN1A 1ZLKA 2WTEA 3I53A 1R5HA 2JTVA 1YW8A 3O2PE 1VTNC 3SQNA 1ZN2A 3COAC 2FSWA 1IN8A 3R0JA 3VB2A 1YIOA 1GXPA 2W25A 1UFMA 5EEHA 1BOAA 1ON1A 1KYZA 3LQQA 5HS8A 2V6CA 2DLLA 1Z9CA 4ON0A 3I0TA 1XDUA 2ZNYA 2QZ8A 3GFJA 1I27A 1S3JA 3FX3A 3HRTA 1ZG1A 3F8BA 3R60A 3V7RA 3DV8A 1YW9A 3KP5A 4LK1F 3L00A 4HF2A 4LK0F 2VBWA 2EA2A 3M7GA 4M73A 3F6OA 3MZHA 4GO1A 5JVTA 2XUBA 2O0YA 5DD8A 1ZLJA 3JSPA 3DFGA 2K27A 5FGMA 3Q5FA 4EJWA 4JK1X 4GYGA 4OIRF 3K1MA 5HLHA 4HX4A 4RB0A 4Q47A 1JE8A 1X3UA 1XCBA 4RB1A 2QYOA 4HAMA 2XRNA 5JR3A 3QP5A 1K6OA 2W85A 2DQLA 4PGHA 1SD4A 1SFEA 4LG0A 4AIHA 3QAHA 1IRFA 5DCMB 3RIRA 5L3BA 1SD5A 4HA8A 4G94A 4OOIA 1IN6A 2ZMEA 3V7SA 2QUFA 3QPHA 2FMLA 4EQQA 2V1XA 5LGNA 4I98B 4BQAA 2CFXA 1I1SA 1W4MA 3MCZA 3FMQA 1SAXA 3DEUA 4OIQF 2KIUA 4UNOA 2IA1A 1IXSB 3F8MA 1KA8A 5H6QA 4PDKA 2PMUA 3I64A 1FY7A 3QU3A 1ODDA 1HQCA 2STTA 4KMUX 3ZQ7A 1G6NA 1YO5C 4HLXA 2Q0OA 3GF2A 2GIVA 3F22A 1TW3A 3HHHA 2XAQA 2NAZA 1EH6A 1Z6RA 2BBYA 1TNTA 2D2WA 3I58A 4HV6A 2DBBA 2P5KA 1XGNA 2LDUA 2ETHA 4Y15A 3M9AA 2GXGA 3F8CA 3GWZA 5BS6A 5ICCA 2UZKA 5K5RA 2R7FA 2PEXA 1BIBA 2F2EA 3I4PA 3F23A 4UXNA 4KDPA 3LWFA 4A5MA 4RB3C 2DPDA 2PLYA 2FU4A 3RPQA 4UUVA 1K78A 1GXQA 2RKHA 1MJBA 2XASA 4BHPA 3F8FA 3HSRA 4EJOA 2LNBA 3IKVA 1YYVA 3R61A 1Z6TA 5BQTA 3NRVA 3WGHA 1I6XA 3TQNA 4UV8A 1PDNC 4KICA 3NEUA 1MZBA 5AIPA 4ZYEA 2MLGA 3SXYA 3SFZA 3T0YA 4BXUA 1K79A 1F5TA 4JQFA 3F72A 4HF1A 4A0ZA 5FLXZ 2VE9A 5FFXA 3SZTA 2DK5A 4U7DA 4BAYA 3H3UA 1RUOA 2RGVA 5DUIA 1BIAA 1T98A 3DPLC 5JI6A 4GGGA 3U2RA 4ZZDA 2L4MA 4KN4X 1B9NA 2H6CA 4PCQA 1YLFA 1IXRC 1IW7F 4UVAA 1O7LA 3E3VA 5DDGA 3HSFA 4KT5C 2PFBA 5ED4A 4KYWA 3MZYA 2JSCA 1WRJA 2A61A 5A2QZ 4PZJA 2HWVA 3CUQA 2A6HF 4BHCA 1ZARA 4A6EA 4CGZA 4Z2YA 2MLKA 4HDUA 6PAXA 2L4AA 4N0BA 1FOKA 1J59A 3OOPA 1Z05A 1BN5A 2DQRA 3KEOA 1D3YA 2RQPA 4WXCA 1R1VA 4XBFA 5H6RA 2FEZA 3G73A 4LLNA 2HQRA 4MGRA 4CICA 2DFIA 2QQ9A 3T8RA 1G4DA 2D1HA 1CGPA 2P7CB 2STWA 2J5OA 5DCMA 2C6YA 3ZMUA 1BI2A 2KIFA 2M30A 2LKPA 2X4HA 2HFHA 5CVIA 2E7XA 5HOOA 2NNYA 5D4SA 1F9NA 5CVRA 1MJ9A 5DCFA 5ERIA 5D5VB 5LGTA 2PN6A 2Z99A 4LG0B 2Z9OA 3PQKA 2OQGA 2DTRA 2OU2A 2K4BA 4IHTA 2V79A 2V9VA 2ZMEB 4U0YA 1HKQA 2A5YB 5D8LB 4UHTA 5L3EA 2KRFA 2JPCA 2VBXA 2R3SA 3E6DA 3K0LA 3J80Z 3JSOA 1YTYA 1XMAA 1FLIA 1FBUA 2HKXA 1U3EM 1TBXA 5LHGA 3VFZA 2GXBA 3T8TA 4KMFA 5F1RA 2JPBA 1RIOH 5CVJA 2QLZA 5HDNA 3KP2A 4KIBA 3G3ZA 3KZYA 2FNPA 4G7HF 5HLIA 3K69A 3I5UA 2ZFWA 2BV6A 1R5GA 3HIFA 3IRQA 1BBYA 3I59A 3KP4A 4E70A 1C0WA 2LF8A 4P55A 3F6VA 1PP8F 2PG4A 1EH7A 3GUDA 2ACJA 5HLGA 2FBHA 3J81K 1QQIA 1SFXA 2V1UA 3F3XA 3CUQC 2WC2A 3C18A 3AAFA 3JAMZ 3ABUA 1QNTA 4LB5A 4LMYA 3BROA 3TO7A 2RDPA 1O3RA 3KETA 2PMHA 4I2OA 2FOKA 5DV5A 1K78B 3L9FA 3BP8A 3U9GA 1RI7A 2EFOA 3W6KB 4N9HA 4AWXB 4FHTA 4NB5A 1XGOA 5H20A 1FWZA 1XB4A 5DEQA 2P8TA 1S7OA 5K5QA 1ONVA 3BJOA 2DT5A 4IXAA 3LA2A 4UVBA 4FX4A 3MWMA 4WXHA 4IPAA 4O5VA 2UWMA 4D0PA 3EDPA 2F5FA 4G7ZF 4I0AA 4I01A 2J5PA 3GO5A 3QU6A 3FXRA 2JRTA 1R1TA 2A3SA 2ESHA 2HEOA 1JXSA 4HV5A 1U78A 5F64A 3BJAA 2O3FA 3MEXA 2VOOA 1G3SA 3LAJA 2GQQA 4WCGA 2FRHA 3LA7A 1WSUA 5D5WB 1IF1A 2OA4A 2ZNZA 3DQVC 4ESBA 2EB7A 5CYVA 2VODA 4EJUA 4NHJA 1RUNA 4CHUA 1S6LA 3FWEA 1MDMA 1AOYA 3CUQB 2Y75A 4LJZF 5HS7A 2FA5A 5JHUA 2XAJA 3EUHA 2H6BA 4TV7A 1YG2A 4HBLA 1WQ2A 1H0MA 5D8KB 3LA3A 4OU0A 1OKRA 4B09A 5K5OA 1LVAA 2K4JA 3Q9SA 1HW2A 3E5XA 4U88A 3R6SA 3B73A 3HRUA 5J8CA 2IA2A 2RC4A 4MEYF 1O7FA 3C1DA 2Z5UA 2RV8A 2D1VA 4ETSA 1W7PD 1OMIA 2ELHA 1PUEE 3BPVA 4BYYA 4U0VA 4DQ2A 2YSRA 3E6MA 4YIIA 3CLOA 5IT9Z 4RGUA 1U5TC 5K1YA 2O8XA 5EEGA 3ZN0A 2PQ8A 1R22A 3T1BA 4CXFA 2HYFA 1QZZA 1YFHA 3L7WA 4ZZLA 1KU2A 3KZZA 1D5VA 3M8EA 1KU3A 4Y13A 3WGGA 5ILUA 1W5TA 2JT1A 3L09A 1F4KA 1LDJA 4G6QA 4L18B 1FYKA 2GAUA 5FB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZYG A;  1P92 A;  2ISZ A;  4M6X A;  5D5U B;  1QGP A;  3S2W A;  3TO9 A;  4A0Y A;  2UXX A;  4R79 A;  3FMR A;  1YS6 A;  1FPQ A;  2DPU A;  2VC1 A;  2XV4 S;  3RI4 A;  5CLS A;  1L3L A;  3WTU C;  2L02 A;  2HGC A;  2TDX A;  1NHA A;  1DPR A;  3D5L A;  5ICF A;  4OIO F;  3I54 A;  2EFN A;  2G7U A;  2P6S A;  2L3D A;  3VOE A;  2XVC A;  1RZ4 A;  2HDC A;  3DP7 A;  1R7J A;  5JFR A;  3KE2 A;  2QVO A;  4IRH A;  4OIN F;  4WX9 A;  1PP7 U;  1WKM A;  2CQK A;  3I59 B;  5IT3 A;  2G9W A;  3WTX C;  4IF4 A;  2VC0 A;  4YIF A;  4MTE A;  2PBI A;  5KVR A;  3E5U A;  5BOX A;  1E2X A;  4P9U A;  5E1W A;  4OMY A;  2RVC A;  3WTS C;  1Q1H A;  3K1N A;  4ZH4 F;  2XKO A;  5FLX K;  4M6Y A;  3KEQ A;  4RGX A;  3RPU A;  3WU0 A;  5J8F A;  1FYL A;  1R58 A;  2QEN A;  4RB2 C;  4EM1 A;  2D45 A;  4IHS A;  4XLN F;  4HYE A;  1G3T A;  1ZRD A;  4M74 A;  1ZHF A;  4GCV A;  2E1N A;  3GX4 X;  1P4X A;  3ZP5 A;  4HX7 A;  1QPM A;  5F6F A;  3E6C C;  3BOQ A;  2FBI A;  5AIQ A;  2O03 A;  3IHU A;  3LFK A;  1ZH5 A;  1SD6 A;  4BHB A;  5FD6 A;  4M9S A;  1R36 A;  5A2Q K;  3T5X A;  4KIG A;  1HST A;  1OYW A;  3FM3 A;  2IA0 A;  1BM9 A;  1UB9 A;  3FM5 A;  4IVN A;  3JW4 A;  2FQ3 A;  4CDG A;  3WGI A;  3VEP A;  2CG4 A;  2O61 A;  4S04 A;  3P7N A;  4MQV A;  4I02 A;  3K1P A;  3DKW A;  4LB6 B;  3TDU C;  1B4A A;  1KYW A;  4A2U A;  3WU1 B;  5HS9 A;  3CDH A;  3HTS B;  2XKP A;  3HYI A;  2M45 A;  3C3W A;  2OZU A;  4HW0 A;  2EFP A;  4ASN A;  1R1U A;  2G7H A;  2PJP A;  1DDN A;  2P6T A;  4Q5S F;  3FZV A;  4U0W A;  1SMT A;  2P4W A;  1MDM B;  3ELK A;  2VBY A;  2DO7 A;  2M87 A;  1FP2 A;  3ZPL A;  2MA3 A;  5L3C A;  2WWY A;  3HUG A;  5LBQ A;  3O6B B;  2IVM A;  2QM3 A;  2ISY A;  1D8J A;  3SZP A;  2FBK A;  3IWF A;  1T0F A;  3WG9 A;  1UCR A;  4XSX F;  4ESJ A;  3P9K A;  4EM0 B;  3HTU A;  3IC7 A;  3KLO A;  2L54 A;  3RKW A;  3J80 K;  2W57 A;  3FHZ A;  5D5X B;  2HYG D;  2W84 A;  5E1Z B;  3CUO A;  3JTH A;  5BPI A;  4YFX F;  2EJR A;  5FO5 A;  3GXO A;  2DW4 A;  1P4W A;  4I09 A;  3N4M A;  2RNJ A;  1XDS A;  1SMY F;  1MKM A;  1IN5 A;  1T6S A;  3MQ0 A;  3RYR A;  3B02 A;  2KKO A;  2DU9 A;  1BC8 C;  3GFL A;  1REP C;  4RGS A;  2RN7 A;  3E97 A;  3OV8 A;  1S29 A;  3U1D A;  1J5Y A;  3LQR A;  2VT2 A;  2KJC A;  4JBA A;  1UST A;  4RS8 A;  1IN7 A;  2F5E A;  1XMK A;  3WOD F;  4K2E A;  4HLY A;  3HSE A;  1UHW A;  3H92 A;  2XIG A;  2ZCW A;  1HKT A;  4A0X A;  4I7H A;  2BEO A;  2YX7 A;  4WWC A;  3ABT A;  5DYM A;  4RAY A;  4P5O A;  1JHH A;  4EVI A;  2XAF A;  2Q8K A;  1U5T A;  5L3G A;  2BYV E;  4ENN A;  3GFI A;  2XRO A;  1BC7 C;  5LHI A;  1MJA A;  4XSZ F;  4CO8 A;  4PGG A;  3NQO A;  4MQ9 F;  5FFZ A;  3GEZ A;  1K7A A;  1J7K A;  2EFQ A;  1B6A A;  3BZ6 A;  1W7P A;  3BPX A;  5L3F A;  2GA2 A;  1OYY A;  1YW7 A;  4EGY A;  4HQM A;  4MNU A;  4EM2 A;  4N9I A;  1TNS A;  2ZJ2 A;  4WF2 A;  1U8R A;  1DUX C;  4G7O F;  3ZMD A;  3EYY A;  4HOB A;  1F1Z A;  4RGR A;  1EV7 A;  4A6D A;  3K2Z A;  4L9N A;  2P5V A;  5KK1 A;  2HOE A;  2R7D A;  1O3T A;  1ZRE A;  4Y17 A;  4O6J A;  1HBX G;  1Y0U A;  2NNN A;  5LEJ A;  3VOD A;  3C7J A;  4ZYD A;  2IPQ X;  1XGM A;  2VXZ A;  1U2W A;  3WTT C;  1GHC A;  4KN7 X;  4L0Y B;  2CGP A;  2H27 A;  2CO5 A;  4BNC A;  1FSH A;  3RDI A;  2X0L A;  5LLQ A;  3V8J A;  2H94 A;  1Z91 A;  3EQL F;  3QOP A;  4RAZ A;  3WE2 A;  5E8G A;  3FF5 A;  1XCV A;  1DP7 P;  1RNL A;  1J2X A;  1YS7 A;  3GW2 A;  3KP3 A;  2VOP A;  2YU3 A;  3WTY C;  5D6F A;  1OYI A;  1LB2 A;  1CF7 A;  2IW5 A;  2DAO A;  2O6G E;  1A04 A;  3QP6 A;  1ZRF A;  1T2K A;  4WXD A;  2OBP A;  1I1G A;  3BY6 A;  1ZGA A;  2NRA C;  2QQB A;  4HQE A;  2P7V B;  2F5D A;  2XHK A;  5CJ9 A;  4ENK A;  4M9X A;  2EV0 A;  1G3Y A;  2XGX A;  1ON2 A;  1P6R A;  2K7L A;  1H9T A;  5IT9 K;  1DPU A;  4ENJ A;  3WTW C;  1FBQ A;  1LEA A;  4L9V A;  1BI3 A;  2HR3 A;  1QO0 D;  3W6J B;  3HOT A;  3RKY A;  4Q48 A;  1KGS A;  2FMY A;  4R1H A;  2VT3 A;  2LSO A;  3KP7 A;  4L5I A;  3V4G A;  2IP2 A;  4GYI A;  2QBY A;  1E17 A;  1UHM A;  2NS0 A;  4IRG A;  4ENM A;  1KU7 A;  4EGZ A;  4LLL A;  1HXD A;  1LQ1 A;  2IT0 A;  5HVQ C;  1FSE A;  2CYY A;  3DPT A;  5E17 F;  2MC3 A;  4XRF A;  3MAJ A;  4LD5 A;  1R00 A;  4EV0 A;  1R23 A;  1LNW A;  2F5C A;  2A69 F;  3R4K A;  5D6E A;  1B9M A;  1AWC A;  3M1E A;  4B8X A;  5E8I A;  3ISP A;  1IAW A;  4M9Z A;  4A5N A;  2HQN A;  4DNC A;  2KIM A;  3ML6 A;  4M71 A;  1SD7 A;  3QRF F;  1FX7 A;  4HX8 A;  3LAP A;  3WTV C;  3ZMZ A;  3GLX A;  3KP6 A;  3V7C A;  1ZG3 A;  3ECO A;  3F8N A;  5E18 F;  1TQP A;  3TO6 A;  3MFK A;  2CWE A;  3GVA A;  1MD0 A;  3ROU A;  1FYM A;  3HRS A;  1P2F A;  4P96 A;  4UVC A;  4O3M A;  2A68 F;  2ESN A;  3DF8 A;  4KIF A;  4WK8 F;  1HW5 A;  2EA4 A;  1TLH B;  2XAG A;  1SFU A;  5ILV A;  2IRF G;  2HKO A;  2K02 A;  3E6B A;  4LLG F;  1HW1 A;  3ZMS A;  3D0S A;  2YPR A;  2HTS A;  1IZ1 A;  2B0L A;  2OAZ A;  4CYD A;  1U5T B;  2JZY A;  4G6D A;  1ZGJ A;  1TQI A;  1V4R A;  3J7A O;  2MBF A;  4ESF A;  1XN7 A;  4IRI A;  3JTG A;  5TRD A;  4AIJ A;  2ZO4 A;  2MD5 A;  5LEK A;  2L01 A;  4OMZ A;  3P9C A;  5LRS A;  1W7P B;  5DD4 A;  5L3D A;  1ZYR F;  3FMS A;  3V8L A;  1T38 A;  1S7A A;  4AIK A;  1IUY A;  4G8X A;  3ECH A;  1OR7 A;  3ULQ B;  3QPT A;  5HDK A;  4FX0 A;  1KU9 A;  4QLC U;  2EK5 A;  3H3Z A;  2FF4 A;  5LHH A;  2VBZ A;  3IL2 A;  5TJJ A;  3TDZ C;  2IJL A;  3IRR A;  3ZMT A;  1L0O C;  4H0E A;  2HS5 A;  2FE3 A;  3IWZ A;  1XGS A;  3ZMV A;  2E1C A;  1WI9 A;  1LJ9 A;  2YR2 A;  4S05 A;  5ILS A;  2GA1 A;  2Z33 A;  1ULY A;  2GWR A;  3Q9V A;  3GFM A;  5LRR A;  2ZXJ A;  5FD5 A;  3RYP A;  3BWG A;  1EH8 A;  4KUM A;  1I5Z A;  2M1B A;  4KA4 A;  1TTY A;  1W5S A;  4GXO A;  5D4R A;  4A12 A;  1J0R A;  5E1X A;  3L2C A;  2WV0 A;  3GYH X;  2Y0M A;  1USS A;  3GZ6 A;  3N97 A;  1XSD A;  2GZW A;  3HHG A;  4HF0 A;  3I71 A;  5DUK A;  1CF7 B;  2UXN A;  4R8H A;  4G9Y A;  3E5Q A;  5BMZ A;  2DI3 A;  4FT8 A;  1FP1 D;  2AXL A;  4HZF A;  1KQ8 A;  3P9I A;  2Z3Y A;  4BH9 A;  2MH9 A;  5CVV A;  3ERE D;  4YFK F;  3KFW X;  2FXA A;  1FBS A;  2EV6 A;  4XLP F;  3F21 A;  4LGW A;  1O3S A;  1ZAO A;  4L9J A;  2M5W A;  1H9G A;  3HOS A;  1P4A A;  1KQ9 A;  4U7B A;  2E7W A;  1J9I A;  1BI0 A;  2M8E A;  1FZP B;  3DXJ F;  1XD7 A;  1Z1D A;  1S8N A;  4YFN F;  2ADU A;  4F7Z A;  2CSO A;  1KQ0 A;  2W24 A;  3EET A;  2VE8 A;  2QBY B;  1U6G A;  3KLN A;  3CO6 C;  2NYX A;  2LF7 A;  3HRM A;  1FT9 A;  1WWX A;  2BGC A;  1HSJ A;  4L0Z B;  4LFU A;  1TW2 A;  3RJP A;  2KJB A;  2H09 A;  3CTA A;  1QBJ A;  2QWW A;  5CVU A;  3FXU A;  2DK8 A;  2V1D A;  1B59 A;  2P5L C;  4EJV A;  3BDD A;  1OPC A;  4MTD A;  3PFI A;  2EV5 A;  1IN4 A;  2HTJ A;  2QQA A;  1STZ A;  1XSX A;  5AON A;  3R0A A;  3WTZ A;  3CO7 C;  3RKX A;  3LST A;  1J75 A;  1XSV A;  2MH2 A;  3IKT A;  5LGU A;  4I0B A;  4AD9 A;  4EMS A;  2ZKZ A;  1MGT A;  1IXC A;  1LDD A;  3K9T A;  5ICG A;  1FNN A;  5E20 A;  2OQR A;  2AS5 F;  1IRG A;  4KNY A;  3JAM K;  2ZBK A;  4MHG A;  2BE5 F;  3PQJ A;  1Z7U A;  4ZYH A;  4KFC A;  3CJN A;  1ZRC A;  2VON A;  1BI1 A;  3FXQ A;  1O3Q A;  1D8K A;  1TQM A;  2K86 A;  1B1B A;  2HZT A;  3V8K A;  4L5J A;  2OZ6 A;  2FNA A;  4EJT A;  4AVP A;  2COM A;  1HKS A;  2OD5 A;  2A07 F;  1YQA A;  2A6E F;  3TKY A;  1G3W A;  5HDG A;  3EYI A;  2XAH A;  4L9T A;  5ICE A;  1ZG5 A;  1FC3 A;  3TOB A;  2Y48 A;  4P9F A;  4Q4Z F;  3TOA A;  3REO A;  1QZY A;  3J81 Z;  1GVJ A;  3GZ5 A;  2EWN A;  4UV9 A;  4HDV A;  1BJA A;  2Q2E A;  2YX4 A;  3M8F A;  1O57 A;  3BJ6 A;  4M72 A;  4MEX F;  3WE3 A;  1LDK B;  3SHF A;  5BPD A;  4CZZ A;  3KCC A;  4YG2 F;  2VN2 A;  3RTR A;  2PI0 A;  1JGS A;  4OIP F;  4QWQ A;  4IJA A;  1LEB A;  2CW0 F;  2EFW A;  3O3K A;  4NQW A;  3TGN A;  1JHF A;  1V3F A;  5J6X A;  1T39 A;  3ZN1 A;  1ZLK A;  2WTE A;  3I53 A;  1R5H A;  2JTV A;  1YW8 A;  3O2P E;  1VTN C;  3SQN A;  1ZN2 A;  3COA C;  2FSW A;  1IN8 A;  3R0J A;  3VB2 A;  1YIO A;  1GXP A;  2W25 A;  1UFM A;  5EEH A;  1BOA A;  1ON1 A;  1KYZ A;  3LQQ A;  5HS8 A;  2V6C A;  2DLL A;  1Z9C A;  4ON0 A;  3I0T A;  1XDU A;  2ZNY A;  2QZ8 A;  3GFJ A;  1I27 A;  1S3J A;  3FX3 A;  3HRT A;  1ZG1 A;  3F8B A;  3R60 A;  3V7R A;  3DV8 A;  1YW9 A;  3KP5 A;  4LK1 F;  3L00 A;  4HF2 A;  4LK0 F;  2VBW A;  2EA2 A;  3M7G A;  4M73 A;  3F6O A;  3MZH A;  4GO1 A;  5JVT A;  2XUB A;  2O0Y A;  5DD8 A;  1ZLJ A;  3JSP A;  3DFG A;  2K27 A;  5FGM A;  3Q5F A;  4EJW A;  4JK1 X;  4GYG A;  4OIR F;  3K1M A;  5HLH A;  4HX4 A;  4RB0 A;  4Q47 A;  1JE8 A;  1X3U A;  1XCB A;  4RB1 A;  2QYO A;  4HAM A;  2XRN A;  5JR3 A;  3QP5 A;  1K6O A;  2W85 A;  2DQL A;  4PGH A;  1SD4 A;  1SFE A;  4LG0 A;  4AIH A;  3QAH A;  1IRF A;  5DCM B;  3RIR A;  5L3B A;  1SD5 A;  4HA8 A;  4G94 A;  4OOI A;  1IN6 A;  2ZME A;  3V7S A;  2QUF A;  3QPH A;  2FML A;  4EQQ A;  2V1X A;  5LGN A;  4I98 B;  4BQA A;  2CFX A;  1I1S A;  1W4M A;  3MCZ A;  3FMQ A;  1SAX A;  3DEU A;  4OIQ F;  2KIU A;  4UNO A;  2IA1 A;  1IXS B;  3F8M A;  1KA8 A;  5H6Q A;  4PDK A;  2PMU A;  3I64 A;  1FY7 A;  3QU3 A;  1ODD A;  1HQC A;  2STT A;  4KMU X;  3ZQ7 A;  1G6N A;  1YO5 C;  4HLX A;  2Q0O A;  3GF2 A;  2GIV A;  3F22 A;  1TW3 A;  3HHH A;  2XAQ A;  2NAZ A;  1EH6 A;  1Z6R A;  2BBY A;  1TNT A;  2D2W A;  3I58 A;  4HV6 A;  2DBB A;  2P5K A;  1XGN A;  2LDU A;  2ETH A;  4Y15 A;  3M9A A;  2GXG A;  3F8C A;  3GWZ A;  5BS6 A;  5ICC A;  2UZK A;  5K5R A;  2R7F A;  2PEX A;  1BIB A;  2F2E A;  3I4P A;  3F23 A;  4UXN A;  4KDP A;  3LWF A;  4A5M A;  4RB3 C;  2DPD A;  2PLY A;  2FU4 A;  3RPQ A;  4UUV A;  1K78 A;  1GXQ A;  2RKH A;  1MJB A;  2XAS A;  4BHP A;  3F8F A;  3HSR A;  4EJO A;  2LNB A;  3IKV A;  1YYV A;  3R61 A;  1Z6T A;  5BQT A;  3NRV A;  3WGH A;  1I6X A;  3TQN A;  4UV8 A;  1PDN C;  4KIC A;  3NEU A;  1MZB A;  5AIP A;  4ZYE A;  2MLG A;  3SXY A;  3SFZ A;  3T0Y A;  4BXU A;  1K79 A;  1F5T A;  4JQF A;  3F72 A;  4HF1 A;  4A0Z A;  5FLX Z;  2VE9 A;  5FFX A;  3SZT A;  2DK5 A;  4U7D A;  4BAY A;  3H3U A;  1RUO A;  2RGV A;  5DUI A;  1BIA A;  1T98 A;  3DPL C;  5JI6 A;  4GGG A;  3U2R A;  4ZZD A;  2L4M A;  4KN4 X;  1B9N A;  2H6C A;  4PCQ A;  1YLF A;  1IXR C;  1IW7 F;  4UVA A;  1O7L A;  3E3V A;  5DDG A;  3HSF A;  4KT5 C;  2PFB A;  5ED4 A;  4KYW A;  3MZY A;  2JSC A;  1WRJ A;  2A61 A;  5A2Q Z;  4PZJ A;  2HWV A;  3CUQ A;  2A6H F;  4BHC A;  1ZAR A;  4A6E A;  4CGZ A;  4Z2Y A;  2MLK A;  4HDU A;  6PAX A;  2L4A A;  4N0B A;  1FOK A;  1J59 A;  3OOP A;  1Z05 A;  1BN5 A;  2DQR A;  3KEO A;  1D3Y A;  2RQP A;  4WXC A;  1R1V A;  4XBF A;  5H6R A;  2FEZ A;  3G73 A;  4LLN A;  2HQR A;  4MGR A;  4CIC A;  2DFI A;  2QQ9 A;  3T8R A;  1G4D A;  2D1H A;  1CGP A;  2P7C B;  2STW A;  2J5O A;  5DCM A;  2C6Y A;  3ZMU A;  1BI2 A;  2KIF A;  2M30 A;  2LKP A;  2X4H A;  2HFH A;  5CVI A;  2E7X A;  5HOO A;  2NNY A;  5D4S A;  1F9N A;  5CVR A;  1MJ9 A;  5DCF A;  5ERI A;  5D5V B;  5LGT A;  2PN6 A;  2Z99 A;  4LG0 B;  2Z9O A;  3PQK A;  2OQG A;  2DTR A;  2OU2 A;  2K4B A;  4IHT A;  2V79 A;  2V9V A;  2ZME B;  4U0Y A;  1HKQ A;  2A5Y B;  5D8L B;  4UHT A;  5L3E A;  2KRF A;  2JPC A;  2VBX A;  2R3S A;  3E6D A;  3K0L A;  3J80 Z;  3JSO A;  1YTY A;  1XMA A;  1FLI A;  1FBU A;  2HKX A;  1U3E M;  1TBX A;  5LHG A;  3VFZ A;  2GXB A;  3T8T A;  4KMF A;  5F1R A;  2JPB A;  1RIO H;  5CVJ A;  2QLZ A;  5HDN A;  3KP2 A;  4KIB A;  3G3Z A;  3KZY A;  2FNP A;  4G7H F;  5HLI A;  3K69 A;  3I5U A;  2ZFW A;  2BV6 A;  1R5G A;  3HIF A;  3IRQ A;  1BBY A;  3I59 A;  3KP4 A;  4E70 A;  1C0W A;  2LF8 A;  4P55 A;  3F6V A;  1PP8 F;  2PG4 A;  1EH7 A;  3GUD A;  2ACJ A;  5HLG A;  2FBH A;  3J81 K;  1QQI A;  1SFX A;  2V1U A;  3F3X A;  3CUQ C;  2WC2 A;  3C18 A;  3AAF A;  3JAM Z;  3ABU A;  1QNT A;  4LB5 A;  4LMY A;  3BRO A;  3TO7 A;  2RDP A;  1O3R A;  3KET A;  2PMH A;  4I2O A;  2FOK A;  5DV5 A;  1K78 B;  3L9F A;  3BP8 A;  3U9G A;  1RI7 A;  2EFO A;  3W6K B;  4N9H A;  4AWX B;  4FHT A;  4NB5 A;  1XGO A;  5H20 A;  1FWZ A;  1XB4 A;  5DEQ A;  2P8T A;  1S7O A;  5K5Q A;  1ONV A;  3BJO A;  2DT5 A;  4IXA A;  3LA2 A;  4UVB A;  4FX4 A;  3MWM A;  4WXH A;  4IPA A;  4O5V A;  2UWM A;  4D0P A;  3EDP A;  2F5F A;  4G7Z F;  4I0A A;  4I01 A;  2J5P A;  3GO5 A;  3QU6 A;  3FXR A;  2JRT A;  1R1T A;  2A3S A;  2ESH A;  2HEO A;  1JXS A;  4HV5 A;  1U78 A;  5F64 A;  3BJA A;  2O3F A;  3MEX A;  2VOO A;  1G3S A;  3LAJ A;  2GQQ A;  4WCG A;  2FRH A;  3LA7 A;  1WSU A;  5D5W B;  1IF1 A;  2OA4 A;  2ZNZ A;  3DQV C;  4ESB A;  2EB7 A;  5CYV A;  2VOD A;  4EJU A;  4NHJ A;  1RUN A;  4CHU A;  1S6L A;  3FWE A;  1MDM A;  1AOY A;  3CUQ B;  2Y75 A;  4LJZ F;  5HS7 A;  2FA5 A;  5JHU A;  2XAJ A;  3EUH A;  2H6B A;  4TV7 A;  1YG2 A;  4HBL A;  1WQ2 A;  1H0M A;  5D8K B;  3LA3 A;  4OU0 A;  1OKR A;  4B09 A;  5K5O A;  1LVA A;  2K4J A;  3Q9S A;  1HW2 A;  3E5X A;  4U88 A;  3R6S A;  3B73 A;  3HRU A;  5J8C A;  2IA2 A;  2RC4 A;  4MEY F;  1O7F A;  3C1D A;  2Z5U A;  2RV8 A;  2D1V A;  4ETS A;  1W7P D;  1OMI A;  2ELH A;  1PUE E;  3BPV A;  4BYY A;  4U0V A;  4DQ2 A;  2YSR A;  3E6M A;  4YII A;  3CLO A;  5IT9 Z;  4RGU A;  1U5T C;  5K1Y A;  2O8X A;  5EEG A;  3ZN0 A;  2PQ8 A;  1R22 A;  3T1B A;  4CXF A;  2HYF A;  1QZZ A;  1YFH A;  3L7W A;  4ZZL A;  1KU2 A;  3KZZ A;  1D5V A;  3M8E A;  1KU3 A;  4Y13 A;  3WGG A;  5ILU A;  1W5T A;  2JT1 A;  3L09 A;  1F4K A;  1LDJ A;  4G6Q A;  4L18 B;  1FYK A;  2GAU A;  5FB2 A; 
#chains in the Genus database with same CATH topology
 1WJB A;  4CCL A;  1MBG A;  1S7E A;  3HOZ J;  4MLO A;  4ZYG A;  2HNH A;  1IO2 A;  1P92 A;  2LTP A;  2LR8 A;  4AYB N;  1VQ8 I;  3LSG A;  2ISZ A;  1R4M B;  1FMV A;  5FKM A;  4M6X A;  1FIP A;  4E4H A;  3L2W A;  1K4S A;  5D5U B;  1QGP A;  4XLE A;  3TP3 A;  4G12 A;  3S2W A;  2TRT A;  3FKJ A;  3TO9 A;  3L2U A;  4A0Y A;  2UXX A;  1SEU A;  4R79 A;  3FMR A;  1YS6 A;  3ZR8 X;  1Z77 A;  2DFH A;  1FPQ A;  4PSW A;  2DPU A;  3K70 D;  1V55 H;  4A3F J;  3GBG A;  3CCL I;  1JUP A;  2VC1 A;  2XV4 S;  3RI4 A;  5CLS A;  1JKO C;  2WAD A;  3I4M J;  1WHU A;  5CKT A;  1L3L A;  3WTU C;  2L02 A;  2HGC A;  2PMZ N;  5GAH J;  2TDX A;  1NHA A;  1DPR A;  3D5L A;  5ICF A;  4IQ4 A;  4RAF A;  4FAS D;  4OIO F;  3I54 A;  5EJC A;  3MKY B;  1NK3 P;  2EFN A;  4FE4 A;  1HA8 A;  1X1C A;  2G7U A;  2P6S A;  2L3D A;  3VOE A;  2VJ4 A;  1HOM A;  2XVC A;  1RZ4 A;  2HDC A;  3DP7 A;  1R7J A;  5JFR A;  2K9N A;  4AC0 A;  3KE2 A;  2ZSH B;  4KIS A;  2QVO A;  2X6Y A;  4IRH A;  4OIN F;  4WX9 A;  1PP7 U;  3H3V K;  2L7F P;  1WKM A;  3OY9 A;  2CQK A;  3I59 B;  5IT3 A;  2G9W A;  3WTX C;  4IF4 A;  3GTM J;  4JX4 A;  2BXZ A;  2VC0 A;  2CW8 A;  4F55 A;  4YIF A;  1A31 A;  3G71 I;  1UZC A;  1GVD A;  4MTE A;  2PBI A;  2E1M B;  5KVR A;  3ZQC A;  1ZR2 A;  2H8R A;  3KYD B;  4EEF G;  3E5U A;  2O9L A;  4U87 A;  2I5U A;  5BOX A;  2BY2 A;  3L2V A;  1E2X A;  3GZN B;  4P9U A;  3GTQ J;  5E1W A;  2KMU A;  4OMY A;  2RVC A;  2A6T A;  3WTS C;  5KCM A;  5C3E J;  1S9H A;  2XGC A;  5KNL A;  1Q1H A;  3ZQL A;  1TL8 A;  3K1N A;  1G2H A;  4ZH4 F;  4BE0 A;  2XKO A;  5FLX K;  4M6Y A;  3KEQ A;  4RGX A;  4ZDL A;  3A02 A;  3RPU A;  3WU0 A;  3OYF A;  3RKQ A;  5J8F A;  4II2 A;  1FYL A;  3DU6 A;  2LG4 A;  1R58 A;  2QEN A;  4RB2 C;  5DM7 F;  2R7R A;  2MGQ A;  4EM1 A;  3H5A A;  4PJL A;  2D45 A;  2VJ5 A;  2R7U A;  3HC7 A;  4E7Z A;  4M3B A;  4QSH A;  3JRF A;  3S1M J;  2XF7 A;  2NVQ J;  2JA2 A;  4IHS A;  2Q1Z B;  2XC7 A;  4XLN F;  4OWR B;  5K7F A;  4HYE A;  1G3T A;  1ZRD A;  4M74 A;  2I8D A;  1ZHF A;  4GCV A;  5F0F A;  2E1N A;  4PSX A;  1BJZ A;  1ZKG A;  3CLQ A;  3GX4 X;  1P4X A;  3ZP5 A;  5CPR B;  1QPI A;  3CCS I;  3BTC A;  4HX7 A;  1K4T A;  2PJR A;  3PFY A;  1QPM A;  2IS6 A;  5F6F A;  4B44 A;  3E6C C;  2GOM A;  3BOQ A;  3LOC A;  2FBI A;  3HZJ A;  5AIQ A;  5C4X J;  2O03 A;  3M07 A;  3IHU A;  3LFK A;  2B63 J;  3S2H J;  5EZG A;  1ZH5 A;  3IAM 2;  3VSK A;  4W97 A;  3UKG A;  1SD6 A;  2M0M A;  5CQG A;  4BHB A;  5FD6 A;  4M9S A;  1Z21 A;  1R36 A;  4CSW A;  3ZQI A;  1ORK A;  1MBE A;  4OAZ A;  5A2Q K;  3T5X A;  1Z7L A;  4KIG A;  2LC2 A;  1HST A;  1FJL A;  1TWC J;  1OYW A;  1A6Q A;  2IA0 A;  3FM3 A;  1BM9 A;  3Q0V A;  4DBQ A;  3BR1 A;  2R5Z A;  1UB9 A;  2OV7 A;  4XR6 A;  3FM5 A;  2R7S A;  4IVN A;  3JW4 A;  2FQ3 A;  1AKH B;  3MKL A;  4CDG A;  1FTT A;  3WGI A;  1JTY A;  1YX3 A;  3TBI A;  3VEP A;  2CG4 A;  2O61 A;  4BS9 A;  3K7A J;  4S04 A;  4Z6Y A;  4IL6 C;  5EG0 A;  3P7N A;  3S1N J;  4MQV A;  4I02 A;  3K1P A;  2KDZ A;  5FLM J;  3DKW A;  4CZC A;  4LB6 B;  3TDU C;  3L1P A;  1B4A A;  1KYW A;  4A2U A;  3WU1 B;  5HS9 A;  3CDH A;  3HTS B;  1R9T J;  2DT6 A;  2HVS A;  4XKW A;  2XKP A;  4BY1 J;  1IRZ A;  3HG9 A;  3HYI A;  2M45 A;  1M1E B;  3FBN B;  2VAS A;  3C3W A;  5K7Z A;  2DOA A;  2R7O A;  2OZU A;  2OJE D;  4HW0 A;  2CV2 A;  3JRH A;  1MSF C;  2EFP A;  4ASN A;  1R1U A;  2G7H A;  4IHW A;  2PJP A;  1DDN A;  4B47 A;  2P6T A;  4Q5S F;  3FZV A;  3LSH A;  2LP0 A;  5J4V A;  4U0W A;  1SMT A;  2LY2 A;  2P4W A;  4CYC B;  3IH3 A;  1MDM B;  4BDZ A;  3ELK A;  2E34 A;  2RRE A;  2VBY A;  2DO7 A;  2M87 A;  1FP2 A;  3ZPL A;  2MA3 A;  3AL0 C;  5L3C A;  2QGU A;  2WWY A;  2LD5 A;  3HUG A;  5LBQ A;  1U9O A;  1YRN A;  3O6B B;  2TCT A;  2X9D A;  1DU6 A;  1N77 A;  2RNG A;  2IVM A;  1YX5 A;  2QM3 A;  2ISY A;  2DMQ A;  1D8J A;  3FXK A;  3I4N J;  4HSR A;  3SZP A;  1VQ5 I;  2FBK A;  3IWF A;  2OTJ I;  4HNU A;  1T0F A;  3WG9 A;  2H8W A;  3HOW J;  3QYB A;  3MVP A;  1UCR A;  4XSX F;  3S15 J;  4ESJ A;  3P9K A;  4EM0 B;  5GTH C;  1B72 B;  3K4K A;  3HTU A;  3DEW A;  2L7Z A;  3IC7 A;  2R7W A;  4V2G A;  3KLO A;  1XMX A;  5LFA A;  4D5C A;  2L54 A;  1E0E A;  3RKW A;  3CDI A;  3J80 K;  3CC2 I;  2A5W A;  2W57 A;  3FHZ A;  3ABK H;  3NAR A;  5D5X B;  2QSG X;  2HYG D;  2W84 A;  5E1Z B;  2N8G A;  3CUO A;  3JTH A;  5BPI A;  4YFX F;  2R7Z J;  3G1M A;  3PJR A;  2EJR A;  4GRI A;  2AO9 A;  2OCC H;  2KHM A;  2Z2S B;  3GXO A;  5FO5 A;  2DW4 A;  1P4W A;  4I09 A;  2YUS A;  3N4M A;  3M3Y J;  3BZC A;  3ZQG A;  4XOP A;  4XID A;  2RNJ A;  1OCO H;  5JLW A;  1XDS A;  1SMY F;  1MKM A;  3H9G A;  3S3M A;  1IN5 A;  1T6S A;  2IGK A;  5GP9 A;  4P1W A;  3MQ0 A;  3RYR A;  3B02 A;  4IZZ A;  4X6A J;  2IS4 A;  4KIT B;  1ZQ3 P;  3JRI A;  4NC8 A;  2KKO A;  2DU9 A;  5EZH A;  1BC8 C;  3DWL E;  3GFL A;  2K85 A;  2BW3 A;  1REP C;  3EPZ A;  5FKN A;  2CQ7 A;  4RGS A;  2RN7 A;  3BR6 A;  3S17 J;  3FIS A;  3E97 A;  2RAE A;  4ZTF A;  5K7H A;  3OV8 A;  1W5C C;  1S29 A;  2EIN H;  3U1D A;  2LKX A;  1J5Y A;  3LQR A;  2VT2 A;  2KJC A;  4JBA A;  2VUM J;  1UST A;  4DW6 A;  4BEH A;  3CCY A;  4RS8 A;  2UUZ A;  3ONQ A;  2KPM A;  1IN7 A;  1XX5 A;  2HI3 A;  2F48 A;  1BOB A;  4PJM A;  2F5E A;  4B4C A;  1XMK A;  5F27 A;  3WOD F;  4K2E A;  4HLY A;  3HSE A;  4F3Q A;  3S2D J;  3VYS B;  1UHW A;  3L2R A;  1MMA A;  3H92 A;  2XIG A;  3JRC A;  2ZCW A;  1HKT A;  1BW6 A;  1FEX A;  4E7L A;  2XAU A;  4A0X A;  1LKX A;  1Y56 A;  4HPQ A;  1N78 A;  2KRC A;  3VWB A;  1Z3X A;  3AL0 B;  5FRN A;  3OR1 C;  2BEO A;  4I7H A;  2E2I J;  2YX7 A;  4WWC A;  5GPA A;  5J1Y A;  3ZRG A;  3OYM A;  3ABT A;  5DYM A;  1QVT A;  1WCM J;  4RAY A;  4P5O A;  1JHH A;  3DCF A;  4EVI A;  2XAF A;  4UB6 C;  1W36 D;  2Q8K A;  1U5T A;  5H2F C;  3BCA A;  1ZTR A;  2BYV E;  5L3G A;  3GFI A;  4ENN A;  2JN6 A;  3K10 A;  2XRO A;  3JRE A;  1BC7 C;  5LHI A;  3NAU A;  5IOY A;  1MJA A;  4XSZ F;  3CMY A;  3HPH A;  5JHF A;  1MW7 A;  4CO8 A;  4PGG A;  4XKB A;  3NQO A;  4MQ9 F;  2BHY A;  5J1U A;  2K3F A;  1OCR H;  5FFZ A;  3GTJ J;  4HEA 2;  1ACI A;  3GEZ A;  2R7X A;  3GTL J;  3M1C A;  1K7A A;  1J7K A;  3VYT B;  2EFQ A;  2CV0 A;  2HVR A;  1B6A A;  2VLA A;  1U8B A;  1R6R A;  3BZ6 A;  1W7P A;  3BPX A;  5L3F A;  1MMN A;  1OYY A;  2GA2 A;  1YW7 A;  3CF2 A;  4EGY A;  4HQM A;  5E3L A;  4MNU A;  2KL4 A;  3W6V A;  4EM2 A;  4N9I A;  1TNS A;  2ZJ2 A;  3C2G A;  4WF2 A;  1W36 C;  1U8R A;  4LG3 A;  1ETY A;  1DUX C;  4G7O F;  3ZMD A;  3EYY A;  4HOB A;  1IUF A;  3IP4 B;  1E3H A;  1F1Z A;  4RGR A;  1EV7 A;  2M0C A;  1JTX A;  3K2Z A;  4LIT A;  4A6D A;  2GBY A;  3ZQF A;  4L9N A;  4DZP A;  2P5V A;  3OIP A;  5KK1 A;  4IHV A;  1U9N A;  2HOE A;  2R7D A;  1O3T A;  1ZRE A;  1QHH D;  3DEE A;  4Y17 A;  2QQ8 A;  4O6J A;  1HBX G;  4XKV A;  1Y0U A;  3JRA A;  2NNN A;  5LEJ A;  4YEL A;  3VOD A;  3C7J A;  2M34 A;  4ZYD A;  2IPQ X;  1XGM A;  2PJR B;  2MFZ A;  1U2W A;  2VXZ A;  3WTT C;  1GHC A;  4KN7 X;  3O8H A;  4L0Y B;  2KIQ A;  1X19 A;  2DJI A;  2CGP A;  1JI8 A;  2H27 A;  2HZD A;  2CO5 A;  4BNC A;  1FSH A;  4RDU A;  3RDI A;  2X0L A;  5LLQ A;  2QSH X;  5LD2 C;  4IHY A;  1ITY A;  3V8J A;  2H94 A;  3AG2 H;  4HNT A;  1Z91 A;  3EQL F;  3QOP A;  4IX7 A;  2DMU A;  4RAZ A;  3WE2 A;  5M3M J;  5E8G A;  2KZG A;  3FF5 A;  1XCV A;  5DM6 F;  2OTL I;  1DP7 P;  1V54 H;  1RNL A;  2LVS A;  1J2X A;  1YS7 A;  3GLL A;  3GW2 A;  3KP3 A;  2VOP A;  2XSJ C;  3KZI C;  3J7Z I;  1JT0 A;  2YU3 A;  1WFX A;  4C3I J;  4PUS A;  3H5N A;  3WTY C;  5D6F A;  5HOD A;  1GDT A;  1OYI A;  4AVZ A;  3SEQ A;  1LB2 A;  1CF7 A;  1S5L C;  1WJ5 A;  1LFU P;  2V26 A;  2JQ7 A;  2IW5 A;  2DAO A;  4PFO A;  2L9R A;  3CC7 I;  1BR1 A;  2FQ4 A;  5EG0 B;  5M5X J;  3RQ4 A;  4XOR A;  2O6G E;  3RCO A;  1B8I B;  4G6T B;  2HDD A;  1A04 A;  3QP6 A;  1ZRF A;  1T2K A;  4WXD A;  4C3H J;  2OBP A;  4IO9 F;  4IQJ A;  1MBF A;  4DYR A;  1I1G A;  3BY6 A;  1ZGA A;  2NRA C;  4A3D J;  4DGW B;  2QQB A;  4HQE A;  1WJA A;  2P7V B;  2F5D A;  3BQY A;  2AQF A;  2XHK A;  2QKL B;  5CJ9 A;  4ENK A;  1UHS A;  2LFB A;  4M9X A;  2EV0 A;  1UEL B;  1G3Y A;  2XGX A;  2GIZ A;  1ON2 A;  3PO2 J;  3BR3 A;  1P6R A;  2K7L A;  1H9T A;  4C3J J;  3MMY B;  4AID A;  5IT9 K;  4PFP A;  3CF5 F;  1DPU A;  5IOZ A;  2E5N A;  1WJE A;  2ZB9 A;  3FXJ A;  4ENJ A;  3WTW C;  1FBQ A;  2A05 A;  1LEA A;  3EUK L;  4L9V A;  3H35 A;  4DBR A;  3OYD A;  3D1N I;  3GTK J;  1BI3 A;  1Y8Q B;  2HR3 A;  3S14 J;  4A93 J;  2OCE A;  4UUS A;  1QO0 D;  3W6J B;  2D5V A;  2LY1 A;  2V9P A;  5HLT A;  3HOT A;  2EZH A;  4XRS G;  3RKY A;  4Q48 A;  3HUG B;  1YRN B;  1KGS A;  4XL9 A;  2FMY A;  4M3G A;  2CUZ A;  4R1H A;  5E79 C;  2VT3 A;  2LSO A;  2ZJP F;  3KP7 A;  1SVL A;  4L5I A;  1DP3 A;  3V4G A;  2IP2 A;  1VQM I;  4GYI A;  2QBY A;  1LPQ A;  1E17 A;  1HF0 A;  1D1C A;  3UNG C;  1UHM A;  2NS0 A;  4XQF A;  2LYC A;  4IRG A;  4ENM A;  3S1Q J;  1KU7 A;  4EGZ A;  2MSY A;  1VQ9 I;  1R5I D;  4LLL A;  1HXD A;  3DBH B;  1LQ1 A;  3LSK A;  1GV2 A;  2IT0 A;  3OYE A;  5HVQ C;  1FSE A;  2CYY A;  3DPT A;  5E17 F;  1I39 A;  2MC3 A;  4XRF A;  4BJ6 C;  3A0H C;  3MAJ A;  4LD5 A;  2M9H A;  1R00 A;  4EV0 A;  1R23 A;  1LNW A;  2VQL A;  3S8P A;  1XPX A;  2F5C A;  2CUE A;  1BL0 A;  4NBQ A;  3ZXS A;  2A69 F;  3R4K A;  3K4L A;  1BA5 A;  5D6E A;  3AKZ A;  4RLF A;  3PSF A;  3OYG A;  2KRH A;  1B9M A;  1H8A C;  1AWC A;  3M1E A;  4B8X A;  1KZH A;  5E8I A;  1IDZ A;  1PYV A;  3ISP A;  1IAW A;  1MBK A;  4M9Z A;  4A5N A;  2HQN A;  3OYA A;  4DNC A;  4E7I A;  1V5E A;  2KIM A;  3PSI A;  1VND A;  4J00 A;  3ML6 A;  4M71 A;  1OCZ H;  1VFC A;  5EDN A;  3JR9 A;  2K3P A;  1SD7 A;  3PL8 A;  1D1B A;  2L2O A;  2DXI A;  3QRF F;  1FX7 A;  1H88 C;  2JJ7 A;  4HX8 A;  2BW3 B;  3LAP A;  2O7O A;  3WTV C;  2YU9 J;  3ZMZ A;  3IV5 A;  3GLX A;  3KP6 A;  3OL4 A;  3V7C A;  5IPA A;  1ZG3 A;  1XG1 A;  2NVU B;  3ECO A;  3F8N A;  5E18 F;  1TQP A;  3TO6 A;  3PNV A;  3V42 A;  3MFK A;  2CWE A;  3GVA A;  4RMN A;  2VXD A;  1RKT A;  2R7T A;  1X1B A;  2KQR A;  2H1L A;  1MD0 A;  4BEH B;  3ROU A;  2XPU A;  1FYM A;  3HRS A;  1P2F A;  2B7E A;  4BY7 J;  1OIS A;  3HPG A;  1F36 A;  4P96 A;  4UVC A;  2LH9 A;  1I50 J;  1MNM C;  1RR8 C;  2E71 A;  4O3M A;  2A68 F;  2ESN A;  3DF8 A;  2NVT J;  4KIF A;  5B66 C;  4WK8 F;  3DPU A;  3O8G A;  1HW5 A;  2EA4 A;  3W2A A;  1TLH B;  2XAG A;  2NOG A;  1SFU A;  4FET A;  3G6E I;  5ILV A;  2XF5 A;  2IRF G;  1G59 A;  4PK4 A;  5IP6 A;  2HKO A;  4XLA A;  3OYH A;  4M3E A;  2K02 A;  1T8I A;  2VQH A;  5IYD J;  1W0U A;  3E6B A;  3H0G J;  3LFU A;  4LLG F;  2QF7 A;  1HW1 A;  3HEF A;  3FK7 A;  3ZMS A;  3D0S A;  5IYB J;  2YPR A;  3K70 C;  2HTS A;  1IZ1 A;  3HGY A;  3OYJ A;  3BTL A;  2B0L A;  2OAZ A;  4CYD A;  1U5T B;  2JZY A;  4G6D A;  3CMM A;  2WBM A;  2V9K A;  4YRV A;  1ZGJ A;  2VJI A;  1TQI A;  3K2A A;  1P7J A;  1V4R A;  3B6C A;  3J7A O;  2MBF A;  2L9S A;  4ESF A;  3CCR I;  2LRD A;  1XN7 A;  4IRI A;  3CCV I;  3FDY A;  4E7S A;  3Q0U A;  4PJN A;  3JTG A;  5TRD A;  1MNE A;  4RLQ A;  4BQQ A;  4AIJ A;  2ZO4 A;  4FCY A;  4HNV A;  2MD5 A;  5LEK A;  2L01 A;  4OMZ A;  3P9C A;  3W3C A;  5LRS A;  1W7P B;  5DD4 A;  1HDD C;  4A3M J;  5L3D A;  5FLV A;  1ZYR F;  2VB6 A;  3M8J A;  1MBH A;  3FMS A;  3V8L A;  1YHQ I;  1T38 A;  1S7A A;  4AIK A;  1K6Y A;  1TT5 B;  2Y0S N;  1IUY A;  4G8X A;  3ECH A;  1OR7 A;  3ULQ B;  3WHB A;  2HXI A;  3QPT A;  5HDK A;  2EZI A;  2BXY A;  4FX0 A;  1KU9 A;  2W00 A;  2GM4 A;  3OYI A;  4QLC U;  4II3 A;  2EK5 A;  3HJE A;  3H3Z A;  2FF4 A;  5LHH A;  1ZEL A;  2VBZ A;  3IL2 A;  1EJ9 A;  5TJJ A;  3TDZ C;  3BG5 A;  1EKE A;  2IJL A;  3IRR A;  1JUM A;  2JVH A;  3ZMT A;  3TW7 A;  1L0O C;  4H0E A;  1R71 A;  2HS5 A;  2FE3 A;  3IWZ A;  1XGS A;  2WY8 Q;  3ZMV A;  1N25 A;  3I3L A;  3K6G A;  2E1C A;  1WI9 A;  1LJ9 A;  2YR2 A;  4S05 A;  5ILS A;  2GA1 A;  5B5E C;  2IBD A;  3DLA A;  2Z33 A;  1ENH A;  1ULY A;  3ASO H;  1QA6 A;  2WV1 A;  2BZT A;  4UB8 C;  2GWR A;  5C44 J;  2KFD A;  1DQU A;  4ZJZ A;  4DIQ A;  3CES A;  3Q9V A;  3GFM A;  5LRR A;  1O4X A;  1EA3 A;  2HOT A;  2ZXJ A;  2DOD A;  1B8I A;  5FD5 A;  3RYP A;  1Z3Y A;  3BWG A;  1EH8 A;  3CP2 A;  3MN2 A;  1I5Z A;  4KUM A;  4C2T A;  1ZR4 A;  2M1B A;  2DMP A;  1FOY A;  1TTY A;  1W5S A;  3VPR A;  4GXO A;  5D4R A;  4KA4 A;  4A12 A;  1J0R A;  5E1X A;  1SFK A;  3L2C A;  2WV0 A;  3GYH X;  1SC7 A;  2Y0M A;  4BQN A;  1D0Z A;  1USS A;  3GZ6 A;  4E7H A;  3N97 A;  1XSD A;  1UAA A;  1J09 A;  2GZW A;  3ABL H;  3HHG A;  4HF0 A;  3I71 A;  3LSJ A;  5DUK A;  2Y0S A;  5E3M A;  2KP6 A;  1WH5 A;  4PJ0 C;  2NXN B;  1CF7 B;  4ZC3 A;  4NNJ A;  1OQY A;  2UXN A;  3H36 A;  1VQ4 I;  2JA8 J;  1VQL I;  2JA7 J;  1ETQ A;  4R8H A;  4G9Y A;  1DGR M;  2WAF A;  2AHQ A;  5M3F J;  1JKP C;  3E5Q A;  2K9M A;  3LSM A;  5BMZ A;  4M3F A;  2L5Q A;  2IAI A;  2DI3 A;  4FT8 A;  1FP1 D;  1Q1V A;  2K40 A;  3GTG J;  4PJJ A;  2DT7 B;  2AXL A;  4HZF A;  1KQ8 A;  3P9I A;  2DA7 A;  2Z3Y A;  4BH9 A;  4F93 B;  1WPK A;  2MH9 A;  5CVV A;  3BCB A;  3ERE D;  4FTH A;  4YFK F;  2R93 J;  3KFW X;  2NOJ B;  4ZDO A;  2FXA A;  2LK2 A;  3HB9 A;  4QTR A;  1FBS A;  2EV6 A;  4XLP F;  3F21 A;  2WAQ N;  3BQZ A;  3E1S A;  2O5R A;  4LGW A;  1ZAO A;  4L9J A;  3K4M A;  1O3S A;  3QPS A;  1JJ8 C;  2COB A;  3HBL A;  2M5W A;  1H9G A;  3E0J B;  3HOS A;  2E2H J;  1P4A A;  1SFO J;  1KQ9 A;  4XM3 A;  4U7B A;  3LMM A;  1MIJ A;  2E7W A;  1J9I A;  4JX6 A;  4A3G J;  1BI0 A;  2HU9 A;  1NTC A;  1QVU A;  4UUS B;  2M8E A;  1FZP B;  3DXJ F;  1XD7 A;  1Z1D A;  1ETK A;  2VKE A;  2EPF A;  1S8N A;  3HOX J;  4YFN F;  2ADU A;  1LE8 A;  2DA2 A;  4F7Z A;  2BVL A;  2CSO A;  1KQ0 A;  3BT9 A;  2K5C A;  2W24 A;  3H9Q A;  3EET A;  2VE8 A;  5EEA A;  2QBY B;  1U6G A;  2BOL A;  3KLN A;  3OS2 A;  2NYX A;  2LF7 A;  3CZ6 A;  3HRM A;  4UUT A;  3CO6 C;  1FT9 A;  3FXL A;  1WWX A;  2EQR A;  1IV8 A;  2FX0 A;  4Y4R A;  3QOE A;  2BGC A;  1HSJ A;  4L0Z B;  2HOA A;  4LFU A;  1K61 A;  1TW2 A;  1D1A A;  3RJP A;  2VIX A;  4NC7 A;  2KJB A;  2AQE A;  1E3P A;  2H09 A;  3CTA A;  2CRG A;  5KAF C;  1QBJ A;  2QWW A;  5CVU A;  3FXU A;  2DK8 A;  2V1D A;  5DTD A;  2MYS A;  4CH7 A;  3LSI A;  1B59 A;  2P5L C;  1P7I A;  3S3N A;  4ZDP A;  4EJV A;  3BDD A;  1OPC A;  2X6W A;  4MTD A;  3PFI A;  2EV5 A;  1IN4 A;  1VQO I;  2MG4 A;  5TGT A;  4YIR X;  2HTJ A;  2QQA A;  1STZ A;  1XSX A;  3NWS A;  5AON A;  2WAQ A;  3UR3 C;  3R0A A;  2HPM A;  3WTZ A;  3CO7 C;  2ME0 A;  3RKX A;  4XIC A;  3LST A;  1J75 A;  4F91 B;  1OR7 C;  4DYQ A;  1XSV A;  4C9Y A;  2MH2 A;  3BR0 A;  1VQN I;  3TP0 A;  3IKT A;  5LGU A;  4I0B A;  4AD9 A;  4EMS A;  1YIT I;  2ZKZ A;  1JUS A;  1MGT A;  1IXC A;  4X0G A;  3ZQH A;  1LDD A;  1RKW A;  2CW7 A;  3E7L A;  3K9T A;  4XN0 A;  1Y0N A;  5ICG A;  4W1U A;  2DDB A;  5J3L A;  1FNN A;  1V5F A;  5E20 A;  3CCJ I;  2Y9Y A;  3I9V 2;  3DLL F;  2R5Y B;  1JKR C;  2OQR A;  2AS5 F;  1IRG A;  4KNY A;  3JAM K;  2ZBK A;  4Y3O A;  4MHG A;  3OIO A;  2EH3 A;  2EZL A;  3RSN A;  3BG3 A;  4IHX A;  2ZXH A;  2FJ1 A;  3KYC B;  2XB0 X;  2P0W A;  3QOD A;  2BE5 F;  3PQJ A;  2ZJQ F;  3IAS 2;  3S93 A;  2VQG A;  1UG2 A;  2L9N A;  2YS9 A;  3JCU C;  1Z7U A;  4ZYH A;  4XK4 A;  4KFC A;  3CJN A;  5IY5 H;  1CQT A;  1QRY A;  1ZRC A;  2WB1 N;  2VON A;  2M7B A;  3GCM A;  1AA7 A;  1BI1 A;  2DOF A;  3FXQ A;  1GLN A;  1O3Q A;  1VQK I;  1D8K A;  1TQM A;  2K86 A;  2E60 A;  1B1B A;  1ETV A;  3OYK A;  2HZT A;  2ZXI A;  3KPH A;  1WJD A;  3V8K A;  4L5J A;  2OZ6 A;  4GDF A;  4CCM A;  2FNA A;  2VQC A;  4EJT A;  4AVP A;  3FIW A;  2COM A;  4N4N B;  1HKS A;  2OD5 A;  3SYT A;  3OS1 A;  2A07 F;  1YQA A;  2A6E F;  3TKY A;  1YE9 A;  1G3W A;  4FIS A;  5HDG A;  3EYI A;  2XAH A;  4L9T A;  2NVX J;  4BBS J;  5ICE A;  1ZG5 A;  2DYS H;  4BJ5 C;  1FC3 A;  3DTE A;  3TOB A;  3SFI A;  3DKX A;  2Y48 A;  4P9F A;  4Q4Z F;  2R7V A;  3TOA A;  3REO A;  4MIM A;  1WI3 A;  1QZY A;  1TZL A;  3J81 Z;  4XKC A;  2L9V A;  1LFB A;  1GVJ A;  3BG9 A;  1MH3 A;  3GZ5 A;  5GTI C;  2EWN A;  3BR5 A;  4UV9 A;  1UJ8 A;  2IGM A;  3A03 A;  4HDV A;  1BJA A;  2X1E A;  3TL4 X;  2Q2E A;  4V19 K;  3AG4 H;  5BNG A;  4Y52 J;  3RQI A;  9ANT A;  2YX4 A;  1GT0 C;  3HGG A;  3OIQ A;  1YJW I;  1RES A;  1V5G A;  3M8F A;  1O57 A;  3BJ6 A;  4M72 A;  2DMN A;  4MEX F;  3WE3 A;  4HG2 A;  1LDK B;  1APL C;  3SHF A;  5BPD A;  2IGN A;  1BR4 A;  4CZZ A;  3KCC A;  4CCJ A;  4D7M A;  4YG2 F;  2P81 A;  2VN2 A;  3ABM H;  3RZO J;  2WY7 Q;  1X4P A;  3QPL A;  3RTR A;  2PI0 A;  1X1D A;  2LBF A;  1JGS A;  4BL0 B;  1H89 C;  4OIP F;  2BY3 A;  4QWQ A;  2WB1 A;  2ZC2 A;  4IJA A;  3F0C A;  1LEB A;  2CW0 F;  2EFW A;  2X51 A;  1NG6 A;  3O3K A;  4NQW A;  3TGN A;  3C2B A;  2DOE A;  3CQZ J;  2KZV A;  2QEX I;  1JHF A;  1V3F A;  5J6X A;  1T39 A;  3ZN1 A;  1ZLK A;  2WTE A;  3I53 A;  1R5H A;  2JTV A;  1YW8 A;  3ZCO A;  3O2P E;  1EF4 A;  4D7N A;  1VTN C;  3SQN A;  3A0B C;  1ZN2 A;  2RQQ A;  3COA C;  2FSW A;  4X1E A;  1IN8 A;  3R0J A;  3VB2 A;  1YIO A;  3U21 A;  3TW6 A;  1GXP A;  4I6Z A;  1HLV A;  2W25 A;  1X58 A;  2FOW A;  2XF6 A;  2E35 A;  1UFM A;  1OCP A;  1IV6 A;  5EEH A;  1BOA A;  1ON1 A;  1KYZ A;  5J40 A;  1ERD A;  5F0H A;  3LQQ A;  5FRM A;  3SZG A;  5HS8 A;  1ZGW A;  2PX9 A;  2V6C A;  2Y9Z A;  1XC5 A;  2W82 A;  4DOZ A;  3IH4 A;  2MAB A;  2DLL A;  3TMO A;  1RET A;  1Z9C A;  4ON0 A;  1HCR A;  3I0T A;  1NH3 A;  5J4Y A;  1R4N B;  1XDU A;  4RAG A;  4CCO A;  2ZNY A;  2QZ8 A;  3GFJ A;  4XLF A;  1I27 A;  1S3J A;  3FX3 A;  2ZSI B;  3HRT A;  1E3O C;  2X1D A;  3FXO A;  1ZG1 A;  2M2E A;  3F8B A;  1ETW A;  3R60 A;  3V7R A;  5GPC A;  4XNF A;  3CDL A;  3DV8 A;  3G4S I;  1YW9 A;  5C4J J;  3BG7 A;  3KP5 A;  4LK1 F;  3L00 A;  2CUF A;  1OFC X;  4HF2 A;  4LK0 F;  1P9Q C;  2VBW A;  3FK6 A;  3MKW B;  2EA2 A;  3FBI B;  3M7G A;  4M3D A;  2LRE A;  4M73 A;  3GME A;  1X3Z B;  3F6O A;  3MZH A;  4GO1 A;  5JVT A;  1SAU A;  2O0Y A;  2XUB A;  5DD8 A;  4HST A;  1ZLJ A;  3JSP A;  3DFG A;  2K27 A;  5FGM A;  3FHN A;  3Q5F A;  3CME I;  4EJW A;  4JK1 X;  4GYG A;  3AG1 H;  4JYK A;  4OIR F;  3B6A A;  4XMY A;  2Y2Z A;  2HVQ A;  3K1M A;  5HLH A;  3CD6 I;  1IG7 A;  2XGE A;  4DYC A;  3PUB A;  4F92 B;  4HX4 A;  4RB0 A;  4Q47 A;  1JE8 A;  1X3U A;  1ETX A;  1XCB A;  1IRX A;  4RB1 A;  2QYO A;  4HAM A;  2XRN A;  4LIV A;  5JR3 A;  1WH7 A;  1X1A A;  3QP5 A;  1K6O A;  1BW5 A;  2W85 A;  2DQL A;  1FMW A;  3OYC A;  2K9S A;  2CQX A;  4PGH A;  1SVO A;  1W1W E;  3WG7 H;  5HNH A;  4MFE A;  4A3K J;  2VL8 A;  5JLX A;  2XDV A;  1SD4 A;  1SFE A;  5M5W J;  4LG0 A;  2ME6 A;  4AIH A;  1I6H J;  4XRM A;  3QAH A;  1IRF A;  5DCM B;  1DU0 A;  2R4G A;  3W2V A;  3RIR A;  2G0E A;  1LE8 B;  2CQN A;  5IP9 J;  2MW8 A;  5L3B A;  1SD5 A;  4HA8 A;  4G94 A;  4OOI A;  2VKV A;  1IN6 A;  2ZME A;  3V7S A;  1JGG A;  1ZK8 A;  2QUF A;  1YIJ I;  3QPH A;  2FML A;  2X6X A;  4EQQ A;  2V1X A;  3P5J A;  2F5V A;  2KLO A;  4ZTJ A;  2JWT A;  5LGN A;  3H9J A;  4I98 B;  5KHD A;  4CCN A;  4BQA A;  2V6E A;  2CFX A;  2EIL H;  1I1S A;  1W4M A;  3MCZ A;  4NDL A;  3FMQ A;  1SAX A;  3DEU A;  4OIQ F;  2DYR H;  2KIU A;  4UNO A;  2IA1 A;  1IXS B;  3F8M A;  1KA8 A;  1IJW C;  5H6Q A;  3S32 A;  3DBR B;  4PDK A;  2WA0 A;  3IUO A;  4QPO A;  2PMU A;  2GXA A;  3I64 A;  1FY7 A;  3QU3 A;  1ODD A;  1HQC A;  4B3X A;  2STT A;  4KMU X;  1MBJ A;  1G6N A;  3ZQ7 A;  1YO5 C;  4HLX A;  2Q0O A;  3GF2 A;  2R5Y A;  1X2M A;  2GIV A;  1WJF A;  2ELJ A;  1XS9 A;  4FQG A;  1JJ6 C;  1MND A;  1VZ0 A;  3F22 A;  1TW3 A;  3OOU A;  3KIO A;  3OL3 A;  3K4J A;  3U1K A;  1TP4 A;  3HHH A;  2JVG A;  5M5Y J;  2XAQ A;  4BJT A;  2NAZ A;  4IOC F;  3K4B A;  1VQ6 I;  1EH6 A;  3OMY A;  2VKH A;  2OC6 A;  1Z6R A;  2BBY A;  1TNT A;  1A6I A;  2DA5 A;  3A4C A;  2D2W A;  1YJN I;  3H0D A;  1ETO A;  1OCC H;  5IP7 J;  3I58 A;  4HV6 A;  2F4I A;  4MO7 A;  3PUF A;  2GLO A;  2DBB A;  3CJR B;  3PO3 J;  2QSF X;  2ICW G;  2P5K A;  4XN3 A;  2XGD A;  1LUJ B;  1XGN A;  2LDU A;  3PNY A;  3DU5 A;  3H5R A;  4N4O B;  3ZQQ A;  1MMD A;  2FD5 A;  2ETH A;  4Y15 A;  3M9A A;  2GXG A;  1VQ7 I;  3F8C A;  1FOX A;  3GWZ A;  1MMG A;  5BS6 A;  5ICC A;  2MD0 A;  2UZK A;  5K5R A;  3LL7 A;  2KDO A;  2R7F A;  3JRD A;  2VJJ A;  2PEX A;  1LFP A;  1BIB A;  5HNF A;  1TC3 C;  1IDY A;  2F2E A;  3I4P A;  3Q0W A;  4CA0 A;  3F23 A;  2ID6 A;  4UXN A;  5EGO B;  4KDP A;  3HL2 A;  3LWF A;  4A5M A;  4RB3 C;  2LMD A;  5EYR A;  2DPD A;  2PLY A;  4A3I J;  2ZFU A;  2VPL A;  2EBI A;  5JVG F;  3J7A Y;  2IS2 A;  5TIS C;  5FJ8 J;  4AYB A;  4CUG A;  2LKS A;  2FU4 A;  2ZXW H;  2CS3 A;  3ERM A;  2L7K A;  3RPQ A;  4UUV A;  3DTI A;  3G1L A;  1K78 A;  1VF9 A;  1GXQ A;  3ESW B;  2RKH A;  2GOX B;  1MJB A;  2XAS A;  4BHP A;  2JK3 A;  2OPT A;  3F8F A;  3HSR A;  4BE1 A;  4EJO A;  2LNB A;  3IKV A;  1TWH J;  4RM3 A;  5B1A H;  4DJA A;  1TT0 A;  1YYV A;  3CCU I;  3R61 A;  3GTO J;  1RPW A;  3EUH C;  4Y7N J;  1Z6T A;  5BQT A;  2HQ5 A;  3NRV A;  3WGH A;  1I6X A;  3TQN A;  4UV8 A;  5F1J A;  1PDN C;  2NVY J;  2DJN A;  4KIC A;  3NEU A;  3MKZ A;  1MZB A;  2E19 A;  5AIP A;  2NS8 A;  3HOU J;  1Y1W J;  4ZYE A;  1XTA A;  2MLG A;  3SXY A;  1GV5 A;  2PMZ A;  2Z16 A;  3T0Y A;  3SFZ A;  4BXU A;  1K79 A;  1F5T A;  2Q2E B;  4JQF A;  3F72 A;  4HF1 A;  1VQP I;  4A0Z A;  5FLX Z;  2DA4 A;  2VE9 A;  3CCM I;  3MD2 A;  2EIJ H;  5FKK A;  2VKD A;  3H1C A;  5FFX A;  3BG6 A;  1KON A;  2CUJ A;  3SZT A;  4A3L J;  2DK5 A;  2WAE A;  4U7D A;  4BAY A;  3S3O A;  3H3U A;  1RUO A;  2RGV A;  4A3B J;  5DUI A;  1BIA A;  1T98 A;  5E3O A;  4A3E J;  3DPL C;  5JI6 A;  4BDY A;  2X85 A;  5FKO A;  1FTZ A;  4GGG A;  2LBF B;  3U2R A;  1YJ9 I;  2Z1D A;  4ZZD A;  2HOS A;  1Y39 A;  2L4M A;  4KN4 X;  1B9N A;  2H6C A;  4PCQ A;  2ZME C;  1YLF A;  4NQW B;  1IXR C;  1IW7 F;  4UVA A;  3OWT A;  1O7L A;  4GFB A;  3E3V A;  5DDG A;  3HSF A;  3QWL A;  1YI2 I;  4KT5 C;  2PFB A;  2M8G X;  2JSP A;  2K9L A;  4D5F A;  3BC8 A;  5ED4 A;  4KYW A;  3MZY A;  3CJQ B;  3I56 I;  4AU7 A;  1T08 B;  3A2K A;  2BHZ A;  2IGO A;  2JSC A;  4S0H B;  1WRJ A;  2ELK A;  3OSG A;  2O8K A;  2V1N A;  2DDA A;  2A61 A;  3G1O A;  5A2Q Z;  3A01 B;  1NK2 P;  4PZJ A;  2EIK H;  2HWV A;  3CUQ A;  2A6H F;  3NWT A;  4BHC A;  4F52 A;  1ZAR A;  4A6E A;  3SDB A;  2IS1 A;  4ABZ A;  1JT6 A;  4CGZ A;  4Z2Y A;  2MLK A;  2ECC A;  3D5R C;  4HDU A;  4LIU A;  6PAX A;  2L4A A;  4N0B A;  1FOK A;  2QKM B;  2BY1 A;  2Y69 H;  1J59 A;  3OOP A;  1WGX A;  1RC9 A;  1BN5 A;  1WVR A;  1Z05 A;  2DQR A;  3KEO A;  4CCK A;  1D3Y A;  4XLC A;  2XPV A;  4IEJ A;  2RQP A;  4QIW N;  1A35 A;  2HPI A;  4WXC A;  1R1V A;  4XBF A;  5H6R A;  2FEZ A;  4B43 A;  1POG A;  3SDG A;  4A3J J;  3QQA A;  2V7F A;  3G73 A;  4BXF A;  3MZ8 A;  2DFE A;  4LLN A;  5FRO A;  2HQR A;  4C30 A;  4MGR A;  3J7Y J;  4CIC A;  2DFI A;  2QQ9 A;  1UMQ A;  2LOO A;  3T8R A;  2JMW A;  1G4D A;  2D1H A;  1WZ2 A;  1CGP A;  2P7C B;  2STW A;  2J5O A;  1WJC A;  5DCM A;  3M4O J;  2C6Y A;  2CFO A;  3ZMU A;  3VSL A;  1BI2 A;  2KIF A;  2M30 A;  2LKP A;  3RPU D;  2X4H A;  2HFH A;  5CVI A;  2L7M P;  2E7X A;  2QA4 I;  2M4G A;  2DTZ A;  5HOO A;  3N05 A;  2CH0 A;  2M4K A;  2NNY A;  3CP8 A;  3W2W A;  2XRL A;  5D4S A;  1F9N A;  3SEZ A;  5CVR A;  1MJ9 A;  5DCF A;  1T33 A;  4NC6 A;  2L0K A;  5ERI A;  5D5V B;  4J19 A;  1HDP A;  5LGT A;  2PN6 A;  2Z99 A;  4LG0 B;  2Z9O A;  3PQK A;  1Y6I A;  2OQG A;  2KIS A;  2DTR A;  4ITV A;  2OU2 A;  2K4B A;  1T56 A;  3JRB A;  2R0Q C;  4IHT A;  2V79 A;  2V9V A;  4J01 A;  2ZME B;  4A69 C;  4U0Y A;  2JUG A;  1HKQ A;  2A5Y B;  5D8L B;  4UHT A;  5L3E A;  2KRF A;  2JPC A;  2VBX A;  2R3S A;  3E6D A;  3K0L A;  3J80 Z;  3WHC A;  3JSO A;  2HXO A;  4E6K G;  1YTY A;  1XMA A;  4A3C J;  2MC4 A;  1FLI A;  1FBU A;  5F04 A;  3KYL A;  2HKX A;  4I99 C;  1TBX A;  1U3E M;  1PVE A;  2F4O B;  2K9Q A;  5LHG A;  1PUF B;  3S16 J;  3VFZ A;  2W7N A;  2GXB A;  2DA1 A;  2QCO A;  3T8T A;  4KMF A;  5F1R A;  2JPB A;  1RIO H;  5CVJ A;  1GUU A;  2QLZ A;  5HDN A;  2I10 A;  1SVM A;  2ECB A;  5FKL A;  2XPW A;  3KP2 A;  4DZJ A;  5GAE J;  3OSF A;  3HDD A;  4KIB A;  3G3Z A;  3KZY A;  4E7K A;  2FNP A;  4OAY A;  2CJJ A;  1A5J A;  4G7H F;  3HXL A;  5HLI A;  3K69 A;  3S1R J;  4EAT A;  3I5U A;  2ZFW A;  4JOM A;  4QPQ A;  2BV6 A;  1R5G A;  3HIF A;  2JRM A;  3IRQ A;  1BBY A;  1UG0 A;  2HDW A;  1X3W B;  3I59 A;  3KP4 A;  1T95 A;  1DGW Y;  3QYF A;  3IH2 A;  2LY9 A;  3G2B A;  4E70 A;  1C0W A;  1I3A A;  3K4N A;  2LF8 A;  4P55 A;  4BQO A;  5EGO A;  3F6V A;  1PP8 F;  4B48 A;  2PG4 A;  4V2F A;  2X1C A;  4BBR J;  4XON A;  3OYL A;  2B9S A;  1EH7 A;  2W48 A;  3GUD A;  2ACJ A;  5HLG A;  1G8X A;  2FBH A;  1QQI A;  3J81 K;  1SFX A;  3LSR A;  4Y33 A;  2V1U A;  2JUC A;  1OJL A;  5IYC J;  1FOW A;  3F3X A;  5B3S H;  1Z67 A;  2R92 J;  3FKI J;  4C2U A;  2F4M B;  3CUQ C;  2WC2 A;  3C18 A;  3AAF A;  3CMA I;  4JP0 A;  1OLT A;  4XLH A;  3VDX A;  3BR2 A;  2E1O A;  3JAM Z;  3DKY A;  3ABU A;  3PNT A;  1QNT A;  3OR2 C;  4LB5 A;  4D1Q A;  4LMY A;  1W0T A;  4C2M J;  3BRO A;  3TO7 A;  2RDP A;  1O3R A;  2M3A A;  3ASN H;  2CU7 A;  3KET A;  2R7Q A;  4H4K C;  5J1R A;  4UY8 I;  4NUB A;  2PMH A;  4I2O A;  2FOK A;  5DV5 A;  4BKX A;  4HRI A;  4AM3 A;  2KT0 A;  1PJR A;  2W1O A;  1K78 B;  2Y31 A;  2NS7 A;  2V4J C;  1MSE C;  2UV1 A;  1I3Q J;  4ZYA A;  3L9F A;  3BP8 A;  1IGN A;  3U9G A;  1RI7 A;  2EFO A;  2IXS A;  3W6K B;  3CJT B;  4N9H A;  4AWX B;  5E3N A;  4FHT A;  4NB5 A;  1RR7 A;  1XGO A;  5H20 A;  2IEK A;  2JA6 J;  3QYE A;  4JX5 A;  1FWZ A;  1XB4 A;  2EZK A;  1Z0X A;  5DEQ A;  3PIP F;  2P8T A;  3OYB A;  1QHG A;  1S7O A;  2ZJR F;  2H1K A;  5K5Q A;  1ONV A;  3BJO A;  1U0J A;  4RM2 A;  2DT5 A;  3VYU B;  4IKF A;  4IXA A;  2DCE A;  3LA2 A;  3HOV J;  4BGD A;  1T0F C;  4UVB A;  2OF7 A;  4L5E A;  1OCT C;  3MWM A;  4WXH A;  3AG3 H;  4FX4 A;  4IPA A;  4O5V A;  2CV1 A;  2UWM A;  3HKZ N;  4FE7 A;  3DTK A;  4D0P A;  3EDP A;  2F5F A;  4G7Z F;  1F43 A;  4I0A A;  2XB5 A;  3I55 I;  4E7J A;  4I01 A;  3ZGK A;  3HOY J;  5CQE A;  2J5P A;  3GO5 A;  1S72 I;  1Y1V J;  1MH4 A;  3QU6 A;  3FXR A;  2JRT A;  3SJM A;  1R1T A;  2VPR A;  2A3S A;  2ESH A;  2HEO A;  1JXS A;  1AKH A;  5EF6 A;  4HV5 A;  1QZE A;  4BU2 A;  1U78 A;  5F64 A;  3BJA A;  4BUP A;  2O3F A;  3MEX A;  4RA2 A;  2VOO A;  1BR2 A;  2BY0 A;  2E36 A;  1R49 A;  1VI0 A;  3A01 A;  2JA5 J;  1G3S A;  2CMP A;  3HM5 A;  3CC4 I;  3BTI A;  3LAJ A;  4LOC A;  1A36 A;  1N75 A;  1D0X A;  3KX2 A;  3TED A;  2GQQ A;  4WCG A;  3EUA A;  2R5Z B;  2DA3 A;  2FRH A;  1HC8 A;  3LA7 A;  2CQQ A;  3DBL B;  1WSU A;  2W4S A;  1D0Y A;  5D5W B;  4BXX J;  1IF1 A;  1LVK A;  2OA4 A;  2ZNZ A;  2E5Z A;  3DQV C;  4ESB A;  2X6O A;  2DFF A;  2EB7 A;  5CYV A;  2VOD A;  2E2J J;  4EJU A;  4I76 A;  4NHJ A;  3BTJ A;  1RUN A;  4CHU A;  3JRG A;  1S6L A;  2DA6 A;  1TWA J;  1TWG J;  3FWE A;  3BLY A;  4CYC A;  1MDM A;  4M6V A;  3L2Q A;  1AOY A;  5F0C A;  3LNQ A;  3CUQ B;  3OS0 A;  2EIM H;  1RRJ A;  2Y75 A;  4LJZ F;  5HS7 A;  2FA5 A;  2OUM A;  5JHU A;  2F6C A;  2XAJ A;  3HKZ A;  3EUH A;  2H6B A;  1X1P A;  4TV7 A;  1YG2 A;  4HBL A;  1WQ2 A;  1SAN A;  1H0M A;  5D8K B;  3LA3 A;  2HQA A;  4OU0 A;  2DN0 A;  1OKR A;  1K83 J;  3RZD J;  2LLK A;  3BZK A;  4BAC A;  5KAI C;  4B09 A;  5K5O A;  5GAD J;  1LVA A;  2K4J A;  3Q9S A;  2Y30 A;  4XRS A;  3LSP A;  3E5X A;  1AHD P;  4U88 A;  3R6S A;  1HW2 A;  3B73 A;  5J47 A;  1QU3 A;  3HRU A;  1B72 A;  5J8C A;  2BVM A;  2IA2 A;  2RC4 A;  1NG7 A;  4MEY F;  4RBO A;  3CCQ I;  1O7F A;  1JKQ C;  3C1D A;  2Z5U A;  2RV8 A;  4BE2 A;  5GAG J;  2D1V A;  3A1Y A;  4ETS A;  1W7P D;  1OMI A;  4KJZ A;  5F08 A;  4B1R A;  4AUX A;  2ELH A;  1PUE E;  4MFD A;  3BPV A;  3AFH A;  4BYY A;  1X2N A;  2E1M C;  1TWF J;  4U0V A;  1Y8R B;  3PM1 A;  2YSR A;  3E6M A;  4DQ2 A;  2XSD C;  4YII A;  1MMS A;  1FIA A;  2AXT C;  3D5S C;  5DS9 A;  3CLO A;  5IT9 Z;  4RGU A;  1U5T C;  3C2H A;  5K1Y A;  1YOV B;  3KEY A;  2O8X A;  1D5Y A;  3PIO F;  5EEG A;  3ZN0 A;  4XOT A;  2PQ8 A;  3OYN A;  4KT6 A;  1R22 A;  3Q3S A;  3T1B A;  3K4C A;  4B3A A;  4CXF A;  2HYF A;  3ZOB A;  2X48 A;  1AU7 A;  3CCE I;  2FUG 2;  1QZZ A;  2ID3 A;  1X4O A;  3FXM A;  1YFH A;  3VYR B;  3L7W A;  4ZZL A;  1KU2 A;  4D9J A;  3KZZ A;  3WU2 C;  3F9K A;  5B1B H;  1D5V A;  3M8E A;  3GTP J;  1KU3 A;  4Y13 A;  2HYJ A;  2DMT A;  3WGG A;  5ILU A;  1W5T A;  2JT1 A;  3L09 A;  1IC8 A;  1F4K A;  3X2Q H;  1LDJ A;  4YEJ A;  4IOA F;  4G6Q A;  4L18 B;  4ANJ A;  2VI6 A;  1PUF A;  1FYK A;  2GAU A;  2M7A A;  5FB2 A; 
#chains in the Genus database with same CATH homology
 4ZYG A;  1P92 A;  2ISZ A;  4M6X A;  5D5U B;  1QGP A;  3S2W A;  3TO9 A;  4A0Y A;  2UXX A;  4R79 A;  3FMR A;  1YS6 A;  1FPQ A;  2DPU A;  2VC1 A;  2XV4 S;  3RI4 A;  5CLS A;  1L3L A;  3WTU C;  2L02 A;  2HGC A;  2TDX A;  1NHA A;  1DPR A;  3D5L A;  5ICF A;  4OIO F;  3I54 A;  2EFN A;  2G7U A;  2P6S A;  2L3D A;  3VOE A;  2XVC A;  1RZ4 A;  2HDC A;  3DP7 A;  1R7J A;  5JFR A;  3KE2 A;  2QVO A;  4IRH A;  4OIN F;  4WX9 A;  1PP7 U;  1WKM A;  2CQK A;  3I59 B;  5IT3 A;  2G9W A;  3WTX C;  4IF4 A;  2VC0 A;  4YIF A;  4MTE A;  2PBI A;  5KVR A;  3E5U A;  5BOX A;  1E2X A;  4P9U A;  5E1W A;  4OMY A;  2RVC A;  3WTS C;  1Q1H A;  3K1N A;  4ZH4 F;  2XKO A;  5FLX K;  4M6Y A;  3KEQ A;  4RGX A;  3RPU A;  3WU0 A;  5J8F A;  1FYL A;  1R58 A;  2QEN A;  4RB2 C;  4EM1 A;  2D45 A;  4IHS A;  4XLN F;  4HYE A;  1G3T A;  1ZRD A;  4M74 A;  1ZHF A;  4GCV A;  2E1N A;  3GX4 X;  1P4X A;  3ZP5 A;  4HX7 A;  1QPM A;  5F6F A;  3E6C C;  3BOQ A;  2FBI A;  5AIQ A;  2O03 A;  3IHU A;  3LFK A;  1ZH5 A;  1SD6 A;  4BHB A;  5FD6 A;  4M9S A;  1R36 A;  5A2Q K;  3T5X A;  4KIG A;  1HST A;  1OYW A;  3FM3 A;  2IA0 A;  1BM9 A;  1UB9 A;  3FM5 A;  4IVN A;  3JW4 A;  2FQ3 A;  4CDG A;  3WGI A;  3VEP A;  2CG4 A;  2O61 A;  4S04 A;  3P7N A;  4MQV A;  4I02 A;  3K1P A;  3DKW A;  4LB6 B;  3TDU C;  1B4A A;  1KYW A;  4A2U A;  3WU1 B;  5HS9 A;  3CDH A;  3HTS B;  2XKP A;  3HYI A;  2M45 A;  3C3W A;  2OZU A;  4HW0 A;  2EFP A;  4ASN A;  1R1U A;  2G7H A;  2PJP A;  1DDN A;  2P6T A;  4Q5S F;  3FZV A;  4U0W A;  1SMT A;  2P4W A;  1MDM B;  3ELK A;  2VBY A;  2DO7 A;  2M87 A;  1FP2 A;  3ZPL A;  2MA3 A;  5L3C A;  2WWY A;  3HUG A;  5LBQ A;  3O6B B;  2IVM A;  2QM3 A;  2ISY A;  1D8J A;  3SZP A;  2FBK A;  3IWF A;  1T0F A;  3WG9 A;  1UCR A;  4XSX F;  4ESJ A;  3P9K A;  4EM0 B;  3HTU A;  3IC7 A;  3KLO A;  2L54 A;  3RKW A;  3J80 K;  2W57 A;  3FHZ A;  5D5X B;  2HYG D;  2W84 A;  5E1Z B;  3CUO A;  3JTH A;  5BPI A;  4YFX F;  2EJR A;  5FO5 A;  3GXO A;  2DW4 A;  1P4W A;  4I09 A;  3N4M A;  2RNJ A;  1XDS A;  1SMY F;  1MKM A;  1IN5 A;  1T6S A;  3MQ0 A;  3RYR A;  3B02 A;  2KKO A;  2DU9 A;  1BC8 C;  3GFL A;  1REP C;  4RGS A;  2RN7 A;  3E97 A;  3OV8 A;  1S29 A;  3U1D A;  1J5Y A;  3LQR A;  2VT2 A;  2KJC A;  4JBA A;  1UST A;  4RS8 A;  1IN7 A;  2F5E A;  1XMK A;  3WOD F;  4K2E A;  4HLY A;  3HSE A;  1UHW A;  3H92 A;  2XIG A;  2ZCW A;  1HKT A;  4A0X A;  4I7H A;  2BEO A;  2YX7 A;  4WWC A;  3ABT A;  5DYM A;  4RAY A;  4P5O A;  1JHH A;  4EVI A;  2XAF A;  2Q8K A;  1U5T A;  5L3G A;  2BYV E;  4ENN A;  3GFI A;  2XRO A;  1BC7 C;  5LHI A;  1MJA A;  4XSZ F;  4CO8 A;  4PGG A;  3NQO A;  4MQ9 F;  5FFZ A;  3GEZ A;  1K7A A;  1J7K A;  2EFQ A;  1B6A A;  3BZ6 A;  1W7P A;  3BPX A;  5L3F A;  2GA2 A;  1OYY A;  1YW7 A;  4EGY A;  4HQM A;  4MNU A;  4EM2 A;  4N9I A;  1TNS A;  2ZJ2 A;  4WF2 A;  1U8R A;  1DUX C;  4G7O F;  3ZMD A;  3EYY A;  4HOB A;  1F1Z A;  4RGR A;  1EV7 A;  4A6D A;  3K2Z A;  4L9N A;  2P5V A;  5KK1 A;  2HOE A;  2R7D A;  1O3T A;  1ZRE A;  4Y17 A;  4O6J A;  1HBX G;  1Y0U A;  2NNN A;  5LEJ A;  3VOD A;  3C7J A;  4ZYD A;  2IPQ X;  1XGM A;  2VXZ A;  1U2W A;  3WTT C;  1GHC A;  4KN7 X;  4L0Y B;  2CGP A;  2H27 A;  2CO5 A;  4BNC A;  1FSH A;  3RDI A;  2X0L A;  5LLQ A;  3V8J A;  2H94 A;  1Z91 A;  3EQL F;  3QOP A;  4RAZ A;  3WE2 A;  5E8G A;  3FF5 A;  1XCV A;  1DP7 P;  1RNL A;  1J2X A;  1YS7 A;  3GW2 A;  3KP3 A;  2VOP A;  2YU3 A;  3WTY C;  5D6F A;  1OYI A;  1LB2 A;  1CF7 A;  2IW5 A;  2DAO A;  2O6G E;  1A04 A;  3QP6 A;  1ZRF A;  1T2K A;  4WXD A;  2OBP A;  1I1G A;  3BY6 A;  1ZGA A;  2NRA C;  2QQB A;  4HQE A;  2P7V B;  2F5D A;  2XHK A;  5CJ9 A;  4ENK A;  4M9X A;  2EV0 A;  1G3Y A;  2XGX A;  1ON2 A;  1P6R A;  2K7L A;  1H9T A;  5IT9 K;  1DPU A;  4ENJ A;  3WTW C;  1FBQ A;  1LEA A;  4L9V A;  1BI3 A;  2HR3 A;  1QO0 D;  3W6J B;  3HOT A;  3RKY A;  4Q48 A;  1KGS A;  2FMY A;  4R1H A;  2VT3 A;  2LSO A;  3KP7 A;  4L5I A;  3V4G A;  2IP2 A;  4GYI A;  2QBY A;  1E17 A;  1UHM A;  2NS0 A;  4IRG A;  4ENM A;  1KU7 A;  4EGZ A;  4LLL A;  1HXD A;  1LQ1 A;  2IT0 A;  5HVQ C;  1FSE A;  2CYY A;  3DPT A;  5E17 F;  2MC3 A;  4XRF A;  3MAJ A;  4LD5 A;  1R00 A;  4EV0 A;  1R23 A;  1LNW A;  2F5C A;  2A69 F;  3R4K A;  5D6E A;  1B9M A;  1AWC A;  3M1E A;  4B8X A;  5E8I A;  3ISP A;  1IAW A;  4M9Z A;  4A5N A;  2HQN A;  4DNC A;  2KIM A;  3ML6 A;  4M71 A;  1SD7 A;  3QRF F;  1FX7 A;  4HX8 A;  3LAP A;  3WTV C;  3ZMZ A;  3GLX A;  3KP6 A;  3V7C A;  1ZG3 A;  3ECO A;  3F8N A;  5E18 F;  1TQP A;  3TO6 A;  3MFK A;  2CWE A;  3GVA A;  1MD0 A;  3ROU A;  1FYM A;  3HRS A;  1P2F A;  4P96 A;  4UVC A;  4O3M A;  2A68 F;  2ESN A;  3DF8 A;  4KIF A;  4WK8 F;  1HW5 A;  2EA4 A;  1TLH B;  2XAG A;  1SFU A;  5ILV A;  2IRF G;  2HKO A;  2K02 A;  3E6B A;  4LLG F;  1HW1 A;  3ZMS A;  3D0S A;  2YPR A;  2HTS A;  1IZ1 A;  2B0L A;  2OAZ A;  4CYD A;  1U5T B;  2JZY A;  4G6D A;  1ZGJ A;  1TQI A;  1V4R A;  3J7A O;  2MBF A;  4ESF A;  1XN7 A;  4IRI A;  3JTG A;  5TRD A;  4AIJ A;  2ZO4 A;  2MD5 A;  5LEK A;  2L01 A;  4OMZ A;  3P9C A;  5LRS A;  1W7P B;  5DD4 A;  5L3D A;  1ZYR F;  3FMS A;  3V8L A;  1T38 A;  1S7A A;  4AIK A;  1IUY A;  4G8X A;  3ECH A;  1OR7 A;  3ULQ B;  3QPT A;  5HDK A;  4FX0 A;  1KU9 A;  4QLC U;  2EK5 A;  3H3Z A;  2FF4 A;  5LHH A;  2VBZ A;  3IL2 A;  5TJJ A;  3TDZ C;  2IJL A;  3IRR A;  3ZMT A;  1L0O C;  4H0E A;  2HS5 A;  2FE3 A;  3IWZ A;  1XGS A;  3ZMV A;  2E1C A;  1WI9 A;  1LJ9 A;  2YR2 A;  4S05 A;  5ILS A;  2GA1 A;  2Z33 A;  1ULY A;  2GWR A;  3Q9V A;  3GFM A;  5LRR A;  2ZXJ A;  5FD5 A;  3RYP A;  3BWG A;  1EH8 A;  4KUM A;  1I5Z A;  2M1B A;  4KA4 A;  1TTY A;  1W5S A;  4GXO A;  5D4R A;  4A12 A;  1J0R A;  5E1X A;  3L2C A;  2WV0 A;  3GYH X;  2Y0M A;  1USS A;  3GZ6 A;  3N97 A;  1XSD A;  2GZW A;  3HHG A;  4HF0 A;  3I71 A;  5DUK A;  1CF7 B;  2UXN A;  4R8H A;  4G9Y A;  3E5Q A;  5BMZ A;  2DI3 A;  4FT8 A;  1FP1 D;  2AXL A;  4HZF A;  1KQ8 A;  3P9I A;  2Z3Y A;  4BH9 A;  2MH9 A;  5CVV A;  3ERE D;  4YFK F;  3KFW X;  2FXA A;  1FBS A;  2EV6 A;  4XLP F;  3F21 A;  4LGW A;  1O3S A;  1ZAO A;  4L9J A;  2M5W A;  1H9G A;  3HOS A;  1P4A A;  1KQ9 A;  4U7B A;  2E7W A;  1J9I A;  1BI0 A;  2M8E A;  1FZP B;  3DXJ F;  1XD7 A;  1Z1D A;  1S8N A;  4YFN F;  2ADU A;  4F7Z A;  2CSO A;  1KQ0 A;  2W24 A;  3EET A;  2VE8 A;  2QBY B;  1U6G A;  3KLN A;  3CO6 C;  2NYX A;  2LF7 A;  3HRM A;  1FT9 A;  1WWX A;  2BGC A;  1HSJ A;  4L0Z B;  4LFU A;  1TW2 A;  3RJP A;  2KJB A;  2H09 A;  3CTA A;  1QBJ A;  2QWW A;  5CVU A;  3FXU A;  2DK8 A;  2V1D A;  1B59 A;  2P5L C;  4EJV A;  3BDD A;  1OPC A;  4MTD A;  3PFI A;  2EV5 A;  1IN4 A;  2HTJ A;  2QQA A;  1STZ A;  1XSX A;  5AON A;  3R0A A;  3WTZ A;  3CO7 C;  3RKX A;  3LST A;  1J75 A;  1XSV A;  2MH2 A;  3IKT A;  5LGU A;  4I0B A;  4AD9 A;  4EMS A;  2ZKZ A;  1MGT A;  1IXC A;  1LDD A;  3K9T A;  5ICG A;  1FNN A;  5E20 A;  2OQR A;  2AS5 F;  1IRG A;  4KNY A;  3JAM K;  2ZBK A;  4MHG A;  2BE5 F;  3PQJ A;  1Z7U A;  4ZYH A;  4KFC A;  3CJN A;  1ZRC A;  2VON A;  1BI1 A;  3FXQ A;  1O3Q A;  1D8K A;  1TQM A;  2K86 A;  1B1B A;  2HZT A;  3V8K A;  4L5J A;  2OZ6 A;  2FNA A;  4EJT A;  4AVP A;  2COM A;  1HKS A;  2OD5 A;  2A07 F;  1YQA A;  2A6E F;  3TKY A;  1G3W A;  5HDG A;  3EYI A;  2XAH A;  4L9T A;  5ICE A;  1ZG5 A;  1FC3 A;  3TOB A;  2Y48 A;  4P9F A;  4Q4Z F;  3TOA A;  3REO A;  1QZY A;  3J81 Z;  1GVJ A;  3GZ5 A;  2EWN A;  4UV9 A;  4HDV A;  1BJA A;  2Q2E A;  2YX4 A;  3M8F A;  1O57 A;  3BJ6 A;  4M72 A;  4MEX F;  3WE3 A;  1LDK B;  3SHF A;  5BPD A;  4CZZ A;  3KCC A;  4YG2 F;  2VN2 A;  3RTR A;  2PI0 A;  1JGS A;  4OIP F;  4QWQ A;  4IJA A;  1LEB A;  2CW0 F;  2EFW A;  3O3K A;  4NQW A;  3TGN A;  1JHF A;  1V3F A;  5J6X A;  1T39 A;  3ZN1 A;  1ZLK A;  2WTE A;  3I53 A;  1R5H A;  2JTV A;  1YW8 A;  3O2P E;  1VTN C;  3SQN A;  1ZN2 A;  3COA C;  2FSW A;  1IN8 A;  3R0J A;  3VB2 A;  1YIO A;  1GXP A;  2W25 A;  1UFM A;  5EEH A;  1BOA A;  1ON1 A;  1KYZ A;  3LQQ A;  5HS8 A;  2V6C A;  2DLL A;  1Z9C A;  4ON0 A;  3I0T A;  1XDU A;  2ZNY A;  2QZ8 A;  3GFJ A;  1I27 A;  1S3J A;  3FX3 A;  3HRT A;  1ZG1 A;  3F8B A;  3R60 A;  3V7R A;  3DV8 A;  1YW9 A;  3KP5 A;  4LK1 F;  3L00 A;  4HF2 A;  4LK0 F;  2VBW A;  2EA2 A;  3M7G A;  4M73 A;  3F6O A;  3MZH A;  4GO1 A;  5JVT A;  2XUB A;  2O0Y A;  5DD8 A;  1ZLJ A;  3JSP A;  3DFG A;  2K27 A;  5FGM A;  3Q5F A;  4EJW A;  4JK1 X;  4GYG A;  4OIR F;  3K1M A;  5HLH A;  4HX4 A;  4RB0 A;  4Q47 A;  1JE8 A;  1X3U A;  1XCB A;  4RB1 A;  2QYO A;  4HAM A;  2XRN A;  5JR3 A;  3QP5 A;  1K6O A;  2W85 A;  2DQL A;  4PGH A;  1SD4 A;  1SFE A;  4LG0 A;  4AIH A;  3QAH A;  1IRF A;  5DCM B;  3RIR A;  5L3B A;  1SD5 A;  4HA8 A;  4G94 A;  4OOI A;  1IN6 A;  2ZME A;  3V7S A;  2QUF A;  3QPH A;  2FML A;  4EQQ A;  2V1X A;  5LGN A;  4I98 B;  4BQA A;  2CFX A;  1I1S A;  1W4M A;  3MCZ A;  3FMQ A;  1SAX A;  3DEU A;  4OIQ F;  2KIU A;  4UNO A;  2IA1 A;  1IXS B;  3F8M A;  1KA8 A;  5H6Q A;  4PDK A;  2PMU A;  3I64 A;  1FY7 A;  3QU3 A;  1ODD A;  1HQC A;  2STT A;  4KMU X;  3ZQ7 A;  1G6N A;  1YO5 C;  4HLX A;  2Q0O A;  3GF2 A;  2GIV A;  3F22 A;  1TW3 A;  3HHH A;  2XAQ A;  2NAZ A;  1EH6 A;  1Z6R A;  2BBY A;  1TNT A;  2D2W A;  3I58 A;  4HV6 A;  2DBB A;  2P5K A;  1XGN A;  2LDU A;  2ETH A;  4Y15 A;  3M9A A;  2GXG A;  3F8C A;  3GWZ A;  5BS6 A;  5ICC A;  2UZK A;  5K5R A;  2R7F A;  2PEX A;  1BIB A;  2F2E A;  3I4P A;  3F23 A;  4UXN A;  4KDP A;  3LWF A;  4A5M A;  4RB3 C;  2DPD A;  2PLY A;  2FU4 A;  3RPQ A;  4UUV A;  1K78 A;  1GXQ A;  2RKH A;  1MJB A;  2XAS A;  4BHP A;  3F8F A;  3HSR A;  4EJO A;  2LNB A;  3IKV A;  1YYV A;  3R61 A;  1Z6T A;  5BQT A;  3NRV A;  3WGH A;  1I6X A;  3TQN A;  4UV8 A;  1PDN C;  4KIC A;  3NEU A;  1MZB A;  5AIP A;  4ZYE A;  2MLG A;  3SXY A;  3SFZ A;  3T0Y A;  4BXU A;  1K79 A;  1F5T A;  4JQF A;  3F72 A;  4HF1 A;  4A0Z A;  5FLX Z;  2VE9 A;  5FFX A;  3SZT A;  2DK5 A;  4U7D A;  4BAY A;  3H3U A;  1RUO A;  2RGV A;  5DUI A;  1BIA A;  1T98 A;  3DPL C;  5JI6 A;  4GGG A;  3U2R A;  4ZZD A;  2L4M A;  4KN4 X;  1B9N A;  2H6C A;  4PCQ A;  1YLF A;  1IXR C;  1IW7 F;  4UVA A;  1O7L A;  3E3V A;  5DDG A;  3HSF A;  4KT5 C;  2PFB A;  5ED4 A;  4KYW A;  3MZY A;  2JSC A;  1WRJ A;  2A61 A;  5A2Q Z;  4PZJ A;  2HWV A;  3CUQ A;  2A6H F;  4BHC A;  1ZAR A;  4A6E A;  4CGZ A;  4Z2Y A;  2MLK A;  4HDU A;  6PAX A;  2L4A A;  4N0B A;  1FOK A;  1J59 A;  3OOP A;  1Z05 A;  1BN5 A;  2DQR A;  3KEO A;  1D3Y A;  2RQP A;  4WXC A;  1R1V A;  4XBF A;  5H6R A;  2FEZ A;  3G73 A;  4LLN A;  2HQR A;  4MGR A;  4CIC A;  2DFI A;  2QQ9 A;  3T8R A;  1G4D A;  2D1H A;  1CGP A;  2P7C B;  2STW A;  2J5O A;  5DCM A;  2C6Y A;  3ZMU A;  1BI2 A;  2KIF A;  2M30 A;  2LKP A;  2X4H A;  2HFH A;  5CVI A;  2E7X A;  5HOO A;  2NNY A;  5D4S A;  1F9N A;  5CVR A;  1MJ9 A;  5DCF A;  5ERI A;  5D5V B;  5LGT A;  2PN6 A;  2Z99 A;  4LG0 B;  2Z9O A;  3PQK A;  2OQG A;  2DTR A;  2OU2 A;  2K4B A;  4IHT A;  2V79 A;  2V9V A;  2ZME B;  4U0Y A;  1HKQ A;  2A5Y B;  5D8L B;  4UHT A;  5L3E A;  2KRF A;  2JPC A;  2VBX A;  2R3S A;  3E6D A;  3K0L A;  3J80 Z;  3JSO A;  1YTY A;  1XMA A;  1FLI A;  1FBU A;  2HKX A;  1U3E M;  1TBX A;  5LHG A;  3VFZ A;  2GXB A;  3T8T A;  4KMF A;  5F1R A;  2JPB A;  1RIO H;  5CVJ A;  2QLZ A;  5HDN A;  3KP2 A;  4KIB A;  3G3Z A;  3KZY A;  2FNP A;  4G7H F;  5HLI A;  3K69 A;  3I5U A;  2ZFW A;  2BV6 A;  1R5G A;  3HIF A;  3IRQ A;  1BBY A;  3I59 A;  3KP4 A;  4E70 A;  1C0W A;  2LF8 A;  4P55 A;  3F6V A;  1PP8 F;  2PG4 A;  1EH7 A;  3GUD A;  2ACJ A;  5HLG A;  2FBH A;  3J81 K;  1QQI A;  1SFX A;  2V1U A;  3F3X A;  3CUQ C;  2WC2 A;  3C18 A;  3AAF A;  3JAM Z;  3ABU A;  1QNT A;  4LB5 A;  4LMY A;  3BRO A;  3TO7 A;  2RDP A;  1O3R A;  3KET A;  2PMH A;  4I2O A;  2FOK A;  5DV5 A;  1K78 B;  3L9F A;  3BP8 A;  3U9G A;  1RI7 A;  2EFO A;  3W6K B;  4N9H A;  4AWX B;  4FHT A;  4NB5 A;  1XGO A;  5H20 A;  1FWZ A;  1XB4 A;  5DEQ A;  2P8T A;  1S7O A;  5K5Q A;  1ONV A;  3BJO A;  2DT5 A;  4IXA A;  3LA2 A;  4UVB A;  4FX4 A;  3MWM A;  4WXH A;  4IPA A;  4O5V A;  2UWM A;  4D0P A;  3EDP A;  2F5F A;  4G7Z F;  4I0A A;  4I01 A;  2J5P A;  3GO5 A;  3QU6 A;  3FXR A;  2JRT A;  1R1T A;  2A3S A;  2ESH A;  2HEO A;  1JXS A;  4HV5 A;  1U78 A;  5F64 A;  3BJA A;  2O3F A;  3MEX A;  2VOO A;  1G3S A;  3LAJ A;  2GQQ A;  4WCG A;  2FRH A;  3LA7 A;  1WSU A;  5D5W B;  1IF1 A;  2OA4 A;  2ZNZ A;  3DQV C;  4ESB A;  2EB7 A;  5CYV A;  2VOD A;  4EJU A;  4NHJ A;  1RUN A;  4CHU A;  1S6L A;  3FWE A;  1MDM A;  1AOY A;  3CUQ B;  2Y75 A;  4LJZ F;  5HS7 A;  2FA5 A;  5JHU A;  2XAJ A;  3EUH A;  2H6B A;  4TV7 A;  1YG2 A;  4HBL A;  1WQ2 A;  1H0M A;  5D8K B;  3LA3 A;  4OU0 A;  1OKR A;  4B09 A;  5K5O A;  1LVA A;  2K4J A;  3Q9S A;  1HW2 A;  3E5X A;  4U88 A;  3R6S A;  3B73 A;  3HRU A;  5J8C A;  2IA2 A;  2RC4 A;  4MEY F;  1O7F A;  3C1D A;  2Z5U A;  2RV8 A;  2D1V A;  4ETS A;  1W7P D;  1OMI A;  2ELH A;  1PUE E;  3BPV A;  4BYY A;  4U0V A;  4DQ2 A;  2YSR A;  3E6M A;  4YII A;  3CLO A;  5IT9 Z;  4RGU A;  1U5T C;  5K1Y A;  2O8X A;  5EEG A;  3ZN0 A;  2PQ8 A;  1R22 A;  3T1B A;  4CXF A;  2HYF A;  1QZZ A;  1YFH A;  3L7W A;  4ZZL A;  1KU2 A;  3KZZ A;  1D5V A;  3M8E A;  1KU3 A;  4Y13 A;  3WGG A;  5ILU A;  1W5T A;  2JT1 A;  3L09 A;  1F4K A;  1LDJ A;  4G6Q A;  4L18 B;  1FYK A;  2GAU A;  5FB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...