2J66A

Structural characterisation of btrk decarboxylase from butirosin biosynthesis
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
414
structure length
390
Chain Sequence
DQAEITALTKRFETPFYLYDGDFIEAHYRQLRSRTNPAIQFYLSLKANNNIHLAKLFRQWGLGVEVASAGELALARHAGFSAENIIFSGPGKKRSELEIAVQSGIYCIIAESVEELFYIEELAEKENKTARVAIRINPDKSFTAIKMGGVPRQFGMDESMLDAVMDAVRSLQFTKFIGIHVYTGTQNLNTDSIIESMKYTVDLGRNIYERYGIVCECINLGGGFGVPYFEKALDIGKITRTVSDYVQEARDTRFPQTTFIIESGRYLLAQAAVYVTEVLYRKASKGEVFVIVDGGMHHHAASPMEYIPLEKVTIAGPLCTPEDCLGKDVHVPALYPGDLVCVLNSGAYGLSFSPVHFLGHPTPIEILKRNGSYELIRRKGTADDIVATQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BTRK
publication title Structural Characterisation of Btrk Decarboxylase from Bacillus Circulans Butirosin Biosynthesis
rcsb
source organism Bacillus circulans
molecule tags Lyase
total genus 128
structure length 390
sequence length 414
ec nomenclature ec 4.1.1.95: L-glutamyl-[BtrI acyl-carrier protein] decarboxylase.
pdb deposition date 2006-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00278 Orn_DAP_Arg_deC Pyridoxal-dependent decarboxylase, C-terminal sheet domain
A PF02784 Orn_Arg_deC_N Pyridoxal-dependent decarboxylase, pyridoxal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.10 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 2j66A01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 2j66A02
3ANUA 3B8VA 1QU4A 3NZPA 4Y2WA 2ODOA 3OO2A 3CO8A 5BWAA 1NIUA 1VFHA 1XQKA 4PB3A 2NVAA 2YXXA 5GJPA 4XG1A 4FS9A 7ODCA 2PLJA 3R79A 4PB5A 3HURA 3WQEA 3WQDA 4A3QA 4LUSB 4BEQA 2SFPA 5IRPA 3HA1A 5FAGA 2NV9A 3C5QA 4KBXA 4ECLA 4QHRA 1HKVA 4DZAA 2P3EA 4PB4A 4LUTB 1KO0A 1CT5A 3KW3A 1TUFA 2ON3A 2VD9A 3LLXA 4BHYA 1SFTA 1HKWA 4AIBA 2DY3A 1D7KA 1W8GA 3AWNA 3S46A 2OO0A 1EPVA 4BEUA 1SZRA 3SY1A 1B54A 3WQFA 1TWIA 1FTXA 3CPGA 4LUSA 3E6EA 2PLKA 2TODA 1L6FA 3AWOA 4ILSA 3N29A 4BF5A 3BTNA 4ZGYA 2RJGA 3ANVA 3WQGA 1VFTA 3E5PA 1NJJA 3GWQA 3N2BA 4LUYA 1L6GA 5FAJA 3UW6A 5GJMA 4LUTA 2QGHA 3VABA 1F3TA 5GJNA 1XQLA 1VFSA 2RJHA 5FACA 4WR3A 2J66A 1RCQA 3B8WA 4DYJA 4XBJA 2VD8A 3B8UA 3MT1A 3NZQA 3WQCA 3B8TA 4V15A 1BD0A 1KNWA 1XFCA 2O0TA 3N2OA
chains in the Genus database with same CATH superfamily
4EP8C 4UTTA 1BYBA 1GKRA 2ZZ7A 3KFTA 1NP0A 4GISA 1HO4A 2Z1KA 2QEZA 4JQ2A 2J79A 2BBFA 3VYLA 3NQDA 2PLJA 3BOXA 3IAQA 3GD6A 4Q8UA 2PDLA 3TJ4A 1ITCA 1IV8A 5DFAA 4H9YA 3S5SA 5HWJA 1S38A 4DVOA 3OTRA 2WMFA 4F9DA 4P7LA 4HZ6A 3W86A 4J40A 4LEFA 2VZOA 2O9TA 4NZCA 2A3EA 2NX3A 4QLJA 3RJXA 2PSNA 3O6AA 2OSXA 3BG5A 4LUSA 4IX2A 1IQ8A 2WWDA 3MHUA 3NZRA 5EBUA 3RG6A 4O0KA 3KBMA 4WGXA 5CH9A 4HOXA 3SGGA 4OQVA 5HOSA 3CB3A 2R1PA 2G3IA 4ATWA 2QW5A 1QBAA 2WYSA 3TROA 1OX4A 3QFEA 2CLPA 1XQLA 1RBLA 5FACA 1KBIA 1UR4A 4HMEA 4NXKA 3MUXA 4JX5A 2VEKA 1T6MA 4WJXA 2Y5JA 3W6MA 2WNWA 3NQ8A 1W91A 1T96A 1R0MA 5DT5A 4TU1A 1GHSA 4YCOA 3ZLHA 2NUYA 3IJ9A 4UCGA 3VZYA 3VDAA 1TYGA 3ZJ6A 4M19A 2VGIA 1QXLA 2R1LA 3AMGA 3OGRA 2HS6A 4JKLA 3ZM8A 3MP3A 1VRDA 3LGDA 2XIQA 4XO6A 3I6TA 5LGZA 3RLHA 1OFOA 3SCOA 1VBJA 2HPMA 5FD0A 3BCDA 3G2GA 3ZS4A 3W29A 3GU1A 3MV01 2HXUA 4C7GA 4US5D 5D02A 2GVEA 3BICA 1JD9A 1LWIA 4PRRA 2NLIA 1TE6A 3RMJA 4GQ0A 2DT0A 1OC6A 3T42A 4M82A 3UZYA 3EX1A 4R27A 4AISA 4C90A 3EB3A 4EE9A 4QG8A 1EX1A 4M8UA 3KBSA 5JXQA 3MV11 4FNPA 4MUPA 1WOBA 5A2CA 2VRJA 4IUOA 3OW1A 2PCEA 1WV2A 2OQHA 5CZSA 2J7FA 4C91A 3ANVA 1EPXA 1FXPA 3MUZ1 2ISVA 4DBEA 3U3HA 1L6GA 3KZPA 1P1MA 4AWSA 3ZMRA 5G1TA 3T0CA 3R25A 2F8QA 1FWFC 1KXHA 5EGRA 2PRHA 5EMYA 5AVHA 4JQ1A 4HIBA 4R33A 4S2BA 3V36A 2YCKX 4HSHA 1H7RA 4GO9A 3GFYA 4BF7A 1G4EA 1WDDA 1MQPA 4OUEA 1UWQA 2YB1A 2PDCA 3GIYA 3L21A 4XX6A 2PD9A 1EF2A 2B7OA 2QVHA 2PD5A 3PWGA 5LNWA 2I17A 4PUKA 2Z25A 1W17A 3AU6A 3QGKC 3VMPA 1QPNA 2OEJA 1VP5A 3CEUA 3PAOA 2HVOA 4GKTA 2TYSA 1O4UA 1POKA 3RRXA 1EKOA 3MZ2A 2QJIA 3E2VA 1QNVA 4W84A 3SCNA 3QV7A 2DSUA 5DELA 1E6QM 3IUIA 4D6FA 1ONXA 2FZMA 1QW8A 3DFTA 2ZUSA 1GQNA 3GXMA 4HU4A 1ZZMA 1EIXA 3CV2A 1SJBA 1V3MA 3ZVIA 1UROA 3EDKA 1OK6A 2WAGA 1JCMP 5CCZA 2IPGA 1H7NA 5K9XA 2OT1A 2DVUA 4HVXA 3M0LA 5FEXA 1UIOA 2FDMA 4K68A 4AD5A 1ZP4A 3C6CA 1YRRA 1SW3A 1OG0A 3M41A 4H8HA 3CYVA 1FP9A 2O7QA 4LT9A 1EJXC 3U6WA 4AW7A 4E8GA 2Z1BA 4PUDA 3PPGA 1DL3A 1VJSA 4Z1YA 7REQA 1E0WA 2D0FA 1EP3A 2X0YA 3OPSA 1DBTA 5BRBA 1HIZA 3WD0A 2ZUNA 4IZGA 4XVEA 3VZXA 3KTXA 4PB3A 3BLLA 2UZ9A 2BHUA 4MOZA 1O5RA 2OQYA 2PTYA 4FF7A 1HX0A 4B3ZA 2E9BA 1Z3NA 2XSAA 2E77A 4LUSB 3WDQA 2QLYA 3ARYA 1W3LA 3NL6A 1M6JA 4NZJA 4UQDA 5E6ZA 4GKLA 1IE7C 4GK8A 1US2A 2FPVA 3N4FA 8A3HA 3M46A 1AUSL 1AA1B 2FMOA 2OLSA 4QP0A 1PZ3A 2UV8G 2XWEA 4N9EA 3IAPA 3LCIA 4QS6A 1VCFA 4KWUA 5ABFA 5CPTA 4UBPC 5D38A 5FI8A 1D7KA 1NAL1 4LU0A 2QJGA 4F79A 3KCJA 1EHAA 5HPCA 5LZLA 3SI9A 3VD9A 1TZ7A 3BH4A 4DUWA 2HJPA 3U0HA 2EPNA 4RE0A 1YIXA 2AOSA 2XH2A 3C2RA 4U28A 3QTGA 2DZPA 3SR7A 4Q7IA 2ZZ4A 4DJFA 4WIWA 1TQJA 3BJFA 1B3XA 1OCNA 4ATLA 4GZ7A 2E7FA 3CIXA 1F3XA 2XFYA 4RV3A 4L9YA 3TEVA 1SVDA 1E1EA 3E0LA 4H9VA 3S6TA 4XKYA 4B5XA 2J77A 1C91A 1PHWA 3EMCA 3LG3A 4AX7A 2P3ZA 1EH9A 1ZBWA 2HVNA 3GB6A 4C6LA 1XI3A 3MSRA 3O07A 4KPLA 1G6CA 3NEVA 2DV0A 3Q45A 1VGAA 3O9NA 5BOOA 1KV5A 4ZA0A 4GYJA 4AF0A 3IK2A 3WH9A 1K7FA 2DW7A 3EWDA 4RDZA 2E25A 7XIMA 4BQ3A 4QRNA 4DI8A 3DFSA 2PDPA 1Q5MA 1AH3A 2ZUUA 5I79A 3GHUA 2QNEA 2XIMA 4HHLA 2WXDM 4C6BA 1EC8A 3E5BA 2NT1A 1OYCA 4RNJA 3AIVA 2DT2A 3WO8A 3CM4A 5TAOA 2YSWA 2VD9A 3NO5A 2J7CA 3DX5A 1K7XA 1KWKA 4IH3A 4L4MA 1SMDA 4A2SA 2QCMA 4Q8TA 1Q6LA 4UNKA 3VCNA 1GYMA 3BG3A 1LYXA 5CXPA 4D6EA 3VNZA 2EPKX 3LCGA 4J3SA 3QYSA 1GVIA 3UJEA 4RUBA 4HNCA 1TFVA 4DF1A 1ZBKA 4S3GA 3SRDA 4MSSA 3WLQA 3ZT5A 3DFPA 2OOGA 2V3EA 2HDJA 3L4XA 1XFBA 2Y70A 1GOWA 4KGLA 4WQ6A 1H51A 5I00A 2CFFA 3PSWA 5A8QA 3W2JA 1OFEA 4C6OA 2PEVA 5LIXX 2QJJA 3H2NA 3MANA 3BMVA 1O12A 4DI9A 1VIZA 1OABA 1S5VA 5BU9A 1MXDA 2G3NA 1A0CA 2DIKA 5TQLA 2JK2A 1RZMA 4Q32A 4CCCA 2GSJA 3NGFA 4ES4A 1WOAA 3E12A 4EPDC 4JCMA 3UBPC 1E3ZA 4LVGA 4HZ8A 2RDTA 3M5XA 4D8ZA 1AZ2A 2ZIDA 3DHDA 1N2VA 3CQ0A 2H8XA 4Z2GA 3LI1A 3UVIA 1KRCC 1BPLB 1M7JA 1RAKA 7REQB 2HISA 1PTAA 1HP5A 1GVSA 3B04A 1Q2SA 2Z1VA 4TV6A 3ZLGA 1QK2A 5AYYA 1E6ZA 1CNVA 3QY8A 1H11A 1XSJA 1UWTA 3R58A 3T4WA 3SW6A 2QGYA 3AZRA 1R3WA 1GEQA 1XLMA 1W3IA 4GIAA 1EUNA 2VENA 1C7TA 3LCLA 1TO3A 4LB4A 1T8QA 3CHVA 3ABSA 1FDZA 2DZVA 1V8EA 1ZUAX 5C8BB 1TB3A 2I14A 4DWSA 4F40A 3F2BA 2PRMA 1MRAA 5C9XA 3RX3A 2EQDA 4TV5A 4TQTA 3I3DA 4GJ1A 3D5HA 5ABFB 1Q45A 1UBSA 4XSMA 4D6JA 3GO2A 1QNRA 1Q6DA 4NJHA 1KRBC 5KSWA 2DZSA 4C6JA 1A47A 2FIQA 3VFCA 1EC9A 3VIFA 3GW3A 1PX4A 2XISA 4BI7A 3P5YA 3F2DA 2GQAA 4KCUA 3PANA 4NNCA 3W81A 4I5XA 3NAVA 4FXRA 2QUTA 2BHYA 3PZGA 3PAJA 3SCPA 8TIMA 2DZWA 3FYPA 2DP3A 1HVQA 2VM8A 2Q02A 4AD1A 5F2GA 1UD6A 1H1YA 1OEPA 4S23A 2PF8A 3L65A 2C0AA 1TUFA 4UB9A 2AL2A 1UWUA 4BS0A 3TXZA 3P2VA 4D71A 1U33A 4AMCA 3AS1A 1FOBA 5JH1A 2O56A 1PYFA 3UG3A 2P53A 1LQ2A 4I90A 4LAZA 4PGLA 4AF0B 3GTIA 4NG3A 3N29A 2I57A 2CWXA 1R86A 4EWND 3KDOA 1F6YA 3SZ8A 3BC9A 3CV6A 2E68A 3WLRA 4DO7A 1KR1A 1TJ1A 5M03A 1O95A 4K7YA 3R11A 4ZOCA 2V2CA 2J75A 3CZJA 2Z2BA 5HQEA 8CGTA 9XIAA 3NO1A 1OT2A 3AHYA 1WBJA 1NELA 1OVDA 2CKRA 5DXYA 4E3VA 3O63A 3TNBA 3WK3A 3L5MA 4H7CA 4IL0A 1K4GA 4LAKA 5M5DA 4WOQA 1B4KA 3TJIA 1EGVA 2INEA 1Y8BA 3K1DA 2BVYA 2FZ9A 1GZJA 1AH4A 1LP6A 1J12A 3LNMA 4H6KA 1VR6A 3LOTA 4FNSA 1TWDA 2Z7KA 4DAIA 3R79A 3WQEA 2NUWA 4Y9MA 3TKFA 1U5HA 3CUJA 3NPVA 1XIJA 4BQ2A 2ZC8A 5A6SA 2Y89A 2P1FA 4POCA 3HV9A 3AAMA 3A24A 3W7DA 5AHFA 4ZB5A 5CSRA 3PPCA 1K02A 4QE4A 1T0OA 3W2LA 1SFTA 4WVXA 1PIGA 1CGYA 3S46A 3MDUA 3SCVA 1GQIA 2XDFA 2V38A 3VOCA 1IGSA 3ZQ9A 1KCKA 4D6DA 3NPUA 1RLDA 3TOPA 3GY1A 4J3VA 2TMDA 1VFTA 1WE5A 5LXXA 5BXSA 2YL5A 3SSZA 1FBAA 4FLOA 2PDGA 2OWCA 4MJ4A 4JKMA 1W5MA 2XSBA 1FKWA 2W62A 3OZOA 3NM3A 3EAUA 5KZ6A 1W3KA 4F3HA 4G5DA 3KLKA 1OCJA 1W8SA 2BOFX 5LIKX 4GUGA 3WQCA 1L6SA 4QFUA 4R5EA 1N8FA 3IJLA 2D23A 3CGTA 2LLEA 1KBBA 4UMCA 5KZDA 5C2XA 1AW2A 3FFSA 4O4VA 1E56A 3KCLA 5HJLA 4W7UA 1XW8A 3ABRA 2BDQA 1WDRA 5XIAA 4LSBA 4WOZA 4RXGA 3S5ZA 4ADUA 2VUYA 1ME7A 3PULA 4O14A 5G1YA 3GNPA 3U9IA 2BZNA 3MWCA 3GS6A 3VM7A 3WELA 4LUIA 4MG4A 1S2VA 4A22A 3A4XA 4HHHA 4DXVA 1QAPA 4DPQA 4PMRA 1MMFA 1XSIA 4O19A 1QFEA 2VR5A 1UKPA 4M7TA 4NX5A 2D2JA 4FX6M 3EX4A 1J2BA 1UD4A 2QUUA 4DWSB 2G50A 1KQYA 4CKQA 4AD0A 1QASA 2GWGA 4JEQA 4DF2A 3BGAA 3FOKA 3G5EA 3QMSA 2VDIA 4I9TA 5ECUA 4EXQA 2F6UA 1M7OA 4REQB 1S3TC 3CV7A 1BXBA 1NJJA 3USZA 1IR2A 1E9YB 1TSIA 1QWKA 5CG0A 1Q6GA 1T99A 1H62A 3O6CA 2QF7A 3M5YA 2V5JA 4NAFA 4XD5A 4YTSA 2V0TA 4C5YA 5I2UA 3EBVA 1Y5XA 4IIGA 3WEMA 4D6CA 2WZTA 3ZT7A 1BD0A 1Z7AA 2CKSA 3OBAA 2DSKA 3BURA 2AL2B 3LCFA 3S6DA 4FIQA 1VFUA 1D3CA 2DUAA 2FTYA 2E1WA 3VKAA 3CPUA 1GWJA 2PP1A 5C54A 5FF4A 2QQ6A 1VJZA 3SCQA 1P5BA 3L66A 3PM6A 5I09A 1QOPA 5HR6A 3ITXA 1M04A 2OX4A 2E8YA 3FK4A 4I7WA 2CBIA 5LHEA 1S5WA 3WF1A 1I45A 5G2IA 1HKKA 2I9EA 3EMQA 5CZ0A 4BWLC 1XL9A 2W67A 5HINA 2PWVA 3A3HA 4K8EA 3MKVA 4WY0A 4Z0JA 3TW7A 2OR2A 3CIWA 1H61A 1UG6A 4LH8A 1A5NC 3FAWA 4JKKA 4EOUA 2Z1SA 4RX0A 2QS8A 2DQXA 3L4ZA 3K46A 2PP3A 3TAKA 3BWWA 1GOKA 3TSDA 5F7UA 1FH9A 4C65A 2X1RA 3BTNA 1YHTA 4EACA 5A8PA 2YXOA 4AYSA 4AZ5A 3BMWA 1XPGA 4LB3A 3GHTA 2ICSA 3ERPA 2PDUA 3TQVA 5AHEA 1IYXA 1J0ZA 3AI0A 1RBOB 1WBHA 4DHGA 3GG8A 3PB0A 3VD4A 3CQJA 3VAVA 4TR9A 2EPHA 3H4XA 5CJMA 2O9PA 5CPMA 1F61A 4N6EA 4IQLA 5I7GA 3S2MA 1OADA 3VNIA 5CBBA 1SFJA 4FF5A 4S1FA 1P0EA 4GINA 1G94A 2R82A 3F2CA 4H3DA 4E2VA 2X42A 1RR2A 2PDFA 2OLHA 3GNXA 3L4TA 1EHNA 3W6LA 5H6HA 5AC4A 2IKJA 2PLCA 3FXGA 1O1ZA 4PSRA 3S47A 1DIEA 3OVGA 5D04C 4MWAD 4B5NA 4HSNA 2RDWA 1MSSA 2CBVA 3PFMA 4A3HA 3ZWTA 4Q8PA 1Q7ZA 1E71M 5HMEA 2A79A 2V5LA 4LWWA 4AU0A 5EB8A 2QDGA 3LPOA 4QR6A 2R9RA 3VCCA 3GH7A 1WZKA 1QO2A 5E9AA 3UWZA 3FVMA 2W91A 5DX7A 4UNIA 4KH2A 1KQZA 1R38A 4MPQA 2VVSA 1XYMA 4W7VA 1J01A 1PIIA 3G6LA 4FOJA 1JFXA 3URAA 2JIWA 2VZSA 2HPIA 3B8TA 1F3WA 1EOKA 2E3ZA 3HN3A 6REQA 4EVZA 1JF5A 1RJRA 2VDGA 2FQIA 3MCOA 1XR2A 1NIUA 2EXOA 1DTUA 2ZXAA 4GZEA 4UUIA 3SQMA 1BG9A 3IRSA 1TPEA 1Q6RA 4CD6A 3TQPA 4N02A 5I3GA 3R0UA 3V16A 1OFQA 2R1KA 4F8XA 4GLEA 2BGQA 4GQGA 1XCFA 2NX1A 1SR0A 1JRBA 2ZC1A 1J4EA 3SRFA 3TIMA 4UR8A 3MKKA 3UT0A 4DZHA 2VC9A 4NYYA 4US5A 2E6FA 1G7VA 4NAFB 4HZ7A 3P62A 2YL8A 3OVPA 2FVKA 3W22A 1JDEA 1J79A 4A3YA 3EWZA 1KRMA 4BEUA 2CZEA 1K6WA 4AZCA 2H9AA 3QR0A 2XUCA 4KKXA 4DN1A 3EWXA 1UH3A 1VLWA 1WX0A 4PCTA 1J0IA 3GNDA 3P84A 3CUXA 1V5XA 1ADDA 1U1UA 1LL4A 3CWNA 3M16A 4ROQA 3C2OA 1EJRC 4JEJA 4JS3A 4B5WA 4AZ6A 1UWIA 2QHAA 3T08A 2ZTJA 4UFMA 3ABZA 3AS3A 3H70A 3FV9A 1ZQ5A 4WY0B 1DVJA 1FWEC 1YTEA 1OY0A 4AIEA 3WDPP 2ISFA 2QUNA 1VPQA 4DJDC 3OVRA 3OZPA 1DORA 1HXJA 3L67A 3G0SA 4QJ4B 2J4GA 2CHOA 3ITLA 4AVNA 1SSGA 3DC0A 3ITTA 1EJVC 4CVWA 2NX9A 3ITVA 3NPWA 5D2TA 3D6NA 1EA0A 2C1IA 2WQDA 3VDCA 2DIEA 5HMFA 1S39A 3LEPA 2Y62A 4S3FA 3W7CA 3UPBA 2YYTA 3UCCA 1HKWA 3AYSA 1TPDA 4A2RA 2XVKA 3AS0A 4ZOEA 5AC5A 4Q4QA 4WKHA 5FF0A 1MXGA 4D72A 5E93A 1H5VA 4A8IA 2PI6A 5EFDA 3W2KA 3CUIA 3AU2A 3PZMA 4ZSUA 1GJWA 3N18A 1L6YA 3EOUA 4QJ5B 4W89A 1VH7A 4E4FA 2WCGA 1NWUA 2ZE0A 4CVUA 9RUBA 4KWVA 3KCOA 3M4HA 4UQCA 5CSUA 1O5KA 4PL2A 2W0UA 1J2WA 2A2IA 4NVTA 3F4WA 4NYUA 3CO8A 3PBUA 3MSYA 4KW2A 4JNYA 4JQ4A 4L80A 5D37A 2O9RA 3CNYA 5IXEA 1LUCA 2ABAA 1R87A 4FX7A 1IGWA 2CYGA 4XAYA 4O10A 1UZHA 4UQBA 1JPIA 3W7EA 4DZAA 1MEIA 3MKCA 4BA0A 1ODUA 1EGMA 4GHRA 1C90A 2OLAA 1ZBCA 2Q3OA 3LHTA 3EZ4A 4M6PA 1X98A 4P8WA 4TX9A 4ALDA 2XFRA 1FWBC 2YOCA 3EXTA 3GFZA 3VDBA 1J93A 2EG7A 6REQB 5C9WA 3N2CA 1I75A 3CUHA 3NQBA 2BXZA 4K37A 1L0PA 2HE5A 4YHGA 3JS3A 2IQ0A 3C8FA 3LHUA 4RV8A 2QULA 4BF5A 5BRPA 1JYNA 1V0NA 3EB4A 1YPFA 3VGGA 3WFZA 4PC8A 5TF0A 4LGXA 5A6LA 3PR2A 5ABGA 1RPKA 1G7UA 2BY1A 3W71A 3W2NA 1Q4NX 1XYFA 4V28A 1M1BA 1TV7A 2QF8A 4R7JA 3PBWA 4O4WA 3S1GA 2QUMA 4V33A 4YTTA 3AIUA 3SY5A 3F5KA 1L2UA 5K9DA 4D9PA 4F66A 1Q8AA 3IEBA 5AZ1A 3W0KA 1XRTA 3WNPA 4JTCA 4L1XA 1N7KA 2DT3A 1G69A 2ZVRA 4AZCB 2H9AB 1NOWA 3L7RA 2BVTA 2C16A 3ITYA 4E0CA 3RU8X 1ZFJA 3MO4A 3URQA 4JIIX 2Q01A 4ACZA 1FA2A 3OGSA 3R8HA 1MNSA 3BARA 3GVRA 1GVEA 3TP4A 4OECA 4CU8A 4B92A 1SO4A 4EWJA 4ZFCA 4MFDA 1PKYA 1R85A 2UBPC 1AQFA 3TYZA 1ZY9A 1KBLA 1EUAA 3L5AA 2WNQA 3WFAA 3HGRA 1TWSA 1UWSA 4AXNA 5G2WA 3C2EA 1OD0A 1DP0A 3SSJA 1EX5A 1JI2A 4MLRA 1HL9A 1NARA 1Q3NA 3T40A 3GW0A 4JD4A 2PBOA 4AUBA 2QCLA 4XIAA 3BAIA 3HFTA 2EF9A 3S5OA 4GH3A 3BSHA 4PTNA 1H4PA 2YFOA 3M5VA 1KRAC 3OLEA 3I7QA 1UP0A 4W7WA 4LVAA 3TOYA 2Y2WA 3GHRA 3K1GA 3CL8A 1M03A 4QGCA 2ZQ0A 2V69A 2XZ7A 4EK7A 2A3CA 4O1CA 2G4FA 4O18A 5J04A 1P48A 3GIPA 4CD7A 4JTKA 5BWAA 4OBRA 4JDBA 3WJYA 1XDMA 4C6QA 3RCMA 3FKKA 3L9CA 2DH3A 4PTWA 1ZPTA 3C0LA 2O92A 5FAGA 2ZX8A 3AYTA 3R12A 3V7PA 4U5KA 4KEVA 4GCXA 1B3OA 4HA0A 5AC8A 3W1AA 3QTPA 1LL6A 3W88A 4K8GA 5C9UA 1CXEA 3DBNA 4S39A 5F4XA 1XLKA 1JCNA 3GK0A 1TJ2A 4EAYA 3FHQA 4XZWA 1W1TA 1JVNA 4LVDA 1LG2A 3NIYA 4YIWA 3RIKA 3P3BA 5IBXC 2YCEA 2YLLA 3EEZA 4L61A 3RMEA 1E73M 5I03A 3H53A 3SURA 3LQGA 1FWAC 3R94A 2GVGA 1VS1A 1KM1A 2YA1A 3MVIA 4Z1CA 5HANA 4O1BA 3E5PA 4CU6A 3S83A 1FQ0A 3QQWA 3MVTA 3WQ4A 4G1NA 1AMKA 2J7GA 2XHYA 3V3WA 3L2IA 1W31A 3WQWA 4GWEA 5D2WA 1P6WA 4OOZA 1W5QA 3D46A 4C7FA 4PTMA 5M2FX 1VFFA 3DFNA 3NEHA 2VELA 4PCSA 2TAAA 2DT1A 1MFUA 5AYIA 3A6OA 4V1XA 1G9HA 1W1ZA 3K4WA 1PAMA 1QPRA 4L6DA 4LX4A 5DMNA 4ONVA 4M6QA 4AZBA 4LNYA 2OGJA 1V6XA 4JFVA 1GW9A 3TN3A 1R3VA 3ENLA 3E0WA 4W8AA 5XIMA 4GVIA 4E4UA 4Z1BA 3K2GA 2OYLA 3H7RA 4ROPA 2VEMA 4HCLA 1KWGA 3CHDA 9CGTA 1TWWA 4PYSA 1W8GA 2XJ7A 4JTIA 5F1UA 1YDYA 2CWNA 1E0TA 2J24A 3UYIA 3WG6A 1VFLA 4GIRA 3DU0A 3GKAA 3KOXA 3FJNA 4P61A 3T7VA 1OM0A 1V93A 4MGGA 2ZX9A 3T8QA 4RK8A 2OZ3A 1V3HA 2W6RA 3AMDA 2HROA 1VF8A 4UQEA 1HGWA 1V3LA 1WAWA 2PU0A 2OTDA 4ACYA 3WMSA 3E0IA 1S2AA 2FTPA 1RCQA 4P7RA 3UY7A 2AMGA 3EA3A 4ACZB 3BLDA 1JCXA 3RXZA 3ZSTA 3ECQA 5L6UA 3WSUA 3RR1A 1KKRA 1RALA 3VPLA 2QAFA 3V0TA 4MKVA 3OLDA 1E4LA 3QLDA 4W8BA 3QPEA 3NYDA 2R24A 4O28A 1K9EA 1DHKA 1TMQA 3QPZA 5AHLA 4Q8VA 3L4UA 4L4OA 5EKYA 3CMFA 2ZVIA 4BEQA 3GX9A 3LM3A 1UYQA 1FWHC 1XLDA 1J0KA 2NV1A 4Y6GA 1H1ZA 2PURA 2G37A 3HJEA 2P3EA 4FK9A 3HV8A 4ZSTA 3GR4A 5AHIA 3DBPA 3S9ZA 3GBEA 1XINA 4FR6A 3WJZA 1E9LA 3TE9A 2F61A 4UOJA 5CLWA 2P50A 4F0LA 3LZ5A 4C6DA 3K5XA 2OEKA 4KRUA 3SY1A 2FZNA 4YWIA 3RDKA 1ONWA 3G1HA 4XAFA 3EDDA 1CX9A 1XWYA 4AEFA 4B3KA 1PKLA 4NI8A 4G2DA 3PJXA 4MHBA 4LXFA 1K6AA 3NQ2A 3DC8A 2W66A 3T0AA 1IT8A 1LG1A 3HPSA 2WMHA 3GXDA 4M1RA 4N9CA 3UU0A 4OV4A 3N6QA 2QPUA 1TVPA 5G5IA 1FWIC 1XRFA 4MYAA 3YPIA 2XGBA 4QCFA 1BEUA 4MFEA 3KBVA 2GOUA 1KCXA 3PFRA 1NQKA 4JN6A 4DRSA 3KLLA 2XZ9A 1SM9A 4GGBA 5CGMA 1RA0A 2VR4A 3QW3A 4XUGA 5K9CA 3TN5A 2E40A 1TIWA 2WZMA 3F4DA 1XC4A 3OEXA 3GFXA 4RE2A 4KBXA 3SUVA 3HQNA 3A5FA 4JN7A 3BXWA 3P93A 1NWRA 1DWAM 4H2CA 1ZP3A 1Q7MA 4BJHA 2J13A 3IIPA 4Q4RA 3CEPA 1FFQA 4OU1A 4PMZA 4MZYA 4Z0SA 2EGZA 2Y61A 4PFHA 3SCRA 1X7FA 3W1LA 4KEMA 4XK2A 1XBXA 2CPUA 4CQ9A 5DANA 4IFOA 4PMQA 3OYZA 4OBSA 3S2NA 4S2CA 3E74A 1IHIA 3TC6A 4JTUA 1HP4A 3ALFA 3P82A 1BKSA 3HG5A 3LENA 5FAJA 4PCNA 1EWDA 4BY3A 1MUWA 4J35A 3URBA 4HPHA 4JIHA 3UR2A 4M81A 5C6MA 5EMKA 3VDGA 1ZS2A 4O1FA 3NXLA 3FA5A 3THQA 1XC6A 4GZIA 1XFCA 2ZYFA 3PY2A 1C8QA 4YNGA 3IGXA 1V79A 3FKRA 3NVDA 2PWUA 4H8UA 2OYMA 1IIGA 3BOLA 5FL0A 1XICA 2CITA 1PBGA 3LYEA 1B2YA 3C61A 3P74A 3SRKA 2FFCA 4JTTA 4ASTA 2WKJA 5HK4A 3NCOA 1F9CA 2AAAA 2XVLA 1B31A 1QPOA 1EP1A 4YN5A 3S2JA 2XPKA 4X0VA 2BY2A 3H55A 3DUGA 2WLZA 4MY1A 4AIOA 3TWBA 5AKQA 2FGZA 3TC7A 3BJTA 1WPCA 1YNPA 1AL7A 4B5SA 3GVQA 2VNCA 2FGBA 3C56A 1XRVA 2I16A 1UC5A 2VOMA 2CETA 3I4EA 5FA5A 1TELA 3GIQA 3SY8A 2V6AA 2J6XA 5B7YA 4GQQA 1E1FA 4RZBA 3E1F1 1Q85A 5DCDA 3HGJA 4PEEA 4FLRA 3S2LA 3CMJA 3CT7A 4W4QA 4OV9A 2CHRA 3B3DA 4OZOA 1TPFA 2YXGA 1EJTC 1CDGA 3SCTA 2E5DA 3B8IA 2G96A 3STEA 1ITXA 5I07A 2L5HA 4S3CA 2WC4A 3GDRA 3UQNA 1VBHA 3AQUA 3ALGA 1V7AA 5EL1A 3T78A 4FI4A 3WEOA 5AC6A 2PGFA 4BZYA 2XFFA 3MC5A 3DI1A 1UW9A 4D6IA 1UOKA 3E2QA 1Q66A 5M1TA 3V5FA 2Y7FA 3AHVA 5CBIA 1K70A 4D6GA 5BXPA 2X16A 9XIMA 2NV9A 1RLCL 5IFPA 2JKEA 2NSXA 2J8GA 4H19A 1NWSA 2F7FA 3OIXA 3POCA 3ABXA 3NGJA 3T55A 5F1VA 3W7QA 3WMCA 2PDBA 3FIGA 1TTJA 2QCCA 3CAVA 3PC0A 4BCEA 3TX9A 3QKEA 3FJLA 1CYGA 4H4IA 2PF0A 1WDQA 1FUYA 5JU6A 3F4NA 1SQ7A 5I3KA 3TQ0A 1VEMA 1U1JA 4TOQA 3UPMA 1W9PA 2UY5A 3DYOA 4A05A 3VOGA 1IWPA 2YL6A 4UMBA 1HZYA 2D20A 4QDWA 2VP8A 3W2MA 1XYBA 2NWSA 3S4TA 3EWBX 4B4HA 5AY7A 2WANA 1SJCA 1RQEA 1SO3A 2NT0A 4UTWC 2GJPA 2RJHA 2Y8UA 5I6SA 3W84A 2VGGA 4JIQA 4MMWA 3UNTA 2BG5A 1TCMA 4QBXA 4I7VA 2QMKA 1RH9A 4JOMA 3QSTA 3MY9A 1GHRA 4M7SA 2WHLA 4KCWA 2Y5SA 2FH8A 2WSRA 5GNZA 4IWWA 3RILA 1AQ0A 4EXBA 2XM2A 4O11A 1R9XA 1UKQA 5M17A 1AL8A 1OZMA 2ACRA 3TCSA 1H09A 4J9JA 3G6MA 4PUMA 3CL6A 4DM1A 1PZ2A 2ZX5A 3OA3A 4US6A 2Q3RA 5JBEA 2EJAA 4ZZ9A 1J9YA 4JTQA 3DKLA 1M68A 3TR2A 3B9AA 2QYGA 3IARA 1ZJIA 1OINA 4UTUA 4K6AA 1GKQA 1YXCA 2B31A 1R3QA 2AGTA 3DKJA 4MY8A 3WQ6A 1W9UA 5L9FA 4QG9A 1OZQA 3N9SA 4IGSA 1UZDA 2GVJA 4O1DA 4FR1A 1B54A 4UR7A 1FDYA 1V6YA 4R3UA 4TIMA 5JVLA 2XN2A 2BWGA 2ZCGA 4PUNA 3A4AA 4DJDD 1GUVA 3VIJA 2F6KA 3MHFA 2QMJA 4OKDA 1A3HA 1W3NA 4CEUC 5C2CA 3DYPA 5HNTA 2QCFA 2FB3A 4L9XA 3S6OA 3UERA 4HN4A 1Z41A 4LANA 4FXJA 5AVNA 4ATDA 1FVPA 1VC4A 2DEPA 1JNDA 1XIBA 4Z2HA 3VIIA 3ZIZA 3U57A 1ZNNA 1EYWA 1F5ZA 5M3WA 5JMUA 3SADA 2QZRA 2VCCA 5EU9A 4IUGA 1SGJA 3W83A 4XSLA 1FCVA 4AEOA 3G24A 4GX9A 1PE1A 1EZ2A 3C2VA 2FKPA 1V0MA 1POJA 4X61A 4R85A 1V0KA 1G4PA 1TTQA 2BFGA 2JFEX 1XIEA 3WH8A 5HULA 4NT0A 1E6PA 3QZEA 2DPEA 4F2TA 1C92A 1YNYA 3TCEA 4TVDA 1WB0A 1EGZA 5D30A 1XCXA 4ZE4A 2OKTA 4BKNA 3E38A 3NYZA 3F7JA 4ZQRA 3WDJA 1ECQA 3U7VA 4D8AA 4CNPA 4GH1A 3WJSA 4AZ7A 2NXGA 1TV5A 4E4PA 1LORA 3M44A 1UUQA 4WGHA 4UOQA 3IGSA 5HDRA 2CU0A 1V51A 3DHPA 1NDWA 2OU4A 4A3RA 1ZGDA 3LRMA 1AW5A 2VI0A 1OJXA 3CLWA 4IP5A 1ISZA 5C70A 2ACUA 4W87A 3TLLA 2POTA 4HJFA 3UVAA 3NOYA 2G5WA 1KFJA 5AZ0A 3PP7A 3PF3A 4J3ZA 1A5CA 2Y0FA 4RCXA 1GK8A 3MUY1 5IHRA 1LJYA 1DJWA 3S2CA 4H7ZA 3WBXA 1CWYA 1F7BA 2OFJA 4MJ2A 1AVAA 2R1NA 1R7AA 2PBGA 3N34A 2A21A 1M7XA 1CXHA 2YIHA 5G1MA 1OSEA 1UH2A 8XIMA 2CBJA 4PFMA 4I9MA 4HNUA 1BF6A 4J4KA 3IS4A 2OWWA 3RGTA 2ZKMX 1D7FA 2V8ZA 4MZ1A 2BY3A 4LYRA 1EF3A 2PDXA 3PTMA 4YYCA 1P43A 4OHQA 3QZAA 5PTDA 3PS7A 4HHMA 1E3XA 2GSEA 1UMYA 3WDHA 3W7NA 3BW2A 4L9ZA 1VAHA 3T0BA 3RM4A 1AW1A 4OJYA 3B40A 3KBJA 2ALDA 4HOWA 4TTGA 4HOZA 1G4SA 5F4SA 5K7JA 1KFWA 3BK0A 3AHTA 4C6PA 3HIJA 1K1DA 4L6OA 2G8ZA 3N2BA 3WLTA 1QNQA 3A13A 1LQAA 2GK1A 1XIFA 1A80A 4LCQA 1U1HA 3RYSA 3AIBA 1E4MM 4NSBA 3L2LA 4U2YA 6XIAA 4L1WA 4LAOA 3VKJA 2CZDA 3N3TA 4MNJA 3D3FA 2PDNA 4O0ZA 1AJZA 5KEZA 4CD4A 5CZJA 2P5NA 1HUVA 4PMXA 1RJQA 3DENA 1CXFA 3R2GA 5KTLA 3AMCA 2FLIA 2WMIA 2AAMA 5DBTA 4JQAA 3W02A 4S38A 4JN8A 3VO0A 1CGTA 2CLFA 4IJRA 3NQEA 5HNNA 4LW7A 3O15A 1F4HA 3H22A 3WJXA 1AJ2A 4W8LA 3EDEA 2C6QA 2PDJA 4HU3A 1IEWA 4W86A 4QIUA 4F4RA 1KLZA 2WJZA 3AROA 1XD0A 3I4KA 5FEWA 3GVGA 1JYWA 1KV8A 1H5YA 2D2HA 3FEQA 3LLDA 5I77A 1XF0A 5E6YA 1QWGA 1DJIA 3AOFA 1OX6A 3G8EA 3AYRA 3ARRA 4G1KA 3G1DA 1QT1A 3GTFA 3WBAA 1UR9A 2X0HA 3R13A 4HKPA 4XAPA 1S5TA 4XKMA 1UD3A 3GE7A 3LTYA 2A7PA 3E9AA 3QW4B 2D2OA 3LERA 5E70A 3WLHA 5K2ZA 4H6RA 2ZFAA 3OBKA 1QHPA 1I60A 5D2VA 3GDKA 5E9XA 4S3EA 3HF3A 1CGWA 3E2SA 7TAAA 4H9TA 3EYPA 3B4YA 4JX4A 2CIPA 3BE7A 1E0XA 2V3GA 3GG1A 1CECA 2Y7EA 3EA1A 1OD8A 2PUZA 3QY6A 5B80A 4GNKB 2NXIA 2PA6A 3WMLA 5C0QA 1C8VA 2X7VA 1O60A 1TPH1 4B90A 3VUPA 2AKZA 2V5KA 5E0FA 5A6MA 4Z17A 1UIPA 4CUCA 4HT3A 1GG0A 5AYZA 3BLOA 1R30A 4QROA 1CZ1A 3NQFA 1DJYA 4M3PA 4I6VA 2YDSA 4QX4A 1VEPA 3WUEA 2PGWA 1PJ9A 4N9DA 1XLCA 5DXXA 3HPZA 3KTCA 3O0KA 4TO8A 4BFAA 4ZCWA 4M24A 3PZQA 4IPNB 1LBFA 3VCRA 5I5RA 3WK1A 4AH7A 4FA3A 2DZTA 2IPFA 3VD5A 4JR5A 1VFMA 4HMCA 3THDA 3SDOA 3WFLA 2ZDRA 1HJXA 5KITA 1XP3A 3O06A 1CXIA 2NQLA 2WVSA 2XGIA 4GC3A 1J11A 4GFIA 1E43A 3ARXA 4YHEA 2WO5A 3TR9A 4NQ1A 4DPPA 3WZ0E 1V7YA 5DCBA 1MZRA 1R8LA 1GYLA 2VEFA 1OGBA 3KX6A 3GLCA 3QBUA 2PS2A 3CAWA 4WSHA 2NLYA 2A6LA 3QYQA 1YDOA 4NJJA 4DEFA 1BQGA 4B2DD 4XZ9A 1DOSA 1P0KA 4AYGA 3HPXA 3IGUA 2PFHA 3QN3A 3BPWA 3PUEA 4N6FA 2G95A 5ECVA 4QQ3A 3PN8A 3UWQA 2I1OA 1VBGA 1HFBA 2PMQA 1JGMA 2HK0A 2O4MA 1ISXA 3LM7A 4H83A 4H9MA 1UKTA 3AXHA 4RLIA 2ZRWA 3MDWA 4IXHA 4PEKA 1W1YA 2Z2UA 2A7NA 2YA2A 3Q58A 4H41A 4GY1A 1I9CB 1PZ0A 4GQRA 4S3AA 4ILSA 1AJ0A 5LA1A 1MQQA 3B97A 2WZIA 3HMCA 2Y7DA 2YYUA 1U83A 4HU0A 3T44A 3TN4A 4G9PA 3EKLA 4GXMA 2WMIB 2PU1A 5K4XA 2E6YA 4AQLA 3UZXA 4DF0A 1TV4A 1WDPA 3BOFA 5A6KA 4LPCA 3GAYA 1JI1A 3UZWA 1Y5WA 3APGA 1WQ5A 1XGDA 4DUOA 4G7FA 2FH6A 5I3HA 1ZJBA 4I7UA 3QC0A 3V1PA 3GNOA 3CWHA 3M0MA 2IKIA 3NZPA 3VOIA 1M3UA 3F4CA 3LV5A 4UTFA 4RNHA 1T5AA 2OEMA 4AC1X 1TJ0A 4AHPA 5H8MA 3GHSA 1I2NA 4GNVA 3SQSA 4MJMA 4H6EA 3MHGA 2Y85A 2XSXA 3P14A 4BR1A 1QI4A 1WUFA 2F38A 3H2EA 3QM3A 4B15A 1XBZA 1J6OA 3ZFHA 1PDYA 3A4JA 1Z32X 2Z00A 5F2MA 3O6YX 4WF7A 1O94A 3OOQA 1YKWA 3KOYA 5CPOA 1KXVA 3WJWA 2F2KA 3GR7A 5CG7A 2VTFA 5EMJA 4NKCA 1PCKA 2FHCA 3OLGA 4GI6A 4U3CA 3CH9A 5JQ9A 3R0DA 1GOXA 2Y5EA 1BF2A 4MWAC 1JFHA 2B81A 3UY8A 4QSFA 1KM5A 1WZAA 5LXEA 2ZICA 4KFNA 4MM1A 4FMVA 4ZO9A 4C1LA 3H12A 4G8TA 4D1IA 1QI0A 1XGZA 3DH7A 4IFRA 2FGLA 1TPVA 1QHOA 1E15A 1EEXA 4TVUA 3NVTA 1UQYA 3CC1A 1LLWA 4XD4A 3HQ1A 3EWUA 2WW5A 2V63A 1W1VA 3UG4A 4WSJA 4FOKA 4WXYA 2O0TA 4O8AA 1UHVA 4HD5A 1M9HA 1LCOA 4GBDA 5JIWA 3VGFA 2PDKA 3DN5A 1AMYA 4KESA 2YDQA 4GA8A 1FWNA 3G8RA 4XG1A 4DBUA 3PZ9A 3G22A 2FZDA 4X9YA 1H7XA 3BW3A 4DNHA 1EJWC 3U2OA 4JQ3A 1UD8A 3L2MA 3JZEA 4BF9A 1CGUA 1TWZA 1B3ZA 4Q6JA 1DWFM 3WL0A 2OSWA 4LCRA 2OZ8A 3N9RA 4YVVA 1F74A 1J96A 4YTRA 3W7KA 1VYPX 4KWOA 4HQVA 5DY3A 4KRTA 2BGNE 4LBSA 4K2SA 1F6PA 2MNRA 3T6CA 2ZXDA 4YYFA 7A3HA 3CIVA 2DJXA 3H4WA 4O8RA 1R47A 1W9XA 3AISA 1Q6EA 4DELA 4QLKA 1N55A 1MEHA 4OWGA 1HO1A 3TN6A 4F0MA 1XLLA 2IMRA 2YCLA 3WLNA 1LOSA 2ZXBA 3PJUA 3GZ3A 3ELFA 3BJSA 2Z4GA 3TNOA 1Y0EA 5CAHA 1WZMA 1CGVA 3WLJA 3ES8A 1YTKA 2QCDB 3VNMA 3WF4A 4M6UA 1GGOA 4ML4A 3GH5A 1B57A 1J10A 4CN4A 2OB3A 2EO7A 4NZ4A 5FJRA 4V2XA 2X05A 4UTIA 4BWLA 1OFPA 3SGUA 2QKFA 3KL0A 3W75A 3CMGA 4G6CA 3FN9A 2V5DA 3AALA 1UZ4A 5LNUA 3DG6A 4MNKA 4NHVA 2IXVA 5A95A 1YX1A 3NSXA 3NQCA 3VC6A 1W54A 2CLOA 1XYLA 3VE7A 3CXOA 3FY1A 1GOQA 2OCZA 3TU9A 2A7RA 2QPXA 4AD4A 2VFFA 4XAZA 1K9FA 3B0VC 4BHYA 1FWDC 1KFKA 4MB5A 2C7FA 5FJJA 3H8AA 2F9RA 3EWYA 3QLLA 2QJNA 1OFAA 2GGEA 4XVDA 3HU7A 3VI2A 2FMNA 3O8AA 3R1ZA 3LGEA 1FCBA 3A4WA 1CLVA 3R4IA 1UUMA 1HTIA 1JPHA 4AHQA 2W3ZA 5AYXA 3MSGA 2GQ3A 3IK4A 1CCWB 2Z1XA 4HA4A 2VX6A 1VIWA 2VMFA 4ICNA 4O57A 3EOEA 3MUIA 3W82A 4CD8A 4LYKA 1JR1A 1FXQA 3WN6A 3T2PA 4QSHA 1XLBA 4DYJA 3CU2A 3APTA 2JALA 4M0XA 3FYOA 5FJUA 2HXTA 1KNWA 3O05A 1UASA 4TVCA 4CQCA 1IR1A 1ELSA 1GVFA 1MDLA 3A12A 3TFCA 1JYXA 2BP1A 5DF0A 2VFHA 1OX4B 4TTUA 4KS0A 1SJDA 1V03A 1C9WA 2G0WA 2JKAA 2VVNA 3CZ8A 4U33A 3UNDA 2XYLA 1HF6A 4GACA 3VOFA 3T8LA 1KB3A 4F0SA 3TLQA 2PAJA 4WDWA 4NRSA 2A1YA 2GGHA 3WENA 1JAEA 4EXAA 1K7EA 4ERIA 3AXIA 2CC0A 3ARSA 4LUJA 1H7PA 4KIEA 1VHNA 2VZVA 5BOEA 5FJIA 2PWHA 4P7QA 2VDHA 2DH2A 1UPMB 1QDSA 2VCBA 3BSMA 3CH0A 1AODA 4IQJA 5JH2A 1XKJA 5FKYA 1O7AA 4F48A 5AN7A 5LHFA 1JRCA 2V9DA 2WSPA 3KRSA 5GJMA 1PKMA 1F2JA 4K38A 1DJZA 5REQA 3WK0A 2Z7GA 2VD8A 3RNDA 3FGCA 6PTDA 1L9WA 1D2KA 4NASA 3N9KA 1B1YA 1GONA 3LBMA 4AB4A 3VILA 3VX0A 5F4WA 4U10A 1PB0A 2X2GA 1BVWA 3MUAA 5IDZA 3BGGA 2OO6A 5D8ZA 4DM2A 4LF2A 3COTA 4K36A 1W3HA 3BV4A 3NFUA 3GDMA 2YLAA 3DECA 2SFPA 3HA1A 2YCLB 2XINA 2B7QA 4RDYA 3CUZA 2VC5A 1NU5A 2OSYA 3GAKA 1KM2A 2WZEA 1ADOA 4TX8A 3VIPA 1QNOA 5A6AA 1TUXA 2Q6ZA 1JDFA 3RO8A 1TV8A 2YKKA 1JZ5A 3O1NA 4AY8A 4N2YA 3G0UA 4GCAA 3OG2A 4TX6A 4QEHA 3UPWA 5AYBA 2RAGA 2YR1A 5C71A 2Q8LA 1MEWA 3UEQA 1OX5A 1DQUA 2R1MA 3FJ6A 1CENA 4X3ZA 3H23A 5ENLA 2VCAA 1E51A 2GDUA 3CAKA 1IF2A 3ARZA 3M0VA 3ONBA 3T4CA 1SPQA 3RM8A 1EL3A 1GPFA 3BAJA 1WP6A 3IVTA 4DJDA 4PMVA 1KGWA 3VZZA 1GT8A 3TJLA 3UCDA 4R7WA 4PR4A 3OA5A 3VGDA 4TMCA 1R3TA 3A3WA 3KRUA 3B0PA 1SZFA 2WSKA 3MJYA 4IF2A 3RU6A 1I4NA 1X39A 3ANUA 3UETA 1LROA 3MQTA 1ZENA 1GG1A 3C86A 3OP2A 4RPPA 1YDNA 5HXMA 5D2YA 1A50A 1FX6A 2VFGA 1GTEA 3BANA 1S5NA 1GOMA 3IVUA 3TTSA 1XBVA 3VIGA 2NVAA 5EA9A 3GXNA 1E72M 3DFHA 1FP8A 7ODCA 2GSHA 4R88A 3P8JA 3CUGA 2XM1A 5GQBA 1JUKA 4CLMA 3ATYA 3U2ZA 2EPLX 1IT7A 2QR6A 5HWNA 1VKFA 1PCWA 1V08A 4XBKA 3FAXA 1K8YA 4WX2A 3AJ7A 1AFSA 3OZYA 3PUDA 5D33A 2V67A 3SUUA 4FP1A 4PUJA 3H26A 1UD5A 3MMTA 2EG6A 3GYEA 3HJZA 4DAFA 4FXFA 3LX9A 2VKZG 1X38A 1DIOA 1W2VA 3CAQA 2TPSA 4RZ4A 4WY0F 3GWQA 2ZA2A 3GG7A 4PBGA 2YPIA 4MB3A 3VMNA 2XH0A 4JTSA 1B3YA 1HJUA 4Z2JA 3NURA 2J7BA 1GVRA 3HTWA 1S3HA 2OPJA 4NUWA 1X97A 3KVJA 4XZNX 2ANUA 2FJKA 3LCHA 1X6NA 1B5TA 3AHXA 2XN1A 1Q7QA 3N2OA 2YCJA 3L68A 3RPDA 2XWDA 3KTSA 3W27A 3CT2A 3S3GA 1IEQA 4O13A 4AHOA 2D3NA 4Q3MA 1RP9A 1VQTA 4XKYB 3W1UA 1JZ8A 4JX6A 1OFRA 2ZUTA 4QJ3B 3IIZA 2ZWYA 2HRWA 3UXAA 2ZUVA 5H1WA 2QDDA 1OBAA 3W76A 1PS9A 1J0JA 1XLEA 4Z2IA 4MDOA 5G4EA 2E09A 2YDRA 4E5TA 1T40A 2FZ8A 3P0WA 3N4AA 4DZ5A 1K03A 1X1OA 1YE4A 5A8MA 4IL2A 5D4YA 5REQB 3VIOA 1KXTA 1JDCA 4INFA 1P1XA 2ZOXA 2HNHA 3C2YA 2VR2A 1PTDA 3TQKA 1ECEA 4FEZA 4HPNA 1BWKA 3UJFA 3RR4A 3QXBA 5A3HA 2R6OA 2GFTA 3PB2A 2EKCA 5T8GA 1UJQA 4B3LA 1UA3A 1H49A 3E49A 3HO8A 3AJXA 4UFHA 4K1GA 4BQ5A 2GVYA 4XBJA 4HCHA 1HJWA 4U5IA 2J9XA 2E1DA 1MYRA 4MY9A 1G0CA 2V81A 3F03K 4PULA 1XG3A 1KA9F 1UCWA 2ZZ2A 3N25A 4A3UA 3AXMA 1QI5A 3QMTA 3INPA 1Z48A 5BOFA 1H41A 3KL5A 1CGXA 2ZBTA 4H00A 3WEZA 1V4YA 3DXIA 4DZIA 3BG9A 1S2UA 1TMLA 1Q6CA 4ML9A 3WLPA 2J25A 1XG4A 8RUCA 4LAUA 4NJKA 1V6TA 3MMUA 1W5PA 3FA3A 3PNZA 5FF7A 4FXSA 6TIMA 3D47A 3NQ6A 3VIMA 3KOZA 3W28A 3WNOA 1W6TA 4WKFA 3UXDA 1FWTA 2GGGA 3TYEA 3VNJA 1R5YA 3PZVA 5BWFA 1PV8A 4QAWA 3W53A 1V6VA 3NDZA 4H6QA 3G1YA 4MPKA 1EDQA 4D2JA 2VJXA 1X1ZA 2OOFA 4MNMA 1PL9A 4ICCX 1FFRA 3I6RA 4HK6A 1G4TA 2OMAA 3CB8A 4XV0A 1PWMA 2PC4A 3PBMA 4IIDA 1O5QA 1XM3A 4DO4A 3AUJA 3LBCA 1ITUA 1YW1A 1OYAA 3QFWA 1X6LA 1YADA 1SUXA 1S2WA 2BGSA 3QRHA 3LPGA 5BXRA 2C14A 3DOPA 2HBXA 4HYRA 2WK2A 1GJPA 2A3AA 1F07A 4M5PA 2PE4A 4E8CA 2OGYA 3R43A 7ENLA 1QOQA 1IIHA 4IXXA 3ISIX 4O16A 1ML1A 1PO9A 1JUBA 4PMNA 2F84A 3D0CA 2QPSA 1DHPA 5KINA 1TREA 5CZKA 1MZHA 5IBXA 4DO5A 3M47A 3OODA 4AC7C 4PMYA 1L8PA 3WUGA 3HPAA 6CGTA 1EQCA 3A22A 2PRLA 2G97A 1K8XA 1C3FA 5HBFA 1VBRA 4IP7A 5EFFA 3WBWA 2PDYA 3W74A 3ZJKA 3WIJA 1K4HA 3VD3A 2QT3A 2ZXQA 2G4JA 4E2DA 3S1WA 5I02A 3KRZA 2DUZA 1UQZA 4GYFA 4IISA 3NR0A 3TVAA 1F3EA 1BAGA 3KWXA 4F2BA 4P8UA 4GUFA 2UY2A 1FCQA 3TTOA 1KFEA 1SU5A 2BVWA 2YZ5A 3M0YA 3N04A 1XIGA 4CD5A 3TA6A 1B0IA 4KEZA 2DZBA 1P4CA 2W63A 4GD0A 1AQHA 4DJEC 2BASA 1GZ1A 4HU8A 5E09A 3UA4A 3UYCA 1H50A 1OFDA 4NF7A 4JDYA 1LRNA 4GFSA 2J66A 4KERA 1CW2A 4LOCA 1C8XA 2C91A 1VYRA 5AFDA 1T8XA 1QCWA 1RY0A 1KXQA 1TV3A 2BB0A 5CPSA 3OO2A 2FFIA 1X96A 5H8UA 4GYPC 3LB0A 1EXPA 2V82A 4DYKA 4QCEA 1RBAA 4LVFA 2AQWA 1CBGA 2J9YA 4FS9A 1ISVA 3W4RA 1Q2RA 2ASHA 2GJLA 3L0GA 1HJQA 1JYVA 1OIMA 1QRQA 4GJJA 2GVLA 4V1YA 3CHFA 4Y9NA 1JF6A 4B2DA 2Q09A 4IMEA 3TZNA 1TKKA 1TPUA 5GVJA 2AL1A 2EJ1A 4YCPA 2MUCA 1EBHA 2CEQA 3SJNA 3HG3A 4HP5A 4HYWA 1US0A 3EEGA 1GEHA 1VPXA 2CLLA 5BW6A 3LV6A 4OIFA 4RKAA 3S9IA 2PWGA 5XINA 1OT1A 1XUUA 4X63A 4GG9A 1GORA 2D0HA 4M1BA 3BV7A 4K1WA 5FSEC 3JUGA 4UTMA 4R9XA 4IFKA 4RNFA 1JCYA 1GZGA 5HMSA 1GVOA 4ORMA 3W7IA 5BMWA 4D6HA 1EDGA 4IPLA 1WKFA 4X2PA 1NOFA 1OCQA 5GPRA 4DIAA 1QI2A 1PTGA 3VIKA 1TJPA 4MZ8A 1JL8A 3AMLA 2BNJA 3ZR5A 3FDKA 3GYCA 3ZJ8A 4PUWA 4I9JA 3SQLA 1VFHA 1XQKA 1FWJC 1W37A 4H7VA 4PRWA 4XISA 3LY0A 1ZSXA 3EMZA 4K7VA 1XX1A 1ICQA 4JHZA 3M7SA 1PVNA 1NOUA 2REQA 3I3BA 1IT0A 3T9PA 2VFIA 4E2OA 2H8ZA 2PB1A 2QAPA 2QXWA 3R0KA 2WKGA 1H1NA 1KW1A 2ISSA 3H54A 4GY0A 5K4ZA 4PL1A 4LTSA 1AG1O 2PDIA 4NAEA 4A8NA 1WXJA 3JU2A 3AWNA 1QI3A 1WDWA 5HQLA 4X60A 1M53A 4S3DA 3V1HA 4LYQA 5CAKA 3GQYA 3W85A 3P80A 4NZ3A 1WXYA 1D8WA 3LLFA 3KL3A 3NDYA 1XBYA 1L6FA 3KP0A 4QEEA 3ARWA 5U7SA 1SSDA 4IM4A 1M01A 3BMXA 3BW4A 2CNCA 4OUIA 2VHLA 4IPIA 1O68A 3PZTA 3JR2A 1IXNA 4X0NA 1XLIA 3O16A 1TMHA 1RPXA 2Y88A 2XH7A 4HTBA 3IUDA 3U8GA 2A0NA 4QISA 5J8LA 4RDWA 3LXAA 3KHDA 3WBYA 3VM5A 2A3BA 3S1XA 1EJ7L 2X40A 1OF6A 4UOZA 4LAMA 4UTJA 3AC0A 3PBGA 2PGRA 1BLIA 3WH7A 2H3DA 3TW9A 3A23A 1H0GA 2NQZA 3QC3A 5LNRA 3LBOA 4HA3A 3RM9A 3W38A 1JDAA 1KD0A 2V3FA 5CEWA 3EWCA 1FKXA 2NQHA 1FHVA 1QPKA 4WKAA 3GNNA 1R46A 2ESCA 4UQ9A 2CBUA 4RNIA 4KMQA 4DLMA 1BFNA 1W32A 2POZA 1EWEA 1AD4A 1TTPA 4MWAE 2IQTA 1LBMA 1YNQA 3RX4A 1BXNA 3W7MA 3TMLA 4IIHA 3KWSA 4JZ5A 2E5CA 1ADSA 3ZR6A 3O3RA 4PA8A 1A5UA 5AC7A 1FH8A 3SJ3A 3DESA 5T9CE 3QR1A 3AZTA 3FCPA 3HQPA 1TPB1 4ORIA 2NQ9A 1QO5A 3SECA 3WLIA 4UC5A 2JBMA 5EMLA 4ZB2A 2RFGA 1RQBA 3K13A 1M5WA 5KETA 3W37A 1A3WA 2XGZA 4KWSA 4QJ1A 1SZNA 1XIDA 1H0IA 1K8CA 1MW3A 1VFSA 1XH1A 4PBFA 3LTSA 1KCLA 3ES7A 4MDPA 1UH4A 3WUBA 2V5BA 2ALRA 3UCQA 4UZSA 2YB4A 1G01A 4MAZA 3B8VA 2WSQA 5HA7A 1G5AA 4NZ1A 1GPWA 5HMDA 4Y8FA 1E4NA 2BS9A 1SZGA 4F9JA 1ZB5A 3DZ1A 1Y65A 4CCEA 2YCIX 5FCZA 4QDMA 1D9EA 3B9DA 3W87A 3QHNA 3MZNA 4IFKB 2WC3A 3WLLA 2V2HA 3ARTA 3CHEA 3E96A 2EAWA 1UC4A 3HM7A 1C9DA 4H2HA 6A3HA 3QZ6A 2VEGA 3KM8A 4PMJA 3N12A 1CT5A 3KW3A 2Y6ZA 3W7OA 3KDNA 2IPWA 2FZBA 4Y8EA 3M1ZA 4B5TA 3TH6A 3CV1A 5AOUA 4O54A 4HSOA 3I10A 3QVQA 3VKDA 1C93A 2YX0A 3R8GA 5FESA 4ADSA 1GQLA 4GZJA 1A5OC 4JFWA 1AK5A 2QV5A 1P6CA 5CGTA 4WZHA 3M0KA 3OLIA 4HK5A 5JIPA 3VA8A 1Q65A 3QGAC 1Q8JA 5CC6A 3T05A 2RH9A 2REQB 1SZEA 4UIOA 5D9OA 1KM4A 4H9ZA 2I5IA 1MW0A 3M64A 2ZA1A 3TSBA 4GNJA 4J3WA 4L6HA 4KEUA 3MU7A 3ZVHA 4UZUA 3B9EA 3DERA 1S46A 3OHMB 1JG9A 1UD2A 3BQ6A 3CTLA 1SR9A 3W6YA 1V0LA 4UMAA 2IXUA 4NAEB 3A9BA 3SUTA 3XIMA 4P7NA 4IPPA 3CHCA 1QPQA 1XDJA 3WH6A 2NQ5A 1BKHA 1EBGA 3EX6A 1P7TA 1RSCA 1IZCA 5TIMA 3UGRA 2PP0A 2QVNA 4QITA 2WMKA 1MI3A 4YL2A 5I0DA 2CZVA 4HYVA 1LT8A 4FLSA 4LV4A 3LA4A 4F0RA 3T2OA 1B30A 3K8LA 2NUXA 2VL4A 3DFQA 1QOXA 3QGVA 4UCFA 4AMAA 3WKZA 1W1IE 4N0RA 4UTLA 4M51A 4W5ZA 4JPGA 2ATMA 2VGBA 4UTWA 1RQHA 3G1XA 3U5YA 2QJHA 3WLMA 4PZVA 2VC6A 4IIEA 1IZJA 3HGSA 1R3SA 3H2OA 4KFOA 3N2XA 3IJ6A 4GY7A 3W7PA 2ZZ5A 5LKYA 1HQTA 3WQVA 1B3VA 4LUYA 1JZ3A 4LBUA 2OZ0A 2PDQA 4KGJA 3M0JA 4G56A 1R2TA 3UXKA 3FLUA 1F8MA 1ZHAA 2IKHA 4HNLA 1O5XA 4MKSA 1G1YA 4L4LA 3TV8A 1E1CA 5D9MA 3THCA 1TR9A 2NW0A 3WQ8A 4PUUA 1JGIA 5KMYA 1SMAA 1HJSA 3VVGA 3W1MA 2DDXA 4IMDA 3W7LA 2BY0A 4MIMA 2OYKA 3DHFA 1QUMA 4U3AA 1WAUA 3TYUA 2W92A 5A8GA 1XRSA 2BLEA 4BK9A 3M0XA 5G4WA 4NIRA 3WNLA 1Z69A 2BSLA 3UXLA 4LS0A 3WD2A 3B9NA 3KEHA 1X1NA 3NQAA 4AVFA 1Q63A 1V6WA 3PBYA 2VRQA 3LQLA 1B9BA 3QSRA 3F4VA 2EHHA 2YGYA 3HBLA 3U2CA 3M0ZA 1HT6A 2BV9A 2J47A 1K9DA 1XLGA 2VC7A 1JZ7A 1ONEA 4LBRA 1GOOA 4DBDA 3SM0A 3NQGA 4ZEPA 3VGBA 3S1UA 4GXWA 3GXFA 1UOZA 4RXFA 1KTCA 1U5VA 1A5BA 3DG7A 4FIRA 4Y9OA 3KRBA 3C0QA 3TTEA 2RUSA 2C79A 3S8HA 1PUDA 2D2GA 4EPBC 1NDYA 2PPGA 1EFZA 2E28A 3N6JA 3P67A 5E0KA 4NJIA 1CB2A 2HTMA 4HNOA 1T41A 1OG6A 4L64A 3IANA 3B8UA 3MT1A 5ABHA 3UWWA 4R34A 3WD4A 1JXKA 2XVPA 2GOKA 3GTHA 1QHZA 1L2QA 4IGHA 1FHDA 4NP7A 2BVDA 3EKGA 3AYVA 4FPSA 2D22A 5EYWA 1A49A 4EF9A 2JF6A 4B4FA 1PSCA 3WF2A 4PB5A 3MYPA 1X8FA 3C5QA 4LQ1A 1BXCA 2JKPA 1NFBA 4HCDA 5ABEA 4HJWA 2WM1A 3UZJA 5D09A 2QCHA 2W9MA 3NQMA 3B8DA 3U7BA 2DIJA 4UR9A 4D1JA 2GL5A 4IJCA 2PCQA 3NL3A 3AIEA 3Q4DA 1E6RA 5I3DA 1ZCOA 4Q8NA 1E6SM 2GQ8A 3G1SA 4RDVA 4C6EA 3ZVHB 1LUCB 3H4GA 3RCNA 1W1B1 2XU2A 2UY3A 3RHGA 4E8DA 3MS8A 1P7TB 1RK6A 3ZZ1A 1NDVA 2RGLA 4UTKA 4RR4A 3V5CA 3CYJA 4QXIA 3VGEA 1F4AA 1JULA 4PMUA 1EEPA 3TSMA 3NSMA 3CQHA 4GUJA 4WXZA 1J0HA 3ITCA 3WLOA 4KWWA 3B8WA 4JTHA 2PZ0A 1DIKA 3PPFA 1TTIA 2HQAA 2QIIA 4NNBA 5HNUA 1Q6QA 4MKNA 4JFSA 1X8CA 3UR5A 2X1SA 3MO7A 1LWHA 4QNEA 4I9AA 2Y7GA 2CHNA 1IEVA 2DSVA 1YQ2A 2A3LA 4R9OA 1YYAA 3IV3A 3T0DA 1BTCA 5CGQA 4AY1A 3OIHA 3IPWA 2VZUA 3BGJA 4C6MA 3D3AA 2AKMA 5CPNA 3RRAA 3UR8A 2FHFA 5I3FA 1Z42A 3OQEA 3L0NA 4XD6A 3BZJA 1XCWA 1QW9A 2DORA 1P0DA 5LGXA 4REQA 1I1XA 2ZRXA 4RZ6A 3TK7A 4PMDA 1XH0A 3LZ3A 2VWTA 4K8HA 2X1IA 4XIMA 5HAOA 1QR7A 4UNLA 1ZAHA 1H3GA 2FVMA 3LPFA 1E1CB 4GE8A 3ZSSA 2DFAA 4PCFA 4KFPA 2GWNA 2A3HA 5DRIA 3H2CA 2ZUMA 3W00A 3H2AA 2P8BA 2W27A 4QG6A 3ZOAA 3VXGA 4CCZA 2J27A 1H7WA 4J1OA 3JZUA 3LCWA 1FRBA 3HG2A 3LN3A 4IQEA 3BSGA 5GNYA 4RW5A 3ORWA 3VOHA 1ZU8A 3W1XA 3KBWA 4HTYA 4E3TA 4BI6A 1Q6OA 4KIRA 5D03A 3BLFA 5E1QA 2V30A 2AGKA 2ZZ1A 3CLMA 5A6JA 1A3XA 3UESA 3ATZA 3MMDA 5EMMA 3SO7A 1KM6A 3MCNA 1YPIA 3GTXA 1LQ0A 1I6NA 1QK0A 3PVFA 1DXFA 2YXXA 3N2MA 2XFWA 4S3KA 4FX8A 3RFAA 2E9MA 1ENUA 5H91A 1H7OA 2IQDA 3KVMA 5IRPA 5DEZA 4MAVA 4R7OA 4AZGA 1N82A 4GIYA 3O0FA 3IVSA 2YZRA 4CEXC 3TTQA 1DE6A 1R2SA 2ZZ3A 2KX9A 4UTTC 4ZMGA 2E8ZA 3UFYA 2O55A 1ISWA 1FWGC 2Z29A 4GI4A 3VNKA 1KBJA 4Y9PA 1CLKA 2WPGA 2CLMA 1UR0A 2BOGX 3P61A 1C8YA 1QNSA 2VQUA 4UXDA 3LXCA 4JTJA 1O66A 5AHNA 2GJXA 5LA2A 1JPMA 3UP8A 2FDSA 2WJDA 3WQFA 3KOFA 3BLEA 4ENLA 2ZX6A 2CXEA 4JYEA 1SO6A 3I68A 1KFBA 3IWPA 3NL2A 3SB0A 2WMGA 4NZFA 2EEXA 5DY2A 2DZXA 3GNRA 4HMNA 4WSKA 3WYZA 2V68A 3V0UA 2XIJA 1FCUA 3RLVA 4OBTA 3TJXA 1YBQA 1TPWA 2KAUC 4Q8MA 2RDXA 5TBOA 1RVGA 4JHMA 4Q4KA 3KOWA 4HNVA 2IUZA 3FX4A 3DYMA 1XIHA 3QH2A 1XYZA 2A5HA 1TZ9A 3PSVA 5A8NA 3KVKA 5A6TC 3ONCA 4GUHA 1A5AA 1GCYA 3LMYA 4TUFA 4CNNA 4O53A 3A3XA 4CN1A 2WZHA 3OYXA 1YXDA 4ZO7A 2OELA 3BZGA 1Z8AA 5MHBA 3VD7A 3MMWA 1BVZA 3H6OA 4EKJA 4W85A 1Z89A 3CZKA 3VMOA 2G3FA 1NSJA 3BO9A 4AWUA 3BDKA 1C29A 3BL3A 3C2FA 3NZ1A 4DJED 3HOJA 2NVDA 1A4MA 3QHOA 4ZQPA 1QATA 5CLTA 2UWFA 1KO0A 3N11A 2J74A 2EPMX 1XHGA 4IMAA 1BWLA 2BOEX 2R14A 4RJEA 3LD5A 1WKEA 1DWIM 3GTNA 4ZXOA 4N4PA 2Q8ZA 4XWUA 5U4NA 4JTRA 3V35A 3LK6A 4YS1A 4QAIA 2Y8VA 3VKKA 1RCOB 2E4TA 5HUPA 4X22A 1U22A 4H8VA 1CXKA 4IG2A 4MVAA 1TX2A 4JYFA 4ZXLA 1FH7A 3W1NA 2ZRZA 5F2LA 2C1HA 5T91A 1ZL1A 3O6DA 2PTDA 5EMUA 3U2EA 1H63A 1CPUA 1A53A 3DGRA 4V15A 3S5YA 3C52A 2IKGA 3C0JA 2OQLA 3B0YA 5DO8A 3VOJA 3AIWA 4F2UA 3RITA 2DQWA 1IXOA 1H60A 2WBKA 5HQMA 5CQ1A 1BTMA 2DSWA 4JCLA 1GQKA 4NRRA 2PC8A 3SFKA 1W5OA 1KKOA 3WQDA 3LDVA 1NTHA 1EB3A 3P60A 4ZOAA 4GRSA 1W3JA 4HPXA 1ICPA 5A8OA 2WHMA 2C1GA 2CLEA 5A94A 1J8VA 2G41A 2HSAA 2WSYA 3A21A 3LI0A 3R10A 2DVXA 4URIA 1UR8A 3T81A 1RK5A 3R5EA 1LRTA 4WDXA 3GRIA 1EDTA 4LCSA 1ZJAA 3M0HA 3EOLA 2I5QA 3UF9A 3VTRA 1PHQA 3PTDA 4UWMA 1REQA 2DZUA 4LC6A 3HB9A 3NQVA 1OGGA 1VYSX 3TUUA 1RD6A 3BQ5A 5DRCA 3W73A 3V75A 1UWAA 2OG9A 4IIBA 3SAZA 4NXSA 1PEZA 4FSAA 1NFGA 4RW3A 3S9YA 1JUEA 3JW7A 3VX1A 1UP2A 2ADAA 1F3TA 3POHA 3GZAA 2CXGA 1R7OA 1RJPA 3K4AA 3SUSA 1EXBA 3XISA 4ZFMA 3F1QA 4PBEA 1E0UA 4Q22A 1VRXA 1FWWA 3G1FA 3NO3A 3B06A 2NWRA 4RPQA 4PCPA 2WNNA 3V5OA 4A4AA 4YJ5A 2X1TA 2VXNA 4H8NA 1W1A1 2GJXB 3K8MA 2D3LA 5FJPA 1E9ZB 3WY1A 3AO0A 2QCGA 1XPYA 4MWAA 1WKYA 1E9IA 1F76A 3B0UX 4QE1A 3UJ2A 1QTWA 5MF5A 4ZQCA 2KZHA 1I2OA 1V02E 3GR8A 3Q37A 1YPXA 4J3XA 4Q7BA 1LTDA 1YBQB 1ZAIA 2J78A 1NVMA 3P5ZA 1XD1A 3W1QA 1JZ6A 2ZX7A 3UWVA 5LIUX 3LS9A 4FNTA 3AIRA 3RPMA 1HKJA 1EJSC 4I5RA 4DNMA 3W25A 4GMEA 2J9ZA 2PLKA 5KZEA 2TODA 2FYMA 3I7SA 1MW2A 2WVVA 4B9YA 1MVYA 2HBVA 3RN6A 1XV8A 3B8SA 3NG3A 3TXVA 1HGYA 4D8LA 1E5NA 3ZLFA 1ALDA 4Y9AA 5HJXA 1TR1A 2WLYA 4BI5A 3SIMA 2ISWA 3KP1A 3ARUA 4GXPA 4NL1A 2C15A 3A5VA 2G3MA 2JEQA 1VFOA 5FIPA 1DIDA 2UY4A 2VQTA 1Y5VA 1RY8A 1ODZA 2HK1A 2WMJA 3DG3A 1TQXA 3T1GA 4DJFC 1RP8A 2VT0A 1W56A 1XLHA 3EXRA 4UFIA 1F6KA 3C4UA 4CQ8A 2OWXA 4AWEA 2CZ5A 1LZOA 4FAMA 2YFNA 3ZO9A 3G1RA 5A2BA 4JL1A 3WQPA 2GLKA 5IOBA 4EF8A 5BROA 3ARQA 2P0OA 5SWUA 3AUOA 1K8ZA 2HS8A 2B0MA 2QJMA 4IG2B 1UR3M 3V4BA 2PLMA 4PRTA 3WMBA 3LLXA 4JY9A 4A8LA 4QE5A 1KM3A 3GG0A 4M80A 5LNVA 1K3UA 3DIPA 1BHGA 5DQPA 3GU9A 5LIYX 3IIVA 5BXTA 1V6UA 4MJZA 5FEPA 2JQXA 1CLXA 3AWOA 3NOEA 1V3JA 2C0HA 4DUVA 2FHBA 2PWEA 1EO5A 3FVDA 4P7OA 3IIXA 4Y7EA 1UR1A 1XKYA 1JCJA 3UW6A 2DW6A 4C60A 3DAQA 4XQ6A 2EG8A 3REQA 4XZMX 4A8RA 4AZHA 3FSTA 1PPIA 1A5LC 5DN1A 3APYA 2NVCA 3IGHX 4IICA 4PUEA 5DMYA 1WZLA 2J6VA 4MLJA 3WDRA 2HNEA 3KS5A 3TTYA 5I3JA 1R3RA 2JF7A 3RJYA 5A6BD 1YE6A 5BZAA 2D1ZA 5C7VA 1QVBA 4J5NA 3RLUA 7PTDA 3QQ1A 2I56A 3MBFA 2H3BA 5ABTA 1O6IA 4UFKA 4ZE5A 3VNLA 4JL2A 4CGTA 2Z26A 3F5JA 4A6GA 3EKZA 2OT0A 5B7ZA 1OF8A 5D32A 1REQB 1OQFA 1UP3A 1B4EA 5GNXA 3EX3A 2VRKA 3P0XA 1THFD 2NZLA 1FDJA 2OKOA 4B91A 2ISDA 1KFCA 3W7HA 3LCXA 1N8WA 4DWDA 1J5TA 5TD4A 4MNLA 1J6PA 2GQ9A 4XZBA 1M41A 1VENA 3PPHA 4DYEA 4IMCA 1BYAA 3OU8A 1NF7A 3E0VA 1FTXA 4W9TA 4GJIA 5FEZA 4CQDA 3WQ5A 1CXLA 2WOQA 3VE9A 1XH2A 1HW6A 3R7MA 4WEVX 4E2BA 1B9ZA 1KBKA 3L4YA 4JYDA 2J62A 1IEIA 3VNDA 2J7DA 4MWAB 2Y63A 1BVNP 5A5WA 5DMLA 3WD3A 2ZRYA 3I7RA 3EOSA 2YBVA 1MNZA 2VWSA 4LRTA 3GUWA 3L4WA 4LYPA 1A0DA 1ZTVA 1WO2A 4HNTA 1GKPA 1S1RA 4Z2KA 1KM0A 4KQNA 3MP4A 1EZWA 3KXQA 2FJUB 2Z6JA 1F73A 4L7ZA 2PGEA 2ZUWA 4O15A 2F6XA 5CC3A 2ZA3A 4JTAA 2WPBA 3MJMA 2YW4A 4ZO6A 4IQDA 1JDDA 5F2IA 2Y1HA 1ITQA 4DWSC 2Z28A 3BLKA 3R6IA 1FY6A 4A21A 5DBUA 4QHRA 2W4XA 1XYCA 4KT2A 2WVVB 3QY7A 4EANA 2HEJA 4O17A 4PB4A 5BCAA 4QLLA 2YBUA 3M0IA 3WLSA 1B3WA 4C7DA 4H1ZA 3QOKA 2R94A 1VJIA 3NXFA 4W93A 1W3TA 1ICSA 2OJPA 2FVLA 4Z1AA 3B4UA 3NDOA 3GSMA 3PHAA 1HL8A 3B05A 1GW1A 3UZZA 5C5YA 4GOAA 4YU1A 4ZVJA 4MB4A 2XIIA 4K3ZA 3WQGA 2GJRA 3B0XA 5C7HA 3VIHA 2CERA 1W2PA 5I06A 4GVGA 3AXXA 4AZIA 1MW1A 2ACSA 4TMBA 4EPEC 1F8IA 5D2XA 3LU2A 2WJFA 4AXKA 4HMDA 2QDEA 1UUOA 4QNWA 4AX6A 3VUSA 1WUEA 5DMMA 3W1RA 1YXYA 1EP2A 1IZKA 4HK7A 4WHBA 2WCAA 3UD6A 3KE0A 4ZQNA 4PSPA 3UG5A 5FOOA 2TRSA 4V27A 1PKNA 3HPFA 3W7RA 1YTDA 4C5ZA 1MWOA 1RCXB 1XJBA 5JBFA 3M7WA 5LA0A 2RHGA 4FZIA 2H6RA 3DHUA 1I2RA 4JFTA 4XUYA 4MTVA 1FWCC 4A3QA 3AICA 2E6DA 3NNTA 4HPJA 1LRQA 1SW0A 3EDJA 1BG4A 4GGHA 4BQ4A 3GBDA 5IHSA 2OVLA 4KETA 3AIQA 3FYYA 1NQ6A 2CLKA 2IW0A 4Y90A 2GJNA 4J7RA 1TVLA 1Q13A 3REQB 5FL1A 1JJKA 1EOMA 1NH6A 5IFTA 3W23A 5D8WA 1OK4A 1DJHA 3U4FA 5DT7A 3W01A 4NILA 3N14A 3W1TA 6ALDA 3DCPA 3BLIA 2WBGA 4O0QA 2QCNA 3V18A 1OIFA 3GDLA 3TDFA 1GVYA 1US3A 2J7EA 4HZMA 3R8RA 1TJRA 5FJTA 3HG4A 1ISYA 1ZALA 4Q8OA 2E0PA 3RK8A 3I3EA 1OHLA 2YJQA 1DYSA 5CC7A 3W7JA 1KGXA 1YLVA 3N17A 4ADTA 1XLJA 2VOTA 4AY7A 2C19A 1LWJA 1HJVA 1KTBA 4LS1A 4JTGA 3VK5A 2P10A 5LYRA 1UWRA 1E40A 4MADA 3VINA 1RV8A 3THAA 4YMZA 4IT1A 2QIWA 2IPJA 2CCRA 2BXYA 1UA7A 3OZMA 4DBSA 1NDZA 5BNKA 2WC7A 1XSKA 2GYIA 3TZFA 3MPGA 5T9BG 3MUCA 4LF1A 1GYNA 5C9RA 3NTYA 4IPJA 1GOIA 1U5JA 4LC8A 3A64A 3GXTA 3SCSA 2ON3A 1UKOA 1FHLA 4O52A 3MA8A 1EC7A 3RO6A 3DDMA 4JHOA 1I2PA 4QDPA 2OO0A 1H2JA 3AFBA 2PDHA 4A35A 1XLFA 1GNXA 2QV4A 3PUOA 1SZRA 3AZSA 1XYAA 1JD7A 3K30A 1TWIA 1CI1A 3SN0A 4OGZA 4XB3A 2VYOA 4GI8A 4F0HA 4LALA 5BYWA 3QOMA 2X1UA 4J3TA 5EY5A 2B7NA 1V3KA 1GVQA 3W07A 3WL1A 4IGMA 3S42A 3ITOA 5CJNA 3WQOA 2QGHA 2XVNA 2YW3A 3FHAA 1JAKA 1RUSA 4C6IA 2RGMA 4Z42C 3RF9A 3TFXA 5A1AA 4NI3A 3R89A 3L4VA 1JXJA 4XZLX 1VCGA 4DLFA 2GGJA 3G77A 2E6AA 3TYAA 3NJ3A 1PX8A 4Y2WA 3SIZA 3KVLA 4I3GA 3NL5A 1ZCCA 2GK1B 4R53A 3UGVA 1VZWA 1MUCA 3SN4A 2VX7A 3SEPA 3L23A 2CLHA 3KS6A 2Y24A 2QUVA 2WHKA 2HCVA 1LM1A 4LY8A 3TA9A 1TX0A 3KHJA 1R9ZA 1J0YA 1IWBA 1V77A 4S3JA 4Z08A 1VBUA 1LOLA 1JPKA 5HUOA 4J2PA 2EBNA 3LHYA 3PJWA 3N15A 1OGSA 3QR3A 3MCMA 3TONA 4HPGA 4PE8A 3N3MA 2F2HA 2AQOA 2ZTKA 3ME3A 1KR0A 1KGUA 3ICJA 3RUBL 5D9PA 5HATA 4AAJA 1V3IA 4G7EA 2Q8XA 5I24A 2B4GA 1JCLA 3USBA 4IGNA 3M6YA 3E2RA 2W5FA 3KBNA 6ENLA 1UBPC 3HMJG 1DQWA 4JIPA 2PDMA 2AQVA 3ZYZA 2X7WA 4L65A 3LNPA 3CUFA 2TSYA 3TAOA 3ARVA 4LY4A 3BAKA 3WNKA 4GO8A 4Q4PA 3M6DA 4J28A 4NY2A 3VGHA 4KF1A 1DXIA 3GDBA 1E70M 1G67A 2WNZA 1K9TA 4Q4OA 4PTVA 3VKCA 2BODX 1W9BM 3BUVA 5CKSA 4XO7A 3H2MA 1KFLA 1AD1A 4L1GA 4TXEA 5CPLA 3O2LA 3VDHA 4JXCA 1HKIA 4LRSA 1I0BA 4K39A 5BMXA 3CQKA 4U2ZA 4C1KA 1A5MC 1E0VA 1TA3A 1ZAJA 4U31A 3NSNA 1TE1A 4DQWA 2H90A 2VURA 3MYOA 3PK7A 2RDUA 3MW7A 1VHCA 5FF2A 4DBWA 5CC5A 4XZIA 4DY1A 1BRLA 2ZWZA 1RVKA 1UPPA 1R3YA 4PMOA 1NF0A 1JQVA 5HNRA 5A2AA 3NZGA 2ABBA 1E55A 3U48A 3EX2A 1YEYA 3PZIA 4E6MA 4CQBA 1GTHA 1E6NA 4IHCA 3LMZA 4CU7A 4ZODA 1DXEA 5FJOA 2WVUA 2G3JA 2MANA 1QJWA 2DGAA 4J3UA 2VUNA 4HBKA 5TNVA 3SRHA 2ONEA 2NQJA 3OHIA 4FALA 3MI3A 2VX4A 4O1AA 1OC5A 3IJ7A 3PWIA 4IIFA 1TPC1 4ZOBA 1M7PA 1W9DM 3MB9A 1EO7A 5BRQA 4EX4A 3SN1A 3I6EA 1S2CA 5H8PA 3U4AA 2INZA 3GXPA 2XIBA 1BWVA 1VPYA 4W5UA 4QM1A 3L12A 1YMYA 2I5GA 1HL2A 2PODA 3E02A 4IP4A 3WH5A 1E6XM 2W79A 4DJEA 1IWAA 3LRKA 3OB8A 5J5DA 1I1WA 1GQJA 1UMLA 3BLPX 7TIMA 1OFBA 3CASA 3NQ7A 3QQ0A 4C6KA 2Y4SA 5JUVA 4JIEA 3ABOA 1ME8A 3PZOA 3ZXWA 1LT7A 4ZTXA 4ERGA 2VFDA 1D3HA 1KCZA 4GYPA 4AEEA 5HWMA 4U4MA 3N73A 4GUIA 4Z2LA 2XN0A 1IEXA 1TCDA 4LJ3A 4H9XA 3LRLA 4I5UA 3GKFA 3RLGA 3PTKA 3RAOA 3K4DA 1OC7A 4RE4A 2XG9A 1PX3A 1K77A 2V3DA 4ZGYA 1HG3A 3QMRA 4O50A 3IV8A 2GUUA 3ITGA 1D8CA 2FB2A 1U30A 2X2YA 3WCZA 3CTTA 3GC2A 2BHZA 3SCUA 3WD1A 1L6WA 2JGQA 4WD0A 3C0SA 1ONRA 1V02A 4WDUA 4JAWA 4ZBCA 3PTQA 1AZ1A 2WQPA 1ZLPA 2ZDSA 4CQAA 4G7EB 2Y8KA 1XDLA 2GDQA 5G4HC 4Q4MA 4FNUA 3M9YA 1OYBA 2OODA 4ERAA 2GUYA 1O1HA 1NY1A 4S3BA 4N42A 4KCVA 1TRIA 3EA2A 3WF3A 4Q4SA 3MSDA 1FHUA 3N1AA 3TYBA 1IXQA 3E6EA 1JZ2A 1KC7A 1S1PA 4WJEA 3NM1A 4KRZA 1HVXA 2X30A 1NEYA 4AWTA 1W1PA 1WDSA 2OXNA 4AD2A 2HWGA 1DV7A 4WUIA 3E0FA 1U2YA 4P2VA 1BYCA 3N6HA 1XISA 3JVAA 3RPTA 2P8CA 4OT7A 4HNNA 5EBAA 2HZGA 4IOTA 4I8DA 1R2RA 1BSLA 3LSBA 1DJGA 2O7SA 4OE7A 1Q6FA 4JTDA 3ZR4A 2BX7A 3Q65A 1MFVA 1A4LA 1RHCA 3MWAA 4IMFA 5CSSA 3EPNA 3OJGA 5CSYA 2ODOA 4C1NA 1MUMA 4HB7A 4P5UA 3H2FA 1TA3B 2YA0A 3W7GA 2VFEA 2D69A 1ZRQA 4NNAA 4CCDA 1WXZA 3OVQA 4C6CA 3EB2A 1X6UA 1NFPA 5GJPA 1FWSA 3DEQA 5AHMA 3PBVA 4XTDA 1X7IA 2WKLA 1LBLA 3L0KA 2VGFA 1P0NA 1A5KC 1BRLB 1S2TA 4ZTYA 1B90A 4UQAA 2CZFA 3IIOA 3LGGA 1R6WA 1W9VA 4CNUA 1BGAA 3J7HA 2E9LA 3UWUA 1XIMA 4FO4A 4JFUA 4B5UA 1TZZA 1WNOA 2DY3A 3RCYA 1DKWA 2O4QA 1R9YA 4FNRA 1EPVA 1VB9A 3QV8A 2YBTA 2PZNA 4Q6XA 4DJFD 4O12A 4JTFA 3PJTA 4DUXA 3FSUA 1VLIA 1WA3A 4B16A 4AD3A 3TWAA 3N19B 7CGTA 4YWSA 3FW6A 2GPTA 3C8NA 3NPXA 3P81A 5GJNA 3K8KA 1DWHM 2R91A 2ZE3A 2C3ZA 1QBBA 2EKGA 3M07A 3TYDA 4NU7A 4DXXA 2R8WA 4CNTA 2JE8A 4E38A 1UB3A 2V5CA 1QU4A 3GM8A 1TRDA 1WCGA 4IX0A 1MQRA 4J2MA 3UA3A 1EJUC 2CW6A 1LF1A 1EA9C 3DFYA 2J8TA 3CBWA 4L56A 3Q2DA 3WDIA 1W0MA 1XS2A 4P8VA 3GVVA 4JBRA 5HR7A 1XXXA 3HURA 3XINA 4GQBA 3U5UA 2OZTA 3STCA 1A5SA 4YVPA 2YL9A 3QPYA 3MI2A 3CL7A 3CK5A 5MKGA 4ZR8A 1IXPA 4JTEA 4LEQA 4NX0A 4MYXA 1MXSA 4OVXA 5LSMA 3S5NA