2J66A

Structural characterisation of btrk decarboxylase from butirosin biosynthesis
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
414
structure length
390
Chain Sequence
b'DQAEITALTKRFETPFYLYDGDFIEAHYRQLRSRTNPAIQFYLSLKANNNIHLAKLFRQWGLGVEVASAGELALARHAGFSAENIIFSGPGKKRSELEIAVQSGIYCIIAESVEELFYIEELAEKENKTARVAIRINPDKSFTAIKMGGVPRQFGMDESMLDAVMDAVRSLQFTKFIGIHVYTGTQNLNTDSIIESMKYTVDLGRNIYERYGIVCECINLGGGFGVPYFEKALDIGKITRTVSDYVQEARDTRFPQTTFIIESGRYLLAQAAVYVTEVLYRKASKGEVFVIVDGGMHHHAASPMEYIPLEKVTIAGPLCTPEDCLGKDVHVPALYPGDLVCVLNSGAYGLSFSPVHFLGHPTPIEILKRNGSYELIRRKGTADDIVATQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BTRK
publication title Structural Characterisation of Btrk Decarboxylase from Bacillus Circulans Butirosin Biosynthesis
rcsb
source organism Bacillus circulans
molecule tags Lyase
total genus 128
structure length 390
sequence length 414
ec nomenclature ec 4.1.1.95: L-glutamyl-[BtrI acyl-carrier protein] decarboxylase.
pdb deposition date 2006-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00278 Orn_DAP_Arg_deC Pyridoxal-dependent decarboxylase, C-terminal sheet domain
A PF02784 Orn_Arg_deC_N Pyridoxal-dependent decarboxylase, pyridoxal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.10 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 2j66A01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 2j66A02
1L6GA 3MT1A 2RJGA 1B54A 1QU4A 1HKVA 3E6EA 3HURA 4ZGYA 1CT5A 2SFPA 3E5PA 3S46A 1XQLA 2RJHA 4BEQA 5GJNA 5FAJA 2P3EA 2J66A 3HA1A 3OO2A 4PB4A 3SY1A 1RCQA 1KO0A 2VD8A 1NJJA 3C5QA 1VFHA 3NZPA 3R79A 4XBJA 4BHYA 2PLJA 1VFTA 3N2BA 5FACA 4QHRA 2VD9A 2DY3A 2QGHA 3B8UA 3WQFA 3KW3A 4LUTB 4LUSA 5GJMA 1SZRA 1KNWA 4V15A 1XFCA 1EPVA 2YXXA 3CPGA 5GJPA 4KBXA 3WQDA 4BF5A 3ANUA 3WQGA 4ECLA 1VFSA 3CO8A 5IRPA 1TWIA 2ON3A 4BEUA 4XG1A 4PB5A 2NV9A 1NIUA 4A3QA 5FAGA 3N29A 3B8VA 1L6FA 1SFTA 2ODOA 7ODCA 3GWQA 1F3TA 3B8WA 2TODA 3VABA 1D7KA 1TUFA 4AIBA 1HKWA 4DZAA 5BWAA 3AWOA 3UW6A 4LUSB 3B8TA 4PB3A 2NVAA 4Y2WA 3LLXA 1FTXA 2PLKA 4WR3A 1XQKA 4DYJA 1W8GA 4FS9A 3BTNA 3WQEA 4LUYA 3AWNA 3N2OA 3WQCA 2OO0A 4ILSA 3NZQA 4LUTA 3ANVA 1BD0A 2O0TA
chains in the Genus database with same CATH superfamily
3QR1A 5C6MA 4FO4A 3W2MA 1G67A 4F0HA 3GXMA 5FJOA 4K8GA 3I7QA 5I3FA 2QCEA 3W1NA 3TP4A 4S1FA 5D9OA 3WY1A 4KRTA 1IEQA 2X16A 3LM7A 2WMIA 2Z2BA 3SIMA 5JBFA 5A2AA 1X6UA 3DH7A 5JXQA 1U1HA 3VNLA 3J7HA 3ARUA 1LRNA 1GWJA 3FSTA 1TRDA 1OF8A 4H9UA 4IGMA 4LUSA 1U22A 5TF0A 3VIIA 3TCSA 2V69A 3C2VA 4E8DA 1W32A 4IMAA 1SVDA 2VFGA 2PDFA 2VMFA 4XSMA 3PFMA 1RK6A 2W3ZA 2Y5EA 4UQAA 1G6CA 3M5VA 1ZQ5A 1E6ZA 3UZJA 4R9XA 3R0DA 5E93A 3SCOA 4QISA 5DN1A 1XBZA 3M5XA 1FY6A 4NILA 4HMCA 4GRSA 5CXPA 1CLVA 4OE7A 3RX4A 2VWTA 4FEZA 5CPTA 3WH9A 1OX4B 3SI9A 3I68A 3K4DA 3HV8A 3BANA 3I3BA 1OIFA 4HSHA 2OWXA 1BRLA 1DQUA 1QNQA 4AZCB 3K46A 1DOSA 1ZAHA 2X2GA 4NG3A 3THAA 4TVDA 2OJPA 1MW0A 3FFSA 5DCBA 4MGGA 3B0VC 1CB2A 1KB3A 4N6EA 3JRKA 3ATYA 1GVSA 3DC8A 4LNCA 3U6WA 4L1WA 2G8ZA 3ZR4A 3SY8A 2V0TA 2D2GA 4XUGA 4WIWA 3ARPA 2PTWA 3WUBA 1C8QA 2Z26A 1GONA 2YYUA 3KRSA 1QR7A 2YKKA 1W2PA 3MI6A 1WOBA 1DWAM 3T9PA 1PYMA 4DN1A 4B3LA 1FCVA 3CL7A 3W4RA 1H51A 2NX9A 4ERAA 3DXIA 2VEMA 4LS2A 3HF3A 5DXYA 5FF0A 1UOKA 3B0PA 4QJ3B 3OZOA 1NOUA 3EBVA 3PJXA 1P7TA 2D2OA 1E1CB 3EKGA 4WSKA 3Q65A 1PEZA 4ENLA 1P6WA 3WSUA 2IPWA 2P3ZA 1SJDA 3TH6A 2P50A 2A21A 3BMXA 1BLIA 3TR2A 2ESCA 3O6DA 4C6PA 3TMLA 2IMRA 1J0KA 3DN5A 3LBOA 4MYAA 4CQ9A 2XGBA 2QW5A 3VUPA 2VOTA 5C9RA 5HA7A 3TQVA 1EJVC 3W7OA 4K38A 5G2IA 2A7RA 2ZDRA 3M0LA 4P61A 1QXLA 2RJGA 3LG3A 1W6TA 2JEQA 4JNZA 5A6TC 3GR8A 3FN9A 2AL1A 2QJGA 1H49A 1PZ2A 1TV8A 4AZ6A 4ALDA 3PTKA 5DRIA 2C71A 1I1WA 4D2JA 4AWUA 1ODZA 2EG7A 1BG4A 5CJNA 3HO8A 4HT3A 2ZX9A 2ZC8A 1WPCA 3BURA 3PG9A 5ABEA 1G4EA 3WJXA 4PTVA 4JD4A 1R2RA 2WMKA 3RU8X 3R6IA 1QBBA 1ZFJA 1UH2A 4MWAA 3ZJKA 5K9DA 1AL7A 3OHIA 1R3YA 5FSEC 1FWSA 4F0KA 2OSXA 1KM1A 3AICA 3TXZA 5DANA 2F8QA 4HPXA 3CO4A 4OZOA 4FAMA 3N6JA 1JEZA 3GXDA 3IEBA 1VC4A 3W7GA 1MW1A 1RXOB 3SCVA 1BHGA 1G94A 3F1QA 3AYTA 3AZSA 4JCMA 3MV11 2VXNA 4UTIA 1DBTA 4QTGA 4XQ6A 5MHBA 4ZXOA 6REQB 1TCDA 1W1IE 3WQCA 4KRZA 3RITA 5IDIA 4EPEC 3A12A 1ONEA 3N1AA 3D6NA 4V27A 1KC7A 1FDJA 4P7OA 3T0AA 4IJRA 3NQEA 4GACA 3AZRA 2VR4A 3PUOA 1V0LA 2OCZA 2OGYA 1SYTA 4I5XA 1UKTA 4WDTA 2RDUA 4AUBA 3G0SA 3KCJA 4IH3A 4FIRA 1TWSA 1GOMA 1LQ0A 2ZFAA 2ZZ7A 1YE4A 1F73A 1SO3A 3NO3A 3VX0A 3PSVA 4QHRA 3ITOA 3RRAA 1UZ4A 4NXKA 3P60A 4LW7A 4LB4A 3WLIA 2VC9A 3LNPA 3QHMA 1VFSA 3WF0A 5D03A 1VBUA 4FIQA 2CZVA 1A5LC 1PS9A 2ZRWA 3MSRA 4A8IA 3VTRA 4ZSTA 2HEJA 4TMCA 2EG8A 1J18A 3ARSA 3SW6A 1U30A 3GWQA 3A3XA 1VS1A 3AFBA 2TMDA 3LOTA 4QCFA 4D8AA 1FFQA 1QPRA 3BAYA 2FB2A 3UY7A 1GQJA 3MW7A 4W9TA 2F7FA 3TTOA 3T2PA 2VGIA 1AMYA 2VZTA 2CHRA 3W02A 2OO0A 2YBTA 3U5YA 3BLIA 2QPSA 2WHJA 5EBAA 4CQAA 1BWVA 2ZC1A 3MT1A 1UJQA 3MU7A 2WHKA 1YXYA 4JTQA 4PYSA 2X0HA 3PM6A 1EH9A 3UCDA 2FFCA 1EP1A 4AISA 5CZ0A 3KBJA 3NQAA 3GY1A 4KWOA 4JOMA 2ZWYA 3P0WA 4LANA 3P84A 4JKLA 4LSBA 3NL6A 5DELA 3TIMA 4JYEA 4NAFB 3U9IA 1NELA 1PWMA 3PSWA 3E0LA 2DUXA 3L0KA 4TOQA 1P0DA 2FFIA 1US0A 4J2PA 3VCRA 3K4WA 3NM1A 1O66A 2FH6A 4AY8A 3ITVA 1TV3A 2VR5A 3KCOA 4IOTA 3CQJA 1CGYA 3CUZA 4KH2A 4KT2A 2QCDA 6TAAA 2ZIDA 1ADOA 3AHZA 3FCPA 3SCQA 3GIPA 4KMQA 3IWPA 3BWWA 4MDOA 3M6YA 4RDVA 1G69A 2XM1A 4C7FA 5EFFA 3TYCA 4DLFA 3Q37A 3FJLA 2JIWA 3WBAA 5HBFA 3D5HA 1AZ1A 2QF7A 2B4GA 1Y8BA 1GZGA 1TMQA 1KD0A 2OYLA 5D9MA 2IPGA 1HO4A 3CIWA 2AQWA 3VMNA 2EAWA 4TTGA 4GC3A 4MF4A 4J5NA 4TTUA 1WCGA 1L6GA 4GZEA 4UFHA 1CI1A 1H1ZA 2JQXA 1DEDA 3BV4A 3UFYA 3KTCA 3LMZA 1LCOA 3W2KA 2PDCA 4DWSB 1XGEA 3ABSA 3LSCA 2Y7EA 1IZCA 5IFTA 1FWTA 1WKDA 4W7UA 3E38A 4TIMA 1R3SA 4HU4A 3MA8A 2XDFA 3W7JA 3WH6A 1GKPA 3GDKA 4ZTYA 2HMCA 3FDKA 1QNRA 1TR9A 4E6MA 2NWRA 3QH2A 4H8HA 2VFDA 3C2FA 1JFXA 2GWGA 1YNPA 4L56A 4AF0A 4BI5A 5FJUA 4EXAA 4MY9A 3L2LA 1VBRA 4PMJA 3TJ4A 4PE8A 1J12A 2OR2A 3VKBA 4A21A 3EWBX 3W53A 3GB6A 1XRSA 1P43A 2YDSA 4NL1A 3NNTA 4FHAA 5DT5A 3ARQA 1OFBA 1GUVA 1LROA 2IUZA 4BI6A 4C90A 4HOZA 5GPRA 5U7SA 3NQVA 2WHLA 4RJEA 4Q7IA 1DWGM 3PHAA 5BXPA 2CC0A 3THDA 1RY8A 3STPA 4NJKA 1K4HA 3K5XA 1VBJA 1NDYA 5HOSA 1K8YA 2E3ZA 5TAOA 2QYGA 3UESA 1ZRQA 4JQ2A 3TAKA 4A22A 3EMCA 3DFHA 1NOWA 1IT8A 1JAEA 3HTWA 4MJ4A 1DE6A 1S5TA 4UMCA 2FDMA 3B8IA 4U3AA 4EKJA 1XYMA 3HBLA 4LQ1A 4QG9A 1K8CA 1MMFA 4H00A 4YJ5A 1KXVA 4DX3A 2OKTA 2XFYA 5AECA 8XIMA 1EOMA 3SJ3A 3BZGA 2FMNA 2AL2B 2WZMA 2WLZA 1XW8A 5HXMA 3RO6A 2Z1VA 1M5WA 1FWFC 3N13A 3WH7A 2MNRA 2BHYA 1C8XA 2EO7A 4GI6A 1F3WA 3GBEA 3WBEA 3MMDA 2ZVIA 3RJYA 3S2LA 3UJSA 1G5AA 1GVRA 2CKSA 2PLKA 1HJSA 3ZWTA 3LQGA 4PUEA 3AXXA 5IHRA 1FWIC 3G22A 4HN4A 3KCLA 1F6KA 1PKNA 5TBOA 4FF7A 4G8TA 4RLIA 4MUPA 1OX4A 4Q6JA 1W5OA 1KFWA 5LYRA 1QO5A 2Y8UA 1AG1O 1BVZA 3SCUA 3FYOA 4KESA 3W7DA 5CC6A 3EDEA 2VURA 4JX5A 1VBGA 1HO1A 4GX8A 5F4XA 3GHUA 1OK4A 2XIJA 2HPIA 1VJIA 3CGTA 1E1FA 2NV2A 4Q8NA 3LK6A 3NPUA 1HG3A 1KBJA 2QUUA 2Z2UA 4JTDA 3N6HA 3NOEA 5CBJA 1B4EA 3ITYA 3DHPA 3RLHA 3VA8A 1C92A 2FZ8A 1YW1A 3GG0A 2O9OA 1NF7A 4L9ZA 2B81A 1XYLA 1TV5A 1CXEA 1MQQA 3F4WA 3E02A 3UNTA 1KTBA 4FXSA 1R6WA 5H1WA 3IGUA 4OIFA 2ZUWA 1FBAA 3AXIA 1PZ3A 3F03K 4NSBA 3HMJG 1MRAA 3S5SA 3ARRA 2J6VA 4HNLA 3OVRA 3EA3A 3REQA 2F38A 3BICA 4QE1A 5K4ZA 3JS3A 4JIHA 3V5OA 5KSWA 2VWSA 3ITXA 3S83A 4EACA 2CZDA 3V4BA 3ZM8A 2FYMA 4HK7A 1ZCCA 3WO8A 2EF9A 2A6NA 1B9BA 4ZO7A 5GNZA 1KBKA 2G41A 4IGNA 4CQ8A 1JAKA 1EHNA 3KRBA 3RCNA 4D6GA 1U83A 3BJTA 3E2SA 1MRQA 1XIIA 3F4NA 3F2DA 1GW1A 3KVKA 2X2YA 1JQXA 5HATA 4IFKB 3EMZA 4A05A 4E2OA 2ZICA 4GJ1A 3FY1A 2EPLX 3NDYA 3G2GA 3W1RA 3CO8A 1EC7A 2E1DA 3E2VA 1TWIA 5HQEA 2DUZA 4H2CA 2PF0A 4ACYA 3OGVA 1J9YA 2ZA1A 2CU0A 2PPGA 1WDPA 2CZEA 4GQRA 1XLKA 2Y8KA 3HFTA 3UVAA 3M0KA 3I10A 3U4AA 1MO0A 3LI0A 4X3ZA 3WJYA 3OB8A 3TYDA 1IEXA 2YA1A 2NLIA 3AUJA 4O1CA 4AYGA 3B9AA 3SCRA 2OB3A 4B5XA 4IJBA 9CGTA 1JD7A 1RK5A 3BW2A 1Z6KA 3P6LA 3WJSA 4UTMA 4K8HA 1GQNA 3CV7A 5BCAA 2DIKA 3E0IA 3EPOA 4ZMGA 2REQB 4H7ZA 1TR1A 2YJQA 3WNNA 3EWCA 3SCNA 4IPJA 3KZPA 3ISIX 3P14A 4LC8A 3OQ8A 2I5IA 3VINA 2GQ9A 2D0GA 4LYRA 2GUUA 1FWAC 1XM3A 6REQA 2ATMA 1W1ZA 4G2DA 4BS0A 1Q6GA 3W25A 1C91A 3C0LA 2DGAA 2CZFA 1SSDA 4ZOBA 5JUVA 4AY7A 1RUSA 1I4NA 5CSSA 4Z17A 4AIOA 3NO1A 3G77A 1EX5A 4H9VA 3UR7A 2ZRYA 3C8NA 1OFQA 4RZ4A 5CPOA 5AC5A 1TB3A 1UC5A 2GGJA 5C9ZA 4LAOA 1EBHA 2J88A 1W3NA 1NEYA 5AHLA 3NSXA 4O18A 1IIGA 2QDDA 2HV5A 5D9NA 1DXFA 3CUIA 1ISVA 4NAEA 1XUZA 4ICCX 3HG4A 4CNOA 3RXZA 4CNUA 3SCSA 3W1XA 2AGKA 1UWIA 2JE8A 3T8QA 3PJTA 1B9ZA 3W00A 3KWXA 4I7WA 3KHDA 3U2CA 4L4LA 2W67A 3DEQA 1AZ2A 1GCYA 5LA0A 4YMZA 2UY5A 4PN2A 3GVVA 1S38A 5EMUA 2OELA 4Z2JA 3AQUA 3DBNA 4AZHA 3R4IA 1X98A 4U5IA 3BG9A 2OOGA 4TO8A 1UD4A 3GH4A 3SJNA 3AIQA 1U5VA 4OJYA 5A6BD 4FX6M 1WE5A 3VGHA 1M41A 2NLYA 2BVTA 1Q6CA 2E5CA 5G1MA 3CLWA 2PP3A 2VGFA 4PUUA 3ZT5A 3T4WA 1W9PA 2HXTA 2GSEA 3WZ0E 4KGJA 3PZVA 3TROA 4D1JA 4PRTA 1OB0A 5AVNA 2H90A 1FWBC 1FUYA 1IZJA 2QCMA 1E6RA 2Y5SA 3ANUA 4U10A 2XSAA 3WEMA 2DPEA 4P7LA 4OQVA 1KFKA 4IWWA 3RLGA 1K7XA 2FTWA 4WKAA 4Z2HA 2A3CA 3UWVA 4G9PA 3WX7A 3VD3A 3U57A 2YDAA 4NZ1A 1J4EA 3BMWA 1LWHA 2ZUUA 5LIUX 2BXZA 2GPTA 4AIUA 2JIEA 5A6BA 1RSCA 4NASA 1E0TA 1FXPA 3PBVA 3RPDA 1PVNA 1XV8A 3UJEA 3GTXA 2I9UA 2Z6JA 4JTLA 2WSPA 1XIMA 4AVOA 4CQBA 1YKWA 3KS5A 4AZ5A 1OT1A 4UTWC 3UWEA 2R14A 1GJPA 1HKIA 1T8XA 5DCEA 2E40A 3AISA 2Z1SA 3FAWA 1YMYA 5F2LA 3W29A 2XH7A 3SY1A 3GRIA 1TSIA 2QCLA 2GGIA 4DO6A 2ACQA 2WSQA 3MKVA 1MYRA 3MCNA 4J27A 3AZTA 3S1WA 3BL3A 5E0CA 1TPH1 2BB0A 1CGUA 2G97A 4LWWA 3SM0A 3OA5A 2NX1A 2XIBA 3IVTA 3G1SA 1A0EA 3CHCA 4R85A 3P62A 1SU5A 3L4XA 1TJ0A 3IV3A 1AA1B 1KV8A 4D6CA 3BLEA 3W70A 3EXRA 1Z42A 1QFEA 2R94A 4RDWA 4DVOA 3DFTA 1TCMA 3W76A 3KHJA 5BU6A 5A8MA 1WKYA 3G1YA 1BVWA 2QUNA 1DWIM 7REQA 1D7KA 1UWQA 3H2EA 3RR1A 3DFOA 3A4XA 4KCWA 1PCWA 4JDBA 3Q58A 2F9RA 3BGJA 3MWAA 3MY9A 2O7QA 3L21A 2FGBA 2FJKA 3AYVA 3AHYA 4JFWA 4XBSA 1EOKA 3IRSA 1TJRA 3EOUA 3QY7A 5PTDA 1TZ7A 3D47A 3NZQA 2WK2A 2QV5A 1UQYA 3M16A 3OIXA 2OWCA 2XVLA 4YTQA 4ZFMA 3H55A 2CLEA 3U4FA 4WUIA 4GYPA 1BQGA 3VCCA 4WJ8A 1IWAA 5FJPA 1JPIA 2E6FA 3QKEA 3APGA 5G5IA 4H8NA 4EVZA 4KWWA 3BDKA 4H1ZA 1ZB5A 4Q4RA 3UPMA 1A5KC 1PXGA 1H63A 2PC8A 5AYYA 4O13A 3THQA 1GKQA 3TTQA 4KKXA 3VPLA 1HJUA 5HQLA 4CNPA 3ME3A 4ECLA 2D24A 5EMJA 1WDRA 2OEJA 3P0XA 2VDHA 2ZCGA 4GE8A 3VNZA 4HIBA 4IPPA 1D2KA 1UB3A 1IE7C 4U31A 1XIGA 3HQNA 2HQAA 1CB7B 1KFEA 4MB3A 3SAZA 4LUJA 3UZ5A 1J11A 2VYOA 1QJWA 1C7SA 1J0ZA 4MIMA 1R85A 3TCEA 3GSMA 5IDZA 3OW1A 3M7WA 4QDPA 2D0FA 2Q71A 5XINA 5JQ9A 4IMEA 5ECVA 2QCGA 5EL1A 1DJZA 3MBFA 1TPFA 2B31A 1KFJA 1QI2A 4XZHA 1YEYA 1QW9A 3K30A 3MKKA 2Y89A 3KX6A 3MB9A 3T55A 5ABGA 3OBEA 4R9OA 3TJXA 4RNHA 1VFLA 1HTIA 1P6BA 3AHTA 1QAPA 2WVSA 1OD8A 1MQRA 3EGJA 3PR2A 3M0MA 4XAZA 3A3WA 4WGHA 5CSYA 4V1YA 4EE9A 1ADDA 4L6DA 3CZEA 3TFXA 5HUPA 5SWUA 4S3DA 1AH0A 1V77A 2PLCA 1BWKA 1VEOA 3RHGA 4B3ZA 1ZAJA 4E2VA 1UIPA 3N6QA 1PZ0A 4UFJA 2ADAA 3QM3A 2QAFA 3L4TA 3LBMA 2NWSA 3JR2A 1H7WA 2PDPA 3WLMA 1KBBA 3EWYA 6ENLA 3EX2A 1HQTA 1UR8A 3RR4A 1KR1A 4JNMA 4XG1A 4CEUC 1UUMA 1MEWA 4AFYA 1CBGA 2WPGA 3C86A 1H7PA 4B9ZA 3QTPA 5C9UA 3W7PA 2WXDM 1F76A 4CU8A 2TODA 4BQ5A 5BMWA 4GBUA 2G50A 2EPOA 4DWSC 3CASA 3U2EA 3IRDA 1BKSA 4YLWA 3VOCA 3NSNA 1TMLA 4ML4A 3TN5A 2OWWA 1TV7A 2X1SA 3C8FA 3PULA 1IQ8A 3CV6A 2WVVB 1W1A1 3BPWA 2D73A 5LIYX 4IQJA 2ABBA 1DJXA 4REQA 1BSIA 3BMVA 1IIHA 3AXKA 3GW0A 4AWEA 4CKQA 4UQBA 1HKVA 3WMSA 2DZAA 1JPHA 3EYPA 4E4FA 3QR3A 4F9JA 1QOQA 2O4MA 1S46A 4B5TA 4MVAA 2V3FA 2PWEA 1VEMA 3SZ8A 2AMXA 5HQMA 4YS1A 1V7YA 3H54A 3CQIA 1BG9A 3C0JA 3B8UA 3TSBA 5M3WA 3F5JA 1ME8A 3WK0A 2DW7A 5FF4A 5T8GA 1SO6A 1QASA 1A0DA 4O4VA 5H8MA 3TJIA 1UA3A 1XL9A 1U1UA 1W3KA 4KEZA 4PB5A 3UWWA 1W56A 1AJ2A 2AKMA 2EJAA 2FHFA 4R27A 1EDGA 1H7NA 3AMLA 4JTIA 1YPFA 1Z3NA 5DBTA 3PZUA 2VRKA 1OC6A 5K4XA 3BLFA 3LHWA 1B30A 1A4MA 3PPHA 3UR8A 4JL1A 4LRTA 4HGXA 1S5MA 3QOKA 3GYEA 3B0YA 1EO7A 1UCWA 2VOMA 2NSOA 1J93A 2QIWA 3EEZA 1AQ0A 2Q09A 3VX1A 5E9XA 2PRMA 1E6QM 2OVLA 4QQ3A 3W01A 1SJCA 4UNLA 4LFYA 2ABAA 5C7VA 1W9VA 4F0SA 5CAKA 1AJZA 3W3OA 4FX7A 3KOFA 1AD4A 1HP5A 1R7AA 1JXKA 3TLQA 1DTNA 2W5FA 1EA0A 1C90A 3NJ3A 4JQ3A 2CWNA 4GUIA 3ALFA 1XIFA 3P8IA 2QT3A 4GWEA 3WJZA 4Q8UA 4DJDC 3QV9A 2GWNA 3L5LA 3QV8A 4PODA 2ZOXA 3GTFA 2A5HA 3S1VA 3FGCB 4XZBA 2CW6A 4ASTA 5BU9A 3R5EA 3M7SA 2VEKA 1BVNP 1GJWA 4W88A 1XI3A 1I0DA 2ZADA 5D2TA 2QV4A 5F2GA 2W6RA 1Q6EA 4NYUA 4DUXA 3C2OA 1GOWA 3WBXA 3G8RA 4E0CA 2JALA 3UJFA 4DBUA 4IMCA 2NVAA 3GFXA 3Q4DA 2EPNA 1ZENA 3P8JA 2VELA 3MJYA 5CPNA 1M01A 1TV2A 1XIEA 4HMEA 4KFOA 1S3HA 1T7LA 1KQYA 2ZE0A 3S2JA 1UUOA 1DXIA 1A5UA 2QZRA 2BY1A 3ABQA 1PX8A 2PBOA 4UCGA 2XZ9A 2BGSA 4YWSA 1UASA 1XD1A 3BCJA 3QR0A 4I8YA 4LV9A 3R25A 5JU6A 2DDXA 4A6GA 3H2NA 1Q8JA 4CQCA 2W92A 2HNHA 4PRRA 3NGJA 1XYAA 4AWTA 1XXXA 3F4VA 4M5PA 2DW6A 4DYEA 2DY3A 4M24A 4WLCA 3ZS4A 4QS5A 4PH6A 5EMLA 1JDEA 4HMNA 1WXZA 1UP2A 3HV9A 4LGXA 3VK5A 3EDJA 3KLKA 4OOZA 1QHOA 2L5HA 2NZLA 3A9IA 4GXPA 1A5NC 3VDBA 4Y90A 4XAFA 3EOSA 4LVBA 1MZRA 1P0EA 1X8FA 3CUFA 4RZ5A 2DP3A 3NSMA 4O0QA 3HM7A 4W89A 4OBSA 1JPMA 2QQ6A 3S9IA 3OHMB 5E0KA 3U5UA 1JF6A 4GG9A 2PRLA 4QQUA 1SFLA 1THFD 1TFVA 1UW9A 1VYSX 3M07A 4S3EA 3TUUA 1TX0A 1FTXA 4C6BA 3ITCA 1BF2A 2D23A 3NGFA 2HROA 1Z89A 1FQ0A 1RLDA 4M82A 3NQFA 4CN6A 1WXJA 4MPKA 2NT0A 1BD0A 2FZDA 3GBDA 4C6FA 3QSTA 4GY0A 4XD5A 1E9YB 3ARZA 3W7NA 4Q8WA 3QFEA 3C52A 4S2BA 3I4EA 3AIUA 1EJRC 5JBDA 1H7OA 5AHNA 4H3DA 1HF6A 4IMFA 5FJRA 4C1NA 2CPUA 5CKSA 3TEVA 4HNVA 2QNEA 5E0FA 1K6AA 1JCLA 1EQCA 4BQ3A 2PDUA 1E0WA 2WNZA 2Y70A 3FHQA 4XKYB 1J8VA 3RG6A 3DIPA 4IMGA 1P1XA 3QLDA 2Y61A 2DIEA 2FZNA 3N19B 4ZR8A 3VOIA 1AJ0A 1XJBA 3AS2A 4CVUA 4K3ZA 4DM1A 5LIXX 2Z25A 1QK0A 1LT7A 4W7VA 3WMCA 2DT1A 3HG5A 1TVLA 3NR0A 2TAAA 1H0GA 5C8BB 1T99A 4CCZA 3CZGA 2WZEA 3BH4A 3BQ5A 3VOFA 1MSSA 2R1MA 5BWAA 3N12A 4PMDA 3N2XA 1D3HA 2F6KA 3GXTA 1WZMA 2E6AA 5EMMA 3L4ZA 5D02A 5FL1A 4NJGA 2XU2A 4QAIA 5HINA 2GVEA 3WDIA 5KTLA 1XYFA 3DZ1A 4PRWA 3VI2A 5M2FX 3A4AA 4HCDA 3BOFA 4WJXA 3UXDA 1KKOA 1YXDA 1TA3B 4BJHA 4CD8A 2QLYA 4H4IA 2VVSA 1QK2A 4GABA 2E6YA 2FJUB 1ITQA 1G4TA 1QW7A 1TPDA 3OO2A 4JTSA 3LCIA 3M0ZA 3LYEA 3VD7A 1ZJHA 3MZNA 3VNYA 2PDXA 1JYWA 1WDQA 3CWNA 1OWQA 3MWCA 4GH1A 3STEA 4IQLA 2DV0A 3VC5A 2YX0A 1SPQA 2BASA 1X6LA 2QDHA 1XRTA 3ZJ6A 1OYBA 4RE4A 4PCSA 1R3WA 1FHDA 3MI2A 2ZX5A 3S9YA 4UQ9A 1OG0A 1K9FA 5C54A 2I57A 1I0BA 4C6JA 3EA1A 2ZX7A 3NIYA 3K2GA 4IG2B 5A5WA 3UPWA 3OBKA 3UWYA 4QDMA 2PD5A 2CBVA 3TQPA 3LZ5A 4IX2A 2FGLA 2OMAA 4PEKA 1W17A 2AKZA 3BOLA 1W1B1 1JZ6A 5KZ6A 4ZQNA 3ZSTA 2GGEA 2VZUA 4GY1A 2OGJA 3R11A 2CXEA 1XLEA 1J01A 4CD7A 2JEPA 3COTA 3RMEA 4Q7NA 4MZ8A 2EXOA 5DMYA 3G6MA 3EB4A 4M6UA 4AZ7A 1CEOA 1ICQA 4HOXA 1WBJA 4CD4A 3WLRA 1CYGA 2J27A 5FL0A 2VEGA 3MO7A 1NF0A 4B90A 1J6PA 1OCNA 3GDTA 4WSJA 2P3EA 4PB4A 4NNBA 1OFRA 1RCOB 4LC6A 2R82A 2HWGA 4RW5A 3H70A 3FAXA 5EKYA 2BDQA 5E6ZA 5ABHA 1E51A 3CB3A 4JIIX 4IP5A 1KWKA 5AC4A 3P2VA 2UV8G 3AS0A 1LL4A 1CLXA 2A79A 2C6QA 2R8WA 1ESWA 1UBPC 1B2YA 3GD6A 1F5ZA 1CX9A 5FIPA 3M43A 1WA3A 1K3UA 1POJA 1YDNA 4Q8VA 3HGRA 2QDGA 5I6SA 3PVFA 1G4PA 3Q45A 2IPJA 2GSJA 3S1UA 1JI2A 1R0MA 2P0OA 4ATLA 3STGA 3N25A 4LVDA 1W1YA 3RX3A 4B4HA 3URNA 3RF9A 1HVQA 1TELA 3TAOA 3LLXA 3IGHX 1JULA 4JN8A 3P3BA 2J79A 4YL2A 2Y63A 3KXQA 2YXGA 1AH3A 4HZMA 5A8GA 4ZA0A 1HKJA 3G18A 1XCFA 1TE6A 4UTTC 1Y7VA 3VKCA 3TOYA 1P0KA 5MKGA 2D20A 3GR7A 2EJ1A 3VOJA 3OVPA 3LXAA 4DAFA 4FLOA 1JDFA 3IJDA 4ZL1A 7CGTA 4I6KA 2R1PA 2WVVA 2WC4A 4HZ7A 2P8CA 5AZ0A 5K9CA 2BX7A 4CU6A 1O95A 1EEPA 5F4SA 3CK5A 3UG3A 5HR7A 4CCEA 2AMGA 3CXOA 3K4AA 2YR1A 3A4JA 2FH8A 3WD0A 1BGGA 1MNZA 2PZNA 1UA7A 1B90A 5I24A 3ANYA 1X96A 4AY1A 3WDRA 3G1DA 2XGIA 3CBWA 3QQ1A 3M64A 3N18A 4DF1A 2ZUNA 3EX3A 2V9DA 2WMIB 4H7VA 1ITCA 2WM0A 1UH3A 1EWDA 1TO3A 3PC0A 4N7QA 3MCMA 3WD4A 2XVNA 3CH0A 4HNTA 4ZFCA 5D2YA 3EKZA 3LPFA 4LUSB 3CT2A 3G1RA 3CZJA 3QBUA 2J4GA 1EL3A 1H5YA 1W91A 1QWGA 1UZHA 3LLFA 1UJPA 2BVDA 1OD0A 3PBMA 4AD1A 4IISA 5I78A 1IGWA 3M6DA 1US3A 4M29A 1F4HA 5DRCA 4H9XA 3E9AA 3PAOA 1BKHA 3W84A 1LTDA 1TPB1 1VD6A 3NAVA 4YCOA 4O8RA 3MUCA 4ES4A 2XWDA 3FKRA 3KTXA 3S5ZA 5GJNA 1KXTA 1SQ7A 5AB3A 1OK6A 3SFKA 1BAGA 2YL5A 4Q4QA 4DWSD 1LQ2A 2PODA 4HA4A 4DI8A 1VCVA 4RR4A 3B97A 2ISFA 4E2BA 5C70A 4CUCA 1W2VA 4JL2A 3LCXA 3OPSA 1V3LA 3IPWA 4LX4A 2Z29A 1OZMA 1KXQA 4JCLA 3YPIA 1VFMA 4FALA 2FZMA 2QGYA 5FAGA 1UH4A 5DBUA 1PKLA 3GDLA 1GNXA 1OSEA 2GQ8A 3L4UA 3BQ6A 1MFUA 1H1YA 4DJEC 2PZ0A 2VKZG 2ZUVA 1RPXA 3BLPX 1TZZA 1LZOA 2ZZ4A 4WRHA 3UA4A 3CMJA 1SZGA 1GYNA 4G56A 4NX5A 1XH0A 4HU0A 1MDRA 1UKQA 1QNOA 2VC6A 3N4AA 1X97A 3ITTA 1ZU8A 4HJWA 4ILSA 1IXQA 1GQLA 4CVWA 4QXIA 1P7TB 1CPUA 1EWEA 3L66A 4BY3A 4FNUA 3DYOA 2VJXA 4BCEA 5HMDA 3HQ1A 2X41A 3C4UA 3LU2A 2OYKA 2VRJA 4I9MA 4KQNA 1BXCA 4MOZA 3RCMA 4GZJA 4RNIA 5BRQA 3WIJA 2BV9A 1VFHA 1KQZA 1FVPA 3CB8A 2WO5A 2E9LA 4N42A 3EX6A 9XIAA 1BYCA 5CPSA 2VHLA 1E40A 1M7JA 2PUZA 3ITLA 3WBYA 2QPUA 3DX5A 3AMGA 3FA4A 4QITA 3QN3A 3SURA 5LKYA 2NW0A 4XD6A 3AXMA 2YDRA 5XIAA 4L5ZA 2HE5A 3V75A 2H9AA 4O53A 2WZHA 2XM2A 2XIOA 4JS3A 1IV8A 2V5CA 1QI4A 4BQ4A 1DJGA 3L2MA 2E09A 3C2EA 1E15A 3IUIA 1X38A 3V7PA 3RLVA 7ODCA 2VEIA 5D05A 4S3BA 3ERPA 4H6KA 2RFGA 3A5VA 3MC5A 2WB5A 4AIBA 3UWQA 2BWGA 2NUXA 3WLTA 1TVPA 1E4NA 1TJPA 1E1EA 4IP4A 1VYRA 1N8WA 2NXIA 2VQUA 4DJDD 1SZFA 1EDQA 3V1PA 2PDHA 2ZRUA 3A6OA 1ICSA 3LCWA 5LZLA 2D2HA 3PZMA 1OQFA 3BAKA 2V5DA 4MFEA 3E5BA 1EYEA 5EU9A 1E4MM 3BW4A 4ZBCA 2TYSA 4CCCA 1YTKA 1PHQA 1VIWA 1YTDA 1XICA 3B04A 1OT2A 1UKPA 4BF7A 4O57A 2W4XA 3DFPA 4HSOA 5GNYA 4BHYA 4NZ5A 2RDWA 4Y7EA 4XV0A 2PEVA 4IX0A 2C7FA 1EDTA 3KOWA 4Q8TA 4QBXA 3L67A 3W88A 2R91A 3T42A 1JF5A 2RAGA 4DJFA 2GUYA 4XZMX 4LS0A 1UQZA 2VO5A 3ZFHA 5I0DA 1Q65A 3NA8A 2PC4A 3Q94A 1FWWA 2YBVA 4GCXA 1R3TA 4F0RA 3WLJA 5CSUA 4GIYA 2FHCA 4JFSA 1QVBA 5B7ZA 1S1RA 1YDOA 3PWIA 4UFMA 4NX0A 2O55A 4UXDA 4GQ0A 3R8HA 1WBHA 2C16A 2XIMA 2D2JA 1KBIA 4L1GA 3RM4A 5IBXC 3QZ6A 1O1ZA 3WQEA 1EF3A 3KRUA 4MNMA 2FPVA 5E5CA 3EXSA 3AIEA 4LXFA 3NQCA 5CGQA 2R1LA 2OTDA 3QEZA 3E96A 3KL5A 1ZSXA 1LQAA 1KRAC 3KVJA 4UR8A 4HU3A 4LYKA 3N2CA 3C0SA 2D3LA 1RD6A 3OZYA 3MUZ1 4J3TA 4HTYA 3GXIA 2W79A 4S3JA 3V35A 3GC2A 2X1UA 1YNYA 2YXOA 1B4KA 1FWDC 1T0OA 1TTQA 3NQ6A 3QYSA 3TA9A 2DVXA 3R79A 3CTLA 5A94A 1Q6LA 5LIKX 3CM4A 4GQQA 2YOCA 2BGQA 1L6SA 1F61A 2Z7GA 2HJPA 3GXNA 2FVLA 2YLAA 4KFNA 3MP5A 4XK2A 4JYFA 2WQDA 4IP7A 2BOEX 3QC3A 3WDQA 1DV7A 3HPAA 3LLDA 3MCOA 1QRQA 1E5JA 2CFFA 1M68A 2VENA 1E72M 3RILA 4PCPA 3UP8A 3DI0A 3R7MA 2JK2A 3VUSA 3M1ZA 3MQTA 3P93A 4O1DA 3U0HA 3GE7A 4ICMA 4H9TA 3SR7A 3T0DA 3CV1A 3ARWA 4DWDA 2E4TA 4WR3A 1XRVA 1K1DA 2PGWA 4QDWA 1NP0A 4J9JA 2Z24A 1V6WA 2BY0A 3OIHA 4LBSA 3S47A 2J62A 2IXVA 2QCDB 3T1GA 1NDZA 1DIEA 1PIFA 4M6VA 3USBA 3O63A 3EDFA 2CHNA 1OFAA 4EPDC 2EQDA 3OJGA 1CECA 2GYIA 4ZQOA 3IUDA 1MUWA 4K39A 6CGTA 1SJBA 2O9TA 1XG4A 3OYZA 2VTFA 3T6CA 3SGUA 3CHEA 1ECQA 4IXHA 3W22A 4YN5A 3W86A 3FIGA 3IJ8A 4DF2A 4A8NA 1O4UA 2J9YA 4FZIA 3WF2A 4QE5A 1T8QA 5FESA 1I75A 3BLOA 5BROA 1FCQA 3KW3A 1XBVA 4AHQA 5AYXA 1I9CB 3E3HA 4RPPA 3RNDA 1VZWA 5FEZA 3SBFA 4HNOA 3W1LA 2ZDSA 3LERA 2ZZ2A 2PDQA 4ZZ9A 3IGSA 2NV9A 1K02A 1D8WA 1UIOA 4S2CA 4UNKA 3TW9A 4AU0A 1IWBA 2XYLA 4IJCA 3BLLA 2ZUSA 4GHRA 3AIVA 2R9RA 3PANA 4B15A 1E6SM 1DPMA 2XGZA 4RDZA 2ZA3A 6XIAA 4KETA 3V16A 1JCXA 1VPXA 2ISSA 1EEXA 3B4UA 3NEHA 3OLGA 2PWDA 4O50A 2XFWA 3QKZA 1KA9F 4KWVA 1OGGA 3CHFA 4AF0B 1HUVA 3GUWA 2QPXA 4BKNA 3IVSA 5K9XA 1ALDA 1VLIA 4IGHA 4JHMA 1IEIA 4WCJA 3HQPA 3U2ZA 1H7XA 4QLKA 2J47A 3ZLFA 4KERA 1HZYA 1US2A 1WKFA 3AO0A 2SFPA 3CUGA 3S5YA 3KOYA 4JQAA 3MO4A 1LJYA 1NTHA 2X7WA 2D69A 3PZ9A 1LUCB 1QI0A 2ZXAA 4XAYA 3WQOA 5TIMA 5JIPA 2VD9A 4XZWA 1E3ZA 4LAMA 1ZBKA 4JX4A 3B8DA 2NQ5A 1ZBCA 1F7BA 2XFRA 4TQTA 5G4EA 4EAMA 2Z1BA 3AYSA 2YW3A 3ALGA 1Q45A 2FTPA 3KLLA 3QRHA 3A9BA 1B3OA 2V67A 4ZEPA 1YRRA 4CNNA 1M65A 4H6RA 3DGRA 4EANA 4FLSA 1SR0A 3M0YA 1POKA 4DBWA 4DXVA 3IJQA 2EHHA 4H9ZA 2YA2A 1NFPA 4EWND 4LJ3A 5HNRA 1JI1A 2PWHA 2Z27A 4GI9A 1HFBA 2YB4A 1A50A 4GNVA 1TREA 2WCGA 4JIQA 4GK8A 3CIXA 3NQBA 1EFZA 2QVHA 4DO7A 1G9HA 1P1MA 4O11A 2HNEA 3VILA 4XB3A 4ORIA 2FDSA 4UUIA 3WH8A 1KKRA 3QOMA 3WK1A 2E7FA 3TMQA 4PUWA 2P53A 4GNJA 4PC8A 3VIKA 2FVMA 2R24A 9XIMA 3NL3A 2J8TA 3O05A 4GA8A 1XIBA 4AEFA 4XAPA 3NWRA 3W7IA 3IV8A 3O2LA 3URQA 3TYUA 5FACA 4OV4A 2Y8VA 4CNSA 3UXAA 1Q8AA 3CHVA 1UROA 5DEZA 5D38A 3AXHA 3WUFA 3UEQA 3O1NA 1NWRA 5D2XA 2HSAA 3W74A 1K03A 2E68A 5BOOA 1RV8A 4N4PA 4HYRA 3SQLA 4C5ZA 3ZXWA 3DHFA 3OODA 3FDGA 5A69A 4GXMA 2XFFA 1JGMA 1ELSA 4Y2WA 7A3HA 2E9BA 2DQXA 4OU1A 4DUWA 1J79A 4GIEA 1KBLA 2DFAA 2E77A 2HE8A 4ZTXA 2WJDA 4A3HA 4E4UA 3P80A 3LCHA 4O1EA 4DF0A 2BODX 3ARVA 1W54A 4XBKA 4FP1A 3SN1A 1R5YA 4QG8A 1WKEA 1QHZA 3L2IA 1XKJA 1JPDX 1I2QA 2INFA 3GH5A 1WAWA 4NZFA 1QO2A 4XUYA 4OKDA 5CG0A 3KOXA 2QS8A 1WDWA 1CGWA 4ZENA 5BOEA 4HSNA 4KW2A 4MLJA 4GQBA 4YU1A 2J66A 4M7SA 2GQ3A 1VH7A 3NQGA 4JIEA 1KXHA 2DSUA 4KEMA 4BA0A 3RLUA 1RQHA 2CLHA 1XYZA 3TJLA 3REQB 3POCA 1S5NA 1X7FA 4M80A 4V15A 1MVYA 3QW4B 3MJMA 2GDVA 4DXXA 3WLLA 4GXWA 3IUHA 4GY7A 1ZP3A 4HJFA 5IRPA 1V6UA 8A3HA 4JEJA 2NXHA 3TNBA 4PTWA 5E6YA 4UNIA 5BRPA 4BI7A 1EPXA 1BYAA 5K7JA 3K8KA 1UYQA 4JX6A 2ZUMA 4HBKA 4WGXA 2Y6ZA 4XIMA 2J74A 3DBPA 2WNQA 4WY0F 1ZJBA 1H1NA 4A3YA 4JTKA 1ME7A 4K2SA 4GOAA 4ERIA 3EWXA 1KWGA 2YLLA 4RE0A 2WJFA 3PUDA 2IKJA 3W26A 3W2JA 1O1HA 2DSVA 1F8IA 4EIVA 4G6CA 1YX1A 4MYXA 1OYCA 3QQ0A 3N2OA 2PD9A 3OTRA 5I02A 4Q4KA 3NQDA 2JF6A 3CS2A 1ZALA 3WLPA 4E38A 1NOFA 1WZLA 2XIIA 2W62A 1W9XA 1SSGA 3BARA 3JU2A 3GNXA 1H4PA 2WJZA 5HUOA 1JJKA 1OCJA 1NFGA 3GM8A 4HNUA 4DJED 4F2BA 4AVFA 1JYXA 1EJSC 2ALDA 4JR5A 3H7RA 3W7LA 3LQLA 3DFQA 2PLJA 4IPNB 4JPGA 3FJ6A 1R9YA 3UF9A 1R8LA 3CAVA 6A3HA 3QY8A 3V5FA 3WYZA 2WSKA 4LVAA 5I09A 3CUJA 4MKVA 4C5YA 4D6FA 1GG1A 2X1IA 1XSKA 1TYGA 5FF3A 4H6EA 5C9WA 1Y65A 2OPJA 3E2RA 3RRXA 3MPGA 4JGDA 5EYWA 3VABA 3A4WA 4GLEA 4KFPA 4UOQA 4R53A 5CLTA 4ZQCA 2HK0A 4NJIA 1WXYA 1A80A 1FH8A 1GEHA 1JZ8A 1M03A 2YW4A 2QHAA 4M3PA 4X9SA 7PTDA 5LGZA 3H7VA 1XINA 2B7PA 3B05A 1DL3A 5XIMA 4B2DD 1KM0A 4DJEA 1ONRA 1SMDA 4ADTA 4DIAA 1NDWA 1DHPA 3CWHA 3GDBA 2EPMX 1OX5A 3NFUA 3NPXA 4WK9A 1H61A 3MUXA 4HHPA 4NAEB 2G4FA 4MTVA 2OZ8A 5DXXA 2Y7DA 3KBWA 1QW8A 4DPPA 1G01A 3UGRA 4DUOA 3M0JA 3B9EA 4OOUA 1E4LA 3HPXA 3VIFA 4D71A 4PGLA 1HJXA 4S38A 1OC7A 1E3XA 2A3BA 1EUNA 3KDOA 4OBRA 2HBXA 3WQFA 2V5KA 1DQXA 5D09A 3AIWA 3XINA 2CBJA 1A47A 3MHGA 5CQ1A 2D0HA 1JYNA 4LB3A 1X1OA 4CEXC 3TYEA 5C2GA 1A5AA 2F6UA 1YBQA 4PUMA 2YL8A 3BG3A 1UD6A 3L4YA 4WDXA 1UMLA 3II1A 3FK4A 3N29A 3L23A 2CBIA 3CQHA 3KOZA 3UCCA 3GTIA 1SZNA 2V63A 7TIMA 2HTMA 4PUJA 5BMXA 1SFJA 4B2DA 1A49A 1XC6A 4FK9A 2WLYA 1M9HA 3H53A 1NWTA 5FEXA 3PK7A 1JYVA 1FRBA 3FXYA 3L12A 1IF2A 2JKAA 1AW5A 4NRRA 1NM9A 1WB0A 3EZ4A 1MQPA 4OGZA 1Q5MA 1P6CA 4D6HA 2KAUC 3AOFA 2AOSA 3UYIA 3W72A 1JZ7A 3I6TA 3GIYA 3AALA 1RJRA 3UZXA 1PYFA 1U1JA 1V0MA 3KTSA 3GFYA 1O12A 5HWNA 2G4JA 3WKZA 4LF1A 4TV5A 1ONWA 4MUZA 3PY2A 3F7JA 1J10A 1GOKA 1WQ5A 4HYVA 1V6XA 1UD8A 2E1WA 3U2OA 3W73A 4MWAC 5H8PA 5D4YA 2XH2A 1KFLA 3TC6A 3AIRA 1H41A 3WNMA 2JGQA 3O6AA 3I7SA 3KDNA 2DU2A 3NQ8A 3WFZA 3CLMA 4O1BA 1FCBA 4HQVA 1GVOA 4F3HA 4W85A 1XH1A 4DHGA 3IIVA 2JKPA 3O9NA 4AXKA 1RJQA 4FXJA 1GTEA 2BZNA 4RNFA 4XAGA 1OX6A 1CXFA 4ZSUA 3N14A 4V2XA 3CUHA 3T81A 2NQ9A 1WUFA 2J7BA 4PA8A 2V38A 3AWNA 5B80A 1EGVA 4DELA 1RP9A 1QHPA 3RAOA 5CC7A 3QFWA 4S3AA 4EAYA 1OINA 4QM1A 2EKCA 1EZWA 4WKHA 1LOLA 1JL8A 1GW9A 3WLNA 4LVGA 4ROPA 2PDWA 3FKKA 4PFMA 7REQB 1K77A 4M51A 4C6KA 5IBXA 3LPOA 1VJSA 3NOYA 5LNWA 3H7UA 2QEZA 3SUVA 2O9RA 3N15A 2WBGA 3O15A 4GCAA 3QLLA 1FWNA 1H2JA 1V0KA 2J24A 4G1NA 4AH7A 3B03A 3WK3A 1HT6A 2WKGA 4NIRA 4NY2A 4UZUA 5JH1A 1PIGA 1B57A 4S39A 2V2HA 1LBMA 2VZSA 1DXEA 1S2TA 4QJ1A 1GPFA 3PS7A 3CPGA 4W8LA 2PP1A 1KCLA 5GJPA 1R7OA 1UWSA 2G3NA 4GKLA 1JNEA 5A2BA 3W9ZA 1REQA 2OX4A 2WMFA 3SGGA 1G7VA 1LUCA 1JCJA 5G4HC 4UZSA 3BZJA 4ML9A 3S1XA 4DZ5A 2NSXA 1KRCC 2BP1A 1VR6A 3BK0A 4ZCWA 1RAKA 4F2TA 1TJ1A 5A8QA 3LD5A 3QSRA 1A53A 3SCPA 1SFSA 3UBPC 4C6DA 2VFIA 4H7CA 4IPIA 1EQPA 4MY1A 4PL1A 2X1TA 2A7PA 4IGSA 4FB7A 2YB1A 4A2SA 4RE2A 1MW2A 2E0PA 1BGAA 2PWFA 4MNJA 1ZGDA 1R3QA 3RDKA 3G1VA 2WKJA 2FVKA 2J7CA 4YTRA 1ADSA 4ZE5A 5J04A 2XWEA 3PN8A 3WQWA 1K8ZA 4AC1X 3T8LA 1Q13A 2Q02A 3KFTA 1IYXA 5CZTA 3ABRA 3VKJA 4GINA 2OQYA 3NZPA 3WLOA 3P74A 3VIPA 3UR2A 4OUEA 2WHMA 5C9XA 2CNCA 2WC3A 2WQPA 1VCFA 1GORA 1V02A 3ZT7A 1Q6RA 1EC9A 1L0PA 2VDGA 2XZ7A 5F7UA 3LN3A 1EJXC 5LNRA 1EJ7L 2WNWA 2FHBA 2P5NA 1JZ2A 1PX3A 1W3TA 3H2MA 3D3AA 4XSLA 1RP8A 4PMQA 3FVMA 2G0WA 4HCLA 3IJLA 2QUVA 4XO7A 3IIOA 5CG7A 3HU7A 5E09A 1HL9A 3UW6A 3NQ7A 4GYJA 1SM9A 5GVJA 3R58A 3B06A 2X09A 5TD4A 2A3LA 1GHSA 3NEVA 4ZQRA 3ZLHA 1E5NA 3A3HA 2GK1B 4FOKA 3HFYA 4NKCA 4K7VA 3VAVA 1E43A 1HXJA 4YTTA 5HANA 3MS8A 4HU8A 3WL1A 1I45A 1RCXB 1Z69A 4N0RA 4IIBA 4HOWA 2A0NA 5MF5A 2V5LA 1V3MA 2BHZA 4L64A 4INFA 4TUFA 3WFLA 2A4AA 3PWAA 4JHOA 3FYYA 5HWJA 1O68A 4REQB 2Y2WA 2RGMA 5JBEA 3GH7A 3WQDA 3ATZA 3O06A 3OG2A 4IT1A 1KM4A 2Z00A 3V0SA 3LEPA 3ZIZA 1B3ZA 4UTUA 3SCWA 3ZJ7A 1Z8AA 5BRBA 2E28A 3BCFA 1PDZA 4DM2A 2ZX8A 1FH7A 3FOKA 2WPBA 2H6RA 3M0XA 3MDUA 4PMNA 4C7DA 1J2WA 4Z2LA 3H2FA 4DZAA 3AMCA 4LNYA 3DHUA 2XG9A 3T0CA 2VGGA 2A3AA 4US6A 1Q6FA 3TN3A 1OYAA 2XSBA 3PZIA 1B0IA 3CAKA 1OGBA 3KVLA 1CLKA 2VCCA 1OGSA 1ITUA 3AAMA 2IKHA 4LCSA 1YLVA 2WJEA 4Y8EA 4TV6A 5KITA 2J8FA 3WQ6A 1OADA 3VGGA 3M9YA 1J0JA 2C1GA 3W7QA 3GHSA 5AY7A 3SDOA 2OZ0A 4J40A 3VGFA 4LEQA 4LV4A 1JUBA 5D8ZA 3TONA 4WXZA 3DU0A 2TSYA 1TPUA 1ZZMA 2BOFX 2PTXA 2ZYFA 3GTNA 3L0GA 1RBLA 1SZEA 2XN0A 3UU0A 4FOUA 3C2RA 1E6PA 3TWBA 1OVDA 4C6NA 2PTZA 4Q6XA 3TC3A 1KM6A 2A1YA 1OHLA 1FX6A 2QXWA 3DYPA 4QAWA 1XF0A 3GIQA 5F1VA 1Z48A 3ZR5A 4H9MA 1KW1A 4XX6A 3GNOA 3WLKX 1JD9A 3F5LA 2O9PA 3K8MA 4OBTA 3H2OA 3GU2A 4GYFA 1SW3A 3W1MA 3R10A 3TOPA 1U5JA 4D6DA 2J7FA 4GUFA 1XHGA 1ECEA 1BTCA 3P5ZA 1E9LA 4ICNA 1TKKA 2J7HA 2Z28A 4TU1A 5I00A 3CYVA 2QJNA 2QF8A 4DBEA 3OU8A 1DWHM 4HK6A 4ZE4A 1GJUA 5DMLA 1ENUA 4PCFA 5DLCA 4E8GA 1UUQA 5HAOA 5LHFA 4C6LA 4ZXLA 1GOIA 4N9BA 5C0QA 3PP7A 3QV7A 1UR3M 4R88A 4N9DA 3W6LA 3ITGA 4LAUA 2VNCA 2R6OA 1P48A 4HA0A 3B9OA 1K7EA 4HHLA 4UFIA 1W5PA 4L1XA 3DFYA 4H01A 3PZNA 1LBLA 4YVPA 1MXDA 1E0XA 2G3IA 4K7YA 6TIMA 3QXBA 3U7VA 3MVIA 2I5GA 1XYBA 3PUGA 4H41A 3A47A 2DH2A 4NF7A 2WYSA 4FPSA 1WNOA 1V3KA 2ISWA 1E0VA 3PNZA 5HULA 1NP2A 1G7UA 2C13A 1E71M 4Q8QA 4O10A 4PBFA 5ABFA 1FWCC 2I9EA 3W37A 2YFNA 3IJ7A 2AGTA 3LHUA 1UR1A 5DY2A 3R8GA 1KFBA 3PUEA 1Q4WA 3URBA 3CYJA 4EXBA 1SW7A 2W61A 3TZNA 2J78A 3GTHA 5M03A 4DNMA 3WNKA 2F6XA 4M7TA 3L0NA 3R2GA 1V6TA 1VPYA 1FDYA 3THUA 3IIXA 1VJZA 1OJXA 1A3HA 1VIZA 4PMVA 3E0VA 3W7HA 5A6JA 3SY5A 3VM7A 2HS8A 2DZBA 5JIWA 3SUUA 1TPWA 3PPFA 4GBDA 2PURA 3T40A 1RBOB 1EIXA 4LU0A 3UZYA 4DXKA 3ES8A 4QS6A 4GC4A 1AFSA 3S5OA 4W7WA 3WDHA 4NNAA 1K6WA 1Z7AA 3TFCA 4K6AA 1PIIA 1JR1A 4HNNA 3AS3A 3UXKA 1R47A 3E0WA 3BVJA 4P5UA 1ZTVA 4WDUA 1XSIA 2VT0A 1UWRA 3W81A 1XLIA 2VVNA 1QATA 1RCQA 1UC4A 5EB8A 1EF2A 3R43A 3RFAA 2YSWA 8XIAA 4O16A 1OFEA 1R3VA 5A6SA 3CJPA 3LPGA 2VDIA 5A6KA 5C7HA 1OY0A 4K36A 4EWJA 4DB7A 5DFAA 4AB4A 3RGTA 1W3LA 4RUBA 1RZMA 3CU2A 1XX1A 4R33A 4ROQA 5CPLA 4B92A 4QSFA 1U2YA 3S9ZA 1QBAA 2C19A 1BEUA 4WDWA 2ODOA 2BY3A 4C1NB 1LG1A 1UP0A 2XSXA 2ZA2A 5CZJA 1HKWA 3ECQA 3HGSA 3GHRA 4ERGA 4BWLC 4IFRA 5G2WA 4TX6A 3WENA 3EPMA 5L6UA 3OGRA 2YFOA 3JW7A 1LRTA 2VUYA 2P76A 3KL0A 1V51A 4XO6A 4EPBC 1MZHA 3EB3A 2ZBTA 3A22A 3ZSSA 1GZ1A 3ZOAA 3NVDA 4UFLA 1GVIA 2HBVA 1V5XA 1QCWA 4ADUA 4H04A 3WEZA 2PGFA 3ZO9A 2V82A 4UC5A 1W1PA 3KEHA 1HNYA 2Y62A 3U7BA 1H60A 3C5QA 5REQA 1GOXA 2G3FA 2X0SA 3W07A 1M53A 3G3DA 3CEUA 1E73M 3O6YX 4ZO6A 3N2BA 3UZZA 1UZDA 3MVTA 2ZUTA 2Q8XA 3H4GA 3M47A 1I6NA 4RPQA 2R1NA 2Y88A 3N17A 3WLHA 4UOJA 4JNYA 2V81A 1RLCL 3HG2A 4I8DA 5LGXA 3ID7A 5J5DA 4IM4A 1UD2A 4D6IA 4Q4PA 3VNIA 1YNQA 1YHTA 2I7GA 2PTDA 3USZA 3GDRA 3GLCA 4RK8A 1AODA 4AZBA 3TV8A 2FPYA 3OZMA 2BNJA 4LUIA 1XUUA 3TTEA 4MDPA 3EWUA 2ZZ5A 3UG4A 3C3UA 4DNHA 1XBXA 4DLMA 3GXPA 4S3GA 2GJXA 1KGUA 3DGBA 3W27A 4JTCA 1Q3NA 4DUVA 3CWOX 3PBGA 4GYKA 4F4RA 1H3GA 2V3EA 2QCNA 1H62A 2PU1A 4QIUA 1DWFM 1XS2A 2B7OA 3V1HA 1PE1A 1ZP4A 3S2NA 1GVQA 4MWAD 3VMOA 4I5UA 1SO4A 3TZFA 4W93A 4PBGA 2Q3OA 3MZ2A 2F2HA 1XFBA 2DORA 3PFRA 1HGYA 3HURA 1I60A 3IK2A 3TN6A 2C3ZA 2POTA 3DI1A 1TTPA 5DX7A 1FHLA 3H12A 1D3GA 2GJRA 3P81A 4B91A 4M6QA 2CETA 2VD8A 4ZOCA 2QKFA 2WC7A 3WBWA 2XJ7A 5DY3A 1A3XA 5HR6A 3VIOA 1XLHA 3GO2A 4A8LA 3CL6A 3FNDA 4H8UA 4DQWA 1C93A 4O15A 3NXLA 5HNNA 4OUIA 1W1VA 6ALDA 3GW3A 3IS4A 3UERA 4FR1A 1R9XA 1HJQA 5H6HA 3GNPA 1A5CA 4U4MA 4R5EA 2GL5A 2Y85A 3IJ6A 4BEUA 4NHVA 3F4DA 4D1IA 3ZVHA 4Z2IA 2NUYA 4AMAA 4C6MA 3DC0A 1S2WA 4K1GA 5LHEA 2NVDA 2BY2A 4B5UA 1CIUA 1FP8A 1PB0A 3MMTA 4HZ6A 3WD3A 3QV6A 2HRWA 3UNDA 1GVEA 4PB3A 1FDZA 3F2CA 2XVPA 2VL4A 3HIJA 4Q8PA 1XQKA 1UD3A 2AQOA 1TWWA 4QCEA 4Q8MA 5F1UA 1I1XA 1KTCA 2WOQA 2CHOA 3T0BA 2PP0A 2ZXQA 1QPOA 4I9JA 4BZYA 4K8EA 2WWDA 3KM8A 5EMYA 4URIA 4ZGYA 4Z1BA 1O6IA 1VHCA 1VCGA 1F8MA 4RZBA 2YZ5A 5EBUA 1E55A 1XGZA 1M7PA 3M0HA 3SSZA 3BGAA 2FQIA 4YCPA 4WOZA 1GTHA 4DRSA 5AYIA 3JUGA 5AFDA 1PTGA 4YWIA 5BOFA 2B0MA 1PV8A 3GKAA 3M5YA 4JN6A 2DZUA 2GK1A 3H22A 4J2MA 4HPHA 1A3WA 3AJ7A 3TSDA 4C6QA 4C6OA 3LXBA 1RQBA 3W83A 1KNWA 1JXJA 3MBDA 1IGSA 3B3DA 4R7JA 2VX5A 3LY0A 5MKGB 3RCYA 1HJVA 2CLMA 2FTYA 4LTSA 1FWEC 1JUKA 4XD3A 3WMBA 1UR2A 2V3DA 3LRKA 3G24A 1T96A 5GQBA 4J3VA 4AEOA 3TR9A 5A95A 3ZT6A 1JQVA 1EUAA 1HX0A 5DQPA 2WZIA 4LPCA 4RL3A 1VEPA 3KVMA 3PZOA 5ABTA 1ZY9A 5K2ZA 1OF6A 2D22A 3HGOA 3NXFA 3NQMA 3H6OA 3UA3A 5AC6A 4KWSA 1HKMA 2VX6A 2CWXA 1XCWA 4RE3A 3NZRA 4ZOAA 2PDNA 3M0VA 1S1PA 5CLWA 3C2YA 1HGWA 3N11A 3MHUA 2PF8A 1WO2A 2PDLA 3O3RA 3W71A 4O4WA 3WD2A 1R9ZA 4F48A 2ZX6A 1IWPA 2F61A 3U48A 4FNPA 5EY5A 3N4FA 1B1YA 4JFTA 4GYPC 1G0CA 4IZGA 1JDAA 3LXCA 4HHHA 1EZ2A 4C1KA 5LXEA 3PWGA 4J28A 4NJHA 4N4QA 3KBVA 5A6LA 5HJXA 2Y4SA 2Z0IA 3BV7A 5CGMA 1TIWA 4QNWA 1W9BM 3NDOA 3PTDA 3RU6A 3VD5A 2EPKX 5D30A 5AYZA 2OO6A 2GDUA 3TA6A 3NL2A 3UT0A 4GMEA 4CNTA 3M5ZA 4QJ5B 3L68A 3AHVA 3WF3A 3PBWA 1SZRA 2ONEA 5HMEA 2W27A 3W1PA 3HMCA 1TTIA 3IGXA 2B7QA 1N7KA 1U5HA 4G7EB 3O0KA 1T5AA 3GNRA 4MHBA 2CESA 4MG4A 1XLAA 2XHYA 4HNCA 1L6WA 2IW0A 1AW2A 1VLWA 3FJ4A 1DJIA 1DP0A 1X1NA 1XIJA 2DT3A 4V28A 3EDDA 1GQIA 1XC4A 5AYBA 1AVAA 4PBEA 1WDSA 3P61A 1F3XA 1V4YA 3RUBL 3TYAA 1RA5A 3UR5A 4TVCA 1DWJM 5HPOA 2XN2A 3H26A 1A5BA 1N2VA 3VNMA 4W4QA 1TRIA 5I5RA 1K9TA 4GI4A 4LY8A 3VDAA 4LUTA 1KCKA 3STCA 3VO0A 4JKMA 1JZ3A 1KLZA 5E9AA 1XH2A 1GYLA 4L4OA 2PS2A 1NWUA 4GGHA 3BJFA 1ZNNA 2RJHA 3OEXA 3WQ4A 3ZZ1A 4L65A 3QGAC 2LLEA 2X05A 3SN4A 3NL5A 2A85A 4G1KA 1EKOA 4UQDA 5A3HA 5D9PA 2J7DA 3FLUA 2IXUA 1A5SA 1LOSA 4XVDA 5CBIA 4L9XA 3QC0A 4O0KA 1UWAA 1YPXA 1Y5WA 3OOQA 5CPQA 4F66A 4O1AA 2OLAA 3OVQA 2ACRA 2BFGA 5HPCA 3BCDA 4QP0A 1KRMA 4Y9AA 1AH4A 3VNKA 1PHWA 3GX9A 3K8LA 1XDMA 1T6MA 2CITA 5T9CE 2VUNA 3O07A 3FXGA 4R34A 3UG8A 1JPKA 3O6CA 4C1LA 1V8EA 4MWAE 2WANA 4Z2GA 3ZWSA 4HCHA 3WNPA 5FJIA 2VEFA 4MNKA 4M1BA 2ZKMX 3H8AA 4GZ7A 1QPNA 2OLHA 3I3DA 2PDKA 2YZRA 3W7CA 3DFNA 1HL8A 4LUYA 1VP5A 1A4LA 1T40A 1JG9A 2H9AB 3ANVA 3KWSA 3UXIA 1KR0A 4HHMA 1TX2A 3LGGA 4WD0A 3TTSA 3VYLA 5DMMA 2W63A 3EMQA 4XKMA 1JGIA 2Z1WA 5DT7A 4CQDA 4GZIA 3HJEA 3IK4A 2BXYA 5K3VA 4L6HA 3NTYA 3VOHA 4DY1A 1J6OA 2J6XA 1XLDA 5IFPA 3BC9A 1UKSA 2ASHA 2PTYA 3TDFA 2YCIX 4JDYA 3L65A 3BE7A 4KS0A 2OSYA 4KPLA 1SR9A 1YADA 3C6CA 2XTKA 4WY0A 3EWWA 3VE9A 4GVFA 4MADA 3VFLA 4U33A 4JN7A 5FOOA 4R3UA 3A5FA 2B7NA 3E49A 3LCGA 3LV6A 4FNQA 1Y0EA 3OLDA 4PZVA 1SUXA 3WF4A 1E56A 2VX7A 3BW3A 4CLMA 4C65A 2CCRA 4DYKA 4YVXA 2XPKA 4IQEA 1MWOA 2RGLA 5I7GA 1K9DA 3R8RA 2PCQA 1VBHA 1IZKA 1XP3A 4QR6A 3AMDA 1EC8A 2DZTA 3C56A 3PZGA 1X39A 4LCQA 1QNPA 3W75A 2XH0A 4M1RA 1VFUA 5LSMA 2BLEA 4MKNA 4YVVA 2RH9A 2DZXA 3T7VA 2GVLA 3NYDA 5EA9A 3APTA 4JTRA 1CXKA 1E6NA 4L9YA 1BFNA 1XIDA 3SRHA 1S5VA 4BK9A 1B3XA 2FGZA 4XTDA 3ZJ8A 1CCWB 3IIPA 3KBMA 1IHIA 1E9IA 4RXFA 1CT5A 1PDYA 3T78A 3QGVA 5HMSA 1DVJA 3M0IA 3WLSA 4Q33A 3O7UA 4AYSA 1YE6A 2X7VA 1EP2A 2VGBA 3R13A 3VKDA 2NQHA 4FI4A 2PWGA 4HTBA 4XZIA 4D72A 4PMOA 6XIMA 3GDMA 3RM9A 3WQ8A 2PDIA 4RKAA 1L9WA 4KIEA 4KEUA 1CNVA 1TMHA 2CKRA 2IKGA 3OVGA 1DIOA 1TZ9A 3WDPP 3H4XA 1ML1A 1IXOA 1XKYA 4AZCA 1Q2RA 4MJZA 5EFDA 1L2QA 2XISA 4O12A 1TE1A 3KBNA 1GOOA 4MKSA 4AD5A 3L4WA 1RA0A 1OC5A 2VCBA 3N2MA 2ZQ0A 3NVTA 4IMDA 2E6DA 1KTNA 3CAWA 3PAJA 3URAA 2W66A 4CD6A 4XZ9A 2VCAA 2WCAA 3T08A 4B9YA 4JYDA 1V7AA 1NARA 3MSDA 3B8SA 3CQ0A 4UMBA 5EPDA 2ZRXA 4QE4A 3HGJA 1UMYA 2ZXDA 3ARYA 1F05A 3DYMA 3VGEA 2TRSA 4JTTA 1C3FA 1E70M 3L5AA 3IJ9A 2WAGA 2OODA 1Z44A 3F5KA 3N9RA 1O7AA 3G0XA 4FLQA 2QJJA 3K13A 5D32A 2YPIA 3DENA 3TW6A 1E1CA 1NY1A 3G3MA 3VZYA 4A3UA 2HS6A 5CZKA 3GZ3A 4PSPA 3ZLGA 2OSWA 1TG7A 4O52A 4LVFA 1VGAA 4B4FA 2QDEA 3NG3A 3SN0A 4MMWA 2QULA 4FX8A 1VB9A 3HOJA 4EF8A 4Y9PA 4HPJA 5FD0A 3GNNA 4IQDA 4FNRA 4J4KA 4QG6A 1UHVA 2P8BA 2DUAA 2BVWA 1PO9A 3MI3A 1HW6A 1ME9A 3NURA 4JTAA 3QYQA 1QOPA 3W87A 5G2HA 4JIRA 1G4SA 1OFOA 3RM8A 1M6JA 1LP6A 4WQ6A 5BWFA 2XH4A 2VFFA 2VP8A 5E70A 1XDJA 3QMRA 3OQEA 1XLMA 4MB1A 2G95A 3LUTA 3LV5A 4Z1DA 1LWIA 2E9MA 3GXFA 2WW5A 4UBPC 1OM0A 5FEPA 1QI5A 3CPUA 4CGTA 4H9YA 1Q7QA 4TMBA 1J96A 1XLBA 2PDYA 5LA2A 3WELA 2D3NA 3T05A 2BG5A 3GVRA 1DJHA 4HKPA 1ZJAA 1S3TC 1PTAA 4POCA 4AIEA 1LL6A 1Q2SA 4BWLA 4GO9A 1KCZA 2ZWZA 4UTWA 1W5NA 3LMYA 4Z1AA 1AD1A 1B3YA 3HA1A 1FWGC 4B5NA 2G37A 2QMKA 1EIBA 2EGZA 4A35A 2O4QA 2ZXBA 2O92A 4EPKA 4Q8OA 4IIFA 1M1BA 5BZAA 3FW6A 4GIRA 2FPTA 2MUCA 3ONCA 2NQZA 4ZO8A 4Y8FA 3RIKA 4GVGA 5M5DA 1GKRA 3VCNA 2GJNA 4XZLX 1O5RA 1X7IA 3EOOA 3WQGA 3SGZA 3IJIA 4CN4A 1XLLA 4X2RA 3PTMA 3N9KA 1LLZA 4Y9OA 4YNGA 2GOKA 3UWZA 1VYPX 3PB0A 1XLGA 4RZ6A 4GJJA 4E3TA 5D2WA 4IIDA 4W8BA 3V5CA 3N34A 4DZIA 4AD3A 4YHEA 5HK4A 2WSRA 1F9CA 4HB7A 5I3KA 4HD5A 3UWUA 5I3GA 1GGOA 2CZ5A 3MKCA 4N6FA 5F4WA 2GFTA 1V02E 2RDXA 1P5BA 2PWVA 1C9DA 1HN1A 3ZVIA 3NQ2A 3AS1A 4GH3A 4PMZA 1QTWA 3O16A 1IT0A 1W8SA 2IS7A 3EB2A 2FMOA 2ZRZA 3NZ1A 3UETA 8TIMA 4P7QA 2PDMA 4N2YA 4ATWA 2W9MA 3H24A 5CPMA 5TNVA 1CGVA 3G1FA 3PZTA 2UWFA 1ZHAA 5IOBA 4M6PA 2RDTA 3E74A 4LT9A 2Z1KA 3PTQA 2QUTA 1IXPA 2ZTKA 1LWJA 2VZOA 3TLLA 1UWTA 1UR0A 3N3MA 1AW1A 3W28A 8RUCA 3LX9A 1FXQA 1VQTA 3ICJA 1LL7A 4I7UA 4XWUA 3SQMA 2YXXA 1YDYA 1YQ2A 1E0UA 3TQ0A 2DVTA 1XLJA 5I06A 3BO9A 4NP7A 2PDBA 3LGDA 3LNMA 3UCQA 3EOEA 1F6YA 4WX2A 2X42A 3S0CA 4GPNA 2I56A 1MXGA 3MYPA 3WQVA 3W2LA 1H5VA 1NIUA 1UP3A 3SIZA 2UY2A 4GIAA 4LCRA 1R30A 2OKOA 4KCTA 1JRBA 3LRMA 3BJSA 1D3CA 2PLMA 2Y24A 3GQYA 4PMRA 3G1AA 3MMWA 1QI3A 3INPA 3LTYA 3M46A 3LPPA 3WMLA 4G7EA 4Z42C 1OCQA 2WMHA 4Q3MA 4NQ1A 3DECA 4GD0A 2E8YA 4NNCA 4DZHA 2ZZ3A 1XDLA 3MYOA 4L7ZA 3MTWA 1JNDA 1QDSA 4NAFA 4MAZA 5BXRA 4IF2A 3LM3A 5U4NA 4I5RA 3DHDA 5AHMA 5BXSA 3N04A 2FIQA 3B40A 4PTNA 3EOLA 1E6XM 1EB3A 1RALA 4ORMA 4BEQA 3QMTA 4MY8A 1CW2A 2OG9A 3QPZA 5FKYA 3VMPA 5KZMA 5G4WA 2VC5A 4PMYA 4AMCA 5LNVA 1GVFA 4J1OA 3TX9A 2WMJA 1EJTC 2EKGA 3QVQA 2Q01A 4LAZA 4EP8C 3P5YA 2Q8LA 4X9YA 4PEEA 1X1ZA 2Q3RA 2UY3A 3S2MA 3XISA 1I8JA 4NVTA 3CL8A 4FLRA 4N02A 5CCZA 3PJUA 4JIPA 1BYBA 3E12A 4ZOEA 5D37A 4X0VA 1DJYA 4GUGA 1Q85A 2C0AA 5KZDA 1V3JA 5F2IA 9RUBA 4O54A 4AD2A 4C6EA 1QMLA 1V3HA 2Z7KA 1V03A 5DF0A 4DWSA 1NFBA 3UGVA 1OZQA 4YHGA 2HVNA 4UQCA 5T91A 1OEPA 3HG3A 2OZ3A 4P7RA 4Y9MA 1QWKA 4W86A 4L4PA 4YTSA 1IXNA 2ANUA 3KE0A 4IUGA 4PMUA 1M04A 4IL2A 2H3DA 3LTPA 4CCDA 2I1OA 3FEQA 1ZJIA 1BPLB 2WVTA 7TAAA 1ZL1A 2PDGA 2DH3A 2OT0A 2FB3A 1NSJA 4I3GA 7ENLA 4MPQA 4JTJA 3TNOA 2O7SA 1TQXA 3A21A 5CAHA 3CTTA 3QF0A 3QGKC 3UQNA 1H09A 4AW7A 3ZMRA 2CERA 2J9XA 2HK1A 4FSAA 2CLPA 2WKLA 1D8CA 1V6YA 2Z1XA 2EPHA 1YDVA 1CXHA 1HL2A 1FWHC 1UG6A 3VNJA 6PTDA 4K68A 4RCXA 1VHNA 1N55A 1GEQA 3RYSA 1F74A 1E4IA 3VIHA 4DBSA 2ZE3A 3KL3A 1XBYA 1OABA 2PCEA 1ZLPA 4DBDA 3S4TA 1FKWA 1Q66A 1NWSA 1W5QA 2XVGA 1XIHA 4PMXA 1V79A 2J7GA 3CH9A 4M0XA 2BS9A 1W31A 3E1F1 4BF9A 2CBUA 2QIIA 4WHBA 3SRKA 5FA5A 4UOZA 3WUEA 2GVJA 1UOZA 2PU0A 5FF7A 4EXQA 4RV8A 1XPYA 1XR2A 5HMFA 4GNKB 4AX6A 4LEFA 3NM3A 3AUOA 1G1YA 3FV9A 2AL2A 1RBAA 3AYRA 2ICSA 5CJMA 1X8CA 1BXNA 1OFDA 3CZ8A 4C91A 1VPQA 1WP6A 2C79A 1NDVA 2QCHA 5FI8A 2X30A 3FVDA 5BXTA 2YIHA 4ZVJA 1N82A 3FS2A 2GGHA 4JTUA 3PZQA 5GJMA 3OBAA 3I3EA 2DVUA 4PL2A 1XFCA 2DSZA 4H6QA 3TE9A 4DJDA 1EO5A 2C15A 3B9NA 1CDGA 1TJ2A 1ISWA 3OG3A 3SADA 4KBXA 1DJNA 3FX4A 4CD5A 3VXGA 4ACZB 4WF7A 1KGXA 4O8AA 4NI8A 3RMJA 4I7VA 1Y5XA 1LLWA 3DFSA 3PJWA 2EG6A 3DESA 3HPZA 3S1GA 4YYCA 4E4PA 3CV2A 4QFUA 2PWUA 4L80A 5I03A 3S6DA 5B7YA 1GQKA 1SW0A 5JMUA 1ICPA 1T41A 4A4AA 5HDRA 2OOFA 4LRSA 4LBRA 3RPTA 1FCUA 5I2UA 1QNVA 3S5NA 5LIWX 3NO5A 2I17A 4XZNX 1YBQB 3KAOA 1ITXA 2DZSA 1K7FA 1V0NA 3GS6A 4Y96A 1PWLA 3WNLA 2QJHA 1JUEA 1YYAA 3VIMA 3LRLA 1GOQA 1XSJA 5H8UA 5GNXA 1E9ZB 5D04C 1GK8A 5G1YA 3VFCA 1JDCA 4LOCA 3N2TA 2KZHA 5KEZA 1FOBA 3LENA 3T07A 1FH9A 1IR2A 5BNKA 1TWDA 1S2VA 3F2BA 3N3TA 4UWMA 3PNUA 5C71A 4KF1A 4LYPA 3T44A 1EGZA 1YXCA 4UTHA 1BYDA 4X2PA 3NPWA 3H4WA 4YYFA 1W5MA 4R7OA 4B5WA 1DQWA 4A29A 3GU9A 4IFOA 1PCKA 4PUDA 4F79A 1JCYA 5A6AA 4MLRA 2CYGA 2C1HA 1K4GA 1WYIA 1EXBA 1TV4A 3WEOA 5RUBA 1K8XA 4IHCA 4BR1A 2WNNA 3EKLA 5H2ZA 3LCLA 1DJWA 1KM5A 4M19A 4NT0A 3G6LA 1U33A 2P1FA 5EMKA 4E2DA 2PA6A 1TWZA 2WBKA 3TK7A 3CUXA 3UJRA 3DKLA 1KCXA 2NX3A 4M8UA 3PBYA 3D46A 4HA1A 2QJIA 3GG7A 3RX2A 1QT1A 3SB0A 1S5WA 5KETA 3DG3A 4HPNA 2A7NA 3HPSA 1ZBVA 3R89A 3IIZA 5BYWA 1CZ1A 2O0TA 3L9CA 2DZVA 3HZ3A 4LS1A 4IFKA 4U3CA 2PB1A 1YTEA 2A6LA 3CEPA 4Z0SA 2RUSA 4J3UA 1W3HA 4J3WA 1C8YA 3QY6A 3MSYA 3S46A 2BVYA 3W82A 3I6EA 4KEVA 1Q63A 4IUOA 3JVAA 3QW3A 3W85A 3E0FA 3I4KA 5AN7A 1QNSA 3EX4A 2PSNA 5AC8A 4TVUA 3QQWA 4U5KA 3P7YA 2A2IA 2HZGA 1C8VA 3GG8A 4PR4A 4ONVA 2INEA 2BTMA 3SSJA 4V33A 4DJFC 3Q67A 5AKQA 2YA0A 1EHAA 1XLFA 2C0HA 4UFKA 3UPBA 3TYBA 3GKFA 1AQFA 4HP5A 4YIWA 3U8GA 4NZ4A 4K1WA 1W9UA 4IIHA 4LH8A 2YCLB 2IQDA 3BSGA 3CMGA 4FXRA 4JY8A 4NYYA 4RW3A 4D8LA 4ZO9A 3W1UA 3EWZA 1TIMA 3EAUA 1J0IA 3AJXA 2Y1HA 4IICA 2REQA 4RV3A 2VZVA 4NI3A 3M41A 2V8ZA 2GZXA 2YDQA 3B8WA 3TVAA 4H19A 3MANA 5HJYA 2WSYA 3C61A 5LXXA 2PDJA 3A23A 4F9DA 1RD5A 5BW6A 3B8TA 4MFDA 2QAPA 4XTIA 1L8NA 1I2RA 4DEFA 4O17A 1FFRA 4Z0JA 2J13A 5CH9A 1REQB 1VF8A 1J0YA 3GAYA 1PAMA 4QNEA 2E8ZA 2ISDA 1QUMA 3BG5A 2E5DA 4NXSA 1FP9A 4M81A 3GC4A 4GFIA 1Q6DA 4MZYA 5LNUA 2DIJA 4E8CA 4A8RA 2Q8ZA 2I5QA 4GVHA 3VIGA 1VFOA 3KP1A 4XBJA 4BQ2A 4UTKA 2DT2A 4PUNA 4AXNA 1UR4A 2Z6IA 3CIVA 3FSUA 3WH5A 2DSWA 1H7RA 5E1QA 4JTGA 4AD4A 5LA1A 3IAQA 1AUSL 1I2OA 2VFEA 1CXIA 3V0TA 2ZVRA 2ATSA 3N9SA 1VKFA 3VVGA 2R1KA 4RXGA 1DTUA 5CEWA 2V2DA 2HPMA 2DT0A 1O60A 5A8OA 2HVOA 3GFZA 3TQKA 4RNJA 4P2VA 1DJQA 5C2XA 3O0FA 2A3HA 3BAWA 3G1XA 1XYCA 3S2CA 1BSLA 1JFHA 2ALRA 1SO5A 2V3GA 4I9TA 4J3ZA 4JY9A 5I3JA 5G1TA 1WV2A 3OLIA 5CC3A 3GVWA 3LDVA 3VM5A 4FS9A 4FMVA 1PUDA 4O1FA 5HJLA 5JH2A 1TPC1 3W1TA 2TPSA 3DG6A 4H8VA 4KIRA 1VFFA 4UTJA 5CJ5A 1OFPA 3TSMA 5I23A 1WOAA 2WMGA 1MEHA 3LCFA 1SGJA 4JFVA 3V18A 2X40A 3SUWA 1LORA 1D7FA 3TXVA 4MM1A 3MUAA 4OV9A 3IARA 1O5KA 3CZLA 2JKEA 3MP3A 3MUY1 3L5MA 2QMJA 4PULA 2AAAA 1H0IA 5HWMA 4S3KA 4W5UA 2AQVA 4EOUA 2QUMA 4D9PA 5HNTA 1EPVA 2JGYA 3TW7A 1DORA 3EPNA 3VKAA 3QMSA 1MEIA 4WVXA 1LOQA 1NH6A 3LGEA 3PPCA 4X61A 3I65A 2D1ZA 5KZEA 2IQ0A 4GUJA 1IT7A 3ONBA 5AHFA 3SQSA 3WL0A 1Y5VA 4Y6GA 3EEGA 1AQHA 4JTFA 3ABZA 3DAQA 4PCNA 4UMAA 5I79A 1GG0A 4Q32A 3W7KA 4EF9A 2XVKA 4WSHA 2POZA 1W3JA 3LHYA 4NZ3A 1WUEA 2BGNE 1RR2A 3OP2A 3BAIA 1J5SA 2IPFA 4DI9A 3T09A 3DDMA 2J77A 4RDYA 4GI8A 2X1RA 2Z4GA 4DAIA 1TUXA 3H2CA 2V30A 4JHZA 1AMKA 1UKOA 4AAJA 2ACUA 1RQEA 2FZ9A 3ZYZA 4QSHA 1TTJA 2JBMA 4UTTA 3HN3A 4NZCA 2V68A 3ES7A 5CC5A 3H21A 4HZ8A 4LYQA 3AIBA 2GSHA 3GR4A 1NQ6A 5FSDC 2BHUA 1FWJC 2YL6A 4GISA 3QPYA 4QX4A 2YCEA 3B0XA 4O0ZA 4J3XA 1VAHA 3B9DA 4AHOA 3WUGA 3UXLA 4WJEA 2WV8A 3LHVA 1UPPA 1GZJA 3B4YA 3KS6A 4A3RA 3WG6A 1IEWA 5CGTA 3VDGA 3ELFA 1X6NA 2VRQA 4Q4MA 2XN1A 4PSRA 3QZAA 1LBFA 3WCZA 2PI6A 4BF5A 3UYCA 1M7OA 2V5BA 4IXXA 1EGMA 3TTYA 3LZ3A 3T0TA 4ZODA 3T4CA 2DZWA 3C3NA 2PE4A 3H2AA 2QVNA 8CGTA 4QEEA 4UR9A 3KUMA 3BAJA 4N9EA 1Q6QA 2Y7GA 1BQCA 4F8XA 4AZIA 4Z1YA 3T2QA 1DHKA 4GQGA 1B31A 4W84A 2YBUA 2EBNA 4PTMA 2HVMA 1GVYA 4AG0A 4IPLA 5M17A 2C8NA 3V36A 3TYZA 4OTKA 4MZ1A 4XVEA 5AOUA 1A5OC 3SCTA 3SECA 4TXEA 2J7EA 2GQAA 1BWLA 4OT7A 1PL9A 3WFAA 4UQEA 3VOGA 3T2OA 5FEWA 1B3WA 2DJXA 2F84A 2HXUA 2Q6ZA 4JQ1A 3WD1A 4OECA 4P7NA 4GKTA 1PTDA 2PFHA 3EWDA 4TX9A 5C5YA 4MB4A 4JKKA 4P8XA 3A13A 1QPKA 1P0BA 4P8UA 4LF2A 3PBUA 3UJ2A 2FKPA 3VC6A 3VZZA 2A3EA 3RO8A 2NVCA 3VD4A 1OIMA 3ENLA 1I2PA 5L9FA 2PBGA 4FNTA 1Q7MA 1UWUA 4U28A 4JICA 4Y9NA 4JBRA 4ZQPA 1R2SA 4NUWA 4J3SA 3GVGA 1LYXA 4GO8A 5JVLA 4PFHA 4IIEA 3LTSA 3BGGA 2E5BA 1ZPTA 3IAPA 2P88A 1SFTA 1MDLA 3LHZA 3EX1A 3GUGA 1I2NA 2VQTA 2WVUA 1W3IA 2YCKX 4DO4A 2FZBA 1EJUC 2QCCA 1K70A 1IEVA 3GVQA 1B5TA 2PAJA 2VR2A 3QJAA 1IR1A 4OVXA 5ABFB 1UZ1A 1W8GA 2GUBA 4ACZA 3GZAA 5AC7A 5F2MA 3UY8A 3HQOA 1C29A 4C6IA 3H23A 4UIOA 3W7MA 1OBAA 4D6EA 1O5QA 2OQLA 1GYMA 3QPEA 2X0YA 4HMDA 1F3EA 1FWRA 5KINA 1S2AA 2NQLA 2OQHA 5I07A 3CHDA 4B5VA 1GT8A 2BXVA 1JRCA 5A2CA 3OGSA 4S3CA 2QCFA 5CBBA 3SRFA 1Q7ZA 5H91A 4O14A 1K9EA 3W2UA 1VFTA 4WOQA 4GFSA 4LBUA 3GU1A 4AVNA 4CN1A 1WZAA 4EX4A 2RKXA 2OZTA 1XCXA 4A2RA 3HB9A 1NVMA 4GJIA 1NQKA 3K1GA 4OWGA 4NJJA 3PB2A 1UBSA 3R94A 4B5SA 2Z2AA 1NU5A 4GVIA 3FHAA 1LRQA 2CLKA 4I90A 4MJMA 3OA3A 2XUCA 3FYPA 3S3GA 4EK7A 4WXYA 4Z1CA 5IXEA 1ISYA 2G3MA 4V1XA 1W0MA 5TQLA 4LY4A 3BXWA 2PRHA 3K1DA 2VC7A 3Q2DA 4QEHA 3VIJA 3VDHA 2NXGA 1R3RA 2DSKA 2V2CA 3W0KA 1Z9AA 4TR9A 3AROA 5EGRA 1QU4A 1ZUAX 2OU4A 3VE7A 4W8AA 2C1IA 2J8GA 1N8IA 4PTXA 2H3BA 2BSLA 4IIGA 3IVUA 4ZB0A 2CIPA 2PMQA 2E25A 2DQWA 4C60A 1ODUA 2ACSA 1TPVA 1HJWA 4F0MA 1W9DM 4QROA 4ZB2A 2OXNA 1RY0A 3L7RA 1GHRA 4KGLA 2W0UA 3G8EA 3MMUA 4C7GA 3S6OA 1F4AA 4HVXA 1KGWA 2QGHA 1FHUA 1JCMP 2H8ZA 4KCVA 4PUKA 1TPEA 1EP3A 3WDJA 5A8PA 1KRBC 1FKXA 4QGCA 1ZCOA 1J5TA 3D0CA 5HNUA 4S3FA 3MSGA 2ON3A 1R46A 1HP4A 1XWYA 3LBCA 3M4HA 2OLSA 3TU9A 4F40A 2NQJA 1L2UA 1MUCA 3SUTA 1BRLB 4QJ4B 2NV1A <