2J66A

Structural characterisation of btrk decarboxylase from butirosin biosynthesis
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
414
structure length
390
Chain Sequence
DQAEITALTKRFETPFYLYDGDFIEAHYRQLRSRTNPAIQFYLSLKANNNIHLAKLFRQWGLGVEVASAGELALARHAGFSAENIIFSGPGKKRSELEIAVQSGIYCIIAESVEELFYIEELAEKENKTARVAIRINPDKSFTAIKMGGVPRQFGMDESMLDAVMDAVRSLQFTKFIGIHVYTGTQNLNTDSIIESMKYTVDLGRNIYERYGIVCECINLGGGFGVPYFEKALDIGKITRTVSDYVQEARDTRFPQTTFIIESGRYLLAQAAVYVTEVLYRKASKGEVFVIVDGGMHHHAASPMEYIPLEKVTIAGPLCTPEDCLGKDVHVPALYPGDLVCVLNSGAYGLSFSPVHFLGHPTPIEILKRNGSYELIRRKGTADDIVATQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BTRK
publication title Structural Characterisation of Btrk Decarboxylase from Bacillus Circulans Butirosin Biosynthesis
rcsb
source organism Bacillus circulans
molecule tags Lyase
total genus 128
structure length 390
sequence length 414
ec nomenclature ec 4.1.1.95: L-glutamyl-[BtrI acyl-carrier protein] decarboxylase.
pdb deposition date 2006-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00278 Orn_DAP_Arg_deC Pyridoxal-dependent decarboxylase, C-terminal sheet domain
A PF02784 Orn_Arg_deC_N Pyridoxal-dependent decarboxylase, pyridoxal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.10 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 2j66A01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 2j66A02
1B54A 1SFTA 4XBJA 3WQFA 1L6GA 1TUFA 1HKWA 4PB5A 1TWIA 2VD9A 2OO0A 4LUSB 3E6EA 3OO2A 2VD8A 3HA1A 1EPVA 2PLKA 4WR3A 4QHRA 3WQGA 1SZRA 4LUTA 1VFHA 1VFSA 1BD0A 2PLJA 1NJJA 4ILSA 2QGHA 1QU4A 3VABA 3KW3A 3HURA 4BEUA 5GJPA 1L6FA 3B8WA 2RJGA 4BF5A 4ECLA 1XQKA 2ON3A 5FAGA 1KO0A 2O0TA 2SFPA 1W8GA 1XQLA 1NIUA 3E5PA 3B8VA 4LUTB 3NZPA 3GWQA 5GJMA 2DY3A 2NV9A 1F3TA 3NZQA 3S46A 2RJHA 3N2BA 7ODCA 3ANUA 2YXXA 5FACA 3R79A 3WQDA 4FS9A 4KBXA 5FAJA 4PB4A 1KNWA 2NVAA 3B8UA 4PB3A 4AIBA 3WQCA 4A3QA 3B8TA 5GJNA 4DZAA 1CT5A 3MT1A 3N2OA 3AWNA 3UW6A 3WQEA 4DYJA 2ODOA 3N29A 4LUYA 4BHYA 1XFCA 3LLXA 1D7KA 1HKVA 3C5QA 2TODA 5IRPA 5BWAA 4BEQA 3ANVA 2J66A 2P3EA 4V15A 3BTNA 4LUSA 3CPGA 3CO8A 4XG1A 1FTXA 1VFTA 3SY1A 3AWOA 1RCQA 4Y2WA 4ZGYA
chains in the Genus database with same CATH superfamily
3CQ0A 1HL2A 3UCQA 3IEBA 5HA7A 4I9AA 1HKMA 4C6JA 1BVZA 2E09A 4PCTA 4GIYA 4RUBA 3NNTA 3H2OA 1VFMA 1XYBA 3W7KA 1MRAA 1TV3A 4FP1A 1AA1B 3ITVA 3LYEA 1IF2A 1JDFA 1P0BA 2J6VA 1YADA 3HV9A 1A5SA 5AOUA 3D46A 2XINA 4QJ3B 1C8XA 4GGHA 4EP8C 4GQBA 2FTYA 2ZXBA 4H83A 4LGXA 3W87A 2QVNA 5AYXA 2VFGA 5EFDA 2YYTA 1UW9A 2G5WA 3A3HA 2CESA 4F0HA 3UG8A 2VGIA 1FWNA 4M80A 1HUVA 1OT1A 4C5ZA 2E25A 2BVWA 2QXWA 3W1TA 2UZ9A 1GYNA 4J40A 4KGLA 3KRUA 4WGXA 4QXIA 5CC5A 2XDFA 4Q8QA 4LY4A 5GJNA 5GNYA 3OZYA 1XDJA 4GH3A 4UNKA 1LLWA 3PHAA 5MHBA 2QCDA 5D2YA 3IRDA 4NP7A 4K36A 1EX5A 2D0HA 3MV11 4G1NA 4Y90A 2NQHA 2YA0A 1UYQA 3LSCA 3ANYA 1QI0A 4KWOA 3GR7A 1QNSA 2X0HA 1UJPA 1LTDA 3UWWA 3VNMA 2CLKA 3PNZA 1G6CA 2GOKA 1GPWA 3FAWA 3UCCA 1KTBA 1UMYA 4IMDA 3CAWA 3VXGA 4HNCA 1YDNA 2QPUA 5CJMA 1K4HA 1HKWA 4QG6A 1JAKA 5G2HA 3L4YA 4C60A 2JFEX 4JEJA 1ZAIA 1QRQA 2QV5A 3TN6A 2C18A 1FWTA 1H2JA 3TVAA 1UP2A 4AIUA 2C14A 3E0VA 5K7JA 4ACYA 3F7JA 3RYSA 2GUYA 3UXIA 2ZUWA 1G94A 2VGBA 3HV8A 4EF8A 4C6KA 3MI2A 4HCDA 4Q7IA 2FH8A 3W1AA 3WFLA 4CVWA 3EWYA 1G69A 4RDWA 4HVXA 1D8WA 3B8IA 8RUCA 2SFPA 4JFUA 4N2YA 3PC0A 5AHEA 4XV0A 2Z00A 2E5CA 4QJ1A 3B9DA 4GYKA 2D0GA 2NT1A 2H3BA 4ZENA 5D8ZA 1FUYA 2OMAA 3W7JA 4WZHA 1K9EA 2XVGA 3HPSA 4DF2A 5KSWA 4LUIA 4YLWA 3ZR6A 3G1HA 1JGIA 1TV4A 2VQTA 1JZ6A 3EWCA 2FH6A 2AKMA 4K8EA 2EBNA 5J5RA 1V6YA 1UJQA 3UF9A 1A0EA 1QW9A 4DX3A 5HMFA 3OZOA 3TC6A 3FX4A 2E1DA 1E0TA 1K9TA 2DPEA 2O55A 3W7GA 2RDTA 3IVUA 4A35A 3GTFA 2OOGA 2Y63A 3DFOA 4HK5A 2H6RA 2HDJA 2WMGA 1JJKA 1W5PA 4PUKA 1EQPA 5EBUA 4CN6A 5JH2A 3TQ0A 1SFJA 2RGLA 1VIWA 1F05A 3UZWA 4IPJA 1TUFA 1DJWA 2QUTA 3GDMA 1TJ1A 3OB8A 3VZXA 5HWNA 4WVXA 1EIBA 1EQCA 1HJSA 4W5ZA 2QQ6A 4IL2A 3E6EA 2ISDA 2AL2A 1R3TA 4KWSA 3WJWA 3GUGA 2Q71A 3L21A 1G4SA 4W93A 2VFIA 3LRMA 1WDRA 2NQ5A 3CV7A 3VFLA 1QHPA 3LCIA 1C9DA 1VP5A 3H22A 3TN5A 4AF0B 1BPLB 4CUCA 1VPYA 2RJGA 2FVMA 2WZMA 2DQWA 3SCUA 1J12A 1RVKA 5E6YA 1W2VA 4M7SA 2KAUC 4RZ5A 2QHAA 3LMZA 4N6EA 2QCNA 3BOLA 1D3HA 2I57A 4Z42C 4ZSTA 3QEZA 1QI4A 2PWEA 3P67A 3W7IA 3K46A 4ZOEA 3VIPA 2Y5JA 4ADTA 1H5YA 2FZNA 4ML9A 4X3ZA 5AYIA 1QPQA 1JRBA 3ZYZA 5M3WA 2PRMA 3F4VA 2A7PA 2WQDA 5KITA 2WBKA 2ZWYA 3FHQA 5BROA 5ABHA 1DXFA 4IFKB 3QGVA 3MYPA 3TUUA 4CU8A 5C2XA 3LCHA 1XR2A 1ZAHA 3ANVA 1TPC1 2Q8ZA 3AOFA 1LZOA 1VENA 5U4NA 1SFSA 1WDPA 4XVDA 2PUZA 1IIHA 3UWUA 4Q8VA 4QS6A 3E74A 3NZGA 3AI0A 4YVVA 5JUVA 2BY0A 3T4WA 1I75A 1KCZA 4JNYA 2J88A 2WMIB 2YIHA 1ZJAA 2Y8VA 3USZA 1NARA 3S83A 4H9MA 3W2NA 1IEWA 2YCEA 1OFDA 2EPHA 2GQ8A 2ZBTA 5F7UA 4HK6A 1UC5A 3RG6A 3MUIA 1GW1A 3BSHA 4WY0F 2IS7A 2CITA 4R53A 3D47A 3PWIA 2YL8A 2PWDA 2CHRA 1UKPA 2D2JA 5FL1A 3W7DA 4JX5A 3DUGA 2PDHA 4UFIA 1E5NA 4Q7BA 2NLYA 2G0WA 3WO8A 4O14A 3VNZA 1IT0A 5JH1A 1JVNA 2DSVA 5BOFA 3LTYA 4JL1A 4UWMA 1EC7A 4DLMA 1KQYA 2PC4A 2B4GA 5K9XA 3SIMA 3VX1A 1RY0A 3QV7A 1S46A 2QCFA 1TV7A 2V69A 4O54A 4WDXA 2YCKX 3KZSA 4MG4A 3G1RA 5CGQA 4RDVA 1JZ5A 1RD6A 4PYSA 1X96A 2JGYA 1H1NA 3G8EA 2VQUA 1VEMA 1W3HA 1LWHA 1QJWA 3S6DA 1US0A 2A5HA 4MMWA 3VD3A 1WXZA 4OIFA 2A85A 3FDKA 4GMEA 1ELSA 3C6CA 3BXWA 3WUGA 1SR0A 1M3UA 4HD5A 5DCDA 1ZBVA 4Z2HA 3NYDA 4UTTA 2D3LA 5CPQA 1UP3A 1SVDA 3AAMA 3N9KA 5CPNA 1I9CB 4N6FA 4PBGA 2WK2A 3SADA 5LNRA 4HA1A 3NQCA 5EKYA 2Z26A 3B97A 1GVIA 3NSMA 4NZ3A 1IHIA 3VOCA 1NQ6A 2AMXA 3FV9A 4G7EA 1AQ0A 5C7HA 1Q6DA 1AD4A 5PTDA 1SW0A 1UA7A 2E1WA 4GXPA 4MNKA 3W71A 4JN7A 3AXHA 1U83A 1QPOA 3LBCA 2Y8UA 3KDNA 4PODA 2INZA 4AWUA 5CBIA 3MKVA 2WVTA 3E12A 1XSIA 2JE8A 1ONRA 3UWVA 4TIMA 2VFEA 1E71M 3G6LA 1FOBA 3T08A 1JYVA 3I7RA 2QDGA 3TYCA 4H6KA 3BVJA 1KXVA 5HPOA 4NRRA 3FYYA 3UA4A 2XFYA 2GFTA 1J10A 2ZDSA 5FJRA 5XINA 3QC0A 3T44A 1TPFA 2QT3A 1AODA 4IX0A 3A22A 1W9PA 4OFCA 3C52A 4PBFA 3TLQA 1MDRA 4UMBA 3T78A 3L4WA 2FZMA 4LWWA 2OO6A 1CB2A 3ZVIA 2V3DA 1Y7VA 3V36A 1H7WA 3VNIA 2ISSA 2JBMA 4JTRA 3DFTA 4C7FA 2BG5A 2PBOA 3POHA 4JIQA 4MADA 3NXLA 1EGMA 1RK6A 1BD0A 1M53A 3PFRA 3E0WA 3EDDA 3ZR4A 3VOFA 3WD4A 3B8SA 1FKWA 5EB8A 4AIEA 4G7EB 1PIIA 2Q8XA 1FWBC 3AQUA 4GPNA 2VJXA 4O8AA 4S3AA 3ZQ9A 4JIIX 3QV8A 3THQA 3VC6A 1R86A 1V08A 1A49A 3U48A 1UD4A 2FZ8A 3RIKA 4UTWC 2DY3A 1XM3A 4XBKA 3RAOA 1KLYA 5FACA 2C91A 3PJTA 1BXNA 4U31A 2OR2A 1OB0A 4MWAE 4CQCA 4XKMA 4MPQA 1WCGA 3S4TA 3S1XA 1E4LA 2Y1HA 1N7KA 3GLCA 1EH9A 1UOKA 3NIYA 3SJNA 1TV5A 1TQXA 3GXDA 3QZ6A 3KS5A 1EO5A 1B3WA 3AO0A 1UZHA 2OEMA 3F03K 3DDMA 4JQ1A 3ZXWA 3UYIA 4CN1A 4Q4KA 4C1KA 4NZ5A 3NYZA 3BG3A 1J01A 3GDKA 1GVRA 5LNVA 1NAL1 3TJ4A 1JUEA 3UGRA 1CXFA 4FB7A 4ZCWA 3BLOA 3MWAA 2CU0A 3S2NA 4FALA 1CDGA 5BMWA 4IT1A 3WCZA 3XISA 1BWLA 3PZVA 1G7UA 2F2HA 3TONA 5FL0A 1O68A 2PDMA 3ITLA 3OEXA 2YR1A 5REQB 4EPBC 1XLDA 1S2VA 5KINA 4GY7A 3ZS4A 7A3HA 4GE8A 5KZEA 1XLIA 1E6PA 2AQVA 4NQ1A 4C7DA 2PDGA 1FWGC 4AHOA 2Y7GA 4JFTA 5D04C 4JTUA 5BOEA 2YLAA 3LCWA 3R43A 3WL1A 1VF8A 4GC4A 1V0LA 1EOMA 3N9SA 4MB1A 1Z44A 3CHFA 3G3DA 2NSOA 3FYPA 1OC5A 3EOUA 1HNYA 1LG1A 2NX9A 5A8PA 2XIQA 4M7TA 3T2OA 4DAIA 1J6OA 3T81A 4J9JA 3R10A 3B4YA 3M47A 4Q8UA 4PMOA 3NZ1A 4HJWA 3TDFA 3ZFHA 1UQYA 3FIGA 2HS8A 3WDIA 1NFPA 5K9CA 1ME7A 2Q3OA 3UETA 1G4TA 3LI0A 1T0OA 2JEQA 3QTPA 4W8LA 2JALA 3HQOA 4MY1A 4XWUA 2VRQA 3BLIA 3CBWA 4OWGA 1UG6A 3ITCA 2Y24A 1VIZA 4ZOAA 3CH0A 1X98A 2D69A 4KRZA 4XISA 4AZBA 4QLJA 2VEMA 3VCRA 2IPFA 4W85A 2GJPA 4GKTA 1MW0A 1A0CA 1TWDA 1RJQA 3O06A 3UP8A 3TR2A 4RZBA 4FXJA 3WEOA 4GI4A 2ISVA 4PUJA 2YL9A 1QDSA 1NSJA 4O4WA 4AC1X 3CUXA 3EWXA 1Y5WA 1M6JA 5J8LA 4IWWA 2BB0A 3NURA 3QYQA 4UCGA 1CGVA 3GAKA 2QIIA 1WDSA 4K6AA 3C8NA 4UMAA 2GK1B 1KM0A 3WMLA 3CZGA 4FF5A 2XM1A 5CCZA 4Y9NA 2EG7A 1LUCA 3B8DA 3BZJA 3PG9A 4V1YA 3LCXA 1FX6A 1XGZA 3AWNA 1ZGDA 1QW7A 2PDJA 3LRKA 1KRMA 2GUUA 2OGJA 4WJXA 4Q8WA 5G4WA 5F1UA 4JKLA 4CVUA 1WZLA 4J27A 1HP4A 1TPVA 3GFXA 1RH9A 3DYMA 2WLZA 3VIIA 3KBJA 3CUIA 3CZLA 4GYFA 5BCAA 4JGDA 1R2RA 1XDLA 4J2MA 4JIHA 3E2SA 1P6CA 3G24A 3S1GA 3KBVA 1TWIA 2DT1A 2I17A 4PUNA 2XVKA 4XQ6A 5A6MA 5DANA 4D8ZA 1RAKA 1UZ4A 4E38A 4K37A 3S2MA 4WUIA 2J74A 4H01A 4PZVA 3H7RA 3BO9A 1MZRA 2WZHA 1O5QA 1I2QA 2C1IA 4JXCA 3QBUA 1W3KA 4GIRA 4FXFA 4LVFA 2NV2A 2OCZA 3IAPA 4JQ3A 1SU5A 1WYIA 4UTTC 4AUBA 3ZJKA 8XIAA 3RU8X 4R7JA 2G50A 2YDSA 1CLXA 1EBHA 4C7GA 3UVAA 4ROQA 4H1ZA 2J8GA 2NX1A 2GVLA 3WNNA 3AYSA 3GRIA 3K4WA 3B8TA 1W54A 5JBEA 1JZ2A 2DSWA 3MU7A 3FOKA 4Q8MA 4H9YA 3HF3A 1Q63A 3C5QA 1ICQA 2FHFA 1JCXA 4AZCB 1EL3A 2QVHA 4MUZA 3F2CA 2PF0A 3STGA 3UXDA 2QUNA 4C91A 3AHZA 1FWRA 3QFWA 3URNA 4DM1A 1TO3A 3O16A 3PPGA 3LHWA 1QHOA 3T8QA 5A6KA 3NQAA 3GK0A 3PULA 5D9NA 1A53A 4HKPA 2GQ3A 1NM9A 3WH5A 5EMUA 3WH7A 3TYUA 4LCSA 4LU0A 3NEHA 4JY8A 1MRQA 1SZRA 3UR2A 1HKKA 1YNYA 1XIDA 3UYCA 4RJEA 5G2IA 4GCAA 2VCAA 2P76A 3PAJA 3WQ5A 1WZKA 4BF5A 2AQOA 1OADA 4KESA 3NEVA 4MJZA 3VIGA 4H04A 1V3HA 3RUBL 3ZWTA 3SRKA 4RXFA 2R1NA 4JFWA 2Y4SA 3TIMA 4DO7A 3AYVA 3SBFA 2Z29A 1K3UA 4ZQPA 3SB0A 3AMDA 2Z7KA 4ZXLA 1KNWA 8CGTA 4Y9OA 1MDLA 3DESA 4HB7A 1GZGA 2Z1KA 1S5MA 4I8YA 1GJWA 2XN1A 1KGUA 1TPWA 4D6HA 4B9ZA 4E3VA 3IAQA 1JUBA 3BW2A 1YLVA 2VUYA 1GONA 2CZVA 1FDYA 3RLUA 4GVIA 5BRPA 5I2UA 1LQ0A 1TX0A 3CO8A 4CGTA 2C7FA 1HX0A 5H91A 2O7SA 1P0KA 5DMMA 4JKMA 2FMOA 4O12A 4AD4A 1RJPA 3TOYA 2E8ZA 1EYWA 3WLIA 3FYOA 3GDLA 1UQZA 4QEEA 3TW9A 4N9BA 2FFCA 3H2AA 3CGTA 2GJXB 5CH9A 2J75A 1I1XA 4JX4A 5AHNA 3LDVA 5HQLA 5AECA 1E55A 3WEMA 1XRVA 3CC1A 4AC7C 4E3TA 4ZSUA 1EJSC 4JIRA 2JIEA 5JBFA 4WSHA 3M46A 1A0DA 4EPEC 1B9BA 1NY1A 3S1VA 1YE4A 2PB1A 5IHSA 3PAOA 3WD1A 1UUMA 4JN8A 3TU9A 3TLLA 3I65A 4KBXA 1BSLA 3L0GA 4M19A 3LMYA 1H41A 1JPDX 3RCNA 1TTJA 4N9EA 1OGGA 3VOGA 4B5XA 2OVLA 1XRTA 1Q6OA 4F2UA 3AISA 3U4AA 3MV01 5C0QA 4P8XA 2D73A 4A8NA 1E9YB 3ARTA 3CUJA 2QMJA 1DJIA 3N2MA 2IW0A 5IHRA 1BTMA 3F5KA 3B03A 1QK2A 4QAWA 1XLLA 1JULA 4MPKA 2X1UA 4L1GA 1HG3A 3N2CA 1U30A 3DOPA 1TYGA 1AL7A 4E4FA 2GJLA 4K2SA 4D6JA 1HL9A 3DN5A 3L12A 1HKIA 2F9RA 4NJHA 1TTPA 2AMGA 5D09A 1TJPA 1W1YA 3CMFA 3D6NA 2EHHA 3UCDA 7TAAA 2OO0A 3TN3A 3G1XA 2W63A 1JR1A 1ONWA 3WX7A 3V5FA 3S2JA 4ZOBA 4GOAA 1IR1A 4S3EA 5B7ZA 1NELA 4L65A 1POJA 1XC6A 1VHCA 2ZRWA 1TTIA 2ACRA 2XUCA 5CQ1A 4Y9AA 3DGBA 1LF1A 3EXSA 1VCFA 4GX9A 4LS1A 1GQKA 4MZYA 4MOZA 1YPFA 3DI0A 3EPOA 3WF3A 4C6MA 2ZUMA 1YTEA 2D20A 3NOEA 4YTUA 3O7UA 1H7NA 3Q4DA 3PWAA 4GZJA 1FHVA 1Q4NX 1W9DM 4WDWA 2P8BA 1GZJA 3JVAA 3R8GA 2EPNA 1EOKA 3SCOA 3KP1A 2A3BA 1T6MA 3L5MA 3WQ6A 3GKAA 4YIWA 3G1DA 2OLHA 2C1HA 3B40A 2JK2A 3ARWA 3AU6A 3VOHA 4FR6A 1ITCA 3S5OA 1MWOA 1B3VA 3T55A 3W2MA 1O95A 3E2VA 1TPEA 1TUXA 2HRWA 3C2EA 3U8GA 2VFDA 1LRNA 2VM8A 4HU3A 4UQ9A 3WQ8A 1UD5A 3KW3A 4IGSA 4NNCA 1EA0A 4J1OA 4XBJA 1BWVA 4P7LA 3O05A 2V68A 3DECA 1K8CA 3QGAC 1X7IA 2C6QA 3WDRA 3C86A 2JF7A 1XCFA 3HG5A 3PF3A 3CUGA 2C71A 3UERA 1JG9A 5AC7A 3FXGA 2V3FA 4KEMA 3AMGA 2J62A 4Y8FA 3K8MA 5HOSA 4O4VA 2FPYA 2WM0A 3BCDA 3UGVA 1V6UA 2VZUA 4DBWA 2VURA 1YHTA 4AMCA 2WKGA 2DT3A 2WYSA 3M43A 5TIMA 3VDCA 1XQKA 2XGIA 4QDPA 3IJIA 5I00A 4IISA 2HVNA 3EPMA 5FSDC 4QE5A 2VC6A 3CU2A 8A3HA 1WZMA 4UCFA 1R3VA 4O19A 1IXNA 2Z25A 4AZ5A 5HAOA 2G8ZA 4U28A 4GQQA 6A3HA 5AC6A 2DIEA 1R47A 1EJUC 3DYPA 1PHQA 1SO6A 2QS8A 4E4PA 2PWGA 4A21A 3SCRA 1RQEA 1IZCA 1K6WA 1OFQA 3L67A 4UBPC 3EMZA 1MSSA 4HU4A 2BHZA 1IEXA 5A2BA 1VHNA 5D05A 1MEIA 3ITGA 4HMEA 3NQVA 1A5AA 1Q65A 2QCMA 4PSPA 4N9CA 3K8LA 1PYFA 2WSQA 3IGHX 1QASA 4J3TA 2EG6A 2OODA 1XYZA 1PTDA 3S2CA 2ZVRA 4AZHA 4JTTA 1XIGA 2CZ5A 4O15A 4LQ1A 2XH4A 1SW7A 5DMYA 4N4PA 4AB4A 1RZMA 1ZBKA 2BLEA 1PCKA 4KW2A 4YWIA 5FF2A 4KS0A 2IPWA 3MP4A 1ONXA 3LB0A 4PMDA 5FJIA 3HG4A 5HMSA 2I5GA 1BYAA 4XX6A 4ZO6A 3GHSA 1DIOA 2JKEA 3OG3A 1F9CA 4PMRA 4QQUA 1QTWA 2VWTA 5D32A 3TYEA 4DUOA 4ICNA 1Q85A 1RBAA 2OEKA 1FWFC 1E6ZA 4JS3A 1FWSA 4HNNA 1DBTA 3GD6A 2Z24A 2NQZA 2WZIA 3T42A 4FS9A 5KZ6A 4HNTA 4MLJA 2DUAA 4PEEA 3IIVA 3QV9A 5IDIA 4WRHA 4C6EA 3JR2A 4PTXA 5T91A 1XLEA 2O9RA 1JUKA 3DCPA 4BHYA 3JZUA 1HO1A 5JVLA 2TODA 1VJZA 4LJ3A 3W1NA 2A79A 2PI6A 1O12A 1F61A 3TV8A 3W70A 2PRLA 4BI6A 5H8MA 2PP0A 4TTGA 3CPGA 2MANA 1AL8A 5CLWA 5A6SA 3F2DA 1EO7A 1XIJA 3VDBA 2VDIA 4O1CA 4NZJA 3TTYA 4KCVA 2DU2A 4PH6A 2YA1A 5AVHA 3RITA 4HOZA 3AHVA 3O6AA 4QIUA 4K8GA 4HZ6A 5I03A 4L80A 1JCTA 2FVLA 4JHMA 1GEHA 1DVJA 4W8AA 4QHRA 1EGVA 3N34A 4UFLA 5DCEA 3CWOX 4AWSA 3R6IA 1EDQA 1A3WA 4FA3A 1NWTA 1D2KA 2CYGA 2GDUA 3WBWA 1C29A 1DV7A 5DRIA 3I4EA 4QM1A 1HT6A 1XLAA 1RCOB 4JICA 1GUVA 1ZHAA 1JNDA 1BG9A 1UR9A 1I8JA 3APGA 3KS6A 4M6VA 3BSGA 4RNHA 1QUMA 1LM1A 3N3TA 3ZLGA 3AZTA 1X7FA 4B5SA 1E43A 1E0WA 2R94A 5ABFB 4U3AA 1LLZA 3BLDA 4IZGA 4MKVA 4ATLA 3SUUA 4QJ4B 3ONCA 1RJRA 1I60A 3LV5A 1BF2A 5HULA 2DSUA 1LORA 1OK4A 4U5IA 1XSJA 1JIBA 4NNBA 3P5ZA 1R2SA 4IJRA 2PTDA 5T9CE 1EEXA 5CBBA 1P7TB 1X6LA 2GDVA 2E4TA 3HGRA 1F74A 1AG1O 3TXVA 2XISA 1GYMA 4H6EA 5I5RA 1QFEA 1B90A 4QROA 2ZDRA 3EOLA 1E40A 3WF4A 2G3IA 1QT1A 4GY0A 2ACSA 4LUSB 2VDHA 2RH9A 2XGZA 1DL3A 5C2GA 3I7QA 5MKGA 4IG2A 3TJIA 4CQDA 1V79A 2WMJA 1V6VA 2E9BA 1SO4A 3W86A 1P1XA 3RN6A 3BMWA 1EJXC 2D0FA 4ASTA 4K1WA 4FNQA 4WK9A 1US3A 2E5DA 1FH8A 2CLFA 1JXKA 3AXXA 1XRFA 2YL5A 1EBGA 4Z1BA 3FVDA 1A47A 2UBPC 3IS4A 2HCVA 4QNEA 5I3KA 2PFHA 4F2BA 4M82A 4C6IA 4AVNA 1QNOA 3EA2A 4H9UA 1W0MA 3CHCA 3PN8A 2QDHA 2HJPA 1O5RA 2WLYA 5A95A 1OX4A 2VRKA 1H7XA 4KIRA 3WJZA 2TYSA 3M44A 4O53A 2W0UA 1YE6A 4ZL1A 2DZUA 4GISA 3R0UA 3O6DA 4EWJA 3CNYA 4GI8A 1GOWA 3CL7A 3RJXA 1LOLA 4AIOA 2CKRA 3SCWA 5LIUX 1KFJA 1H7RA 2ZICA 2J7BA 1V3MA 4GJIA 4LAMA 4CCDA 1FBAA 1PWLA 5FIPA 1DHKA 4JBRA 2J9YA 3G0SA 1UR0A 4GFSA 1XP3A 2PMQA 5GQBA 1JL8A 4QE4A 1FVPA 1Z42A 1WO2A 3IJ6A 4UTKA 2Z1SA 3MUZ1 3EZ4A 2X40A 4OOZA 1QOQA 4QCFA 4LALA 4Z0JA 2WM1A 3KDOA 1RQBA 3UBPC 3ZO9A 4EXQA 4H6RA 5I3GA 3W7QA 2VOMA 3UZ5A 3FJNA 4KIEA 3RCYA 3KRBA 2ZUTA 1TR9A 2BDQA 4BQ5A 3M0HA 1PKLA 1P0EA 2ZC8A 1SO3A 4JQ4A 5A69A 2FGZA 2PZ0A 4NL1A 1XLGA 3MSRA 1UWIA 3PB0A 2GQAA 4WKFA 3BUVA 2G95A 5AZ1A 1QATA 4B2DA 2P3ZA 1F3XA 3VO0A 3UR7A 4NILA 1BXCA 3KVLA 4AIBA 4LW7A 3WQOA 4MJ4A 1H7OA 3TQVA 3SR7A 2DV0A 5E9XA 1Q6RA 1J9YA 1K4GA 3VCNA 1GKPA 1TE1A 4I7WA 3VIHA 4O18A 6ENLA 2X16A 4Y8EA 3KAOA 4IIHA 2W27A 3SY1A 4D8LA 5J5DA 3RO6A 3CS2A 1WAUA 1E3XA 4FNPA 3O9NA 1T96A 1F8MA 3ARQA 4PCPA 1UWTA 2XVNA 1RLDA 4R7OA 5C54A 5GNXA 4DJDA 1UR4A 1R3SA 2XU2A 4TX9A 3GAYA 2ZOXA 4JIEA 4CD7A 4E2BA 1LCOA 2BS9A 3B0XA 1KFLA 3JU2A 3GDTA 4PTNA 3N9RA 3RPTA 4EX4A 2Y5EA 2BVTA 3VTRA 1YTDA 3RR4A 2E6AA 4LUTB 4GK8A 1CGUA 4JAWA 3PPHA 5DY2A 1J8VA 3R12A 2OQHA 4B5UA 4LBRA 4L7ZA 1F6YA 3GU2A 3EAUA 4ZVJA 1SZEA 3WN6A 4ICMA 2BBFA 2PAJA 3TTOA 2BOEX 3OIXA 2NVAA 3F4WA 1PZ0A 3SECA 2YBVA 3ZSTA 4DHGA 2AQWA 2H9AB 3NPVA 5DXXA 1B3XA 1ZFJA 1FWIC 3MTWA 4H7ZA 2QULA 1WXYA 1JEZA 3P6LA 2F8QA 3MMWA 1KCKA 1B57A 4ZQCA 1NH6A 4MFEA 4XG1A 3T8LA 4HPJA 3PPFA 3QSRA 4NZ1A 3VOIA 3BARA 3VILA 3GVRA 3W7OA 5HK4A 2W67A 4DO6A 4JZ5A 4OKDA 4A8IA 4KQNA 3W7EA 3MS8A 1GG0A 3QR0A 4U4MA 1JYWA 4QBXA 1VYPX 1XLFA 7REQB 1YQ2A 4EACA 5JU6A 3H4XA 1UR8A 1VFSA 3FFSA 1C93A 4B3ZA 2WVSA 1JNEA 2DIJA 1V6XA 1J0IA 6REQB 5E09A 4RXGA 2DFAA 3VIMA 2V67A 4MYAA 2NV1A 2CFFA 4B15A 4A3HA 3MUY1 4XAZA 4WXZA 4LSBA 4ES4A 2QMKA 4E0CA 5CG0A 2BXVA 2V5KA 1U1HA 4I6KA 1WKEA 4V2XA 2PODA 3WLKX 1YPIA 4DEFA 4MJ2A 4CD8A 4PUWA 1RHCA 3SFWA 1UBSA 1A80A 3IJ7A 2CLPA 4XTIA 4WKHA 1DOSA 2UV8G 5D2VA 3DIPA 4GZ7A 3PANA 1CXKA 2XYLA 3ZOAA 3OBEA 3O8AA 1KFWA 3ZVHA 1GCYA 2ZE0A 1WUEA 2J66A 3UD6A 2G3JA 4GZEA 1F3EA 1Q6FA 2YZ5A 3OBKA 4WXYA 1L6SA 1ZB5A 1A5KC 4AQLA 3GXPA 2CETA 3INPA 1V4YA 3PZTA 1L6GA 3AYRA 1R0MA 4LX4A 2V3GA 5HWMA 5CLTA 4XAGA 4NAFA 2YPIA 3RM8A 3N2TA 2H8ZA 1J2WA 2BSLA 2E6YA 4M1RA 2FHCA 2DUXA 1MMFA 2RFGA 4C6CA 3REQB 1OFAA 5T26A 2XSBA 2WVVA 4ENLA 2QNEA 4DPPA 3HMJG 3W9ZA 4NX5A 3NUKA 3DI1A 1S1PA 3TKFA 3W7NA 3VA8A 3M0IA 1ODUA 5LA0A 1JDDA 1XYFA 3QY8A 1M7XA 4FAMA 3EEGA 3SRHA 3CPUA 4WY0A 2VELA 3EDKA 3AZRA 4YTTA 1Z32X 1TVLA 3CMGA 4TU1A 4Q4PA 4UTUA 3GYCA 2I1OA 1IGWA 1AK5A 1W1A1 1XXXA 3LPPA 2ADAA 1IXQA 2NXGA 2XVLA 3MB9A 4KCUA 3WQPA 4HNOA 3IACA 3M64A 1KW1A 1XRSA 4YWSA 3UESA 4DUVA 4LCRA 2V30A 3PBMA 3TE9A 4IMFA 1FWWA 2OSXA 1VRDA 2FZBA 3NDOA 1NF7A 2IPGA 2ZC1A 3P93A 3R94A 3WBXA 3ZSSA 1H0IA 3GU1A 1NWRA 1ZUAX 3VZZA 1TWZA 2Y7EA 1KQZA 2O0TA 3J7HA 4HPNA 4KCTA 1B4KA 2WC4A 4WF7A 1XYLA 1FDJA 5DY3A 4QDWA 4NVTA 1SQ7A 1GKQA 1V3JA 4DLFA 3VMPA 3PWGA 1H61A 3AJ7A 2E40A 1TMLA 2JIWA 4F3HA 5I24A 1R85A 2FJUB 1XV8A 4D8AA 5LNUA 3KBNA 3XIMA 1TPDA 1CXEA 4GUFA 2VTFA 3BC9A 3E0LA 1HKVA 3EKZA 3NO5A 1ADSA 1Y5XA 3D0CA 4EK7A 4C6BA 4GIEA 3TK7A 4B5TA 3PZGA 1LRTA 3BTNA 3IK2A 3TW6A 1QPRA 3QVQA 3W24A 2DZWA 2ZADA 7XIMA 2DZTA 4ZGYA 2VHLA 3KBSA 1KFCA 2QCEA 1VR6A 1ZS2A 3GXIA 3ZLFA 5D38A 4GQRA 1F07A 1KRBC 2FHBA 2POTA 2PC8A 1R8LA 2QAFA 2QGHA 3HTWA 1K1DA 2W5FA 3EKGA 1PDZA 1XS2A 1GOKA 1OINA 1Q45A 4IPIA 3HURA 1FWEC 4DZIA 3E96A 3M41A 4E8DA 3SY8A 2PDUA 5HUPA 3LZ5A 2QUVA 2GOUA 3S42A 4DVOA 1EFZA 1KB3A 1WP6A 2A3CA 1PL9A 4XZ9A 4LC8A 4JNZA 1HVQA 1E1CA 1MQRA 3C56A 2VCCA 4EE9A 4F0KA 4PR4A 3LQLA 3TQKA 3I10A 4QTGA 1YDVA 3WIJA 3LTPA 2Y7FA 3M1ZA 4PUEA 4OTKA 2BODX 4UTMA 5F4XA 1BVNP 4JTCA 1M68A 5AYYA 2BY3A 2RUSA 4JEQA 5EYWA 2Z0IA 1R5YA 2C3ZA 1SW3A 9XIMA 1DQXA 2WKLA 1W5OA 2BGNE 3P8IA 2R1LA 3A9IA 1LBMA 3TC3A 4M3PA 1SFLA 3BV7A 3NWRA 3SCTA 5CAHA 4E8GA 2P1FA 2F6UA 1A5NC 3UG3A 4YPJA 4HSHA 2Y61A 1WOAA 4HHHA 1K70A 1PPIA 4DXKA 1P48A 2XFFA 4ADUA 3IGUA 3LCFA 4LS0A 1XISA 3PZIA 3TFCA 3PBVA 1GZ1A 1ECQA 3LHVA 4X9YA 1B0IA 4F4RA 4AWEA 3NOYA 4HU8A 4AX7A 1EUAA 3FGCB 4Z1CA 3R5EA 3VGFA 4MB5A 4DELA 3GNRA 2VR5A 3A23A 3VGDA 1UHVA 1S5WA 1LL4A 3KHDA 4O1EA 5EPDA 4J5NA 3TYDA 3HFYA 6XIAA 1RR2A 5GVJA 1I2NA 2XM2A 3KOXA 4REQA 1V7AA 1XIMA 3LGEA 1EWDA 3OLGA 1HJQA 4D9PA 5IRPA 3CMJA 5LXXA 1DJHA 3LLDA 2R9RA 4IIFA 4MWAA 1JPKA 3KVKA 1TVNA 4U5KA 4ONVA 2E3ZA 5BXTA 3QY6A 4UFKA 3IWPA 4O1DA 4TVUA 1QW8A 1E6QM 3I68A 4S2CA 2CZEA 3EPNA 3QMRA 4DWSB 3TZNA 1E70M 5DX7A 2E6DA 4GACA 4AISA 1P43A 3DKLA 1LT8A 4L1WA 2FB3A 1Z48A 3A24A 4J7RA 4V33A 2A4AA 2X0SA 4BCEA 3CIVA 3VNDA 1QWGA 3WBYA 2Q02A 3K8KA 1W9BM 3U0HA 3B05A 5C9UA 5M1TA 3L4ZA 4F0SA 4HA4A 1Z7AA 3EX1A 3OVQA 4PFMA 2J9ZA 3OOQA 5LKYA 2VX4A 2A7RA 1KM1A 5SWUA 3CQIA 1CPUA 3FLUA 1UZ1A 1AVAA 4H19A 3A21A 5AC8A 3CL6A 2OYKA 1CT5A 3VDGA 4CLMA 4OHQA 2A3LA 3NQGA 2V2DA 3O0KA 3PBGA 4JHZA 4D1JA 3L2LA 2NUXA 2G4FA 2PSNA 3KTXA 3UQNA 4C1NB 4MWAB 1JZ7A 1LYXA 3TH6A 1VBGA 5FJPA 3H12A 4K7YA 1JI2A 2C13A 4X0NA 1BG4A 4AWTA 3RFAA 5H2ZA 1EKOA 4CD4A 5DMNA 1EA9C 2BV9A 3RK8A 1K6AA 3B0VC 4DUXA 3U2CA 4F0RA 1IEIA 2PDYA 3C0QA 1ZJIA 3LPGA 1DWAM 3GY1A 1FCUA 1S2TA 3LXBA 3SUWA 1HN1A 4XKYB 3C61A 1D3CA 4ZFCA 3LCGA 2XN0A 3DFHA 1VBJA 4R34A 2PURA 2Q6ZA 2OGYA 1OM0A 2HISA 3II1A 5CC7A 4ZO7A 1R7AA 3ZJ7A 3FA5A 2XVPA 3WQWA 5C9RA 1U1JA 3WLQA 4X63A 1QOPA 1HIZA 3CEPA 3SQSA 2NZLA 1MFUA 4JTDA 4ERGA 5AC5A 3SM0A 1W1VA 3R79A 2GDQA 5CC6A 4M29A 4PB4A 3TCSA 2JKPA 2ZYFA 2VZTA 2OB3A 2J7FA 3R8RA 3NG3A 2QPXA 4K39A 3HOJA 4OE7A 3GU9A 3VU2A 3TXZA 4B3LA 3HG3A 4ZQOA 3TWBA 1V8EA 1Q13A 4GBUA 2CKSA 3E49A 5CZTA 3U9IA 3CYVA 1ML1A 1MUWA 4LEQA 1MFVA 1UWAA 2Q8LA 3NQFA 1AW1A 4NJIA 4L6HA 4NXKA 1HKJA 5LHFA 5DO8A 3WNOA 4GI6A 4V27A 1CXIA 3PBWA 1TA3B 1BLIA 5KZMA 3ZT7A 5FJJA 3M7WA 1K7XA 4Q22A 4BA0A 1Z6KA 4A2SA 1KGWA 3LRLA 1U5JA 1GORA 4QFUA 4DNHA 3AALA 3T2QA 4PMZA 4GNKB 5KTLA 1ZL1A 3LUTA 2NW0A 1JCYA 3TROA 7PTDA 1TSIA 1TV8A 4H41A 4F66A 1YIXA 1W6TA 1KM3A 5HNTA 1QNQA 1BAGA 3MSGA 4QSHA 1SGJA 1JF5A 1TX2A 3ZT5A 1BEUA 3PUDA 4ECLA 4H8NA 3DG7A 1T8XA 3GNNA 4GGBA 2WC3A 4I3GA 5BXSA 2J7GA 1JYXA 3OLEA 4EWND 4NAEB 1TVPA 4F9DA 1ZP4A 1S2UA 4J3UA 2CEQA 4HYVA 4O8RA 3W75A 4MHBA 3BCJA 3BMXA 3NZRA 1DQWA 4L56A 5CPTA 2RDWA 2B7NA 4WD0A 4NHVA 3W1RA 1C7SA 1E0XA 3ZR5A 5BWAA 4A8LA 1E72M 1QOXA 4H6QA 2WO5A 4NSBA 2E9MA 4IMEA 2V0TA 4Y2WA 2PD5A 3MCMA 4F40A 3G5EA 1VRXA 4GINA 1W5NA 3ARVA 1WXJA 1KXHA 4NKCA 4IFRA 3VKCA 3SCSA 4YVXA 2R14A 4B3KA 4IPNB 1BQCA 3LY0A 3U6WA 3DGRA 4GVFA 3U5YA 3V4BA 1XG3A 1TB3A 4C90A 2LLEA 4FSAA 3U2ZA 3G1SA 1S38A 4BF7A 1L6YA 3O1NA 3OYZA 1XLCA 4YYCA 3GTXA 3SUVA 2VDGA 3TYZA 1JI1A 1GW9A 1GVEA 4POCA 5DN1A 3W1XA 3LEPA 1S2CA 3FAXA 4FLRA 1QI5A 2XSAA 4URIA 4LV4A 3NCOA 2IQDA 1BSIA 3CAVA 1P0DA 3NPUA 4K68A 3TWAA 1MQQA 2PDQA 3ARRA 4DZAA 1B4EA 2EO7A 3G1AA 3GW0A 4Q4QA 1EDTA 3UR8A 1C8QA 3CZKA 3IARA 4MNMA 4Q8PA 4QGCA 4KFNA 3V0UA 3GHRA 4CQAA 1B1YA 5DRCA 1XGEA 2Y5SA 4LC6A 4HYWA 3H21A 4CKQA 1SZFA 9RUBA 4G6CA 3GVQA 3KOZA 1SFTA 1DTUA 4R88A 4P7NA 5C6MA 3KHJA 3KZPA 3BDKA 4GXMA 1CLKA 3STEA 4LXFA 4DUWA 4KWWA 1AH4A 2WMKA 4OBTA 4AEOA 5XIAA 2PBGA 3QOKA 3QFEA 3GXTA 3QSTA 3EB3A 1LQAA 4LT9A 4GUHA 3KCJA 4UOZA 3SCNA 4B9YA 2ZWZA 4PMYA 2PP3A 1C3FA 3K5XA 3KWXA 2ZTJA 3VPLA 5FF0A 2GL5A 1D3GA 1SO5A 4H8VA 3SO7A 3GO2A 1H62A 4IIGA 3T0CA 1R3RA 2XIJA 3NZQA 2CWNA 2ONEA 4ACZB 1NOUA 3GHUA 2R6OA 4EXAA 2G3NA 4J4KA 5H8PA 5I77A 4J3VA 4XO7A 3UNDA 2WNZA 2JGQA 4FK9A 1H49A 1XWYA 1A3HA 3ATYA 4FPSA 4NYYA 1EP1A 3BANA 4RE3A 4W5UA 1PUDA 1YDYA 1KKRA 4BK9A 1B5TA 3BJFA 1UMLA 2C15A 6CGTA 3U57A 4UC5A 4EAMA 3L7RA 1TRIA 3PFMA 3TAKA 3R25A 1XYCA 1I4NA 1GYLA 2ZUUA 5F1VA 3T2PA 4GX8A 2ABBA 3GC2A 4AXNA 1MXSA 4IL0A 1A5CA 3WLTA 5LIWX 3OPSA 3LTSA 4BR1A 2BOFX 4AF0A 2WHMA 3Q58A 1OGSA 4GYPA 2ALRA 2DP3A 2OWWA 4WOZA 1YRRA 4GQ0A 2Z2AA 1VYSX 3BCFA 1N2VA 2DZPA 1Q7QA 4JD4A 1VFUA 3LBOA 3UJEA 2J77A 1L6FA 1UUQA 2W6RA 1FWHC 4MB3A 1ALDA 1CXLA 4W84A 1A4LA 1PTGA 1T99A 3ZM8A 2QZRA 3GIYA 4HSOA 4ZQRA 3H7VA 5E6ZA 3UXLA 4JTLA 2X1TA 4AY8A 4IFKA 1RP8A 5C7VA 3RM4A 1O7AA 3BLPX 3KOYA 3N04A 2XFWA 3B06A 3BURA 4TO8A 2OZ3A 1WA3A 4M51A 2EJAA 1RBOB 2PGFA 3LENA 5FEWA 5JQ9A 5HJLA 4XZWA 3UY7A 2Z4GA 5FOOA 1LL7A 3CB8A 3ITXA 1G4PA 4IQDA 3WNMA 2BWGA 2WMIA 5CPOA 3LN3A 1OIMA 2VFFA 4KT2A 3ALFA 4QS5A 2D1ZA 5CSYA 3HQPA 4IXXA 1HP5A 2WOQA 3N25A 4WJEA 4BF9A 2IKJA 5TF0A 3THDA 3AIEA 1C91A 3SGGA 2FPTA 2GGJA 3ABSA 3M6YA 1R3WA 1P0NA 3TTSA 2XZ7A 3WKZA 1XIHA 1ZNNA 4JNMA 5D33A 4J2PA 6PTDA 2GSEA 1UWQA 4IP7A 1NOWA 3KTSA 3L4XA 5RUBA 3CM4A 2D22A 1E6NA 1V0MA 1UROA 1TE6A 5GJMA 3N4EA 4B5WA 2O4QA 1PXGA 4Q4MA 3GYEA 1XSKA 2FYMA 1XDMA 3D3FA 3OODA 2X1SA 3IJ8A 3GVGA 1DXEA 1K8YA 3THCA 3W37A 4C5YA 3ERPA 5C70A 4PC8A 5F4WA 3CQHA 3A47A 2ZVIA 2CLHA 1XLHA 3WJXA 3W81A 1FH7A 1E1EA 2ZUNA 3I7SA 4PEKA 1GK8A 1DIDA 1GTEA 1VYRA 3CWNA 3UG5A 3TR9A 5CPMA 3DXIA 4GI9A 3MP5A 1LDCA 4U3CA 1NQKA 3RO8A 1Y5VA 4RE2A 1XH0A 4W86A 1SJDA 1CNVA 4D6GA 2ZZ5A 1JCLA 2PRHA 1O60A 3IIOA 2ZRYA 2HK1A 4Y6GA 3CV6A 4HZ7A 2IMRA 1F4HA 1N82A 1CGTA 1SSDA 2RDXA 5DBUA 3IUIA 1E15A 4A29A 1ME8A 2E28A 4TMBA 2Y2WA 4IXHA 1XH2A 3FW6A 4W88A 3SURA 3HJEA 2DQXA 3VMNA 5M5DA 4BI7A 2FTPA 4XAYA 1GVOA 1JDEA 1FH9A 3URQA 1ZP3A 2YXOA 1C8YA 2QCLA 1WDQA 3EDJA 3E5PA 1IGSA 3CYJA 3RXZA 1Y8BA 1HW6A 1I2PA 3GFYA 2PDBA 4YHGA 1PZ2A 4MTVA 3G1YA 3N4AA 3VD5A 3B8UA 1OCNA 1OC7A 3ITYA 5JXQA 1Z89A 3TYBA 4RV8A 3OQEA 4JTQA 3GUWA 4M8UA 1AQMA 1YDOA 3ABXA 4FLOA 2ANUA 5D9OA 3TX9A 3HFTA 1ZQ5A 2WQPA 4M24A 3N11A 3DAQA 4P61A 4AYGA 3AHXA 1SZNA 2GUBA 1W3LA 2NSXA 5L6UA 2QDEA 4CN4A 1OX5A 1VS1A 4QAIA 3W1LA 4XSLA 1B9ZA 2I5QA 3A5VA 3W2UA 4Q8TA 3GTHA 3N15A 3NXFA 1SMDA 3MKKA 5FKYA 4AHQA 1ZRQA 2YDRA 4MZ1A 3VIJA 1HL8A 1UWUA 2PDIA 3C2VA 1J5TA 3MMDA 1Q8AA 4H9XA 3GG0A 4BY3A 3VDHA 5A6AA 4ZZ9A 3P3BA 4PUUA 3DYOA 2JKAA 1W9UA 3DHPA 4P5UA 2VX7A 4GBDA 3P60A 3EDEA 1Q6EA 5CC3A 1U5VA 1IV8A 5CKSA 1SPQA 4JN6A 2VGGA 4YYFA 1DEDA 4R9XA 3PUGA 1DWGM 3RDKA 4ZEPA 3TEVA 3GNDA 3CO4A 1TREA 1EZWA 4GJJA 4LBUA 4QR6A 1S3TC 4DN1A 4JDYA 1MYRA 2ZRUA 1H3GA 4R85A 1GT8A 1THFD 1AD1A 3W7RA 5BMXA 3QMSA 3WMSA 5E93A 3QQ1A 3WLRA 2PWUA 3W6MA 4D6FA 3T0AA 3I3EA 3AIBA 1NWUA 2PZNA 4YVPA 5LIYX 4TQTA 3VFCA 3CB3A 3OYXA 4HK7A 1E56A 4A3YA 2ZZ2A 3WUBA 3RX2A 2ZQ0A 3WY1A 2C0AA 3SGUA 2PU0A 3WF2A 5I0DA 5AN7A 3RM9A 3SN0A 1O94A 4I5XA 2R24A 1R3QA 3L5LA 5EMYA 1OFOA 4WEVX 1IYXA 1I2RA 5REQA 1EXPA 5D02A 1CWYA 3WF0A 2E8YA 1Z8AA 2ISFA 3PG8A 3WH6A 1JRCA 3PZMA 3QZEA 4OOUA 4XZBA 3RLHA 3NSXA 4GYPC 3LS9A 4AAJA 4YCOA 1AJ2A 1ZLPA 1V6WA 3KX6A 5CXPA 3DFPA 3WD3A 1XUZA 1E4MM 3AS1A 5CJ5A 3LGDA 1XKJA 2Z1XA 1ZU8A 4UUIA 1U5HA 3FEMA 1ESWA 3W01A 1ISWA 4R7WA 1RV8A 4FIQA 3WEZA 4Z1YA 4B91A 2ZUVA 1VJSA 1LWJA 3M0KA 3W2JA 3ARUA 1JCMP 3NVTA 4HMCA 3IGXA 3QV6A 3IIPA 3MO7A 4AH7A 4Q8OA 2DZXA 3Q65A 3WLMA 3QMTA 4NY2A 1KR0A 4TVCA 1RA0A 3DFSA 4N9DA 3Q67A 3ID7A 3BGGA 4BS0A 4FO4A 1PSCA 5HJXA 4PULA 4WDTA 2A6LA 4D6CA 4GA8A 3OLDA 3FK4A 1MQPA 1PJ9A 5DELA 3GSMA 4UNLA 3UVIA 1OSEA 4ERIA 1R30A 4JYEA 1PS9A 2X05A 5I23A 3GDBA 3PZOA 4XAPA 2BX7A 1UKOA 1JD9A 3DZ1A 1I0BA 1BQGA 4X61A 4C6QA 3AUOA 5EMJA 5H6HA 5CBJA 3F5JA 4DJFA 4IPLA 3GXFA 1OG0A 1ZTVA 3KP0A 1FFQA 1H5VA 3MO4A 1CYGA 2WHJA 2GQ9A 5HNNA 4DXXA 1UP0A 2AAAA 3O07A 4LEFA 3ARXA 3C4UA 2PU1A 5CZ0A 5A6JA 2YXGA 1EGZA 2XIIA 2GK1A 3QPEA 4HPXA 3VAVA 3WYZA 4IGNA 6TIMA 3TZFA 1FXPA 1TFVA 3I3DA 4YTSA 2QAPA 1TJRA 5E0FA 1EHAA 1BRLB 4RDZA 3IJDA 3UR5A 2V82A 3Q37A 5U7SA 1E5JA 1EF2A 3K13A 1U33A 1V7YA 2VR4A 5I6SA 1J5SA 3GIPA 1DORA 1TZZA 1GTHA 4D71A 3WH9A 1Q8JA 3CIWA 2CIPA 1YBQB 2CZDA 2Z1WA 1LBFA 4G7FA 2ZFAA 1H1YA 4E5TA 5IOBA 3WQEA 4HN8A 3PBYA 3E2RA 5A8OA 2P88A 2REQA 5E0KA 4HU0A 4LRSA 3VIFA 1GEQA 4UQDA 3F5LA 3C8FA 4GABA 2PDLA 3APTA 3K30A 1FFRA 3HPXA 5TBOA 1OD8A 4WHBA 2GWGA 2YFOA 3MMUA 1KWGA 3L2MA 1PZ1A 3VE9A 1L2UA 4UZSA 5AYBA 1M04A 4E4UA 3W1QA 1PZ3A 4LTSA 2QUUA 2INFA 1H60A 2WW5A 4IH3A 4UTLA 2J24A 4QX4A 2BHYA 1XBYA 3HO8A 5IXEA 4DWDA 3U7VA 4FOJA 4DJFD 1WOBA 5XIMA 4KKXA 4QSFA 4QISA 1BYBA 1K02A 1VCVA 3B8WA 2GPTA 2VO5A 4L9XA 5FAGA 1QI3A 4GYJA 2X8RA 1OABA 5K4XA 1DIEA 2Z27A 3HJZA 4X2PA 4IUGA 2V5JA 3WLSA 3WQ4A 4S3DA 3H2MA 3WLPA 2ASHA 3CUFA 3OZPA 3GQYA 2F38A 3RRXA 4UTJA 1OCJA 2W66A 4F2TA 1CGYA 1E51A 2OJPA 4AZCA 3TOPA 5LSMA 1GOOA 2L5HA 1W1ZA 4DY1A 4CNNA 2V81A 1WV2A 2REQB 3O63A 1FQ0A 3N4FA 1E6XM 2PWVA 1UBPC 2X7WA 3G3MA 4GRSA 4AW7A 2YB1A 1SJBA 3W25A 3KE0A 1ISXA 4LAOA 1KM2A 3R0KA 4FR1A 2Y88A 4N02A 2J13A 5HUOA 1XIBA 4PMNA 3R11A 1CW2A 4YTQA 4B16A 3QR3A 3OLIA 2Y70A 4XD5A 2VC7A 1U2YA 1QO2A 2PPGA 4XZNX 4TV6A 4N7QA 4EIVA 5FCZA 3SUSA 2CZFA 3TJLA 1YXCA 5CSRA 4P7QA 1NWSA 4YXGA 4TXEA 5AKQA 3FSTA 1Z9AA 4QG9A 2ZX9A 4TTUA 2A21A 4L4OA 2VC5A 2FZ9A 4HT3A 5FEXA 1MUCA 4HHMA 1OJXA 1SSGA 2UY4A 2Q09A 1XQLA 1XIIA 3BAJA 1X38A 2BFGA 4KCWA 3R58A 2TAAA 2C0HA 1XPYA 3NFUA 3T4CA 2RJHA 4KEZA 4O28A 2PTYA 3LX9A 1S5NA 5E70A 1KXQA 4MDOA 4DB7A 4LRTA 4AFYA 3HBLA 4LVBA 4NG3A 3N6QA 3VGHA 4DBUA 4HCLA 1XFCA 4LY8A 4GVGA 1G9HA 2HXTA 2H8XA 3PY2A 1AMKA 3ES7A 5AVNA 1F6KA 3TSBA 4F8XA 2IUZA 1XLKA 3NQ6A 4XD4A 1JPMA 4GO9A 3PTQA 3P62A 3LM7A 4HN4A 4HTYA 1KD0A 2DW7A 1YPXA 2OG9A 2HS6A 2GJXA 3DH7A 2YA2A 5FF4A 2RHGA 3GBDA 4Z2JA 1V5XA 3LV6A 3WNPA 1SM9A 2VVNA 2P10A 3NQ7A 3C0SA 5TNVA 3QKZA 2CC0A 2GSHA 1HTIA 4GH1A 4JQ2A 4JL2A 2OX4A 5LA2A 1YTKA 5AYZA 4FX6M 3UWZA 4O0QA 2BMBA 2R1MA 3VABA 3GH7A 3LM3A 4M5PA 3OVPA 3W00A 5HR7A 3MKCA 2RGMA 3VNJA 4HOXA 2E6FA 3GZ3A 2CLLA 4JFVA 2CW6A 1C90A 4C1LA 4FX8A 1M1BA 4PMQA 4JTIA 4FNRA 1Q6CA 1H1ZA 2AL1A 3FN9A 2XIBA 1MNSA 3ZMRA 4XBSA 4DF1A 3UU0A 4C6PA 3V5OA 1I0DA 3OGSA 3CTTA 3EOEA 4P8VA 1KBBA 3OHMB 3B0YA 3W2LA 3M5VA 4S3BA 2CXEA 1DJQA 1G1YA 1TCDA 3VKDA 3HGOA 4MDPA 1F4AA 2NX3A 3OQ8A 4EPDC 2EQDA 2QPSA 1R9ZA 4ML4A 4A3RA 1BF6A 1IT8A 2V6AA 3EBVA 3IPWA 3BLKA 1AJZA 3VX0A 4AU0A 4DZ5A 1YKWA 4WR3A 3T0DA 1NEYA 4B92A 1BYDA 2IKIA 4DJFC 1ZZMA 1YX1A 4FI4A 4S3JA 3P74A 4FXRA 2V2HA 3C3UA 4S1FA 3H7UA 5IBXA 3WBEA 5DBTA 3BICA 3IK4A 1AZ1A 1KM4A 1VLWA 4O50A 1O1ZA 2VRJA 4UQCA 2NV9A 1NFBA 3A4XA 1LP6A 2BY2A 3T05A 3S5YA 1KCXA 4GFIA 1TTQA 2HTMA 4U33A 5AHMA 4AZGA 1RD5A 2A0NA 2QLYA 5DFAA 5CEWA 2B7PA 4Z1AA 1JPIA 1XW8A 4WKAA 4LB4A 2VT0A 1UASA 2YGYA 3LGGA 3VVGA 1YXYA 4ZTYA 1ICPA 1HGYA 1REQB 5HMDA 3UWQA 1B3OA 1I1WA 4IPPA 3VD9A 3TSDA 1Q5MA 4ZODA 3VCCA 2OXNA 4HCHA 2A3EA 2ATSA 2X2YA 2IQ0A 3IIZA 3W1UA 3AS3A 1NU5A 3KBWA 1GHSA 2Y8KA 4Q3MA 4ZO8A 5A8GA 2FVKA 3UPMA 4U10A 2FKPA 3GR4A 3CAKA 3VM5A 2J7DA 5M17A 4DJEA 4GCXA 4FEZA 2Y0FA 3N6HA 1UKSA 3SI9A 4WIWA 1OYCA 3DHUA 4NUWA 4AZIA 3E1F1 1OC6A 2J25A 2NVDA 3QZAA 2FJKA 3ORWA 4JTEA 3NL2A 4J3ZA 3PJXA 4PCNA 4HPHA 3GC5A 2VXNA 4EXBA 1OHLA 2I5IA 1KBKA 2DVTA 4RDYA 3MYOA 2TRSA 1CXHA 3QGKC 4XZMX 2VGFA 1VB9A 1ZENA 3QM3A 1YYAA 4NASA 1QNRA 1JCNA 1LLOA 3COTA 1DJGA 3S2LA 3U4FA 4A4AA 2WMFA 4AVFA 1CI1A 3RX3A 2WXDM 2GVJA 1AJ0A 1W1PA 4Y7EA 3LXAA 3KWSA 4UTWA 3SN4A 4LAKA 3T0BA 2YW4A 2PGWA 3K2GA 3E0IA 4PUMA 1VPQA 1KCLA 3GH4A 4NI8A 5EY5A 2P0OA 4RZ6A 4O17A 3RLVA 4GVHA 5C55A 4Y9MA 1RK5A 3W73A 1KC7A 5F2IA 1JDCA 1O4UA 1EC8A 4NI3A 1I6NA 3G18A 3P8JA 2DSKA 3BJSA 4U2YA 4IP4A 3IGSA 3N14A 4XD6A 2VWSA 3IJLA 2QCDB 4PL1A 2HNEA 5D9PA 3MMTA 4J3WA 3S0CA 2VEKA 4V28A 4ROPA 5LHEA 1XF0A 1EJTC 3MVIA 2R82A 3BK0A 1GQNA 3YPIA 1IR2A 5LXEA 1WX0A 2AKZA 4DJED 1E6RA 1VFLA 4E2OA 4LH8A 2NUYA 4Q4RA 2XH7A 4ILSA 1EB3A 2TSYA 4I9TA 3WL0A 4OBSA 5GJPA 2DORA 4ZR8A 5TAOA 3BH4A 3GVWA 3ECQA 3QW4B 5BU6A 2IPJA 1PWMA 1TWSA 3AIRA 1M01A 1LROA 2WHKA 3IIXA 4IGHA 2I9UA 4IUOA 1FKXA 1GWJA 3GNOA 1GVYA 1FWDC 2ZA1A 3IVSA 3PNUA 3HPZA 1BFNA 4PMVA 3RMJA 3PM6A 4A22A 2Z6JA 3MVTA 3UWYA 4UQAA 5FF3A 4WGHA 4QP0A 4E2VA 2WPGA 1OEPA 4LCQA 4Z2IA 4R33A 4OUEA 5HANA 4UXDA 1W5QA 5A8NA 3EOSA 3MBFA 3ABRA 4LPCA 1IXOA 3WUFA 4CU6A 4DYKA 4MYXA 3M0MA 2F6KA 3EWBX 2O56A 2CBVA 4F0LA 2O4MA 3AC0A 3LPFA 3UA3A 2D2OA 2WWCA 1RBLA 1QNPA 3GIQA 4KWVA 1E0UA 1ZCCA 3V18A 3FJ4A 4A05A 2VR2A 4M0XA 1HZYA 3CHVA 3ALGA 3PB2A 4IJBA 2VNCA 2OTDA 1EF3A 4MM1A 4ZB0A 3LQGA 1LQ2A 4CD6A 1AQHA 2QJJA 3BAIA 5A1AA 3UZJA 1XX1A 2EPOA 1A3XA 1OFEA 3RR1A 4PE8A 4PCFA 1EX1A 1OF8A 3OVRA 2AL2B 1TR1A 4HP5A 2EPMX 2PDKA 3ARSA 1A5UA 1ZAJA 4LOCA 4WLCA 4QLKA 1OFRA 2R1KA 1ENUA 4JCMA 1RP9A 1BKSA 3QF0A 4D72A 5ABFA 3GWQA 1KWKA 1K77A 1KKOA 3RF9A 4GIAA 3LBMA 3S46A 4P8WA 4BI5A 3BE7A 4JQAA 4PRRA 3MUAA 1OT2A 3CH9A 3SFKA 1EJWC 4MGGA 1KTCA 3A5FA 4Y9PA 2ZZ3A 1J0JA 2WVUA 4H9ZA 3IUHA 5FF7A 1R9XA 4GC3A 4TV5A 3PSVA 1KFKA 3OA3A 4ZFMA 1MNZA 5BWFA 3VDAA 1P7TA 3VNLA 4PMXA 2VEPA 3CTLA 5IM51 3RHGA 2WNQA 3FKRA 1DQUA 2QUMA 1VFOA 1P5BA 1NP2A 2Z2BA 3MZNA 4LUSA 1TJ0A 3P61A 2ZX7A 3CASA 4NZ4A 1AQFA 1J2BA 3BOFA 4PA8A 2V63A 5FJUA 4AD1A 2PDXA 2V5BA 3DBPA 4ZQMA 2XWEA 3N73A 1V51A 4DI8A 2XH2A 3LXCA 2PWFA 4Y96A 3TNOA 2Z6IA 4HMDA 1RSCA 3FJLA 4G5DA 2GYIA 4LYRA 3EWZA 5FJTA 2D2GA 3AHTA 1HJWA 5JBDA 3KLLA 4RE0A 1V02A 3MDWA 3THAA 2DZVA 4AX6A 3BLLA 2VENA 4PUDA 4QRNA 3VOJA 3UZXA 4LYQA 1XFBA 1GQJA 4W7VA 4LS2A 2DJXA 5CPLA 1GVQA 4S38A 4MUPA 1DE5A 3L65A 3GDRA 2G96A 3VZYA 1QWKA 4V1XA 3UNTA 2P50A 3LHTA 1AW5A 4QDMA 1F3TA 2OX1A 4MKNA 4QNWA 4IIDA 3M5XA 2OU4A 4UZUA 2WZTA 3AZSA 1DJNA 4Q6JA 3KM8A 5IBXC 2VX5A 2ZA2A 1VBRA 2OSYA 1ONEA 2XJ7A 4L9YA 2ZXAA 3N2OA 2RKXA 2WANA 4KH2A 5CSSA 3L23A 4LYKA 2WNNA 3G22A 4ALDA 4I9MA 3W28A 4LUYA 2PP1A 3QH2A 1XH1A 3HG2A 3B4UA 3NDZA 3PR2A 4YU1A 6TAAA 2HNHA 1RXOB 4IICA 1YW1A 2ZX6A 4WX2A 4IM4A 4D2JA 2X30A 5AC4A 1V3LA 2VI0A 2PDFA 3WQFA 5CG7A 5A8QA 3IV8A 3W22A 3JS3A 3S9YA 3B9OA 2J7EA 1WKYA 4JTKA 4LVDA 1JAEA 3Q45A 4GUIA 4TVDA 2Q01A 1GJPA 1HJXA 4RPPA 1UWSA 5F2GA 1X39A 4DJEC 1TZ9A 4NT0A 2PWHA 4IJCA 1WBHA 3UEQA 1MZHA 3FA3A 2NLIA 3PJWA 1QU4A 1TMQA 4ZMGA 1CCWB 2VEIA 4A6GA 2G4JA 4XAFA 5LIKX 1FDZA 1Q3NA 4JTSA 3EEZA 3QXBA 1UD6A 1OIFA 2ATMA 3NGFA 3TCEA 4DBSA 3VK5A 4A8RA 3ISIX 4S39A 1W8SA 3KLKA 1OQFA 4RW5A 1A5MC 7ODCA 4O16A 3QW3A 4GUGA 1C8VA 6XIMA 2X2GA 3NL3A 3WLNA 3VKBA 3MT1A 2J4GA 2R91A 3EA3A 3EMCA 4S3GA 2WMHA 4RCXA 1M65A 3ZWSA 2PGEA 5D2WA 2Y62A 3SRDA 2E68A 4DAFA 5E5CA 2EGZA 2OWXA 2WJZA 5FD0A 5IFPA 4J28A 1OFPA 3BAKA 1SMAA 4O57A 3EXTA 4PB5A 1V3IA 5HNUA 3NL6A 3CLWA 3FA4A 2QGYA 4KEUA 4GNJA 3RRAA 2X7VA 1NVMA 4FLQA 3L68A 2GJNA 1FHUA 2GJRA 4WDUA 4QJ5B 3HA1A 3BL3A 5ECUA 1NDZA 3N12A 4LUTA 3L4UA 1S1RA 1ICSA 1VJIA 1O5KA 3BQ5A 3H70A 4YCPA 1W1IE 1ZJBA 3PSWA 3VM7A 3GTIA 2DZSA 4X2RA 1UIOA 3BPWA 4OJYA 5LYRA 1NIUA 2HWGA 5BOOA 5G4HC 3WD0A 2BY1A 5JMUA 3SAZA 1W2PA 2YJQA 2O9OA 1H09A 4GWEA 5CGTA 4DO5A 2QF8A 2VX6A 5EGRA 3VE7A 1XBZA 1XCXA 2H9AA 4UB9A 3E0FA 1OCQA 1B30A 4N4QA 1H4PA 1M7OA 1R9YA 4PMUA 2ZRXA 3UFYA 3FSUA 2EEXA 2OKTA 4ADSA 4PB3A 1QBAA 3HN3A 2DUZA 4NRSA 3ONBA 2GGIA 3DC0A 3SIZA 4F0MA 2ZXDA 3BW3A 4ERAA 5AZ0A 4M6PA 4MB4A 1VCGA 1EJRC 1E1FA 4MSSA 5LGZA 4H8UA 2D23A 3TSMA 3I6RA 4AY7A 1VFTA 1R7OA 7REQA 2ZCGA 4O0ZA 1XYAA 4YTRA 4MAVA 4XIAA 2V9DA 4OZOA 3GXMA 1DJZA 1JFHA 4GHRA 3T07A 3R1ZA 1FP8A 3W2KA 3H24A 1FXQA 1KFEA 1A5BA 6REQA 3TW7A 1LL6A 1EPVA 1X1OA 3C3NA 2PEVA 5I06A 1V6TA 3RMEA 7ENLA 1IWBA 1W32A 4FLSA 4LFYA 4CD5A 4AYSA 4UQEA 2CLIA 2I16A 2BGQA 4HHLA 5T9BG 4TX6A 3GXNA 3I6TA 4B2DD 4RPQA 3OGRA 1ECEA 1Q2RA 3GNPA 1BXBA 3C2OA 1YEYA 1VD6A 3IUDA 1P1MA 1CZ1A 5D9MA 2QV4A 4ZA0A 4O52A 3LU2A 2NQ9A 3WQDA 4R27A 2OQLA 3UJFA 3QJAA 1H7PA 1F3WA 4IFOA 1EYEA 5I02A 3K4DA 4AZ7A 2YW3A 4L4LA 3W7HA 4MNLA 1CGWA 3UZYA 2Y6ZA 1MW1A 3E02A 4LVGA 2IXVA 4F79A 4BEQA 2DJLA 1FWCC 3PPCA 1VGAA 4B4FA 2NUWA 1TIWA 2XPKA 4DJDD 3CXOA 4R9OA 3WDHA 3WFAA 3THUA 3M16A 1DPMA 3REQA 3MCNA 4HNLA 5E9AA 1JZ3A 3A13A 4UR7A 4UTHA 4PTVA 1QK0A 2CLMA 1LJYA 1IT7A 4J3SA 4IIEA 4HIBA 2WKJA 4JCLA 1LWIA 4XUGA 4I5UA 1H11A 2CPUA 3C2RA 4NXSA 3GKFA 3IVTA 3W6LA 4GUJA 3PP7A 1VQTA 1C7TA 3H6OA 1ZBCA 4M6QA 1GVSA 4A3UA 1UZDA 2RDUA 5G1MA 3SSJA 4IMGA 1MEHA 1PEZA 1LT7A 4NIRA 3MI3A 5I3FA 3S8HA 3R2GA 3ANUA 1UA3A 3E2QA 3ZJ8A 1PO9A 3BZGA 1UC4A 2OT0A 3WQCA 3AMCA 2XGBA 1XJBA 3P84A 2V38A 3HQ1A 2PCEA 3EB4A 1N8IA 1J0YA 2DVXA 4CEUC 3L0NA 4FOUA 4D6EA 1GOQA 2I14A 3V7PA 3AJXA 1SZGA 4IMCA 4I5RA 3WNKA 1LUCB 1KM6A 1WDDA 3KVMA 3AXIA 4CQ8A 5ENLA 1Q4WA 4O1AA 1W91A 1B3YA 5HBFA 3ARZA 1VC4A 2OZTA 4R5EA 4JY9A 1EXBA 2EPKX 1PB0A 1AFSA 1G01A 2YL6A 4HBKA 2V5DA 1Q66A 2YZRA 2PTWA 4IQLA 3LI1A 3FY1A 1NDVA 4PTMA 1JXJA 3M0VA 3V5CA 5B80A 2WJDA 3O6YX 3WLLA 4LB3A 3CWHA 2J7CA 3M0LA 2F2KA 3BG5A 1W17A 4X0VA 2NQJA 3W85A 3NGJA 4FIRA 3OHIA 1FWJC 3W29A 4NF7A 5DT5A 3CQJA 4KWUA 1NP0A 1FA2A 4AG0A 1VBUA 1K9DA 3M0ZA 3N2BA 1Z69A 3HGJA 3WLOA 3M0YA 4AVOA 3Q94A 4KETA 2DEPA 2ACUA 1T40A 4DNMA 1X1NA 1SR9A 3V16A 2A3AA 3A6OA 1Q7MA 1F73A 2AGTA 3UWEA 1WZAA 2HVOA 2X42A 1ITQA 2W9MA 4QEHA 4RNIA 3H23A 1PV8A 2ZKMX 8TIMA 3FEQA 2HVMA 1BWKA 4UOJA 3QY7A 3NQMA 4I9JA 1ZPTA 3ZIZA 3JRKA 1YMYA 4YHEA 3AIUA 4XZLX 1MEWA 1IEVA 3QPZA 1CB7B 3FJ6A 1Q6GA 5C8BB 1JZ8A 1W3TA 4QQ3A 3NQ2A 4NJKA 2HE5A 4JTFA 4DM2A 1ITUA 5C71A 5D2XA 4KFPA 4JTGA 4K38A 2W61A 2W4XA 2VD8A 4BQ2A 1B31A 4MY8A 5GPRA 1VEPA 3P2VA 4XO6A 1PKNA 5TD4A 1W3NA 3UJRA 3WK2A 3QN3A 3WDPP 3N6JA 1EDGA 4IF2A 4YL2A 2GZXA 3P5YA 4OT7A 5AHFA 1KXTA 1CTNA 4RK8A 1DIKA 1GHRA 4GLEA 1EZ2A 5G1TA 4DXVA 1S2AA 1KTNA 1MI3A 1RPXA 1MW3A 4US6A 1B3ZA 4RLIA 5K9DA 4QLLA 2OQYA 1GOXA 3EX4A 1W1B1 3W26A 4ZOCA 1L6WA 4F48A 3R8HA 5A6TC 1RALA 4QCEA 3WFZA 1PHWA 1VEOA 5ABEA 1QMLA 3TFXA 4AEFA 4MNJA 2GWNA 3EKLA 2ODOA 3TYAA 2J9XA 2UY2A 3LG3A 3B0UX 2J7HA 3WQVA 1R46A 2DH2A 4PBEA 1EP2A 4IQEA 2V2CA 5I3JA 3LA4A 1PCWA 5EMLA 3PZ9A 5A3HA 3CHDA 3L0KA 3O3RA 1D9EA 7CGTA 4OBRA 4DJDC 4WJ8A 2J8FA 4JKKA 3W7LA 3RNDA 2HMCA 1T5AA 2HSAA 2VD9A 4HA0A 3E3HA 4CNUA 1E9LA 2JF6A 1EIXA 1GQLA 4UOQA 3FGCA 4GD0A 5BYWA 5G2WA 5HR6A 2BTMA 3STFA 3E38A 4BZYA 1ITXA 4PTWA 1UR3M 1Q6QA 4HYRA 4OGZA 2GGHA 2ACQA 1MO0A 5IFTA 3BAYA 1XKYA 1T7LA 4DI9A 5L9FA 1CBGA 4XVEA 3OA5A 4I7VA 3NZPA 3IV3A 1PYMA 3WJYA 1X97A 4LUJA 3USBA 1XPGA 2FGBA 4UFJA 2HBXA 3GTNA 1MXGA 2NVCA 2BGSA 1EWEA 3NTYA 3B9NA 4W87A 2CNCA 3FKKA 1TJ2A 5G1YA 2PGRA 3QQWA 3QPYA 3STPA 2PCQA 3V0SA 3G77A 4KPLA 3LNPA 4HTBA 3UW6A 3GG8A 5A6BA 4L64A 1K03A 3UXAA 4RX0A 2OYLA 1BHGA 2O9PA 5A6LA 3BMVA 4TUFA 3MHGA 4DIAA 3LZ3A 3WSUA 1EUNA 2F61A 2WJFA 2E67A 5C9ZA 5I79A 1CGXA 4DWSA 4D6IA 1RUSA 2XFRA 4FHAA 1XHGA 3TA9A 5DF0A 4ZXOA 3DFNA 1HFBA 5D30A 3VD7A 1Q2SA 4DQWA 1M41A 4C6OA 1H51A 3AROA 1TRDA 4OV4A 4EPKA 3PZUA 2KX9A 3CIXA 3OZMA 1I2OA 1KR1A 4PCSA 1XCWA 1XD1A 3UPWA 3WMCA 2NT0A 3BGAA 4DBEA 5BRQA 4Q8NA 3O2LA 4B5VA 1DJXA 4H7CA 1AZ2A 2KZHA 4AMAA 2DIKA 1POKA 1EJ7L 1DWFM 1PX4A 3KCOA 5I3DA 3W1MA 3S1UA 3KCLA 3WDJA 4JYFA 2G3FA 3SJ3A 2ZX8A 3B8VA 3AIVA 1XYMA 4YJ5A 4NU7A 4RZ4A 1VPXA 1WKDA 2Y85A 2O9TA 1PTAA 4PRTA 1DP0A 2WSKA 2X1IA 1M7PA 1Q6LA 4OU1A 1HF6A 5JIWA 2F7FA 1ZBWA 3U7BA 3NJ3A 3N13A 3VNYA 3NPXA 1M9HA 4S3FA 3JW7A 3NQDA 4C1NA 5BZAA 4JTAA 4L61A 4JYDA 3G6MA 1KM5A 1J93A 3MJMA 3MC5A 1UH3A 2G3MA 3NA8A 1W3IA 3S9IA 2OEJA 3AXKA 4EVZA 4M56A 5HQMA 2QIWA 5KEZA 2WC7A 2CBIA 1C92A 3E5BA 4X22A 5A6BD 1A5LC 3WF1A 3CUHA 3VGEA 4ZE4A 1B2YA 1ISYA 3MZ2A 4PSRA 4D6DA 1JD7A 1A4MA 3W1PA 1FP9A 4J35A 1XLMA 5H1WA 2EKGA 4C6NA 3BJTA 3G1VA 1F6PA 4XKYA 4E6MA 2Z1BA 2FTWA 4DWSD 1J6PA 4Q32A 3AHYA 1TG7A 4JOMA 1ISZA 4UQBA 2FPVA 1HGWA 1MVYA 1VLIA 2G37A 5ABGA 5HQEA 2WB5A 1TPUA 1J18A 3ABOA 2C8NA 1L0PA 4P7OA 3LD5A 2WSYA 2H3DA 2R1PA 4ZTXA 1UR2A 5EMKA 2W62A 3WD2A 2VL4A 2YLLA 2VP8A 2FLIA 4UTFA 3NM1A 4MJMA 3A4WA 2DVUA 3SDOA 3KRSA 1OK6A 1OG6A 4Z1DA 2YXXA 4B90A 3WBAA 2HEJA 5A94A 1IZKA 1GJUA 1TWWA 2CBUA 5HPCA 4AXKA 4LNYA 1Q7ZA 2FDSA 2CLOA 4TX8A 5G4EA 3ZT6A 3BLFA 4O0KA 1OWQA 3URBA 2C1GA 3CQKA 1TIMA 2ZZ6A 4QITA 3MPGA 2ZRVA 3N29A 4K8HA 4F9JA 3JUGA 1JDAA 4M81A 3LK6A 1TA3A 4MWAD 3GNXA 2HPIA 2B7OA 1J0KA 3C2YA 4S3KA 3UJ2A 3BG9A 5C5YA 5DXYA 1S5VA 1O5XA 2BHUA 3EDFA 5D4YA 3VI2A 4B5NA 3KXQA 1OYBA 3NM3A 4HGXA 1J4EA 3HB9A 3NR0A 5A8MA 3ATZA 5HXMA 3ITOA 4ZO9A 3BAWA 5LGXA 3A12A 2YCLA 4L9ZA 3HMCA 4IX2A 3WUEA 4UFMA 4MAZA 4HSNA 3GR8A 3WLHA 8XIMA 3WQGA 4KRTA 1XL9A 2QJHA 3H26A 3R89A 4W7WA 5EFFA 4CQBA 2WCGA 2I9EA 5DQPA 2PDCA 3VIKA 1US2A 4HNVA 4NAEA 1OCBA 3S6OA 4ATWA 1AH3A 1KBIA 4GXWA 4E8CA 3EWUA 1W9XA 2J79A 4OECA 3PJUA 1F2JA 3P82A 1PBGA 4KERA 2ZE3A 3L66A 3WH8A 3PTMA 1KFBA 1W1TA 3VUPA 2MNRA 4LF2A 3M6DA 4H8HA 1GGOA 2ZIDA 1UKTA 1RPKA 4Q6XA 1ZY9A 3ABQA 3N1AA 4CCCA 1J96A 1D7KA 2Z2UA 9XIAA 4N42A 4NJGA 4G8TA 2OKOA 1O1HA 2EXOA 3AWOA 2P53A 1KRCC 1G0CA 3T09A 2Z1VA 4GJ1A 4NJJA 2YCLB 4GG9A 4JTHA 3N3MA 2PTZA 1DYSA 3CEUA 3LNMA 4ORMA 5EA9A 1FCVA 1W56A 2O92A 3S5NA 1JGMA 3R13A 1FHDA 2QKFA 3HU7A 2DDXA 4AHPA 3BLEA 2E7FA 1PVNA 5BU9A 3M9YA 1KV5A 3W23A 4FOKA 4Q4SA 2XIMA 3RX4A 1VZWA 1OBAA 1BYCA 4RNJA 3W88A 3V75A 1PKYA 4AD0A 1WKFA 1FHLA 4INFA 4Z2KA 4MVAA 3L5AA 5H8UA 1W31A 4FZIA 1PAMA 2B81A 3LHYA 4P7RA 3CV1A 3QRHA 4HZ8A 3P7YA 1E73M 3RCMA 2CHNA 2DZAA 5FEPA 1MW2A 2GLKA 3P0XA 1OZQA 5DT7A 1UB3A 2WJEA 4K3ZA 4ZB2A 4ATDA 3EX6A 4K7VA 4RKAA 2J8TA 3V35A 4H4IA 5LZLA 2IXUA 3DENA 4HA3A 1ZALA 4US5A 5HJYA 2VOTA 4M1BA 2DZBA 2GGGA 1OZMA 2Z7GA 3CL8A 3VD4A 1RCQA 1QNVA 4CCEA 1N55A 4UMCA 2V3EA 3MHUA 4Q7NA 3UPBA 4DWSC 1D8CA 2PDPA 4G2DA 1S5TA 1CIUA 3POCA 2VZVA 3DFYA 3TP4A 3QR1A 2YCIX 3HZ3A 4L4MA 4JPGA 2CWXA 4MFDA 1VFHA 4LBSA 3V1HA 4DBDA 3SSZA 5LA1A 2OLAA 4NNAA 4I90A 2HZGA 3BAXA 4ACZA 1RA5A 4XD3A 5K2ZA 5MKGB 4IG2B 1Z3NA 1W8GA 5CPSA 3MUXA 4AD5A 5I09A 3A3WA 3F4CA 4CNSA 4FF7A 4PMJA 4KEVA 4LNCA 3VUSA 3FNDA 3VKKA 3QYSA 4ZBCA 2R8WA 3TMLA 1QCWA 2XH0A 3N18A 3EWDA 1GOMA 4JR5A 2IKHA 3S3GA 3WJSA 1ISVA 3TMQA 1AUSL 1WE5A 5FA5A 4NZFA 3MANA 1YXDA 2WCAA 3ITTA 3T40A 1J11A 3STCA 2QYGA 4M6UA 4FMVA 2A1YA 4K1GA 1R2TA 5LIXX 3TC7A 4MWAC 4W4QA 1EEPA 1OX4B 4A2RA 3IANA 2NXHA 3FS2A 2B7QA 3F2BA 1GNXA 1UPPA 4V15A 3KL0A 1WDWA 3MCOA 4US5D 2QF7A 3W38A 1L8PA 1OD0A 3ZLHA 5B7YA 3V0TA 2BVDA 3A3XA 1QAPA 1WBJA 1JZ4A 4WCJA 1AH0A 1IZJA 3SGZA 4UFHA 2V5LA 1OVDA 3W7PA 1IIGA 1M7JA 2YDQA 1XI3A 3UXKA 1DTNA 4KF1A 1K7EA 4EAYA 3WK0A 1M03A 2QJMA 4BEUA 2PE4A 1NDYA 2G97A 5E0CA 3L2IA 2AOSA 1XICA 2BP1A 3GE7A 2C16A 5AFDA 1LBLA 4O11A 3W07A 1FCQA 4UR8A 4MY9A 5BRBA 4ICCX 4XIMA 1UH4A 3B9EA 2W91A 3NPWA 2HV5A 4H9TA 1CENA 1R3YA 4WOQA 5AB3A 3U2OA 5FAJA 5CGMA 1LRQA 6ALDA 4PRWA 3VIOA 3T7VA 3TQPA 3SY5A 3NO3A 2HQAA 2WWDA 2OOFA 5C9WA 3DBNA 3ARYA 1UOZA 2FMNA 1UCWA 4FNSA 1FY6A 3PK7A 1E0VA 2P5NA 9CGTA 2PS2A 4DPQA 2FDMA 3S6TA 1QPNA 3V1PA 4L6OA 3SW6A 1GQIA 3AS2A 1X8FA 3ES8A 2ALDA 2Y7DA 3SQLA 1KBLA 1P6WA 4CU7A 5LNSA 3K1GA 3GHTA 1UWRA 1UD3A 4RE4A 3OO2A 1XC4A 3DU0A 5AY7A 3PTDA 4HMNA 1DXIA 2C79A 1TPH1 3KRZA 4NYUA 1KBJA 1OYAA 3P0WA 3G1FA 2BXZA 1CX9A 3WMBA 4JIPA 2OZ0A 4W9TA 4XK2A 3NVDA 3MSDA 3I3BA 2E0PA 4S2BA 3O15A 5EL1A 2WZEA 4OVXA 4W7UA 1N8WA 4L4PA 4TMCA 4DRSA 2ON3A 4HJFA 2X1RA 3GX9A 3WNLA 2XSXA 2WCSA 3WZ0E 1KA9F 4RV3A 2VKZG 4CNOA 3MWCA 3L4TA 1MXDA 5K4ZA 2EAWA 4BWLA 1F76A 3N2XA 3DG3A 3WENA 3C0JA 2NWSA 1RQHA 2PD9A 3DEQA 1K9FA 4A3QA 3G2GA 1LOQA 4WSJA 3PVFA 2FIQA 4D1IA 3W0KA 1NDWA 5CSUA 1CEOA 1L8NA 3H2NA 4W89A 3PUEA 5F2MA 2OYMA 1EPXA 2FZDA 2OFJA 3E9AA 3BOXA 1HJVA 3AMKA 2OZ8A 2POZA 1KRAC 3UG4A 1ZSXA 3MJYA 5CZSA 3TTQA 2O7QA 3TJXA 5HDRA 3OU8A 2ZUSA 2BOGX 1W37A 1XUUA 2GVGA 3CAQA 2OWCA 3K1DA 2E9LA 1DWHM 2VFHA 3W02A 1QVBA 1BGAA 1G67A 1L9WA 2HK0A 1RCXB 3VGGA 3G0UA 1XBXA 2OPJA 3HQNA 1PIGA 5TQLA 1K7FA 2PLKA 5D2TA 2I7GA 1DWIM 1EHNA 3CHEA 3GVVA 2FFIA 2PLJA 1ZJHA 2DT0A 5FI8A 3QLDA 5AHIA 1XIFA 3H2FA 4RNFA 1JQXA 1HO4A 2QW5A 1T41A 3W7CA 2FB2A 3P14A 1VBHA 1D7FA 1DKWA 2D2HA 3HGSA 3JZEA 5I3HA 2YOCA 2J27A 3QHNA 3PTKA 2F84A 1EP3A 5F4SA 3DERA 3DHDA 3FHAA 3B0PA 1NF0A 1IWPA 4JTJA 3D3AA 5EBAA 1IEQA 3S9ZA 2GGEA 2PDNA 3GB6A 2VZOA 3H8AA 4UIOA 1V03A 3PS7A 1XD0A 3GM8A 3SUTA 2WAGA 3CUZA 1S39A 1V93A 1HQTA 4Q33A 5DCBA 3TTEA 4AD3A 1Y0EA 1W3JA 1S3HA 4NZCA 5M2FX 1QR7A 4IMAA 4C6FA 5F2LA 1IWAA 4ZQNA 1A50A 5CJNA 1VH7A 1SJCA 3ZVHB 1TCMA 4IIBA 4Z2GA 2A6NA 2A7NA 3U3HA 3GZAA 4DF0A 3GG7A 4MLRA 4HZMA 3AIQA 3N17A 4BKNA 1IE7C 5C2CA 1YNQA 3L4VA 4E2DA 2WSPA 4PN2A 3UT0A 1LG2A 1PE1A 5HNRA 2J78A 2F6XA 3CV2A 4RL3A 3OGVA 1ZCOA 3ABZA 5A2AA 1F5ZA 4NAFB 4LVAA 1BKHA 3RJYA 5FESA 1KLZA 4IQJA 4GZIA 3XINA 4AEEA 3QTGA 1UD8A 3EYPA 2ZZ1A 3ELFA 2WVVB 4XSMA 1E9ZB 4IOTA 4HOWA 3UY8A 1QO5A 4L5ZA 2FGLA 3KOWA 3I4KA 4KGJA 3C2FA 3W6YA 4LF1A 2ZRZA 1IXPA 1WQ5A 4FXSA 4Z2LA 5I78A 2HROA 3QQ0A 2AGKA 3EXRA 4DYJA 3MSYA 4Z08A 3SCVA 1JQVA 2BXYA 2WBGA 2D24A 4WY0B 5ABTA 2VEFA 3R7MA 2C19A 3GC4A 4NX0A 1F7BA 3CZJA 2NWRA 1JYNA 2IKGA 1XINA 2ICSA 3IJ9A 1TQJA 4FNTA 5D8WA 4AZ6A 3KL5A 2ZXQA 3MI6A 5CZJA 3ZZ1A 3KVJA 3OG2A 2GVEA 3H54A 1UD2A 1TELA 1Z41A 3WG6A 4P2VA 5M03A 4R3UA 4I6VA 1J0ZA 1RY8A 3OIHA 1Y65A 4S23A 5DEZA 4X9SA 3BV4A 4H2HA 3DG6A 3W84A 3MY9A 2J6XA 1HVXA 1QBBA 2QDDA 4QG8A 3T9PA 5C9XA 4YNGA 1XGDA 3O0FA 1V3KA 2XZ9A 3M0JA 3PUOA 3NQEA 3CJPA 5T8GA 4XZIA 4BQ3A 3R0DA 2YB4A 3CZ8A 2ESCA 2PTXA 2UY5A 3VNKA 5E1QA 3LSBA 1E3ZA 3AYTA 2YBTA