2J6BA

Crystal structure of afv3-109, a highly conserved protein from crenarchaeal viruses
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
Knots found
sequence length
109
structure length
109
Chain Sequence
MLYILNSAILPLKPGEEYTVKAKEITIQEAKELVTKEQFTSAIGHQATAELLSSILGVNVPMNRVQIKVTHGDRILAFMLKQRLPEGVVVKTTEELEKIGYELWLFEIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords AFV3-109
publication title Crystal Structure of Afv3-109, a Highly Conserved Protein from Crenarchaeal Viruses.
pubmed doi rcsb
source organism Acidianus filamentous virus 1
total genus 26
structure length 109
sequence length 109
other databases KnotProt 2.0: S +31
ec nomenclature
pdb deposition date 2006-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2j6bA00
2J6CA 2X4IA 2J6BA 2J85A
chains in the Genus database with same CATH superfamily
2BKEA 2AIRA 1W4ZA 2OV3A 5A02A 1Q0ZA 3FUWA 1KP9A 3IPYA 1U94A 4IIDA 2H48A 4X24A 5A05A 1HR0B 3G8BA 3VFDA 3N39C 4UARA 3R7NA 2J41A 4J2HA 3QA9A 1ETHA 3CV3A 5FYDA 2WTXA 2I7VA 4BWFB 3RAFC 3AT1A 2WWGA 4HNHA 4LVUA 3H2ZA 4UUNA 3OAAA 4J3JA 5IEJA 1H1TA 5FTLA 1JPVA 2J85A 3D5EA 4CQMA 1C4XA 1TX4B 4LCJA 5K0NA 2YN0A 1IM5A 4IG4A 3W8DA 1N2BA 1HT1E 4XCXA 1YOVA 2WT9A 4Y1FA 1LTHR 5EHGA 5T3YA 2HCFA 3AXTA 3AWDA 3H87A 1NRIA 2XMGA 3HEMA 3P0JA 2QL7A 3GPBA 3O3CA 1AXGA 1XCOA 4HZGA 2XT6A 1BS9A 4M1TA 3MINA 4MS1B 3G1UA 3H2JA 4ZEOA 1T3LA 4ZCMA 3AF0A 1DBRA 3LC2O 2IP4A 3E7WA 1U81A 3ZXXA 1IZ0A 1PUIA 3ZJUA 5AW3A 3GZTB 4GOMD 1XLVA 1L8LA 1ZK2A 3IIEA 1F5SA 5T6BA 2YIMA 2W5UA 1NXPA 2Q0XA 4UAGA 1PD0A 4DLLA 4DSZA 1YR2A 1TD9A 4X64B 3FKSD 1DT3A 2JANA 2WB2A 2PZMA 1DKUA 3NALA 3LW7A 4G0PA 5C8YB 4HYEA 3ETEA 2E5LB 3IQZA 4D02A 3VJMA 4NU5A 4CHTA 3MT8A 3F47A 3QVXA 1L7QA 3QXHA 1G6OA 4TN5A 5JJIA 4A5SA 4EZIA 1DKPA 2R4UA 5AO9A 1X9HA 1I3KA 3NAQA 4LDQA 1E7WA 1WZEA 2X76A 4JB2A 4LRQA 4A2WA 2HLDD 1WR8A 1ZUNA 3IP3A 1PYOA 4PQFA 4D6YA 1WE2A 2A84A 2Q3FA 3COSA 3HU2A 3IIJA 4HN4B 3Q0TA 3R75A 3M6XA 5A5VA 1WCWA 2AX4A 1R0YA 3CLUD 1BFKA 1SFRA 4PC1A 1P3Y1 3F4LA 3PCRB 4W82A 1XZLA 1SC3A 1WXHA 4LNHA 4EKIA 3AGPA 3TQCA 3KB8A 1B6RA 3OZAA 3L2OB 2EFDB 3N2GA 5EAIA 1TF2A 4KV7A 3TE6A 4NFSA 4B8ZA 5C35A 5CDHA 1Z5PA 4NXNB 1PYDA 2PEYA 2YYAA 3OD5A 2W0MA 3R3UA 5KYTA 2H52A 3W4IA 4MV8A 1HKUA 1SY7A 4JNCA 4XM0A 3RFXA 1IY0A 5AI8A 1XYVA 2XVXA 3P9QA 1H2BA 3E48A 3B9QA 3W9YA 4L3WA 4BFVA 5JWRA 1DC7A 3K6SB 3PT9A 1SXJB 1SU7A 2XYVA 4BNIA 1MEJA 3CNHA 1VG9B 2ZEJA 5SYAA 3GY0A 4EF5A 3ABRB 4LYGA 2H3HA 2EKZA 4KO1S 5DHTA 3PDIA 5EJIA 3ON5A 2NV0A 4BNNA 3CA8A 4NOKA 1Y63A 4M8SA 3LE8A 3S2GA 5JZMA 2ETVA 4UW9A 4YCMA 3C41J 4I66A 1ZJ6A 1AQYA 4IDGA 3TSWA 3U9SA 1Z4IA 3VKHA 1WXXA 2I33A 4HQNA 3WS7A 3P9RA 3QX3A 3DBRA 3Q9SA 1DAGA 2Z04A 1TGYA 2JGLA 4KMSA 1JQLB 3U17A 1JNXX 3OPVA 4Z9FA 5CUQA 2FWPA 4LRWA 2C3PA 4AWXA 2HRCA 3INYA 2EFHB 4BASA 2EARA 1O08A 2GWRA 1EHYA 2C2MA 1RLOA 2QVXX 3C15C 2E3JA 2W4IA 3BJEA 2Q4EA 2DPHA 5F64A 1IXKA 4I5EA 3OVMA 3HXKA 2DGDA 1GRQA 4OL0A 1DFHA 1ZC4A 1SKYE 1JDTA 4DJEC 4W9MC 1BHJA 3X44A 4XGQA 1TT5B 2OD9A 2WP0A 3JYOA 2YXPX 4QUAA 3ESZA 3UJ3X 2ERYA 2C7QA 4KGDA 1O87A 3EZ9A 4EKYA 2BL4A 2IYSA 4OI1A 5FPHA 2OV1A 2D3TA 5ERXA 1ACMA 4D9MA 1OH6A 1QIMA 4ZJYA 1JBKA 4QUDA 3TTYA 1U2GA 4HP8A 4N8EA 3U7HB 3RU2A 4RY9A 2VXYA 1H2XA 3PEFA 4GM0A 4M0UA 2A30A 5EZYF 1AC5A 1M8KA 4D6XA 3GRZA 2JJ1D 2XUIA 1MEOA 3UK6A 1QE0A 3QF7A 3FIUA 5DYNA 4Z53A 1R5NA 5CLHA 4QSHA 1XVIA 1Z3IX 2YH2A 3PNKA 1ZZGA 2VATA 5IDVA 4HQRA 5J47A 1Q0HA 4H77A 4MYSA 1HQYE 1NXQA 2W2VA 3OM0A 2GZ1A 1D1SA 3KOYA 1QYRA 3Q85A 4TRMA 3IX7A 1PV1A 1JEOA 2YUTA 4FMBB 5H3HA 4HAIA 3OMWA 3STWA 3BOSA 5J3JA 6ABPA 1O89A 4NBVA 3QVKA 4Y30A 3B2NA 1AV6A 1H93A 4WL0A 1Z0ZA 1HF3A 2XYHA 3KOXA 3O83A 2RGNA 4KXMA 3L1HA 2XA2A 4QWWA 4TRJA 5DNAA 2BV3A 2Y1WA 3E58A 3OFKA 4ZDIA 2IH2A 4LV5B 3AHFA 3V9AA 5EMHA 4EHNA 3EUEA 3C3JA 1ZGAA 3KCNA 3KP1A 3B6JA 2C78A 4NZYA 2DLNA 1E9RA 5F12A 2VSFA 2OCGA 2P6RA 5FWXA 3KT3A 3RHFA 2D00A 1CJCA 2QVYX 1SUAA 3X0DA 2LRHA 3OUZA 3PCTA 5I45A 5ED4A 4J16C 5A4IS 2X19A 4DMKA 1QK4A 2CDAA 3DKKA 1NU8A 3V48A 2RHRA 4HAOA 3HCOA 4I1PA 4IIEA 2TRSB 5BYJA 3CYFA 1TQ4A 4OKIA 3AEQB 1KJJA 5A3SA 5GTDA 3HSYA 3HZZA 1R9JA 2GBPA 3GFOA 4FYYA 4E70A 3PGA1 5AW5A 2PZLA 3BAFA 2AFRA 2VN8A 1SG0A 1D9XA 3E22A 4IJUA 4I3HA 4R3UC 1K5HA 3PQDA 4MARA 4DW8A 4BGDA 4B3IA 2CEAA 2B94A 5E6UA 4B6JA 3M2PA 2IKSA 2AA3A 5JFGA 3IXMA 3RANA 2AKAB 2ZGVA 2UUPA 1IJFA 3EEOA 3ZHXA 5I01A 3LUCA 3MYRA 1R9NA 1V4BA 4JL5A 2KI5A 4DCCA 4UTVA 5A4MS 5KJCA 1JYSA 3MBIA 1XEXB 1YE5A 2EYQA 3HLKA 1F8GA 1Y8AA 4OMDA 1SO8A 1YQTA 1T0JB 1ECLA 1ECJA 4OOEA 4PZ9A 3T38A 4DUGD 3C5WP 3O84A 1OYWA 1WULS 1FP4B 2O3SA 2BM9A 2GJ8A 1N92A 2Y0CA 3ISTA 2Z9CA 4WUTA 2I62A 2XNHA 2YWDA 3CEPB 3NOXA 5TARA 5K0FA 1LK7A 3EPLA 4QM7A 1GN9A 4DNOA 2RE8A 2YFQA 4F4FA 3G8AA 3KKQA 3SZGA 2OGWA 2DUJA 1YVPA 4BNHA 2CHUA 1PWXA 3CM0A 1AK1A 2JLZA 3AR3A 3IRUA 1PEKE 2YWCA 1ZX1A 4GKBA 1U3GA 1XJWA 2E4WA 3EXHB 4GYKA 4PVDA 1GPMA 1OMOA 2VDPB 3GJXC 2OORA 4DBLC 3SDBA 5CFZA 5ALDA 4DSAA 4M7RA 5AOAA 3VVCA 4WGFA 1YR8A 4JVSB 2YVAA 4D82A 4RF3A 2JRLA 2ZJ3A 3G2PA 3OMXA 3QPAA 4XLZA 3ZX5A 3DFFA 2VHEA 1MHPA 2IHUA 1E1LA 4FEYA 2IYQA 2QNBA 4QIHA 2H1RA 4MGIR 4RM3A 1VMKA 3CX4A 1Q0QA 3FMOB 3NIDB 1UPUA 2I0FA 5DWQA 2O2ZA 5H4HA 2APJA 4FUTA 4LE2A 4MKIA 2VJAA 4B81A 5K0TA 1AD2A 2GJ4A 2ZYTX 2D1TA 3EDQA 4YVFA 2NUPA 4C22A 5E4TA 4PV7A 4D79A 3V5NA 3R8CA 2IGBA 3UGTA 4DUZB 2SKCA 1PN3A 1YDMA 3FPFA 5FEUA 3EQ7A 3L4SO 1N6OA 4KQJA 4HDQB 1QMGA 4JBIA 1ZHOA 2GEVA 3JCZA 1RBQA 4A26A 1GTG1 4NENA 1DDOA 3JQ7B 4TTJA 1KKMA 3DEJA 1E1CB 1HMYA 1TU3A 2A0KA 1G3RA 1IE3A 3WG9A 4ZQHA 1G18A 1NLYA 1E4YA 3P2OA 4JB0A 4MLPA 3PJFA 2F3TA 2BMJA 3KJQA 2W2XA 2D7DA 5TE9A 4QU9A 1KS9A 1QG4A 1YB1A 5AI6A 1UXIA 3MWDB 2JLXA 4IIBA 4O4JB 3USES 1M2FA 3L9WA 1M0TA 4RJIA 3HJFA 4GSKA 3AXSA 1U0RA 1XQYA 4J0EA 3EEYA 1FFYA 2H2DA 1GZ5A 3GP5A 2CNBA 3RS4A 3WADA 3HHPA 4CMIB 1TZKA 1GU0A 1X39A 4L0QA 3TJRA 3PQCA 4PCAA 3JALA 3RVQA 4R1UA 1I01A 3EWIA 1ADCA 5MDHA 4TTTS 3GCZA 3RIYA 3TKYA 3WAKA 1B6SA 4HWPA 4F93B 2QU8A 4QXRA 5B1DA 2ONJA 1Y6ZA 1M67A 4Q3OA 4QU5A 4CFYA 1TW2A 4NS4A 4FBGA 2GAAA 5JCXA 1L9XA 1M1YE 4WOBA 3ZWPA 4IMIB 4KPGA 3V42A 3GGPA 4DPMA 1KI4A 4D8YA 3VPXA 3QE0A 4AY6A 5FORA 4E22A 1RJDA 2OTCA 3ILVA 2PT9A 3GX1A 1E3WB 4JXXA 4LJLA 4TXHA 4ZYUA 2BHLA 3HP1A 3OEYA 1NXVA 5FJJA 1V11B 1NM5A 2V5VA 3UB3A 4ARAA 3ODGA 3L7DA 4PHGA 5C1IA 4BMXA 4N9WA 2C5GA 3U26A 5ILQA 4RO0A 4YRNA 2IZ6A 4JBWA 3BBLA 3FWNA 4TRRA 5A1JA 1PR2A 2WM9B 4HK4A 4U02A 1XBTA 3KQSA 3MTEA 3P71T 2LW7A 4KLAA 2AN3A 2WB4A 5IYZA 3OX3A 5K2MA 4F8JA 4QVIA 3FKQA 3BGWA 3TGWA 4CQNA 3QJ5A 4BQOA 3JZIA 1GADO 1OIWA 1Z34A 1QIHA 2Z5VA 5KTNA 1TYDE 4A2PA 3WLTA 4DJAA 2XUOA 2UZAA 4EJMA 2XB2A 3VMMA 4CFSA 5CX1A 4EABA 1HX7A 2YJZA 5E1MA 3M7IA 2XMBA 3NH9A 4E1AA 2CLMB 5A3JA 1E59A 4DFDA 2PPLA 1YB2A 3I34X 4CMCA 3HVJA 1IATA 3PVSA 2H07A 1HORA 3HHEA 4UM5A 4WASA 4JGIA 5SZJA 3VI4B 3GLIE 4I14A 4IDFA 1X1CA 1T8RA 5SYMA 1UWKA 5CB6A 2BW0A 5LBUA 5E6SB 3OEHD 1QVZA 1NG9A 1WEHA 5FXMA 4B4DA 3ZCUA 1MTOA 3DDWA 3JWPA 1J8YF 3KKKA 4WIAA 4X8LA 4UEKA 4B7ZA 3ZPXA 5JYBA 1HL3A 1EHCA 4FPXA 4TUYB 2BGMA 3EVAA 2VZ8A 3AJ8A 4QJ3A 2GBGA 3L7YA 2JAOA 2WUEA 2DQSA 2WIBA 5EMJA 1ODIA 2NPFA 2Q99A 1XALA 3WLRA 1NV8A 2X0KA 3Q3GE 5JVDA 4RV4A 4UVIA 1I0LA 1J09A 1ZW6A 1N6RA 3ESDA 3VKWA 1CUHA 1ZUIA 4PZ0A 2DQ4A 3NEPX 4UTXA 4BX3A 3RT1A 5ADVA 5LKRA 1MDFA 2F67A 4ZAYA 1EPUA 4KDCA 3LBYA 3BT7A 2XMZA 1FS5A 2BFFA 3CEJA 2PT6A 4MDHA 4EK9A 1TDJA 3IBYA 4DAOA 2ZRNA 2ZRGA 3KE9A 4Z7QB 1JLMA 2JAPA 4ILKA 1Z5WA 3FNQA 3GFBA 3OJWA 2QUJA 3DPSA 4ZCLA 4DCUA 5DWVA 5DHPA 1G7SA 2IITA 3PSHA 5KSPA 1T1EA 4RPIA 1WLYA 4AECA 4D1YA 4D9IA 2XOEA 1K08A 1BN6A 3O21A 3C74A 3N6VA 4GO1A 4QJ5A 4JEUA 1JLKA 3EZNA 1MFPA 4AP6A 1L4MA 2F1KA 1WW2A 5JS1A 1T2UA 4G5YA 4HTFA 4B3JA 3G5LA 1IVSA 2PSEA 3N0RA 1Z2EA 4D3XA 4KXYA 3U3ZA 2Z95A 4YMVA 3AIIA 3KVYA 1DEOA 1PZFA 5EIOA 1MIOA 1ZBDA 1ANKA 1QFMA 1PK8A 2YMQA 5JNTA 2OV2A 2KBEA 2QYOA 3HBAA 5IBCA 2JCVA 2C98A 3LDGA 4LQ4A 2V7TA 2AZTA 2O1SA 2XMCA 4MVJD 3PLNA 4D42A 3HJBA 3NR2A 4M83A 1E32A 1LPNA 3TKLA 3MJSA 1E3QA 1JDBB 1QBGA 2LTAA 3LNCA 4S1WA 2ZPUA 3D8SA 1PZHA 2B0CA 1GEEA 2GBLA 4IXNA 5FKJA 4R5HA 3BJRA 1J6UA 3WBBA 1XV5A 1E7SA 1PDOA 4FXOA 1SUIA 5BYAA 1QVWA 1VGVA 4UOEA 3C7AA 2H08A 2WSSD 2J6CA 2MSCB 1O95C 2XSZD 1WA5A 5CG2A 3RHZA 2ZU6A 1PW5A 3RC9A 3O4GA 1G2IA 5DHFA 5KCMA 4BQRA 4YRRA 5FWNA 3IEUA 4XJXA 1E6KA 2R6R1 1HE4A 1XXHE 2ZTUA 4A91A 3IQGX 5T4FA 2DTXA 4Y2XA 2V1XA 4BP3A 1CYDA 3DCYA 4N5HX 4RGQA 5JISA 4U8GA 3AJ9A 3K16A 4PY2A 1T34A 3FD8A 5COAA 1XEFA 2O0HA 5IXYA 3E15A 1OFUX 1WDLA 1Z25A 4DR6B 1E5VA 4TS1A 1OGIA 1UK8A 1PNQA 1EUDB 1OTXA 1ZJYA 2H9AA 4GI2A 1L5ZA 2VRCA 3VR5A 4DANA 3G49A 2PX2A 4DB2A 2B69A 2CZQA 1KH3A 2X0IA 4Q9HA 1QX3A 4GPD1 4BFSA 1X8KA 2YNMA 3D2AA 3UKDA 4ZI7B 1NT4A 4RKEA 4LG1A 2A59A 3C6MA 3MWEA 4C3UA 2UZ1B 3CCBA 3SIXA 2PSJA 3V33A 1YDEA 4LVNA 5BXQC 1O96B 2ZROA 1A9XB 1M7BA 4AM8A 3GLFB 2Z5LA 5EWJA 3S7ZA 4BKOA 2VUTA 4ZU1X 2DR0A 2ZPAA 1C2YA 2DOKA 3C3CA 3OI7A 4RTRA 5FBVB 1DCTA 5F7XA 1GUAA 4MWSA 3UW3A 2IPAB 2VJQA 4RQUA 4G9EA 2CLEB 3Q8MA 1B14A 1E98A 2HMYB 3V1LA 2FP3A 2G0AA 3QUBA 5M34A 5IASA 2GYYA 3T9AA 5J58A 1LW6E 2ODWA 2O2JA 1YC5A 3L06A 4L1KA 3MT7A 4DYHA 1TQ8A 4YRFA 3FCYA 2ARKA 1Z07A 1MVNA 2JFVA 3I28A 1X19A 5IKEA 3EN0A 2QQ0A 2W8BB 4O2BA 1KZ9A 2WTEA 5DTEA 4O8CA 4BNKA 4DRXB 1SXPA 3ZCVA 2A5LA 4CEJA 1X7HA 3LBAA 2AJ8A 3KKZA 2X2FA 3LS2A 1GY8A 4R69A 1MD9A 1SBIA 3HCNA 4X0EA 2PJRA 3EWAA 2ZSHA 4NJMA 3FPCA 3ETDA 5EN4A 1E79A 3KKEA 3Q6NA 5IUKC 1Z37A 2CKDA 3P2EA 4H4DA 4UHEA 2KLBA 1V9LA 3B13B 1HNZB 2V7WA 1XDWA 3R9IA 4WZAE 3R7FA 2YWFA 4JLOA 4JROA 1EZZA 3QMWA 1X1BA 4IKOA 3V8RA 4PYKA 3AW9A 3NRJA 3T1VA 3N7AA 3QWAA 3FLBA 4LSWA 2D5LA 3UJ9A 4C88A 4LW8A 3Q8KA 3H9GA 4DADA 1QH1A 3LGXA 4QATA 4YT5A 1Y1SA 5FNVB 5T6MA 1W2HA 4O4IF 4F6CA 4RZ3A 1UMCB 4RNCA 1NW4A 3BSYA 1JEJA 3LUJA 4RV9A 3DSRA 4RZUA 3U3DA 3EF3A 2QXTA 3X1ZA 1GSHA 2M2IA 4KUGA 5DCUA 1U0JA 1D6SA 1YUBA 4ND5A 4W8OA 1KAGA 4GP9A 2GILA 4X3CA 3RYHA 2OWEA 1RJ9A 3A1UA 3IUPA 2JIOA 3AR8A 3L8MA 2B4RO 4MDYA 1YS2X 2ASVA 3CRMA 4MW0A 3FF1A 1IN6A 4REOA 3SKVA 4HCJA 1FNCA 1FUKA 4DABA 3SQXA 1X8XA 3U44A 2VAWA 1O9HA 5IG2A 2WJZB 1PGJA 4L57A 1MX9A 4GM4A 3EC7A 4BWGA 2GD2A 1T2EA 1HFEL 3IALA 3TLMA 1FSZA 1ELOA 3I2HA 4ND8B 3GNLA 3NDBB 2OGTA 2OXIA 1QGED 5D1HA 4MOWA 1U9ZA 1N2JA 2ATEA 2YFYA 1AKRA 5BUZA 4BX8A 5BNZA 2JCSA 4IJ5A 2JLVA 1HT0A 1M75A 3K1YA 5JCPA 3UKJA 5BR8B 2Q4RA 2Q3HA 3D3WA 2XCIA 4EJSB 4OJQA 1ZN2A 3ANNA 4LTMA 1CHDA 3I76A 4TQUS 1KYTA 1NSTA 2FZEA 2GYWA 3AUXA 2DP4E 4NDZA 5H70A 4CM5A 2C4NA 2RGWA 1CX9B 3FFAA 4LYAA 4LDRA 3BE6A 3I64A 4NBSA 3HACA 1E3SA 2O50A 1C0KA 4M0FA 4IR7A 1CRLA 3AETA 2JGKA 2NOAA 2WTMA 3AM5A 3HR4A 4UU8A 2ZVDA 1IC6A 4UUOA 3TNFA 4N0EA 5LYJA 1KARA 2ODTX 1I6LA 2HDHA 4FK8A 3GFFA 1EJ6A 3H2KA 3VYSB 2G83A 4MJ3A 4BLVA 1Q22A 4CF6A 4YMTA 1VCOA 2LDBA 4LJ9A 1IY1A 1EWQA 1S8NA 2J67A 5ALQA 3W5BA 3ZE7A 1GV1A 3B3JA 4L75A 1G38A 2EP7A 2HHJA 4G5SA 4C2AA 1QUEA 2ZBFA 1QV7A 5L3RA 3N28A 3QQ5A 2JA2A 4K2HA 3EZ2A 2NN3C 1G0OA 3SAJA 5LQKA 3GRKA 3GUHA 4R40A 1AKYA 2W6JD 5DT9A 4AXXA 1W7AA 1QB8A 1RAAA 5AVQA 4L8LA 5KPDA 4A23A 1Y3BE 3K9NA 4GRIA 3KLBA 4R6XA 4TT3A 5J5VA 2QP4A 4YPFA 4LCEA 2XXAA 4HH1A 1WTAA 1NP6A 2H51A 2LUOA 1LI4A 3KK0A 4MEJA 5DTMA 3UB2A 2Y66A 3CNNA 1EBUA 1E2EA 4RD2A 1AY0A 4KQCA 1C9JA 5T67A 3CU5A 3VO8A 1TEXA 1RW4A 3X2SA 5IHXA 2FUG6 1DJLA 1I30A 3B89A 4PC2A 1NBEA 1RFLA 1QFXA 5B58T 5HF9A 1U4OA 4BRZA 2JKZA 2IS1A 1M6WA 2WIKA 3BXPA 3E70C 4C20A 1UDCA 5T7BA 5J2TF 1KI3A 3RTEA 5DCWA 2V7GA 2X5JO 4RESA 4FD3A 3HM2A 4LSZA 4U2FA 2Z5FA 4DV6B 2QRVB 3DM5A 3DO5A 1Q3HA 1I14A 3GLRA 1J2YA 1JXOA 5FAXA 1EYZA 2YHSA 3BHMA 4G37A 2AN4A 2FOLA 4R2XA 4BZZA 5KMGA 1KOFA 4U9HS 3C6QA 4QPNA 2VQ6A 2Y1DA 3MWYW 2VK1A 3HB0A 3KAKA 3PEEA 2WWHA 4HWKA 2FAXA 1C9YA 1LXCA 1U3TA 3I0MA 4FLMA 5JXHA 2AW3A 2GEFA 4MPRA 3RQSA 3W5AA 3L18A 3T1QA 5CDUA 3FW1A 5KHAA 2VT6A 3K2BA 4NKRA 5C8VA 1FFAA 4UOZA 1WUIS 3V7UA 1QR2A 4RL6A 1Y3HA 4RK6A 1UP7A 3EGIA 5AYVA 1U1FA 1WABA 4AS2A 5JYEA 3LGSA 5EJEA 4DOMA 3SZRA 2LP4Y 3K94A 2RBEA 4YACA 5C51B 4GFDA 4IWYA 2F43A 3OECA 5KNDA 4ZO7A 3VDQA 2CF5A 1N0IA 3EIFA 3M8KA 5JROA 4MZDA 5C18A 1RBMA 3H11A 2YIDA 4Q4CA 2P27A 4TTAA 3RKUA 2E4UA 3T94A 4ZMBA 2GUWA 1Y34E 5DX1A 2F64A 1CR6A 3A3OA 1PIWA 3I42A 2FEPA 1SA0B 3X1MA 4OQMA 3OY7A 3GH3A 2ZSIA 3RVPA 2FEAA 3IUJA 4J16A 2HD4A 1LDMA 3INGA 3WI7A 1Z6TA 5L51A 2D59A 4MCIA 4H7PA 4WT7A 4EQ6A 3LT1A 4KGXA 4LOJA 5CAEB 2MSDB 1UWCA 1IOLA 2IDMA 2I4LA 1TUBB 2PCJA 2AQHA 1D4FA 4B4WA 3L7AA 5CNIA 3H1FA 1XP8A 1QH9A 1JR6A 2CLOB 1E4EB 5J23A 4TROA 1IJKA 3FOBA 1U0OC 3S81A 5DB4A 1D7AA 1QOZA 3UXMA 1AT1A 1PCXA 3BH7A 4BU0A 2JLRA 5JO9A 4BEJA 3JD1A 3S6JA 5FTWA 2DFKB 2TMKA 5D6OA 2FSHA 1BFDA 3VZCA 4B2IA 5B36A 1CQWA 5E3IA 4CPDA 2GGSA 3BTUA 5AKJA 3D8BA 1N0VC 5A06A 2OPHA 1P1JA 4JJ6A 1GUZA 1WVGA 2Z1DA 1JXAA 4HJRA 2N9UA 5EKTA 1NVTA 3MMXA 4BN0A 4ENRA 1TTTA 1QX4A 1OSNA 2B2XA 3EZGA 1KJZA 1YOBA 1M8PA 1BHSA 2B35A 2OK8A 2XRMA 3UFXA 1RRGA 4JU8A 2CVOA 4NR0A 5DGXA 1BROA 2F1IA 1CJVC 3OSZA 5I7VA 5JJKA 1GLVA 1ZCZA 4ZCQA 1OIXA 3FTPA 3RBXA 4B4VA 2A9QA 1IOWA 2X9NA 3EZYA 4MULA 3RSZA 1O9BA 1ZGBA 1V6AA 2CLSA 2JEYA 2QOEA 2ZRCA 5A7FA 1R2QA 1NPYA 2PGOA 2RGBA 5EXSA 4IEEA 1W93A 3TD9A 3ILYA 2C1XA 2VHYA 3JD2A 3WZ2A 4F9TA 4RHFA 3TSOA 2V7VA 2VUHB 4B76A 5D3MA 4EH1A 4PZPA 1Z08A 3K5IA 5L3QB 2QBYA 2WY2D 4N6GA 3HJGA 2DBYA 1Q50A 2ZCJA 3H4MA 3AUUA 3DZ8A 3EBLA 5AFSA 1A8QA 3GGJA 2AN9A 5FBLB 4B35A 2PX8A 1IEVA 1US8B 4UNIA 4GYYA 4XD7D 2JLBA 4WSOA 4ZYVA 1E1QA 3SMVA 1K6EA 1P6UA 2CXHA 1Z68A 4V38A 4K40A 3I2GA 4ZYLA 5CBPA 2ZUTA 1J99A 4Q02A 3OQJA 4OHZA 5KDDA 2OLJA 4GRDA 1JTVA 2PUBA 3E9RA 1SVUA 5JS6A 4FONA 5JXWA 4B6PA 2NVUB 4Z7OB 2WMYA 3HDVA 4P4GA 4NABA 2BJVA 4MVJM 3U7RA 1G8YA 1Y4SA 5AUPB 5L3SA 1YKSA 2ZSFA 4FVTA 1OAOC 4O4HF 3DLBA 1NBAA 2M6LA 4LJ6A 4E2YA 1F7UA 2BBWA 1U28A 1HNXB 1BMTA 5HG0A 3SBEA 7MHTA 4OKSA 1C7QA 1UAAA 2NADA 2Z4RA 3C3XA 4ONEA 1OR8A 1Z6AA 2QORA 4K7JA 2ZIXA 1T8PA 1XTZA 1FP6A 1PT7A 2IWRA 2XCLA 4JLAA 2FMIA 3FLAA 1CJTC 1Z17A 2D1FA 2RHCA 5HOEA 4RTPA 2YKGA 3K0BA 2AZMA 3QWIA 3LUPA 1P1RA 2IOFA 2R6GA 3W8EA 1GXSB 3WGQA 1C30A 3SQOA 1MAWA 3M5DA 2HWXA 1RXYA 4FBLA 1KBZA 4IJMA 4DGQA 3O8OB 4KIWA 4RA6A 1UWLA 2DY1A 4HDMA 3MBKA 4HNUA 3OFSA 4DKJA 3M9LA 3QE2A 3EMBA 3I53A 1K4MA 3RC1A 1NRXA 1ZK4A 2IVFA 2FW7A 2V65A 1EGQA 3FMIA 5AT1A 1A76A 4IRUB 1ZIYA 4J9VA 3NS7A 2HH9A 3P20A 4JC5A 3W90A 5DTIA 4DQXA 4XIFA 1BDIA 1P44A 2EOAA 2BMAA 3RM3A 3WB1A 4E4YA 5KWEA 1U2TA 3TZHA 5B7PA 1Z2OX 1R4MA 3SQWA 1D2NA 2QN9A 2XT0A 2ZRDA 3NANA 4ESVA 1H0SA 3CMCO 3L84A 1JHXA 1FNMA 3RREA 1IY8A 2Q6IA 4KXNA 4PNHA 3TAHA 4F8EA 1IAQA 4QLOA 4FMDB 2PBLA 4IWNA 1V25A 4BFLA 2ZZKA 3WFJA 4FZVA 5BMVB 3GN1A 2W2NA 3HJNA 4IO1A 3SBOA 1ZMTA 3OOEA 4AFNA 3UMVA 4P5PA 3V8VA 4B3DA 2R6HA 3DDCA 3BB4A 3HU1A 3K9QO 4FGJA 3KYCA 2PH5A 3O1LA 3S1AB 4C07A 2H63A 3BULA 3LUKA 2YL2A 3IKJA 4WLEA 1I9CA 1ZPDA 4DMLA 2X4GA 2UUOA 3QZUA 3O4RA 1GTMA 1YHNA 4CG1A 3EC2A 4N39A 2QLNA 2CGEA 5FUMA 3QITA 3HA3A 1W1WA 1ATZA 1NHWA 2IELA 2L0XA 3NKFA 4FKZA 4QL3A 4KO4S 2ZP1A 3WP0A 1YA4A 3TZKA 1QHHB 4DLYA 2QV7A 4O1HA 4G85A 3M1LA 5ALHA 4LC0A 4CKYA 3L8YA 4GECA 2YYYA 4PYIA 4TMYA 5TEVA 4UCXA 2EHDA 2QLMA 2C5FA 1IZ9A 2ORVA 4FFDA 3H86A 3SR3A 4Z1OA 1F6WA 1NGSA 2GBCA 3K6JA 1VI6A 1KNQA 3CX6A 5FQNA 4DWJA 2BBTA 3D0KA 4ND2A 1QORA 1YZKA 4CWAA 1TB4A 1Z0UA 3K31A 3KTOA 1J70A 1E6EA 1XXLA 4NMWA 5ENZA 3ZDEA 1PNVA 3STVA 1JBEA 1KMMA 1L1EA 2ONYA 3I1YA 3T5TA 1NW3A 1N2CB 1FRQA 2VXCA 4J6EA 4O1MA 3ONVA 2EKDA 3NAGA 2IQ5A 1M5RA 1UBFA 5TS2A 4F8YA 3FTFA 3NYWA 3LDFA 2ZQYA 3FDJA 2IWHA 3COYA 2PMWB 4FFMA 1BGWA 1SKBA 3OZEA 4DIKA 3LBNA 1UZNA 4L4XA 4TS9A 1F6DA 4AQ7A 4C01A 4JI0B 3WLMA 4JLPA 4AJHA 4K9SA 1CB7A 1KFCB 3GG9A 4MRMA 1UJ6A 1TJPB 1KEWA 2IRWA 2RHLA 2WAAA 5C7LO 5KQGA 3L79A 3D7KA 1V3VA 2M6SA 5CD9A 2O8CA 3A4VA 3T5DA 1N6IA 4B48A 2XBLA 2PAFA 4KWHA 3ROQA 2NACA 1S6YA 1A2QA 4EUKA 2ZT7A 1OBCA 5BQOA 1U4NA 4MKXA 2P1RA 4H7KA 2PU7A 1DOHA 4UHKA 1A5AB 4FEAA 5K8UA 2X15A 3A4IA 2IUFA 2I3BA 5F21A 4B9AA 3PFNA 4LMBA 1R9GA 2VHQA 1GKLA 3CNBA 4CCWA 3IT0A 3OCXA 5JZOA 4FSDA 3LC0A 3RSGA 1T5BA 4PWZA 3CPEA 3HKCB 3A2KA 3A4TA 4YI3A 4URVR 2FPLA 4JB8A 2SECE 2J31A 4Y67A 1MB2A 4AJ2A 5DN6D 5AVVA 2MHCA 3RS2A 3LVBA 3OKCA 5PGMA 3FWZA 3RARA 4BQQA 3AB7A 4Q3DA 2GN0A 1WF3A 2QRLA 4F5EA 1JHOA 4YJ3F 4RA9A 1OGJA 2Z6AA 2WK1A 1FMJA 2JC3A 3JQ9A 2GA8A 4AZSA 3N2IA 2IPNA 3EBOA 4BFCA 1TM2A 1SAYA 2BEKA 5A3VA 2UYGA 1WEKA 3AY3A 3WBKA 5BN5B 2XV1A 5B1EA 3M81A 2R97A 5JS2A 5FV7A 1L5HB 1ECPA 2MR5A 3BZUA 1O95A 1Q0UA 4L5IA 2O6HA 4Q4JB 3GQVA 4P5DA 3WDLA 2WQZA 1JSRA 2HRZA 1FQKA 3PITA 3TD2A 3QE4A 4B6GA 4LYDA 3FGNA 2AEFA 3AHJA 5EZSA 2NSYA 3NTXA 3EXIB 3VYRB 3MWFA 2K7ZA 5DGTA 2YR0A 4CLEA 1UK7A 3VHRA 1COZA 1RWBA 1MZVA 1W9HA 1Y1QA 4FOTA 1QRAA 1I32A 1OTYA 3PF9A 2DFVA 4LZWA 3BXOA 3MWJA 2J7KA 3QPVA 1RKXA 2HJ9A 3FZEA 3MELA 3R8XA 2IP2A 4E2ZA 2RGDA 5IXSA 3HCRA 1YIAA 2ZYRA 4O29A 3ESYA 2FX5A 4JUBA 3SYTA 5HX7A 1DG3A 2CDBA 1K4YA 3CUYA 3DPIA 1GJRA 3CX7A 5AD1A 2IE0A 4RV5A 1H42A 2YDXA 1CY2A 5CITA 5EJ8A 5BR4A 3NONA 3K1ZA 3H05A 9GPBA 2HJRA 4PC6A 4E2FA 1ZI6A 1MIHA 3E2MA 5TQ2B 3E8XA 1JWAB 2FG7C 1IQPA 1FOEB 3MB8A 4QVGA 3AKYA 4D7AA 2BR3A 4EFDA 3WA7A 3FM9A 2RSLA 3OUTA 1BX0A 1ZEJA 2OLEA 4Y6SA 3RBZA 1CQJB 2G6TA 4IH1A 1OXKB 5I9IA 2P5UA 4MDFA 2UYQA 1TAQA 1A95A 1E94E 1ZNYA 4PZZA 4IGEA 4NYMQ 3W7BA 5FULA 3BEOA 2JHCA 3M6UA 3RVJA 3KDPA 1UPTA 4BMPB 1HT3A 2I7TA 5DBHX 1NVEA 1DWOA 3AR6A 4BZQA 1G8FA 2X9GA 5CVCA 4JP2A 3BWDD 4JUDX 1DKQA 4G63A 3ZHBA 1SU8A 4ZJZA 4PIVA 1AA9A 4XOUA 4OFZA 4JC0A 3FYSA 3OURA 2R2GA 2JFGA 1KVUA 2GAJA 3TX6A 1DV2A 1ZSNA 3THWA 2Z6QA 1W8IA 3TD6A 5IDXA 1RACA 5DK4A 1SD5A 2IY7A 3ECAA 5I8WA 2I65A 3KOWA 1I6WA 4GQBA 4IQFA 1R4ZA 4X45A 3LYUA 4J43A 1KEKA 2EZ9A 5KBYA 5LKAA 1CDEA 1L5VA 2BEJA 5KUTA 2VEOA 4L07A 5EIAA 2E2WA 3H9UA 5JD6A 1RJWA 3E9CA 4LOLA 4DN6A 4B87A 3EAGA 4EB8A 1DB3A 4RMGA 1KJIA 4E31A 4EVRA 1UBHS 2Q3EA 3LFUA 4JMPA 3FPAA 1ADGA 1Y3IA 5F2EA 4Q37A 3TUZC 1FP4A 3OJOA 2OG2A 1VLVA 3ZDZB 2J3MA 4ZT3A 2H65A 4I46A 3KWMA 2I2AA 4TRNA 3NM5A 4ZARA 3WIUA 4UVGA 4IH4A 1XROA 2ZWVA 2FZVA 5COQA 4ZVKA 3O4VA 4Y1RB 1M10A 1AKWA 1FXWF 3OQVA 1XQ1A 5TVGA 1X80B 1XL0A 4RCYA 3I12A 4NX2A 1KR5A 1S1CA 4L5YA 1B23P 1FCJA 2EJCA 4H7EA 1G2OA 2QP3A 4OLFA 3IQXA 4D9HA 2OC4A 4K46A 3HY4A 1MR3F 3KXIA 3S2ZA 2HJSA 2FR8A 3KUDA 1DAOA 2BUCA 2WUGA 2JJ2A 2F1OA 1EU1A 5DRYA 3S1LA 3TSZA 4BNLA 3DYBA 1FDSA 3QNUA 3V34A 4EEZA 1DL5A 2FFJA 1OD6A 3ENWA 2ZUWA 4IZ6A 3KUCA 1CJKC 3A1TA 4TSFA 5DLEA 2D13A 3FGPA 4C06A 4BO3A 4E5VA 1U11A 2IPLA 2YWRA 2Z2ZA 3L0ZA 3QEMA 3OCZA 1SXJE 1ZCFA 1Z6XA 3MUEA 3PGVA 4X6YA 3WMEA 3RRYA 2JD2A 1M2KA 3AM4A 4PPFA 4OHUA 1EM8B 5LCXA 7ADHA 4LRXA 3ETNA 3O8LA 3LWDA 1PJLA 1Y5LA 3PUHA 5ALJA 4YO8A 1NF8A 4F1KA 4WLVA 1YZLA 2O3TA 2AEEA 1CVLA 1F60A 2B1QA 2GAIA 2HCBA 2QRHA 2OBNA 3F78A 4HQ0A 1T13A 3DKRA 3SC6A 1VZ3A 2BFCA 2VRNA 4C29A 5TR9A 5IU6A 5CCBA 4KMMA 3S2UA 3SM9A 4LXXA 2FSIA 1OZ0A 5FLKA 3ZU5A 4NCIA 4ZYXA 3TFWA 3FOZA 4G2NA 3HYRA 3LUGA 1LY1A 1OA1A 4KR3A 4R3WA 2LCQA 3AF2A 4AF7A 1J2JA 4BKPA 1TFUA 3L41A 1Y4DE 3H2BA 3B8HA 3DQPA 1E6MA 4V3BA 4YUYA 2IV3A 5BT8A 1NW8A 3KALA 3U3KA 1U31A 4HL6A 1C8VB 4LDNA 3HSKA 4P3XA 4MIOA 5CDSA 2FDCA 5BN1A 2QTMA 3KVVA 3VDRA 4AT1A 2QM3A 5I3CA 2AKEA 1MW9X 4AJJA 3O5AA 3T1YB 1F1BA 4RCZA 1QQBA 3HDTA 3L1UA 2WE7A 4KWEA 2ODPA 1LPMA 4Q93A 3HEBA 5EZYA 3QVTA 3H83A 4UASA 4BP1A 4CTNA 3AI3A 2J6HA 3P94A 2E49A 4UPEA 2Y6VA 1A1VA 1P4SA 2C5HA 4Q1EA 4D9KA 4KIGA 1XCGB 2CBXA 1MC4A 1IRXA 1E99A 1LPBB 1XJ5A 1C41A 3H9CA 3I3OA 4J6FA 4URFA 4CNQA 2Q0HA 1QHSA 4NDNE 1G3QA 1QHFA 4Q3NA 4CM3A 4FB5A 5HM8A 3KM0A 1AKEA 1K06A 1D6JA 3KQMA 2PYZA 1DZ3A 4IICA 4W8GA 3C3DA 2Y3IA 3VH3A 2J3HA 4B85A 3P2JA 5JD4A 3V8NA 3K30A 4I9UA 1V11A 2A4MA 5A4JA 4PRKA 4TVBA 4C7OB 2FWAA 1KRHA 1UDAA 1RR6A 4ER3A 4P4SA 4M37A 4EUSA 1C7EA 1VE5A 4F45A 2P67A 5E0KB 5LMZA 2Q1SA 1PHPA 2P77A 2XB9A 2YHAA 3DA8A 3NLLA 4MS3B 3FBWA 1R1DA 4RL4A 4ESOA 2BGKA 4Z5XA 5HQ3B 5IFLA 4IIUA 5HM6A 1S5PA 4YRPA 2C2KA 1JFFA 3WJ1A 3F7MA 4IH9A 1GKYA 3K0AB 3AUAA 2H1IA 3Q3CA 3R3HA 3WRXC 3WWYA 1F4PA 1NBIA 2Z9BA 4KQEA 4EAAA 4WK6A 5JWOA 5LP1A 4RFVA 3M4YA 5AK5A 1AKTA 4H6PA 4JQZA 2XNSA 4HR7A 1FJHA 3WL4A 4GICA 6NULA 3MSCA 3QXJA 5TPWA 5I7UA 5L45A 4IXWA 1R6DA 3UTDA 1FTGA 3EIWA 4BN5A 3HVKA 3W5SA 3ZWYA 1SURA 4HB2A 3VR5H 3ZGNA 1R0BA 3AHEA 1YHZA 4ZI3A 5DSTA 4BGIA 1V39A 1T15A 1X13A 1JHZA 2OFPA 5G4KB 4AY5A 3BDAA 3U1TA 2W6CX 2EGHA 3NEJA 4QBIA 4E03A 4JEMA 5J4VA 1P9WA 4US0R 4XQGA 4FGUA 4UTNA 2XPCA 2QTTA 2A3NA 2I22A 3BDVA 3JQGA 3I9KA 2E4YA 1T3ZA 3AVXA 4HF7A 4O2RA 5AOCA 4B6QA 4JV5B 1QBKC 1FVHA 4B2LA 4EMSA 4K6GA 2J87A 4UFOA 4F2WA 2JBAB 4HC4A 4TLDA 1EJBA 3PRKE 4ZO4A 4C6RA 1YDFA 1D8TA 1PL0A 3PU6A 1T1IA 2VDQB 2GPTA 5IRCD 3V2IA 2OFXA 4G5GA 5KTPA 4PHCA 3VX3A 2X0RA 5BWCA 3HB1A 2ZJ1A 1YKFA 2W6QA 2YV2A 1JIVA 3PXAA 5TF4A 4BZPA 1XF9A 5D6NA 2FJUA 1Z06A 4GZ3A 4JITA 1UMBA 2H8KA 1KAOA 4CFZA 5C0OE 3PXGA 5BSKA 1TM1E 3F67A 1W9MA 1TOAA 3BRWA 3L6EA 1UBMS 3S5UA 1UADA 1V5IA 1E4OA 2HDWA 2PLNA 1GGJA 3A1SA 5IARA 2CK3D 3AEKA 1VBNA 3RABA 3LFTA 3FMPB 2WWWA 3MRVA 1JT2A 2ZBEA 4EGCB 1XKXA 3A0RB 2AH5A 3RKRA 5AW1A 4JSYA 4WXEA 2OCAA 4Y6LA 2OHHA 2O8DB 1C9NA 3B53X 5JAQA 4XB6B 2JNWA 1VHWA 2R96A 4NZ9A 1WY7A 2D3WA 3FYCA 5KTRA 3D3QA 4BJ3A 4IOLA 5AXDA 3H8WA 2ORIA 3F74A 3COZA 4C1NA 4KR2A 1U7UA 1UKCA 3PPIA 5CNMA 4X00A 2ZW9A 5H3LA 1OXUA 1YWGO 2AB0A 3FUCA 3K4HA 4PFJA 5JEEA 3OJCA 5TIIA 3VU3A 5SZHB 3TZQA 5CXSA 3IGFA 1OB2A 4I8IA 1JKJB 1P7ZA 4MB2A 4M1OA 4TV8B 5BORA 5DV9A 3R76A 2CXXA 3GRRA 4IVQA 2RC6A 3FVWA 2CNLA 3FPHA 3L82B 4FYXA 4E0BA 5BOSA 3ITDA 2RGXA 3HCCA 3ROXA 1EUCA 2A5JA 5TMBA 5EC8A 4EARA 2J7PA 2Z08A 1ND5A 3FTQA 1DC4A 1KP2A 4MV6A 5GP1A 4EHKA 1L4LA 4JYAB 1JEYA 2WSLA 1GSAA 4PNPA 3WGUA 3H5RA 3VR4A 5EEHA 2DH6A 1QIJA 3BIJA 2GYUA 3GEEA 1G6HA 1NYTA 2J0EA 2ECQA 2FWNA 1GUDA 3QVVA 4KPFC 3UUWA 4G41A 4QVKA 4KQMA 1SCJA 3NTLA 2Q50A 2BRUC 1GCIA 1Y89A 2AX3A 2P3LA 2AQ8A 3N2KB 4KJXA 4ZO9A 3OESA 3TLGB 4PG4A 1E1MA 1U1CA 4P7BA 1DIOB 3AKEA 1MJFA 4D56A 4N7MA 4PYMA 3CJTA 4X5OA 2D4AA 2EEZA 3GOQA 4DCPA 2PAAA 4V0RA 1RQPA 1JQDA 1GL9B 3UB4A 3HGMA 3V32A 1BXGA 1N2OA 4OTZA 2A2ZA 2IK8A 3W4KA 5B6JA 2WPNA 3GR6A 3IUMA 2YOFA 4E5NA 3LDAA 4JA0A 1LS6A 3KEQA 3P32A 4I7EA 4MHSA 4FQ7A 4PBTA 2PMCA 4FCTA 4FE4A 1A3CA 4YWJA 3OHMA 4I08A 2B61A 4ZKEA 3RS9A 3ZUPA 5BMOA 4MNTA 5JSQA 3TQIA 1W6RA 4I2NA 4CLRA 3M4ZA 4YAEA 3GLFA 3LHFA 2HYIC 2CT8A 2PWZA 2B2NA 1OC2A 4YEDA 1YQEA 3CHYA 4FJ0A 1CEXA 3CVYA 2OMEA 1WU7A 2V8BA 3OIFA 1HEIA 3ORRA 4YAGA 3FWKA 4QXPA 3MFYA 4MRVA 2ZIUB 3BXHA 2PZFA 1HZZC 3DMTC 4PPGA 4QELA 3RK4A 1BVRA 1PTKA 5GV8A 1XRNA 3DC7A 4UM8B 3ZJTA 3G88A 1WJGA 2QY6A 1VLLA 3U4QB 3C7CB 4XD2A 1UJCA 4AG6A 4BLWA 1DVRA 1K97A 2NTJA 2VT2A 4AJEA 4J1SA 1Z0JA 4JFRA 3NIGB 5HTKA 1I2CA 3O8RA 4DV0B 1QRTA 2A88A 2C83A 4QPJC 4DCOA 1TKRA 3B6EA 1B8PA 1RPJA 5E9QA 5KOJB 521PA 2X5NA 3R0VA 5JE8A 4ZQGA 121PA 3GVCA 3JAWA 4YONB 3KSUA 3W1WA 4NZPA 4B8YA 2C2YA 4FWTA 5LBTA 3FF4A 2GEUA 5ECDA 3N8KA 2N1MA 3RUCA 3E4DA 1H6BA 2W6ID 4MKHA 4UEOA 1I4EB 13PKA 2LE0A 3JRWA 1H4SA 3AYXB 3OPQA 3HNOA 4RNDB 4LOIA 4IGAA 1ZH0A 4HQFA 3ERCA 2GBFA 2G7MC 4QXAA 1K7CA 1PQUA 2VJBA 4JLNA 3R6DA 3ENKA 2JEZA 3M70A 1LLFA 1BMQA 1ZOSA 3AF4A 3G2LA 4K0RA 3UMBA 1EB8A 4F3YA 5K6AA 5FO0A 2QMEA 3FOWA 3PDJA 3R5KA 3WHIA 3WWZA 3PV0A 2ZYUX 1U3DA 1XAIA 4LZLA 2WE8A 2D54A 2X5KO 2HNBA 4CKBB 3HI4A 1AQ6A 4XI9A 1X1SA 3DE1X 4CTMA 5A9SB 2DTDA 1MA3A 4CMHA 1J07A 2F1RA 2QG4A 1D03A 3DHNA 2IX3A 2HMAA 3F7TA 3NP9A 1C3LA 3QVMA 1MUUA 3F90A 3OLZA 1JEQA 2PRIA 3KAPA 1RC0A 1PR9A 3ABSB 3H6KA 4HXYA 1QGYA 4Y2SA 1XZAA 1FB5A 1PX0A 1V48A 4HJXA 1A98A 4L72A 1CR2A 1CUVA 3SJCA 3CPHA 1QVAA 1PL6A 3ANMA 1XD8A 3P0FA 4U5XA 1D2EA 4O3MA 1BNCA 2JCBA 3U9TA 2GT1A 3VBEA 3VNSA 1GDDA 3VR0A 5EJGA 3FHJA 4L28A 1LBEA 3RIXA 2AXEA 3FR7A 1JSCA 3K05A 1ODKA 5EFZA 5E38A 4J0CA 4DCGA 1NNLA 4E3WA 2MYPA 3MMPA 4GPZA 3X1XA 1A4XA 3C3KA 4TLCA 2O59A 1SZPA 4EA7A 2FQQA 5KNDH 4WFQA 5T8KA 4ZTUB 3BB3A 1CVIA 2C4UA 3AB3A 3H8SA 1VKOA 1SXJD 4W1QA 2AZXA 2ANCA 5EMKA 1KWGA 3CWQA 1G4AE 4X7MA 3CLTC 2EIXA 5D3QA 3TCXB 3QOFA 3NDPA 4UM9B 4MPPA 5LOVB 1E9SA 1BVYF 1Q3KA 1ZOLA 2WFZA 2VDRB 4H7JA 4W63A 1IHPA 1DP4A 2QVLA 1YRBA 1N0UA 3CG0A 1YQDA 4HSEA 5FBWB 1E1DA 1EP9A 4IIJF 4Z0HO 4INAA 4MP6A 4YROA 3G23A 1N5OX 1I5EA 1KAHA 2P2SA 5DW0A 3OZGA 5JDCA 3UGJA 1I3NA 2IYLD 3C8UA 1EK2A 1XZDA 3EUAA 4G1UC 4WCFB 2R7AA 3FOEC 1C1YA 4AZ0B 3ZCSA 2G5CA 1UT6A 1MG5A 1ORDA 2ZSUA 3Q9LA 4HX9A 1NWCA 4M9ZA 4CDRA 1GCUA 1JYFA 2L42A 3EULA 5J63A 3UMMA 2X5OA 7GPBA 4BQPA 4HTAA 5IMSA 2R9VA 1WXFA 5LQJA 5F51A 4A0HA 2QM0A 5KDLA 3H1AA 4PLYA 1WV0A 2C5LA 2ZIEA 4EENA 2IODA 5IDWA 3RT9A 3W0LB 5EJ9A 1RI4A 3R3YA 3VM6A 2EW8A 4AN1A 2K2WA 2QW1A 3H5VA 3TR6A 1GNRA 1ONNA 1U5AA 4N0QA 1RM3A 4KPYA 1J49A 3NH6A 3ZD7A 3PZBA 2GKSA 3MBOA 2QHXA 3KL2A 2OCDA 3R77A 1T9BA 3IO3A 4GZ6A 4KN6A 2H9YA 4Q3EA 5ALXA 5ECYA 4TQGA 3R3VA 4H27A 1OI2A 2Y1GA 4MQFB 5KTKA 3GLFE 4YAFA 4G8JA 4JQCA 4QBKA 1CUZA 4FYPA 3BORA 4ZCRA 2G25A 1Z15A 2Q5EA 3G85A 4M1KA 5F2OA 1E5QA 2CUZA 1EGVB 4AY3A 3M4XA 1N5MA 5FA5A 5IC4A 1BCSA 1ENPA 1UF9A 3LRXA 4XUDA 4B33A 4NARA 1EXNA 4FGWA 2FMTA 5JJBA 1EGAA 5EKDA 1CUYA 1Q14A 3OA0A 5GPBA 4WWHA 3WFIA 1AS2A 2D62A 2WJVA 4HSGA 3HLYA 4QJBA 2GUGA 3NBUA 2FPPB 2EV9A 2BFDB 4E21A 4ZZIA 3NG1A 2PYDA 5I5EA 4P5EA 4X84A 1H8HD 4B75A 2R00C 1BW9B 4RYDA 3D2LA 2PTHA 2FRVA 2J9XB 2VP5A 3MJRA 4RZXA 5A9TA 1IB0A 2ZZMA 1I4OA 2AJCA 1GPDG 5KOHB 1GPNA 4G97A 2XA9A 3CJRA 1SB9A 3TLJA 4FR0A 1CQZA 4FYIA 3I30X 4PLCA 4XYMA 5EMLA 2PS1A 1G3IA 4JI2B 5JAHA 3DMYA 1QUFA 5C32A 3FSEA 4MI9A 4Q7QA 2A92A 4HB0A 3CH4B 4N5DA 5GONF 1O5IA 4HAWA 3IMGA 3HA7A 3NHUA 2A9PA 4DAEA 3CB2A 3CH6A 1Z47A 3I1FA 3GG2A 4YJ2F 4DJJA 2P4HX 3SG0A 1NVKA 5JALA 2AYZA 4M9CA 3EF0A 3OLQA 2LIPA 4G0WA 4O4IA 3BICA 3K1JA 5HQTA 5ICCA 3L8CA 4C0XA 2R6FA 5BVGA 5DGDA 3W5VA 3NHLA 2GTPA 4HX2A 4LQCA 2X6QA 3PA6A 1H8EA 4KE7A 2EWMA 1NMZA 4S2UA 4L9WA 2DSNA 3JD3A 3JATB 4R2HA 3UJAA 1NQWA 3D4NA 4F6RA 1G4HA 3T06B 3ZVKA 3T95A 5DW3A 1UXOA 4XLLA 2A0WA 1MO6A 2BFBA 3W77A 5FP0A 1TUBA 4D4IA 1F2UA 4M1QA 4XR4A 2RGRA 1MQ8B 3W9UA 2QPOA 1E4EA 2P9QA 5TPZD 3UV6A 3WWPA 1FNNA 2W22A 2B7CA 4OCZA 5KEIA 3O74A 1E4VA 1GZ4A 2Y4OA 3HWSA 4WBNF 3AKZA 4EZBA 3FSGA 2NTVA 4WCDA 4YT4A 4OK6A 3PHIA 4Z8YA 1MQSA 4I4IA 5LQSA 1JALA 4HLDA 4B40A 1I3OA 3VI3B 4MUGA 3JQCA 1AQLA 4LWZA 3GT7A 1T3HA 3H18A 3NBMA 4WA7A 4K6HA 5EYPA 5FI3A 4MR7A 2QDKA 3WL8A 3O0DA 4EHDA 5LDHA 2P79A 4KMOA 1GZHB 3CVVA 3O9VA 1LD3A 1KY4A 1ZKDA 4ZAZA 3OHSX 2VT7A 1KI6A 5FLXA 2O8EB 4QPZA 3VZPA 1CQIB 1JKMA 2PO5A 1E20A 1LPAB 3PI7A 2Z2YA 1JR2A 4GS5A 2QUKA 4OV6B 2IUYA 3ZDXB 1TTQB 5KYWB 5EIFA 5FR2A 5L7WA 1CZLA 3WDMA 1NVBA 2EEPA 3HSSA 2YQ4A 3EPJA 2Q2VA 2QTLA 4MVYA 1P39A 1YNOA 3M6FA 5GOZA 1CUFA 1E3DA 3SY8A 4DCNA 2WUFA 4FW8A 4YJHB 2QG9A 1I7NA 2O8BB 1XTTA 4GKJB 2NU7B 1GZ3A 1UFQA 2Q5QA 3AZPA 2BE9A 2IDZA 3N59A 4Q4HB 1B8NA 4ZOCA 3LX5A 3RSCA 3SXUB 3TBKA 3GP3A 2XUHA 4U2KA 4BV3A 3PR3A 2ZITA 2V9PA 4L9SA 3SLGA 1I4DD 2ZREA 3PX3A 2BSAA 3WIBA 4NV1A 4FSHA 1OYOA 3P0HA 4DZRA 2ZJ4A 3S5JA 3K1AA 4XM1A 3GI1A 5DN9A 4OX9B 3VR2D 1JHUA 1NBOA 1JFSA 3LHIA 5DHSA 3HVUA 4OSPA 1B7GO 4LHXA 1R3UA 3ER9A 1GYPA 3KUUA 1WETA 2REQA 4PE5B 3NJ4A 3BHJA 1DPGA 4N40A 1TF7A 4YNBA 3COJA 4R7TA 1WF6A 1JA1A 2Z8YM 2IF0A 2EF1A 4X20B 2IHYA 5E7MA 5INTA 5DM60 5J2TA 1G8GA 1GA4A 3W2TA 1T9AA 5DVZA 1Z7EA 2WHYA 4ZQFA 4DLTA 5EWMA 1G20B 4BVEA 2QTWB 2AJBA 2FK8A 3VR6H 1HT2E 5JMWA 3SHOA 4C4AA 3OEED 4HNAA 1OI3A 4BKRA 4F7WA 2VSOA 4RLFA 4PFKA 3RUAA 3RUIA 2RGEA 3UW1A 2EKPA 1XCBA 1E9EA 2FFAA 1B41A 1Z4MA 2WAXA 1VSBA 2ICAA 1K2WA 2QRPA 4ES6A 2RK3A 2X1VA 3JPWA 3IR7A 5E2BA 2V03A 4LGCA 1HSZA 2FI1A 4LK2A 1IU9A 3K5WA 4EW6A 4Q1BA 3W5DA 1F7VA 1DJQA 2J3QA 1NQOA 1V7QA 3C48A 2JFPA 4IXDA 4TV9B 1Z6PA 5KYXA 2AUNA 1LNSA 1W4RA 4IHJF 3T35A 1QIDA 4G9GA 1SC9A 2Y68A 3QX8A 3M6AA 1W4LA 3F5FA 3QUQA 2C2WA 1JLLB 3L8EA 2OZEA 4IFBA 1KZYC 4M38A 3UPTA 3GZ4A 2CD7A 3B6IA 3LT0A 4O4LB 4RMHA 1U3FA 3R6TA 1RYYA 3T7CA 5C2JB 4K3UA 2XDQA 2F3UA 4KQKA 1F0KA 3UEOA 2WM3A 2GSDA 1T0IA 4D9BA 4ZN6A 4LF7B 3KLMX 3ONFA 2IH5A 3ER8A 1ISJA 1U9IA 3KVRA 4BFUA 1ATIA 4NOJA 4IJ6A 1VXOA 5HBRA 3UQYS 1UKEA 1ISMA 4DV1B 1XTPA 4HI0E 5LBIA 2JFNA 2LD4A 3L7BA 1NT2A 4CUJA 1G21B 4OX9Y 2OLKA 3NU1A 4ZQCB 1IBKB 4L4UA 2BMFA 3D1LA 2P0YA 1TVKA 5AICA 2P4EA 4EVSA 3U7QB 4ZOLB 1UJBA 2PXAA 2JGAA 5DSZA 1WXIA 2VG8A 4GR9A 1GQSA 2QDXA 1PFWA 1VKJA 1OHHD 3AV0B 3UK2A 2BCGY 2I29A 3SKXA 1C3OA 3ZV3A 1WOMA 3L92A 3OQ1A 5MFPA 1KZ7B 2PG3A 3DTVB 3KQQA 3OPXA 5KYUA 1UBGA 1KFEB 2WYVA 1UBTS 3ZHTA 2SBTA 2XNDA 1NKTA 3CIFA 1JDPA 1NQUA 3DMDA 4OFBA 1FVXA 4UD2A 3ZCTA 1AMOA 1G9TA 1GG5A 3GWZA 3OQOA 2PSSA 4BFWA 1K63A 3DEYX 4PGGA 3NAZA 3IT2A 3CTPA 4YJGB 3CRQA 3ND5A 1VLQA 1N1EA 1QFZA 2XQGA 3TRIA 1EX9A 4FR2A 2WHPA 1VSQA 2DR3A 3DG9A 5JU6A 1YJQA 1E2NA 5IBPA 2YBEA 1BHQ1 1QO9A 2R11A 3AEYA 3W1VA 4ZIRA 5K0EA 1X2BA 2NU6A 2GXUA 2VYVD 2VWGA 2CFCA 2GZAA 4ENTA 1PSZA 4TOIA 2QJRA 5E7QA 1WMDA 3CO5A 3KZ1E 1B1AA 1W0JD 1YV9A 3M3PA 1X7YA 1H0KA 1UFOA 2P2LA 3LHDA 4FDMA 3ZJYA 2QNIA 1EA5A 3HTXA 2WAOA 1UWVA 1UEIA 2W2QA 3NQ41 1V8ZA 1VHLA 4PSAA 2LDXA 4YB8A 3LECA 1R0XA 4NYIQ 3GAZA 2HSJA 4AF6A 2OBYA 4P3YA 3OAAD 4RIFA 3OIGA 3NNSA 3V80A 2OGUA 4DWWA 2XI4A 3RJZA 2IDKA 1I4TD 1Q7EA 3NBAA 5C5EA 2REXB 4TMXA 4AYXA 4CQMD 1IY9A 3DZHA 5JDCC 1RYMA 4NBWA 3GGGA 3DQQA 1E3TA 1V8FA 4IINA 3TN7A 2PMKA 2XZTA 4O4HA 4J7UA 3AB8A 3OCYA 4OXNA 2NIPA 1KGDA 1UZUA 5IZ4A 16PKA 5I8PA 3ZD8A 4DG5A 5JY1A 1K1EA 1YL7A 2BI7A 3NRCA 4R9SA 1JAHA 1EM6A 4YCSA 1V1MB 1WUJS 1P3JA 2A94A 5LLSA 8AT1A 5JTTA 5DLPA 4BMSA 3R3JA 3ZR4B 5BN5A 3GT4A 1H2RS 4N12A 3V6MA 3PNBA 3EXEB 1Z12A 1C5KA 3BSSA 4IKPA 5JH7F 1E96A 3CLVA 4E13A 1EXVA 2A7XA 4UOQA 5CVEA 1MT3A 2ROQA 2LIVA 1X7ZB 3F5SA 4MP8A 4WMLA 4GHWA 4B3FX 2YV1A 4X61A 4PLPA 3TLXA 4RW0A 3FYTA 2BRUA 1ZRNA 3O8QB 4EJ0A 4TXLA 4UDOA 1XVTA 4QQKA 4UREA 3D81A 4JY7A 4M6WA 1XMJA 4Q3BA 1USGA 3QYAA 3OT1B 1Q0RA 2W4QA 4QYSA 3HABA 3P27A 4EHBA 3EFOB 5HZHA 4RABA 2F3PA 2I34A 3K8OE 3E5NA 4Z3KA 2CBGA 4D8VA 1J21A 3KYDA 5B1HA 4DCSA 2G04A 5JJ5A 1N33B 2FW9A 3KZMA 2FKNA 4RVNA 1TGVA 3KU4A 4Z1MD 5TQ2A 3FGOA 2A78A 4IILA 4MQ6A 2ZJ6A 4N76A 3RIEA 2XB6A 1C7ZA 4G4SO 3RD5A 2G67A 4RF2A 4O2AB 3DZCA 4Z51A 2C20A 3MLEA 3C5HA 4XZ3A 5AVYA 3SNKA 1CY6A 2ZCVA 1CQJA 2C4VA 4TL8A 4CMEA 1HE3A 1KVQA 2F4NA 1J97A 2FF5A 4CM8B 4I36A 1NI4A 5DIFA 5REQA 3RASA 3V7FA 2PKCA 4KK4A 5CB4B 2C07A 4INZA 1LV7A 1Y4UA 3DMTA 1HZZA 2G9VA 3CZRA 4IV0A 2PJUA 4EVIA 4BY9E 1J20A 1N7HA 4QG3A 3T5GA 5D3KA 1Q7BA 1UINA 3LU1A 5KWSA 4MH0R 1R74A 2XGSA 2WG2A 3RVSA 4HBGA 4MV1A 3DZDA 1GZVA 2ADFA 3JWJA 5A6VA 4TVOA 2OKCA 4NVRA 5KSOA 1GTZA 1I33A 4Z9YA 4R41A 4EY5A 1Q74A 1S8OA 3BL5A 3ZCQA 4CKWA 1FQJA 2VWHA 1C8BA 4KO3S 3NAMA 1JAYA 1S0UA 3B1ZA 1PWHA 5EQTA 3SYNA 4V1CB 1BD4A 2Q4BA 4YP9A 1P3DA 1IUPA 2B1RA 2JBHA 2ZRIA 3L05A 1ECFA 3B6MA 3SQMA 1N9GB 4BEBA 2R60A 3GPDG 1PEYA 4QAJA 3K96A 1PVDA 3GUZA 1P2SA 3WMRA 2DEUA 3N0XA 3MWGA 2CLCX 1XQXA 2OO7A 3JWGA 5KVSA 1K88A 1Z0AA 4L8FA 2VZ9A 3RUDA 3PD7A 3MQ2A 2F55A 2JLCA 4D3YA 5FFFA 3T7TA 4BQNA 1IBLB 1FYFA 3VOSA 5G4LA 4MYCA 3LDUA 1N2CE 2PCLA 1G64A 4TWZA 2YV3A 5ILOA 1CY4A 3GQBA 3M2TA 5LLDA 2UVPB 2VBCA 2GB4A 2XWQA 2Q3JA 1GGMA 4Y7CA 4NU6A 4FMCF 5K0CA 4DRZA 2YXBA 2ZYWX 5D3ZA 4JI1B 5L6LB 4G0XA 4H16A 1D2AA 1IHOA 1M6HA 2FPRA 3DPUA 1JPNA 1SUFA 2QAGC 3B5JA 3WNBA 5ES4B 1KK2A 3FWPA 1GD1O 4PQYA 1C7FA 4E5YA 3OC0A 2LCFA 5AHXA 5ESWA 5HA5A 3T7IA 1C1HA 1XJQA 1NIJA 4I99A 1VIYA 4DQKA 2H1HA 5AKHA 1N3LA 1G63A 1FU4A 1V7CA 2NPIA 2DU8A 2VYFA 1TCUA 2GS9A 3HBMA 3ONWA 4Y98A 2IYXA 3U7GA 3FH0A 1MMFB 1YCHA 2QX6A 2R7NA 2VF4X 5DBGA 3ND7A 1QRRA 4EKNB 1OT3A 1ZESA 2H4JA 4NC9A 3RSOA 5KTTA 2DR2A 2VXOA 1GARA 4KQIA 3ZQ6A 3EYAA 4OJTA 4JXZA 3PD1A 1XNQB 2H1FA 5LU8A 1FMTA 4YALA 3KZXA 1POXA 3WSWA 2JFOA 3P19A 3FMGA 3K70B 1P19A 4JYPA 4P92A 4TLBA 5CLLA 1TZCA 4U7JA 3LUBA 4U9UA 2WHQA 3QFTA 2GRJA 4WHMA 2WTAA 4MAFA 2BFWA 4N5LA 2O8VA 2P78A 3E5HA 3ZNNA 4RIGA 2JW5A 4DJ5X 2Y1FA 2ONZA 5BURA 4WAUA 1FFHA 2NSLA 2H5EA 1RYFA 2OXFA 3HBLA 2WNIA 2G8NA 3LLMA 4UAJA 2HADA 4KN8A 1POWA 2E6UX 5EKUA 4D4GA 2JDIA 1N4DA 3C5EA 2ZWAA 3VU1A 4C2UA 4BB5A 5LR6A 4DIBA 4HUTA 3UV7A 3FRJA 4D8TA 3PNPA 1WPXA 1BQ3A 2WYHA 3BH6A 3CZ9A 1WSWA 1X1RA 2ZCUA 3DDNA 3HI6A 4W8HA 5FUBA 1DMSA 4YUWA 5L3VA 1D1PA 1TD1A 5FBZA 4BCDA 4BLUA 1JMYA 3GUYA 4KNYA 1L5NA 3SFTA 2UXDB 3HNPA 4AX4A 4B8WA 1AJEA 5JI3E 2A9FA 2BUAA 3KJHA 4K6FA 1EX1A 4UXIA 2GD0A 2RCNA 3FR8A 4BLRA 5LXTB 5E8RA 1V5GA 4OIFA 5GZ1A 3I23A 1KMIY 1V37A 2QVCA 3IXLA 1SN7A 1UANA 2ZWOA 3DMHA 3TL6A 3X3HA 2QUHA 3BD9A 3NVMB 2IHBA 4BUZA 1FJXA 2FZWA 3DGFC 5LQNA 4YJFB 2WABA 1A8PA 3DP9A 4BO7A 4H3SA 3ECSA 3KTAA 1BXRA 5JRZA 1JKIA 3GUUA 5JS8A 5FBKA 4EB3A 1PSDA 3LBFA 4UMVA 1KAMA 5L4NA 2J3IA 4TQAA 3ONDA 1I4WA 1M2GA 1QNFA 4IFIA 1WCIB 1DU4A 1JVNA 2QUZA 2KMLA 3EY4A 1T0PA 3F9CA 4FMPA 1OXVA 5DLDA 3BCSA 4C7OA 3I8OA 3ZJVA 1YJXA 3GFGA 2VCHA 1A7JA 2C8KA 3JQRA 3LH5A 4GXRA 4LYJA 1A5ZA 1NX9A 3AR4A 3QU9A 2C94A 2VNAA 3CLRC 4UCQA 1ESNA 1GRVA 2BBSA 2Q3CA 3ZNOA 5FUYA 1BWSA 4W6ZA 3WLHA 3ZIUA 3E0QA 1Q7TA 2YJTD 1PTJC 3N2EA 3VJKA 1K2VN 2HQSA 3KTFA 1BA2A 3GLTA 4HRAA 4IUYA 2YJ5A 4AZ3B 4N0DA 3VR4H 2R8OA 3O3OB 4H6VA 1KBQA 1JLHA 1NQ5A 4DMHA 2PV0A 5FI1B 3DONA 1H9BA 2A67A 1Z6QA 4R83A 4WNCA 2HLPA 1ODFA 5BUQA 1NW9B 3H3FA 3R3XA 1QR6A 1T6BY 1TNDA 1WDKA 5SV2A 1IOVA 4JKOA 4AG3A 1ZVJA 4CG2A 3OQPA 4QTYA 1ICIA 3GJ3A 2R00A 3O91A 3GELA 2PGXA 3UV3A 3LL7A 3AESA 4RTSA 5BSHA 3QBVA 4ARVA 1F9AA 4DIEA 5A4DA 5IFKA 2VBFA 4PPNA 1O9GA 3TDKA 2O8FB 4S1OA 3EMKA 3LYAA 3C5CA 3L5OA 3FFXA 4FHGA 2C97A 2E9SA 3A37A 3RLIA 1YZGA 3Q8XB 2FMHA 1IXZA 2PMBA 4JUCA 5IAKA 5FCDA 2QNRA 3WBFA 4WZBA 1VE6A 1FXWA 1P91A 4AJ1A 2I7CA 4Y7DA 4HXGA 2JBAA 1OX5A 3B1FA 3ANSA 4UTOA 9LDTA 1PHRA 3TG8A 4ZYTA 5B37A 3U3XA 4ITUA 1PNRA 5CB0A 1THMA 4N54A 4D45A 1UPAA 2A9OA 3NBXX 4OB8A 1L7BA 3JYPA 5DGIA 2GF2A 4LNUB 4B43A 4C2TA 2JFBA 2IPOA 2ENUA 4N3NA 2DBVO 1Z35A 1SKUA 1YVDA 3K8YA 4LHWA 5DNEA 1ULAA 1QH0A 2AFHA 2I1WA 4UTZA 4GNRA 2IE8A 2IFTA 4LISA 1J39A 4KRYA 1SXIA 3QTTA 4CQLB 5EXXA 1U0NA 4F2GA 4R54A 5J1TB 1V8BA 4G1EB 4E6PA 1Z2AA 4N7RA 4ZV9A 3ZYCA 1GLNA 2JI8A 3E3LA 4LZPA 4PLFA 5FL3A 5B3KA 1Q19A 1S9DA 3THYB 1XLUA 1HY3A 2EBUA 5LFAA 1PDVA 3TL3A 3MIIA 4RY8A 3SWWA 3GEBA 1T4GA 2QD4A 3Q5GA 4O0MA 3SP1A 4MVJI 4KLNA 2PZKA 4B2PA 3LUAA 1SBHA 5L6MB 1PQ4A 3EZXA 1XHFA 1FBTA 5EGNA 3SJAA 1EIWA 1I1QB 1W5AA 2HTEA 4I50B 1TQDA 1VMAA 3KOUA 3ODPA 1BTOA 5ICFA 4EBFA 1ND6A 5ILGA 2V97A 3ESXA 4GI3A 2WIDA 5AWFC 1K5GA 3S55A 3WL6A 4HH3C 1II9A 4D81A 3DWGA 3MAAC 4UAUA 2WTNA 2VR1A 2LKDA 3GB9A 2PY6A 4CMJA 4G26A 4J91A 4RWEA 4D41A 3AUJB 3MZ0A 1RXUA 3W6ZA 2WUWE 1N77A 1DKRA 4MV4A 4MA0A 2HT6A 3AM3A 4PCUA 3UJDA 4CE6A 3BWMA 2GARA 4OQQA 4KAXA 1DWQA 4LY3A 4RF5A 2IZ0A 4M86A 2BHNA 3OTIA 4FE7A 2CJWB 4HG2A 2BJWA 3A2NA 4UDXX 2P2NA 3AY7A 3G2MA 5DO9A 4EB6B 5THXA 1WG8A 4EPVA 1KPGA 2PVPA 1YJBA 3OT4A 4POAA 2HJHA 2GHQA 5A0VA 4AKSA 5HVNA 5L95A 3INRA 4FHFA 1NPTO 1QJCA 4X6LA 3UCXA 1A27A 1L3IA 3ILHA 4LKOA 2AHOA 4XYBA 1EZ4A 2WKSA 1WHSB 4P86A 3F5DA 4MRSA 2EC5A 4P9NA 5CFRA 4HVAA 4LI3X 4RUKA 2OO5C 3FGZA 2OEPA 3W3AA 1D4AA 1G5RA 1USUA 4JENA 4X1YB 5IAOA 1IJEA 1YRLA 2WYOA 1HC7A 1T2DA 2W43A 3K9CA 2BEWB 2P1DA 5HJEA 4K9NA 5JUWA 1E2LA 4FYJA 4IIXA 4K6OA 1YE8A 2ZJOA 1N8TA 2R8ZA 3ZE0B 2C0QA 5FOVA 3GZNB 4PRYA 3SX0A 2BIFA 2CNKA 4AKGA 2QKYA 2WIGA 5E1BA 3PXEA 3DQZA 3EA4A 5CNJA 4AMYA 1NI3A 1WPQA 4NE7A 4XVRA 4N8SA 4X90A 4PG7A 3RH0A 3RDPA 4HB3A 2B37A 5GVSA 5IT5A 1ISSA 1F2TB 5JSHA 4PGMA 3OTHA 2CHVA 4JBLA 4AVYA 3VV2A 2WLTA 2E5WA 3MS4A 5CYGA 2UUAB 1G55A 3MCVA 4OK3A 1WKBA 5LA6A 5HKLA 1YIDA 1FY2A 1WB5A 2H2GA 1U7XA 3OZFA 5ALEA 4ZJPA 1CS0B 2D5CA 5D00A 1KZ6A 4A8JC 5LDDC 4J29A 4U8HA 2NUTA 3JWHA 3QENA 1RKVA 2FN8A 3ZVNA 1XMOB 4L73A 4CKCB 2FQYA 1TVEA 5JNLA 1P6XA 2OKGA 3GVPA 3IIMA 3L8HA 2TYSB 2EKQA 3BJZA 3BMCA 1CB0A 2DVMA 3CE6A 3V8QA 4CIXA 4RK5A 2IW3A 3VRHA 1YDHA 3BMOA 1WHTB 3N1UA 1FZQA 4BRSA 5C52B 2O3RA 3NHZA 4RACA 3MQFA 2BP7A 5LDGA 1O6CA 4DC0A 2CFIA 2VNKA 4FZ3A 1E62A 1DARA 3TTUA 1V8OA 3DBLB 2HDNB 4AUNA 4Y18A 3DFUA 5K1ZA 2ATIA 1NC1A 1DC5A 2DFLA 4NL4H 1CQXA 3MGCA 2PYIA 3O31A 3MPUA 4Z0PA 1N32B 4LBYA 4DM7A 2BM1A 4NE9A 1JHRA 1Z0FA 2QAJA 4C6SA 3BM5A 1OLSA 1UQTA 4YC7A 4DCTA 3GF4A 3H16A 4U7TB 2GCNA 1ONOA 1UJ5A 3KT8A 3L0CA 4V0ME 3VHXA 3VPSA 3L1KA 1LZLA 2RH4A 1Y7IA 1YIOA 4XGKA 1VJCA 5I9LA 3VTAA 4NICA 1FDTA 5F3DA 3U3RA 1SCUA 1NYLA 4H08A 2AJDA 3O4FA 4IJKA 4EWLA 3DEFA 5BPHA 3NFYA 2F6RA 5BW8A 1VKZA 2WSBA 4C6TA 3G17A 1MAVA 4DT1A 2OBLA 3B38A 1TI7A 1XP5A 2CE7A 5EVCA 2CV1A 4J03A 3ROEA 1H94A 1LLUA 2X8WA 4GL4A 1DAPA 4PVCA 2FQWA 4DY4A 4JOQA 5TGTA 5G0VA 3EPPA 4DIUA 2UUCB 5TJHA 2KHZA 1X15A 5SZIA 2ZR9A 1KYYA 4TTIA 5B7GA 1TKBA 1BE6A 5A9SA 4DQ0A 1MX5A 3DCNA 4NP6A 5JZ9A 3W2EA 1T5DX 1VTKA 1W48A 1W35A 1I6KA 2QMQA 1VJDA 2ZR8A 3IQIX 1CZNA 4ASUA 3UMJA 1R8YA 1EH5A 3NIBA 3QUCA 2X6RA 3QYFA 1Z83A 1ZD4A 2FP4A 3L93A 4HDRA 2ZATA 5F4ZA 4E2WA 1YA8A 5ALZA 3HKBB 3OCCA 3QIVA 2O14A 2J4CA 4WA8A 3QF4A 2MT9A 4QNRA 1P1CA 5FIUA 5AXCA 1AVTA 3A1VA 1JDSA 3RC8A 2D2EA 2R8YA 1HLFA 5HJ5A 4PYOA 1Z39A 4MPDA 3RHTA 4JI3B 1TQ2A 2C7GA 5K8CA 2V7BA 2V0CA 3ZY6A 5P8WA 3OP4A 3EXFB 3PSAA 1NLFA 4BFZA 2A86A 3BHNA 3DXYA 4P4NA 2WJJA 4J1TC 3AZQA 4KO2S 1IZYA 2KX7A 1U2EA 1VYTA 4ENWA 2VTBA 1ZM7A 1QYCA 3NCHA 4XVQA 1JSZA 1D4ZA 1WZNA 3LI2A 4WK4B 5JD3A 1Q2XA 5LOVA 2WBLC 3EY9A 1W5EA 1QMPA 1VJGA 1RHKA 2V4UA 2VOEA 4TL7A 4ILEA 2R1TA 2FDRA 3IDQA 2JCXA 4G1VA 2PL1A 2W2LA 4NFHA 4Q9NA 4CCYA 5CFMA 1WVIA 5KX5F 8MHTA 3PYMA 4CBVA 1BA3A 3NBZC 4QEKA 3SZ3A 3PE6A 5EI5A 4GC9A 3WLFA 3FCEA 3O6VA 4BNUA 1LPPA 1L4UA 1CDOA 1E6CA 2ZT5A 1ENZA 4ARZA 4MWBA 1BSVA 2JFZA 3STYA 3UWPA 4D0LB 1Z4LA 1GR1A 1AGNA 1BOOA 2HPZA 2HM7A 2WOOA 1H3NA 3CEAA 2P2CA 3IJ5A 1Q2UA 3UBTA 5FRDA 4DLSA 1UBOS 4NCJA 2IYFA 4JQSA 2Q2OA 4GBJA 4RLSA 4P3PA 4RSRA 1RPZA 1XYYA 3CPJB 3HCPA 2Q7XA 4JEIA 2HA2A 3BB1A 3IHWA 4YO7A 4CVNA 1QZ3A 4XDYA 4P4LA 5J4LA 1A9TA 4HS4A 1K0FA 2YHIB 1W0KA 2JIRA 1E2JA 2ETXA 5U9CA 3AP1A 4MR9A 4UZSA 3QBEA 3F6RA 2AOVA 1U2ZA 5FHQA 1FDOA 3EG9A 3V4VB 4C7KA 3GFTA 1H05A 3UT5B 3AK4A 4ODIA 3UK0A 3LQ2A 4BHTA 4ZHQB 1RFGE 4MUHA 1VJ5A 2AOWA 4OGWA 4D5EA 6AT1A 4O2LA 2GVDC 1TK9A 2Q1UA 3L7OA 4HWTA 4LX8A 4XKJA 2WWYA 2GCIA 1DRJA 1VPDA 4JXKA 4AROA 1XKLA 4BMZA 4K6CA 2PLWA 2JJ8A 5ALGA 3SIRA 1XF1A 3A6ZA 1J2RA 821PA 2PS3A 5ES3A 1SHZA 2D5AA 2CXOA 4XX1A 3GJ4A 3V6LA 1KH1A 4FWIB 5CA1F 1FTYA 4V2UA 1UOOA 1T1GA 1LF0A 2X7XA 2JGDA 3LZDA 4PS1A 4WZ6A 1RYDA 1ZJWA 2XZDA 1UZAA 1BH6A 1QGUB 4PYRA 1MF7A 4Y2UA 2J48A 2VDKB 3IODA 4W6QA 2A4KA 1EHIA 4U2EA 4IDPA 3EDCA 3U39A 2PBFA 1IN5A 5CR9A 1KEEA 1Y6RA 2A5YB 4Y8VA 4LF5B 2Y05A 1SIOA 5CVTA 2X9QA 2B1JA 3JPYA 3R24A 4M7PA 4PTYA 3AHDA 3PB3A 4H0NA 2HK9A 4Q9AA 3T54A 5T4EA 2NO7A 4AW9A 2PX3A 1JMKC 3B3AA 3CUEF 4A73A 4FGSA 4R2KA 3C1TA 5JASA 4KSBA 1V2HE 4JVMA 3TIIA 2WZDA 4YV0A 5CM8B 1DG9A 2A9VA 1K92A 3FB4A 3N8NA 4MVJG 1FFEA 1PU2A 5K20A 1P7WA 1QC5A 4YJ3B 4ZGBA 1C3XA 2GLTA 3ZBTA 4K9RA 2R6JA 4HNVA 3U09A 1UT8A 4Y0NA 3DL4A 4TL6A 3CLKA 1XMSA 3L6RA 4EYOA 2I6TA 2XOXA 4G0MA 1S2DA 2Y1KA 4YR9A 1ZOIA 4XA8A 5TMEA 3TI7A 4GW3A 3C8DA 1G6KA 2ZE6A 4QXMA 3G0GA 4L95C 1T25A 1VL2A 2G4VA 2H9IA 1CJMA 1TM7E 3BF8A 3FHLA 3GLKA 3IT1A 2JKVA 5EJ2A 3A3PA 4YJDA 4TT3D 2PNJA 2FMKA 1IBMB 3TKAA 3K6RA 2GN2A 3H6HA 3FSRA 2WNSA 3K9WA 3R3SA 4ML3A 1G66A 2P9YA 1GUBA 2H7CA 2OCLA 2JZNA 3LKDA 3UATA 4KAJA 4ZYWA 2WD7A 2HN9A 3B7WA 4EYSA 1I7QB 2FWJA 4P84A 4DC9A 4RE5A 4G4GA 4JP3A 3D59A 2O06A 1G19A 1EQ2A 2C61A 4XQEA 2IGTA 2IHVA 2V4ZA 2EKBA 3C3MA 2A0FA 1GYQA 2WI8A 4Q12A 4F5YA 3QFFA 3L6OO 1GGKA 1U3WA 1WB6A 2WJAA 5JDIC 4KR7A 4HAXA 1KP3A 2X13A 5IK2A 5DYIA 5CDFA 4U7GA 4M99A 2Q7OE 1R6AA 4FTWA 1S02A 1MO2A 3T5BA 3CPSA 2FSFA 3VX4A 2AGVA 3G2NA 3QPUA 4FIDA 1U80A 1H65A 3WLSA 5DHAA 1FRFS 2VBGA 1AS0A 1EWTA 3KEOA 4MV5A 4WV3A 2PXXA 1R8SA 3KETA 1ORTA 1PJ8A 5BW4A 4D25A 4Y2HA 2WT8A 1TIBA 5H68A 1NF3A 5DTRA 4PNZA 1BU8A 4I4TF 3DXXA 4IDQA 4IIJA 3ZXYA 4BIIA 4IM7A 1K98A 3EUFA 4IL5A 3R44A 3N3AC 1FQOA 3N9IA 3JSAA 5A1TA 4AY4A 2Q28A 3LQFA 4KRGA 4YJHA 5F2NA 4PO3X 1JEEA 5IEBA 2FZ5A 3RHSA 3TQFA 1VXRA 2GPSA 5FB3A 4ZRNA 4AN4A 3BMNB 5ITVA 2J30A 1NL3A 2Q4TA 3QKIA 5M04A 3PEYA 1WXGA 4GKKB 1GKIA 1LJLA 1T5TA 3BAZA 1U3VA 2Y0BA 2DFTA 2QXYA 3EUWA 3LTEA 4JN6B 4MAAA 4ZHSA 4QBFA 4R98A 4TZ0A 4BPBA 3WGJA 1GG8A 3O1JC 4MCJA 3BXFA 4HZUB 2HI0A 4IOMA 3TWOA 2VLIA 3OO1A 4NV0A 1K5PA 1G2PA 3M9XA 1XN4A 4TMFA 3LCRA 2ISCA 5KJEA 2A5GA 1W36C 2BTQA 4MINA 5KIAA 5FUXA 3BFKA 3NEYA 1OVGA 3OLVA 1Z82A 1EFDN 4QGHA 3A4LA 1BDJA 2B2CA 4Q4LA 1YQXA 4WFIA 1X86B 3LPCA 4LGMA 4X95A 2QD2A 3B8EA 5LSAA 3R5XA 1DEXA 4CEIA 2X86A 3QPWA 5CFPA 1SUDA 3KR9A 2FKAA 3NHBA 4JVOA 3JVIA 2VSNA 1D6MA 1Y82A 5TC4A 3EZ6A 3SC2A 1F14A 2GZ2A 2QU7A 4G25A 4JBYA 3VGJA 4CJXA 3M5PA 3EFEA 4NF2A 4C4OA 4DNPA 3KZOA 1QIKA 2I67A 2YXDA 5ISMA 3CSUA 1B42A 2XYGA 3JQ8B 4JYBA 2CXRA 4PTLA 4CTOA 2ZRLA 3E18A 1Z0SA 5E6RB 5FDFA 4Q4AA 2GPYA 4G86A 3FRHA 5JJCA 5JSZB 3EG5A 1CZKA 1PFYA 4FOOA 2R1VB 1RI5A 3GLHB 5BSUA 3TLCA 5C8DA 4MLCA 3FPEA 4EIWA 2DJIA 5D85A 3RYCB 1W5BA 2JL1A 3EGDB 1KBOA 1NX6A 5AK3A 1EWYA 2C7VA 2UVDA 3G6WA 2C1ZA 3CKMA 3JD4A 3MPOA 3LCCA 4MR8B 4PGHA 4GX1A 2CJYA 3WLIA 1Z5UA 1PK7A 2IZ1A 5AJZA 1JA9A 4PICA 2A9KA 3BIXA 2OGZA 5AHRA 4EFMA 3N7UA 5DBEX 4PGAA 1R18A 3ROTA 3ZKWB 3EA5A 1NXSA 1RI3A 1U5BA 4U7WA 1AF7A 3R20A 3IHKA 3NUZA 2YS7A 4KE9A 5GONA 5IT0A 3JYLA 4I1YA 2PRZA 2XNJA 3HYSA 5AQEA 3TTWA 4KXQA 1WB9A 3N8DA 4MMZB 3WNQA 4BIMA 3A6KA 1A9SA 4K9OA 5JJLA 3DHWC 4YJ2A 3KVNA 5EUMA 3STUA 3R9XA 3TL2A 4BATA 3BH0A 2HR1A 4GSYA 4IGIA 1F1JA 2ZKLA 5AVTA 2I6XA 3N07A 3RW9A 1PFQA 3QKSB