2J6CA

Crystal structure of afv3-109, a highly conserved protein from crenarchaeal viruses
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
Knots found
sequence length
109
structure length
109
Chain Sequence
MLYILNSAILPLKPGEEYTVKAKEITIQEAKELVTKEQFTSAIGHQATAELLSSILGVNVPMNRVQIKVTHGDRILAFMLKQRLPEGVVVKTTEELEKIGYELWLFEIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Afv3-109, a Highly Conserved Protein from Crenarchaeal Viruses.
pubmed doi rcsb
source organism Acidianus filamentous virus 1
molecule tags Viral protein
molecule keywords AFV3-109
total genus 26
structure length 109
sequence length 109
other databases KnotProt 2.0: S +31
ec nomenclature
pdb deposition date 2006-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2j6cA00
2X4IA 2J6CA 2J6BA 2J85A
chains in the Genus database with same CATH superfamily
3GJ8A 3HR7A 1T3ZA 1VM6A 3TZBA 2BBWA 1PWXA 1RAHA 4C2TA 1YB6A 4X3PA 3VDXA 3TSCA 1WXFA 4ZKEA 2AEMA 1ELOA 3VU1A 3FB4A 1EK0A 1Q19A 4JBYA 2EWVA 3QF7A 2NO6A 1G3MA 2ZZMA 3UAVA 1FYFA 3UJBA 2Z57A 2E89A 3K0KA 3IEVA 1H8EA 2BRUC 2VN8A 2Y0BA 1P9RA 3RODA 4J2TA 1G21B 3DA8A 4CKBA 5C51B 4OLAA 4M99A 3SZUA 4K9QA 3AY7A 4L3VA 3R20A 2Q3HA 3EGCA 4ER5A 3QWHA 2XUPA 2G1UA 1JLHA 1OLSA 3I92A 3GBSA 3ZDZB 4PPQA 3F8TA 3HCRA 5ALVA 4E14A 2FEMA 4IV5A 3EFOA 4EP1A 1FL9A 5EZ5A 3VO2A 4DUGD 4RA9B 3Q0EA 2LV8A 5DKFA 4RH0A 5AO9A 2Q2VA 3RUDA 1DOAA 2FH5B 4EECA 5KHOC 3CVYA 1HE4A 1XDDA 1JEJA 1ISPA 1XROA 2VEDA 2R65A 3EIFA 1BG6A 3QELB 4I55A 4JUCA 4U2FA 1WL8A 3EVDA 4IH4A 3T5CA 3TX2A 1ZGHA 1TDJA 4MZXA 1CUUA 2QE7D 3CGGA 3CKKA 3H8JA 4UMVA 3UKJA 4YHHB 1VHQA 4MX8A 4BLWA 1ZLYA 3ECSA 4XFDA 3VNQA 1QAMA 4JC0A 1O94C 5CM9C 1FSSA 2CLSA 3ED1A 4MI3A 4WH0A 3PFGA 4CF6A 1FTGA 5F73A 2H2DA 3U48A 2VHEA 3N6VA 1CUZA 4PHGA 8MHTA 2REQA 2Z1NA 2DPGA 3P0FA 4UHBA 2C9MA 4NNJA 4XYLA 3OE5A 1PW5A 2PLAA 3C3JA 3IHTA 4EB8A 2J0QA 4QX6A 4UE6A 3UM9A 4GLLA 3UW3A 4MKHA 2H2WA 1C3OA 3GJ4A 3REQB 3SVTA 2XNDA 3QKSB 5DGHA 1BOOA 1FFAA 2A84A 4QJIA 4L7VA 1EWYA 1X14A 2QRZA 3STVA 1OH7A 1T0IA 4DCVA 3K4HA 3S1AB 4AMBA 4AL4A 5ADVA 4EMTA 3HJUA 1EVQA 4RTNA 1LX7A 2YNMA 4WPGA 4XIIA 2JASA 1SOVA 1JEOA 2EL7A 2ZJZA 3F74A 3VUFA 4ASUD 3H1EA 1E3MA 1LPSA 1SXJD 1WUIS 5EI5A 1IY1A 2ZBVA 3TTYA 5FOXA 1KMHB 3NDRA 4OOEA 4DJFC 3PXEA 1IN1A 3ASUA 4AX8A 4FFBB 4QUKA 1UCFA 2DH6A 3GJZA 2EXXA 4MVJM 1KAMA 2VPYA 3M4YA 2LIPA 2D54A 2G88A 1SBYA 3B2QA 3DW3X 5C1OA 4K9DA 3U3MA 1G8SA 3PXCX 3ZCRA 3VR4D 4IQ4A 3L79A 1T8WA 1NQTA 1QU2A 4WNIA 2OLKA 4S2UA 5K5EA 2OV1A 3ICEA 4Y9TA 2VF7A 2QSJA 1FDOA 4K86A 3JWHA 1FQWA 2AH5A 2WU1A 4QRDA 4H3SA 1Q5PA 4HAWA 2AJCA 3WB1A 4Y9RA 4ZWNA 2BPOA 3DZKA 1Z37A 1DTWB 4C3OB 1Q1EA 3BF8A 1PVOA 3K9BA 4JITA 4ZVKA 3B20A 1LD3A 3IUEA 2I4IA 5GINE 4CR7A 1JHXA 2IDMA 5H3LA 5A9SB 1TECE 1NN0A 3D2BA 2Z2XA 2XDQA 3JAKA 3R6LA 2AI3A 4O33A 1QO9A 2R4QA 3GX1A 3HS3A 2DUUA 3L4BC 1TUEA 3C6ZA 1K75A 2JIDA 4EEZA 4FPXA 4UBKA 3EHDA 4G1UC 4LSZA 4MW2A 1X70A 2ZROA 5BSVA 4O2RA 3SLKA 2WJGA 4QBIA 2RKBA 3H83A 4TS9A 2D8MA 1XZJA 2FFAA 2R751 4W82A 3DGEC 2GETA 4GKJB 1ESDA 1TB4A 2X1HA 1COWA 1ZR4A 5KDLA 3RDPA 2GZMA 2MSLA 4BNDB 3DLHA 1ICEA 1SEPA 3ZJUA 1Y6QA 2P3SA 1C7QA 3QYPA 4KPEC 5B7QA 3AONB 1XLWA 2PJDA 4ZYWA 1F9EA 2PT7A 2ZQYA 3DKKA 5J2UB 2R6HA 2XEDA 3DUFB 3PENA 1Z7GA 4BN4A 3BBPA 4LWZA 3BDVA 2FSVA 2XITA 2R7AA 3HCBA 5I48A 2GKOA 3Q6IA 3T41A 1R9JA 1QZUA 1CIJA 4MW7A 1J0CA 2BI8A 3MUOA 3WQBA 2ZSIA 3LCRA 3LGXA 4RDHA 1B2LA 2ZAYA 3KYDB 3FHOA 1UT8A 4HX9A 5DXAA 4C07A 1COWD 4LXXA 3PUXA 4CN8A 1I80A 1SZJG 1EU1A 3UMSA 2BBTA 3G6WA 3U3JA 1LDBA 2OV3A 1S8OA 4PZ0A 3JQBC 1Z88A 5HIKA 1JMYA 4QYXA 5FBWB 5JFGA 2ACWA 1TRKA 2RH5A 3FF1A 1KE2A 5LR6A 4BLOA 3EISA 2L18A 4CF4A 2CZGA 1KI6A 3EPKA 3FPEA 3BWYA 1QG6A 1RXYA 2R66A 2GTPA 1YBFA 2JJQA 2PX8A 1NSYA 4C0JA 1SKYE 4RKQA 5EJ5A 3P52A 4J7XA 4EA9A 4II2A 1YKSA 2V6MA 3THXB 1QH1B 2FVXA 3KD3A 2R7LA 2B1GA 2XUZA 2P9QA 2WLTA 1JGTA 2AMJA 1HYGA 4G41A 4YJGB 4BPBA 5EUCA 4TTAA 3KZCA 5ALNA 3ROQA 3RR2A 2OGWA 1RJWA 1M6EX 3QX8A 4LGVA 2Z95A 3ETNA 1Q50A 2FZWA 1C29B 1XD9A 5IJAA 1E3TA 4U7DA 3IQXA 5ELXA 2X22A 5A05A 1CERA 1W36B 1NWCA 1M2KA 3GT7A 4XUDA 4OHZA 1ZRSA 3TE6A 1A7UA 3X1XA 4YRSA 2VHTA 5HUJA 1BQ4A 3OQIA 4RDXA 2HQRA 1OXSC 1DKPA 4M9ZA 3QE3A 2G5GX 3GRZA 4L6IA 5EWMA 1KL7A 1VE9A 2C0PA 4GP7A 1J56A 3JALB 3LKVA 4XGNA 3WP0A 4I19A 3B13B 1AIPA 3AKCA 4IDNA 4PYJA 3T9DA 2QM0A 2JGEA 1KJJA 2HZ7A 16PKA 4V0SA 1ST3A 4LNHA 4QQFA 5CTJA 2O8CB 4B31A 2NTJA 4L0DA 4QSHA 2R96A 5DMXA 4Y1FA 5FV4A 1K97A 2WUGA 4MARA 4KR0A 1ZM9A 3P9XA 3KL2A 4LEIA 1M8KA 1MNQA 5BNZA 1EP3B 4PZZA 1G98A 4YRTA 1PHPA 3N53A 4AI6A 3FTNA 1WW8A 4DG9A 4ZI5A 3MWJA 4M87A 3B9BA 2PJRA 2D3TA 3RU3A 2B5WA 1R8XA 5G0TA 4H6VA 4QPJC 4DHEA 5D85A 1DV2A 2A5JA 3LZDA 3ANXA 2W42A 3C2QA 3UUWA 1KZ4A 1U2RA 3ZW9A 2Z5FA 1GNLA 2IITA 3L41A 4BNKA 2HNAA 3GFOA 1PUIA 5CH5A 1PDVA 4DLUA 1SHLA 1E3EA 2FMKA 5GONB 5I51A 3U4GA 4M54A 4P86A 4K6OA 2CJXA 3PBKA 3QXCA 5JI2E 1NPTO 2WFZA 2O8NA 2GCEA 1ZJWA 3IPAA 5TQ2B 3HEBA 4FDUA 2PM8A 4M1WA 1B0PA 2B1QA 2BMEA 2CVHA 3NGMA 1I0LA 1UJMA 1H2YA 2DQZA 2HHCA 2OG1A 3FWPA 4FVTA 4YREA 4EY3A 5KYGA 3IOMA 1HXHA 4B7CA 3EG5A 1YE8A 4TX1A 1PFQA 3TBHA 2H7VA 3G7SA 2BONA 4IJMA 3WYFA 1SCUA 1PT8A 2CLEB 4FI3F 2F1OA 4DCCA 4CIBA 4I4LA 4EVSA 2RHWA 1CIPA 4HEJA 2BVNA 1GTSA 2O3SA 2JLQA 4O4JF 3HDYA 5K9ZA 1YHNA 3A1UA 4DRXA 3AEZA 5CA0B 2CSUA 2WTXA 2VQ6A 3GAZA 4RETA 2E85A 1IUPA 1DELA 5K8VA 1MO2A 1E1QA 5I4BA 3QYAA 4EVQA 2VJAA 1MB9A 5DHSA 2PMCA 3EZLA 3W2HA 4CIWA 3M3DA 1TEXA 1JEYB 2H1HA 2PKQP 4Q3LA 4F45A 2ZXFA 4KWEA 4N03A 1YDMA 2BFPA 3WLJA 2HWUA 2JW5A 1ZY2A 2CDAA 2ZIXA 1VCHA 4TKMA 2AG5A 3ZXUB 4F3KA 2B0JA 1CQJA 1PL7A 4N18A 3OP4A 2QS9A 1TLLA 2CHGA 2W4QA 4JLJA 1UAAA 2C00A 3DPSA 4XYBA 4H7DA 1Y1RA 1XCGB 1L2TA 5LYJA 1E4EB 5A0VA 3NQ41 2WY2D 1U11A 4AKSA 3X1DA 2Z6UA 4MUYA 3QZUA 5K2MA 3OQNA 4M6WB 1DG3A 3K5HA 4EKEA 1UJ5A 4EJSA 1MVNA 1C9MA 3PE4A 1V8OA 4KN9S 4OKNA 4UZEA 1OOEA 4F8JA 5CLJA 1GZ4A 3OESA 3KCQA 1I7NA 4UTNA 2NSYA 1TXGA 2CNKA 4Z9YA 4HT3B 1YWGO 1IK6A 4PLYA 5DLPA 1FJHA 1QYXA 3T61A 4BIMA 3GB9A 4ETMA 5CCBA 1TT5B 2VHYA 5JDIC 3DCNA 1R6DA 3ZIAA 3AWIA 2RC6A 3WGGA 1QV9A 3H3JA 4WW0A 4XSHA 4DWWA 4U7JA 4WXPA 4ZAYA 3F1KA 2JGMA 5G3YA 4R1LA 5JMTA 1WQ4A 1JAIA 1UOEA 2K5UA 4EITA 1XT6A 3BCHA 4Z99A 3X3HA 1JXAA 3DQPA 3E2PA 1Z5NA 1REQA 2QL6A 3BK2A 4UBIA 1EFVA 5AHWA 5KOJA 4BQEA 4B83A 2ORVA 1Z13A 2WMOB 2XMGA 1JDSA 4H27A 1PZHA 1Q3KA 1U0FA 3CNBA 2FPUA 3N8GA 4E5NA 4RE5A 3HGQA 4C0QC 5JEEA 1RP1A 2OD9A 4JLSA 1EZ4A 4FFNA 4BJ5A 2AWNA 4L9SA 4M1QA 4PC3A 4PSCA 1A4IA 4A1OA 3DYVA 4TQ9A 1IM5A 1OJ7A 1XEXA 1V3VA 3C4QA 4KL8S 2JFOA 3CLSD 1N0HA 3B6ZA 3OZIA 4EUHA 3LUKA 1E2JA 4Q3OA 5FA8A 2C0QA 2VH2A 2WWXA 1XZAA 3LV8A 3E18A 2RJ3A 3ENQA 1KFBB 3D5QA 3KKLA 2ODQA 5IFKA 5D3ZA 3B6EA 1R9MA 3QXHA 2BD0A 2IE8A 4S04A 1SKBA 3R0QA 5EIBC 3AB8A 1GL6A 4IFIA 3HY6A 1N7GA 3O84A 5D1HA 3COVA 4BQQA 1D0IA 2XODA 3PNKA 4A16A 1VRWA 3RADC 1CUVA 4O25A 2WILA 2FWMX 4BZXA 3W1EA 1LLFA 4TN5A 1YR6A 4F11A 1J5PA 3DKPA 1E2LA 3DHWC 4L8VA 2GJAA 3ORHA 4XQ9A 4D8YA 4B9AA 1TU3A 3G49A 3CT4A 1OT3A 3M6LA 2FWAA 5CDYA 1LZLA 4Q7LA 1NKSA 1Q17A 2OXFA 1XCPA 1CJVC 2DH5A 5TQ2A 1F7UA 2YMLA 2ZP1A 3O91A 3TMYA 2PV0A 3NHFA 4CU2A 5JHGB 2VOEA 4RVDA 4KMSA 2PA0A 4YK7A 4GC9A 2PQMA 3V4ZA 3KX2A 4C4ZA 3V32A 5F3RA 4C1NA 4JL8A 4MVJE 1KRWA 1QAQA 2ZI7A 2PO7A 1YASA 4GLOA 5AUOB 5HHTA 5HQ3A 1DEHA 2ZETA 2XNSA 2VJMA 4LK2A 2QJFA 4A0HA 3T6KA 1E94E 5J4HA 4ND8B 2P6PA 1N5MA 3BMCA 3EBOA 3PL5A 4MV3A 4ZCIA 2VWQA 3T0IA 2WSBA 2YFHA 3C7DB 4JMPA 1NVKA 4JLPA 2F1IA 3UJ7A 2WMDA 2HBQA 3RNLA 1NN1A 2PGJA 2GCNA 3LBFA 5E1OA 2ENUA 3UCFA 4N3CA 3SJ7A 4JJKA 5U9CA 2CY0A 2SBTA 4JI2B 5GQSA 3W2TA 4MI9A 1ZHOA 3O90A 3I37X 3JAWB 3KLNA 2PVSA 4LDQA 4CKWB 4NBNA 1FYDA 2W6ID 1SELA 3VC3A 1W30A 5EIOA 5JC8A 3I39X 5L51A 2JA1A 4OHRA 2FPLA 1DLJA 2ORYA 3W5DA 3T3MB 4IDHA 5AOAA 1X1AA 4JH0A 2R8RA 4UAVA 3SNHA 1CZOA 4ZN6A 2R97A 3DXXA 2H5IA 4GVPA 2HSZA 2OGTA 2CV0A 3VR2D 3NMUF 3OCYA 4QDOA 4B8WA 4JWTA 1HTTA 3RJTA 1CB0A 2XR1A 4OH1A 2GEFA 3GRPA 2XT9A 4DZRA 3KT8A 5K4GA 2FF5A 1GAQA 2W93A 4FTWA 4AN4A 4DIKA 3AF0A 3V1TC 2VAXA 1C7RA 3ITNA 1EAMA 3JWJA 3MGCA 4HWTA 3VR6A 5AW3A 3AWDA 4JQSA 2J4DA 1YE3A 4P36A 1MJGA 4UPEA 4BQRA 4CT5A 2WWYA 5EE9A 3G0BA 8LDHA 2CVQA 5AJUA 3IEUA 5BSMA 3L01A 4TYNA 1I2CA 3KR0A 2VPXA 5DOZA 3QX3A 2RGGA 1I30A 2VHUA 2J3QA 4YRNA 4QPPA 1N6NA 4BKQA 4QU5A 3RBVA 5DYIA 1OQAA 2G17A 4HWRA 1XCLA 1MC4A 4WJLA 3F9CA 3M7IA 1WULS 3FDZB 3V8EA 3WA7A 4UARA 4OI4A 1E2EA 1KJZA 3BOSA 4I14A 4LVUA 4TYPA 5LB4A 5JDIA 4QICA 1KOLA 4A15A 3VR6D 1IXKA 1T34A 3F49S 4FE3A 3Q88A 4BMXA 1O97C 3VO9A 4CEJB 4I5GA 3UAOA 1S7CA 1RQXA 1T1IA 4HDCA 3WBJA 1SEVA 3M3HA 1I4WA 3OCWA 5IDWA 2NGRA 3F5DA 5SYAA 1YGYA 1OWOA 1UDAA 3HCEA 3MGAA 3K20A 4KQWA 2JCXA 1RBZA 3PRHA 1A9XB 2H2HA 1SD2A 2BMVA 3PDIA 1FA9A 3LUHA 5CFQA 4GPIB 1Z22A 5FD8A 1E0DA 3BJRA 1ZUNA 1GA1A 5HCNA 4B79A 1U2PA 2CKDA 4M89A 3UC9A 5KX5A 4TSFD 4KU4A 1LVGA 3A9RA 1SQ0A 3LZ6A 4L5IA 2AFIB 1EK2A 2C8LA 1WSDA 4JGGA 3ZY6A 4EB3A 2CDBA 1E1DA 4TUYB 1J33A 5DT2A 2GSDA 4HDMA 1WXIA 3T1TA 4GQAA 5K3FA 2MR5A 3CRRA 3TQSA 1KP9A 4KVZA 4UU7A 5JZMA 2WV9A 4Y2XA 4A6PA 4TTRA 4YRPA 4J29A 1EK1A 4EY6A 3OHMA 1R64A 4RQUA 4HMPA 2VNAA 1MPTA 1N1MA 4R8MA 2H92A 5DYNA 2R8PA 3OOWA 1BD3A 3H6HA 1GZ3A 4LJ4A 3WQHA 2AWOA 2FUG1 4RTMA 2E4AA 3GG2A 4G86A 4U7WA 5BSUA 5F23A 1ZD4A 1L5GB 1M34E 4N5LA 1EWRA 1I7DA 1VRCA 3M8KA 3FROA 3N2ZB 3NWEA 4IKOA 4OQLA 1DJNA 4M8LA 1S7GA 3D1VA 2QTVA 3OZSA 2AX4A 1W0JD 3VBEA 1QXSA 3PGVA 2WF9A 4JI6B 1JLLB 2DWUA 3HDHA 3OAAA 5B4VA 4ND8A 5HX7A 1CPYA 3GFFA 1UC8A 5EWLA 2EG5A 1FSZA 2FSIA 1S1MA 1SUIA 2E5FA 1PJZA 2OO5A 3IIMA 4DPLA 5J58A 4LJ5A 3IIEA 4RAQA 3ZWPA 4C29A 5H5JA 2Y77A 1OC2A 3CW9A 5DLEA 5HR5A 4R2HA 2QP9X 1BKSB 4P7BA 1LK0A 1E7WA 1EHCA 2DWQA 1YZHA 1Q95A 3ZJTA 3VU8A 5ERXA 1W85B 3FUCA 3ZK9A 1E0JA 1QLHA 1J2JA 2MTBA 3OUZA 4G5FA 1K5GA 1WNTA 4M0CA 1K7XB 4D4MA 5AKHA 3KLPX 3D6MA 3FDZA 4MV8A 1VJTA 4I1SA 3EVCA 4WINA 1PAUA 2HXYA 3FAZA 1Q3TA 3D0OA 5T4HA 3UMBA 5C4IA 1QP0A 1T8SA 1AUQA 1S6YA 3IIKA 3KD2A 1JILA 1O5IA 1LJ8A 2YH2A 3ORYA 4RZXA 3SBEA 1WVMA 4BCCA 4PR0A 1WZEA 3HXLA 3OSZA 3PT9A 2RI1A 3E2IA 1LV8A 3KKMA 1OR8A 4LBYA 3Q3VA 1XVIA 4MA0A 4X1KB 2BM8A 4O4HA 2FE1A 4B8YA 2R8ZA 3BXFA 1DKNA 4G5RA 2G83A 4PVDA 2YR0A 1RHQA 1VLMA 1QLJA 2X76A 4U5XA 3QVSA 3JQPA 2X0EA 4NEHB 1CUXA 4CG2A 5F7XA 1DKOA 1ODSA 1MT3A 1ZK0A 5FI3A 2C7RA 1QH9A 3O93A 3LSYA 3ZCXA 3KVOA 1KP2A 2C78A 3QU5A 1HDYA 3N2IA 3D6AA 3AEXA 1SXIA 4F93B 1EA7A 1JSCA 1RLOA 4LF5B 2FUEA 4CEIA 3MJCA 1BGVA 1EDZA 5EERA 2YYSA 2PNFA 3BXEA 5DP2A 1HI9A 4AJJA 4I4CA 5ADUS 4AKIA 3NWPA 4MJ3A 1MZPA 1ADGA 1RXSA 3DCJA 3HP7A 4I4TA 4FYVA 2F64A 4MZDA 5FYQA 2EFGA 1CNFA 121PA 4ZOBA 3I5XA 4UNQA 3HKCB 3L6UA 5ALIA 3M6FA 3NG1A 3T4UA 1K5PA 4BFXA 1KJ8A 2P9EA 3Q7SA 4KIUA 1YV9A 4R3NA 1ODCA 1FUUA 1KSJA 1L5HA 4PX5A 4YRIA 2EF0A 4HAYA 1BGXT 4IH9A 4Y30A 5JVDB 4J7AA 4GYKA 4DR3B 2ZKIA 1JG7A 5FOUA 3JVUA 4QUHA 3W7AA 2VVTA 2R1VB 2XCLA 4LYGA 3IMGA 2POQX 3OIFA 4MEAA 4Q01A 1A95A 3WWYA 2VATA 5IPFA 1KYXA 3GZ4A 4PYOA 1V5GA 2SKDA 3GDOA 3V33A 3VR4H 4DIMA 3DZIA 2VSYA 2X9NA 4MUJA 4H3HB 3O95A 5DASA 3VOAA 4R98A 5AUPB 5KQLA 3FOFC 1BQ3A 5LP6A 1YVDA 1YS6A 3Q0IA 4RD2A 5KSWB 2X5XA 3FSGD 3KTAA 4YALA 4C88A 1GPMA 5AK0A 1K06A 4N41A 1BRTA 5HKKD 1XFDA 2WV7A 3GI1A 1KQFA 1GFIA 2JATA 1H1LB 3FJYA 1PZEA 4GOKA 1DRWA 4OXRA 5JCJD 2UXBB 2OBYA 1NIJA 3L02A 3M82A 4IRXA 4K9LA 1LSOA 2GEUA 2BZSA 3SDSA 1MG0A 5A5EA 4ZZ3A 1BCSA 2FR1A 3ASYA 4ZVNA 4F04A 2UV8A 4FLFA 5AI4A 5K05A 1Y9JA 2EWMA 3GQBA 4Q9DA 4XEHA 1B6GA 1BXKA 1GLNA 3V7YA 1DE0A 3Q85A 1XMPA 5KEIA 3U1VA 2EJBA 1XTVA 3UW1A 2BMFA 1I24A 4I5IA 4XQEA 4G0WA 2WUEA 4DMHA 1O7JA 4J1TA 2GCOB 1ZU4A 5B58T 3RYIB 5CT8A 1NVVQ 1EXDA 1E60A 3GJRA 3ENVA 2XUOA 4FWIB 4UUMA 1YFJA 1E0AA 2C5SA 5F5XA 1E2PA 4W5OA 1MQ8B 4WEQA 2QLLA 3PEFA 4HZUA 4JI1B 2PR2A 5J63A 4LXUA 4G65A 2ZRCA 1XZBA 4BMPB 2WF5A 3JYOA 1H2RS 4NX2A 4UUNA 3KPUA 4HNSA 1TUBA 1VHWA 3AG6A 4NCHA 1RJ9B 3D6NB 2OAEA 2ECQA 4BUJA 2RDMA 2BUAA 2GD2A 5EIHA 4NULA 3MTAA 5M29A 1P80A 1XMQB 2A92A 1MOQA 1TZCA 3WHIA 3HNOA 3NWJA 4FEAA 4MYSA 1FSFA 3WR5A 1JH9A 4KQHA 5CGZA 3CNQS 2XZTA 3IBTA 4LYDA 3NUGA 1GADO 4X1KA 1JHMA 4QEKA 4X6UA 5ECWA 4CBVA 2O8FB 4HY3A 3NALA 2FRVA 1W47A 2UUCB 3GJXC 4DMFA 5ALMA 1UXGA 4Z6KA 5IXJA 4JX8A 4XUCA 3QF4A 4JOSA 2ISSD 3JZAA 2FG5A 1GRQA 3I9V1 2NZVG 2ADFA 1QYIA 5G0VA 1QB7A 5K0ZA 5KJFA 1IB6A 1Y3DE 2NPFA 4GP9A 4EATA 2OL4A 3JR7A 2H4JA 4IXTA 4PWYA 3K0AA 3T3NA 1IHYA 5SZHB 1CR0A 1X80B 1Z6GA 2VUTA 1AB5A 1WS6A 2QNRA 3FKSA 4BJ3A 1YT5A 1KYVA 4RHUA 4FOSA 4J0QA 1ZUHA 3BFPA 4ARZA 2AG0A 3SP1A 3WNQA 4AECA 5CFZA 5JCOC 1H3EA 3JVDA 1A0OA 2G9NA 3WWDA 1FUEA 3KHKA 2QPAA 3FRHA 1Z36A 4FP9A 1JIQA 1E6WA 3DVRX 4E51A 5GOZA 1W4AA 3SBXA 1OREA 2NXWA 3H0CA 2Q3EA 4D99A 2PPLA 3RSLA 1KE1A 3ISTA 1ZM7A 3FFXA 1J49A 1NVGA 3UJCA 3G5MA 4DJAA 4EGSA 4EB6B 3UG6A 1K86A 1Z0SA 3FKJA 3MTIA 1GQQA 1QC5A 3KOWA 4KCGA 5JVDA 4W5QA 1GILA 4IGAA 3E0QA 2XMDA 2I6FA 4WZZA 2JFFA 2YNMD 1X13A 1NI4B 1PJLA 1I10A 4ZVSA 3RGGA 3RE1A 4A0SA 2BEVA 3JQFC 3HZOA 4PCUA 3K1AA 3DLCA 2KBEA 3TIXB 4BEBA 2BF7A 2J9RA 5DVZA 2W2LA 3QXJA 2AXNA 3PS9A 1YBHA 3ZE9A 4C89A 2YOGA 5G41A 1BE8A 3C7TA 3DB2A 5ICGA 3AUXA 5T4BA 1FRFS 5CLIA 3L9XA 3I2HA 3HDTA 2R11A 3OIDA 1R6AA 3CX8A 3B9QA 3ZCQA 4TLBA 1BQEA 2ONYA 1EFPB 1MGPA 1Q3HA 1VKNA 2OVBA 3B70A 4M7OA 1NP6A 4U2DA 1X7DA 1P74A 1V7CA 3USCS 3LPAA 4WN3A 3SSMA 4B3MB 4RHTA 5J5CA 4CL8A 2BFDA 1E5VA 3G0IA 1U04A 1Z26A 3AVPA 1JPNA 3QVOA 5MGNA 3FWNA 4BP8A 2RGCA 1VLQA 2WWFA 2O6HA 3H2ZA 1YS9A 1YDFA 2HKIA 3IEXA 1GARA 3L2OB 4ZMBA 4BWVA 3DDOA 3L0PA 2JAUA 1F6WA 3AC0A 5FRDA 1PKXA 4B3IA 3L4KA 5EXTA 3FNQA 3IA7A 2QXUA 1CEQA 4ETIA 4H7JA 4KNWA 1UXKA 4JEHA 2IZ7A 2PDAA 1QWOA 4GEGA 4FFPA 2XVXA 1DKLA 1ZSVA 3HEAA 3LF1A 3OPMA 4Y18A 3UHOA 1T36A 2IHYA 2PU7A 4QA9A 1UOOA 4WY8A 1MC1A 4JVSB 2VUUA 3I45A 5CA1A 1Y3IA 1MAAA 3LL7A 4CF3A 1TU4A 1Z2NX 1PIWA 3DOEA 3BMNA 4WKBA 3V8BA 4KRFA 2XD9A 2QD5A 3WLFA 1E9BA 4H4DA 3NV9A 3VOBA 1U5AA 2QYTA 5EUBA 2GNAA 1PGJA 1PNRA 4REQB 5AM3A 4MW0A 1I1NA 3OQ6A 1P39A 2HUNA 1KHTA 1RKVA 3DT6A 1NBME 4CM1A 5CT5A 2AZMA 2ZS9A 5KSZA 3N2LA 1O97D 3WS7A 5CXQA 3WDKA 4F5DA 2X4GA 3BL6A 3N2KB 2PZEA 4V2IA 4YHBA 5IC5A 2RI6A 3MCZA 3OEHD 1GNQA 4Q15A 3TD2A 3LQ1A 2R8EA 5DU2A 5DM1A 3VI4B 1USUA 1TT7A 1X87A 3GVCA 4HO1X 2QTHA 1ZS9A 1DIOB 4E1BA 3ANMA 2VYNA 3GF4A 5KDOA 4N5MA 2PBFA 3IL2A 2V7BA 5EXPA 3RANA 3AVTA 3R7WB 3SHFA 2HLHA 1TVMA 5AQ1A 2BKLA 1XV5A 4OREX 1VXRA 3U7QB 4NYMR 1PF7E 3DC7A 4PZYA 2V9ZA 1W75A 2E4VA 3TNDA 3NHMA 3UUGA 3AH8A 4C3UA 1F2UB 4CMEC 3L06A 4TUYF 4O4LB 1SULA 1ZD2P 2KLHA 1Z16A 1ULZA 3AVQA 4TGLA 4WLUA 1ECPA 1I8TA 2L17A 4EG4A 3VR5A 2X6TA 5JD5A 3PFHA 1NP7A 4YP7A 1Z8NA 4GXRA 1KK3A 4BRWA 1PQUA 5HDQA 4KXXA 5KOHB 1C0KA 1D07A 3KUDA 4P3NA 4WDRA 3HCFA 4RD0A 4KR9A 2RFLA 2GTIA 4DV1B 1FTYA 2YVLA 4PEVA 4ZJZA 2YUIA 2OB2A 4H0NA 1QVAA 5BYJA 4RIGA 3PK0A 2F1JA 2PFSA 1Z4QA 1NVWQ 4I3FA 5I7RA 1Z2EA 2W6PA 3GG9A 4MQUA 5EZQA 1QX3A 4FD2A 3VNBA 5F9MA 2C03A 2QI9F 2ZYHA 2VDWA 3KDAA 2QUJA 1FQKA 5KS2A 2O2CA 4RDIA 4LC1A 1YDEA 2XQKA 1YTLA 2NM0A 3IKVA 4JLBA 1VB5A 4L27A 1SXQA 5KNDD 4A8TA 1GD1O 4D8WA 3GUCA 2WD7B 4CKCA 1N0IA 2PMWB 2UVQA 4K9KA 1J0AA 4EO4A 5L3VA 2DHEA 2EP5A 3LKDA 2ZRQA 4M0PA 5HMMA 3LBHA 1WO8A 4EH1A 3F97A 4AG6A 1KBQA 4MO2A 2NUAA 3HUDA 3IEPA 4R3UC 1H8ED 3EZ9A 4RPCA 2W5UA 2PRYA 5LNK1 1Q7CA 5DYTA 5I4KA 3PC4A 1JFFA 2UZAA 5M34A 1O2DA 1L4HA 4MP8A 2F48A 2E18A 1XDUA 1QHSA 2QAGA 1X74A 1VFPA 4RANA 1D1PA 4Y6OA 2RJOA 1MOZA 3ERCA 4EKIA 2XNKA 4KQCA 1FQOA 4EPYA 2XLCA 1W88B 4JVLA 4LMRA 2XY4A 3LCMA 4INOA 1R0LA 3ECAA 1CIVA 2HIAA 5LZ7A 1S9DA 5SYMA 3LNTA 5F1PA 1QKKA 1GNTA 2DUMA 3UV6A 3MAJA 1WKBA 1NG9A 1CS0B 3B7PA 3ZH9B 2C7OA 3ON5A 2X0FA 3EULA 5JXWA 5K8TA 2BM0A 1WMSA 3FPKA 3QFTA 4AZWA 1OKKA 2DHDA 2ZUUA 3NHJA 1UBLS 4I9HA 4B3FX 3ESDA 2ARKA 4HDMB 4DYVA 4HK4A 4OQ4A 2QU8A 4EGFA 3IVCA 4TQUS 3WB2A 4ZRDA 3AR9A 3F8SA 5JPCA 3GLUA 3PNVA 1CVRA 4XSGA 3VPFA 1N4AA 4AJOA 3S99A 3ZXXA 3O4IA 4EI9A 1U2DA 3KP1A 3PXDA 2O8EA 5FA5A 4GSLA 5FO0A 2C1XA 2CLFB 3NXKA 3PPWA 1R7RA 3OLZA 3I5YA 2HJGA 4BJ1A 1UF9A 3TM5A 4XYGA 2V7QD 3AVVA 1N2BA 3KBBA 1PE0A 5TMDA 2OMEA 2DRIA 2B4AA 4B85A 3I4LA 4V02A 1RWQA 5F12A 1OU0A 3L6BA 4DYHA 3ZK8A 3IS3A 5F7JA 5H68A 3P1JA 4X41A 1D5CA 4NLLA 3K9GA 4ZVRA 2Y1EA 4BFUA 4EBFA 5AHKA 1Y3BE 2P6OA 2BEUA 3FNHA 5JYBA 3CMMA 5CM2Z 2GN4A 4QBHA 4IWXA 2Z43A 4PCVA 5HGJA 2NO9A 4UU0A 3WIBA 3WKEA 4YWHA 1M5RA 4R84A 5LYYA 3VX3A 2L19A 2OP0A 5JFOA 5ALEA 4EPWA 5JJLA 1RWBA 1HZZC 1K6JA 1YB5A 1ZINA 1M2WA 4IINA 2QMOA 5A7HA 1C9JA 2IHNA 4TV9F 2F3UA 4PQGA 2GD1O 3RVNA 3HVIA 2F1HA 4BASA 3GA5A 4WAUA 1SCUB 3KFLA 3KB1A 3LT2A 4LXGA 5J2TB 3W0LB 2VYND 4WECA 4U63A 1VA5A 1L3IA 1XXLA 2IA5A 2OM2A 3FKQA 3WIVA 2Z4SA 1UK9A 4DGSA 1UBOS 3JARB 3Q5EA 2Q1YA 1SWVA 1R8YA 3HU2A 3NYWA 3ETCA 1WUHS 1GG5A 1MA0A 3K6RA 3OF5A 4RYDA 1T3LA 4N12A 4QT4A 1YAJA 2FSHA 1DC6A 1E2UA 1U0NA 1PLJA 3B85A 1VE6A 5ERGB 3GIWA 5JTUA 1V96A 2PKQO 1CY1A 4P93A 3ZJYA 2C97A 4MMXB 3BCUA 1IY2A 1MTZA 3H9EO 3PQEA 4J0EA 4EVRA 3MK31 4GKAA 3PPXA 2QD4A 3V4SA 1ZA1A 3ZZNA 2QTMA 3TYXA 3KL4A 4J1SA 3RVJA 5AVRA 4RY0A 4WLOA 2X1LA 3LBIA 3ZCPA 3AKZA 2R5WA 4QRIA 1SFRA 3C5WP 2CUTA 1NXSA 3FNFA 4PTYA 2VQSA 1ZNQO 4LXIA 1G3RA 4OV6B 4Z9XA 3U9SA 2Y93A 3IYLW 4HH0A 2Z2IA 4UD6A 4YMVA 2J5QA 2JI6A 2XCIA 2WZCA 5FLXA 4MINA 3BAFA 1KY5A 3B1KA 1BROA 3CB2A 3N39C 4TTQA 3BMCB 4BKPA 3QFSA 1QIHA 5BWBA 3LY5A 4Y1RB 1QPBA 3EEBA 4OHYA 4CI9A 1ORHA 5KAMA 4CTKA 1DWPA 4J1NA 1J0EA 2ZYAA 3OY2A 4WKPA 1NFRA 3T34A 4D82A 5EE0A 1M5UA 3G0CA 3UJHA 1XPOA 4LF6B 3WOHA 1W1IA 2C5HA 3OZDA 4J91A 4N40A 2R1ZA 4PGFA 4BZZA 4J3FA 1MT0A 2R68A 1DC4A 2WM9B 2F9MA 3UK7A 4DLPA 1C0LA 1N4DA 5CBKA 1W49A 4Z4HA 1T4CA 1KK0A 2GRJA 3KAJA 3NV7A 2SCUA 3ME5A 3FDXA 3RTDA 5J3JA 3LLUA 5AJHA 4JL6A 3PRKE 4M83A 4L8YA 1L5MA 1SUPA 4Y2VA 3W90A 2ZTSA 1H93A 4O8CA 4OHWA 2PAFA 4L4YA 4RHEA 3TLMA 2JHFA 1U9JA 2JGAA 4KN5A 4OQZA 2PLFA 2VXBA 3GHHA 4OCZA 1FEZA 5LU8A 3B3AA 1CD5A 1TKCA 3E5RA 4P53A 5FNVB 5B6JA 1RQNA 3IGFA 1MF7A 5CMLA 4B3TB 5EQTA 3ASZA 4ISBA 3L7IA 3RSGA 1QIEA 4KEAA 3K09C 5CX4A 2I7VA 4P22A 4YYEA 1FRVA 1JR3E 3BL8A 4O5OA 1A3CA 3IT1A 5CBPA 5I9MA 1T9KA 4DBVO 2ZUWA 2NVUA 3ADOA 3H3XA 3NM6B 1FP6A 3BB4A 4MWCA 3FWYA 2QD3A 1PR4A 4MV5A 2ZJ3A 3OWHA 1ILEA 2NWQA 4HMOA 1G9SA 3SXUA 2B25A 2QTZA 1G2PA 2C99A 2CYBA 2E5WA 2G0NA 3BEDA 4IO0A 3UB3A 1V8PA 3K4QA 4HADA 1TCAA 3FCEA 3NGXA 5ALYA 5DTMA 3RTGA 3V34A 2WC1A 2XOKD 3DVQX 2E6UX 2CLCX 3OX1A 5JNRA 2IS1A 4NARA 4LF9B 1NUPA 3KYDA 1L8XA 1X2EA 1DJQA 2G71A 2YIJA 5FOQA 1ZMXA 1HDGO 5D5HA 1NTRA 2R48A 5IYZA 1HDOA 3AUJB 4DV6B 3GLVA 4Q7MB 3W6PA 3HRHA 4ZJUA 2WSIA 3KHSA 3TGLA 2QVYX 2VAVA 5MN4A 1UKVY 4I99A 2LDBA 4WZ6A 1MO6A 1R9NA 2AI1A 2BJVA 2G1JA 3EGVA 1O94A 3LKBA 4U39A 2ANCA 1M75A 4X1YB 1JKMA 1SBZA 4N3AA 1BNCA 1KH1A 2JB9A 2YOHA 2OB1A 4R8SA 2XUJA 3G8AA 5FL7D 3T9EA 3Q7TA 1BTOA 1RFGE 4EGJA 3O3NB 1T1SA 2PH1A 3ZVKA 4KKVA 2H07A 5IAOA 2XE4A 2B20A 3CN7A 3KOZA 3WRYC 1SBCA 2D3WA 4PQYA 1LNZA 3MCVA 2EW1A 3ZXYA 3HVUA 2AOXA 1AZTA 1QVWA 2BC9A 2ZWAA 3ZNOA 3SXPA 4O2AA 5A6SA 1RYNA 2XE8A 1E59A 2P9ZA 4WFIA 2BELA 2VP2A 4P9NA 4EZBA 4J7CA 2VSNA 1LZKA 1AXRA 1EP1B 2YL2A 3LUCA 4N0EA 3SHVA 1FVXA 3ROXA 4MS4A 3SKYA 3JALA 1G20E 4EUEA 1RHKA 3EDOA 2FY8A 4JASB 5HJ5A 1BFKA 4EW1A 2IYTA 1JIIA 2OHHA 1I6KA 4HDSA 2P0AA 5A4KA 5JS7A 3GPDG 2WPDD 5EYPB 2G1PA 2O2XA 5HFNA 1J24A 2EU8A 1OZFA 2RB4A 3CLKA 1WTAA 3LVFO 1XYGA 2QT9A 3O3OB 5JQWA 4RPHA 4JFRA 2GVDC 3MW8A 3BHIA 3FVQA 3QA3E 3P0JA 3QPVA 4B0OA 4WLEA 1EVYA 2EZ9A 1HNWB 3NIBA 4O4IB 5HTKA 3WZLA 1ZOLA 4WX2B 4KLZA 1EXVA 3SLGA 3CLRC 4HNGA 2CW5A 2QVCA 3G9XA 3HR4A 4MWEA 4YMSA 2CJPA 3E3NA 1ZJ4A 4JUFA 4PHHA 5AR1A 5EP2A 5GY7A 1RAFA 1PFGA 1HE5A 3DDZX 3N70A 3W05A 4URUR 1X7XA 3KSUA 4JXKA 4E32A 2YQ4A 2H11A 3PE3A 1D2GA 1KC3A 1X1CA 1MNAA 3K96A 5CT4A 2R8XA 1IRXA 2HSJA 2WYUA 4IBOA 4TLEA 2DTDA 3NHLA 2ERCA 5DI9A 1I36A 1N2HA 2EC5A 2PZAA 5JD3A 3OIYA 5K09A 4IPTA 3UHFA 1KY3A 5CNIA 4RWZA 5F4BA 1YI8A 3D3QA 4DVJA 1GUZA 1XA0A 3IUSA 3MEQA 1JDZA 1HRKA 2BMJA 3QXGA 4FFWA 5DBFA 4D9EA 1Y7PA 2PKCA 2WWRA 4I2VA 3P9PA 3N2YA 3RAJA 5FWXA 3AU8A 4B4WA 5M5BA 1UBJS 4OYYA 1P9NA 2ZJOA 2GXSA 1T9HA 3I4CA 5LMZA 2L42A 3GZNB 4QUAA 2H85A 5LOVB 3COSA 2OK7A 4HLCA 1W2GA 3NVKI 3P4YA 2IOFA 3IV7A 4X64B 2AL7A 3HE3A 3DZHA 3H2HA 4KZKA 1L3BA 1EX9A 5L7TA 3OC0A 2CL5A 3KKKA 3SU8A 5EZYF 2GZ2A 2R6GA 1APBA 4L28A 2HZBA 2VP5A 4FR5A 3CRNA 2G72A 3BRSA 3MS4A 5COBA 1L5QA 5A3VA 3NWOA 1IC6A 1BHQ1 1GG8A 3QW2A 4KGZA 1TI7A 3TQFA 4TROA 4BNLA 5ICCA 2A57A 3DTVD 2OV2A 2ZS8A 2P5TB 3OTIA 2FPPB 3VDQA 2D2XA 4DLLA 2CL6X 4O4HF 1GVNB 4Q5IA 2D2EA 1G8HA 4FMPA 3W7BA 1D7OA 1JXOA 1R0CA 1WY7A 4IGIA 2IXAA 2ZRHA 1O57A 3CUSA 4IS3A 2AZTA 2LBPA 1N2ZA 1VMAA 1Z0UA 3MCTA 4PLVA 4RHFA 1S8FA 5KI6A 1T4DA 5A4MS 3ELUA 4UXJA 1IBRA 3L46A 3HKBB 3SOPA 2CE7A 4G37A 3WSVA 2AFIA 2PD6A 4IS2A 2AOUA 3KQVA 4CDNA 3ZV3A 4GSYA 3LQFA 1TQ2A 3DV2A 3ORRA 4YJ3B 1E1QD 1M7GA 2OHVA 4A6DA 4WK2B 3EEYA 5E7JA 5EIAA 1WQ3A 4QDUA 5FOSA 2ORIA 4G63A 4P3XA 1T1EA 3EWIA 3IUJA 5E1MA 1Z2OX 4CMKA 1PUJA 2HT6A 2AC7A 4GPZA 1UK7A 4URYR 1XNGA 3OCUA 4R1TA 3FMVA 4KVFA 1DSSG 1JHYA 1YGPA 2C1ZA 1GHTA 2ECKA 3D6JA 3E58A 5BQPA 3I23A 5CLFA 5JLJA 5L6MB 1W5TA 3ZIUA 4MOWA 3T5BA 4LNAA 5BV0A 1KJ9A 3M49A 2JJ2D 4JB3A 3KZKA 2VBGA 4MO9A 1B4DA 1V1MA 3HJCA 3LDGA 4GRDA 4UVIA 4MJLA 4MHOA 1SJ9A 3IKJA 5IZ4A 4RA6B 4HQOA 2AD1A 3CLTC 1L8QA 3JRXA 3KVNA 1E7QA 1LWNA 3PP8A 4IHJB 3WL7A 4OHXA 3ZEAA 4P8RA 2FX2A 4OA5A 1SKMA 1NPYA 2V58A 2VRBA 4BO5A 2YTZA 3S2FA 2FWPA 4LWPA 1SIBE 4PZCA 5LP1A 2BEVB 4Q3BA 2ZWOA 1B8NA 2GARA 4D3ZA 1T0BA 2M32A 2EEPA 4X1OA 1XZLA 3LYLA 1SH7A 1AQ6A 2GM9A 4F06A 3U1TA 1CUJA 3ED5A 1NN5A 1HEIA 1SQ6A 2VP4A 4HRYA 3NUZA 2GZSA 5ALZA 1KHHA 1WDMA 2JH8A 4RJKA 2DMRA 3HRIA 5LA6A 5KNCH 4ZJPA 4YAKA 3D6UA 5JSFA 2N3ZA 4EA8A 4GMHA 5G1PA 3G2QA 4Q7EA 3AVXA 1QOPB 2HADA 3BQMB 4H6PA 2PR7A 3ESXA 1J2TA 4GM1A 2RAUA 5EP1A 4EF4A 4JP8A 1FDRA 2XIQA 1TYDE 5I3ZA 3Q8MA 1VCIA 1E7YA 1KKLA 1C1DA 1KGDA 1KZ9A 1NR7A 2C4KA 2QG9A 4FN5A 2I54A 2FCAA 5FOVA 3P96A 3ZTTA 3V1YA 3CSSA 4B3BA 5JWRA 3SMVA 2VK1A 2WJ6A 3UFXB 2A78A 1YKGA 2XHZA 3I6ZA 4BQPA 1YF3A 4BKUA 3HBAA 3KAKA 2ZTMA 1E6KA 1S2GA 2IEZA 1HFKA 3GW8A 4IXWA 3T99A 3X43A 2B2NA 3U60B 5KNCD 3PEEA 1K3TA 4B2YA 2IV7A 4LOLA 5IVPA 3O2NA 2X7XA 1K92A 2CCKA 2BIFA 1EXNA 1MDBA 1XEWY 1Z38A 2PWBA 3RVRA 2OQRA 1OYOA 3UXHA 1TPZA 4KHPB 1QE0A 3A37A 4RGQA 5JMPA 1CY2A 1KS9A 2NV6A 1HE3A 1VYHA 3EXEA 3NTXA 3BMNB 4PPGA 3M9XA 5F7ZA 4H1VA 1P5RA 3LX5A 4ZVQA 5C35A 3RWMB 1FZQA 2ZIWB 4H08A 2WKPA 3BDAA 4BMNA 1U63A 3VV3A 1HWYA 1YULA 3TZCA 3ZDYB 2NVOA 1CDZA 2PN1A 4Q34A 3ZWVA 1XP8A 5IN4A 3IEIA 4FU0A 4ZPXA 4IWNA 4X3OA 3WVNA 3OJFA 2DKFA 1DBVO 3I2FA 3PKZA 2P8JA 4NJMB 1N25A 1M1XB 2PS9A 1M2HA 4MR8A 1BVUA 1UINA 2ILVA 1XALA 3OE7A 2Y6VA 4G0NA 4U6QA 5HQTA 4EFMA 4ER3A 1B6RA 1YB1A 3VGPA 3E9YA 1GT6A 1Q21A 1RWOA 2QG6A 2RKOA 3FUVA 4Z9FA 5FTJA 3WG9A 1CUCA 2LXNA 1T2DA 1WXEA 2GX6A 1XC7A 2ZJ0A 3UAGA 4LC9A 1G19A 3D3JA 1UP7A 3M70A 1F1BA 3A3KA 3TOSA 1N2IA 1O4VA 5AJWA 5T57A 1E6EA 1QTRA 3GP3A 1DDIA 4OXXA 5A62A 2F8LA 1J39A 2FW6A 4FZRA 4BO1A 4JI0B 1A5ZA 4QXPA 3A4YA 2BGKA 4JFAA 4G0OA 2JG3A 3RVDA 1BAPA 1BXGB 1DP4A 1CF9A 3QA9A 3WGTA 4D9JA 3R09A 4RFSB 1XELA 1Z6TA 2WVAA 2A1UA 4PPYA 2Q7OE 1G1AA 4KNYA 3FB1A 1XEXB 1XYVA 1XMVA 3PGJA 3WTBA 1ZCBA 2R3SA 3RIEA 3VA7A 3D8RA 1J1IA 3VU3A 3LM8A 1CSEE 3I6QA 3A9WA 3HWWA 5C53B 5KX5F 1XZQA 1EGAA 2FF7A 3B1FA 2GZHA 1BCSB 1II8B 1GFWA 1RHUA 4NCKA 3CURA 1U3WA 1I1OA 1W59A 5LU9A 4DXAA 5KPDA 3N3AC 1MB2A 3D0RA 1Z2DA 1GGVA 4RVNA 4X65B 3I2IA 2D5BA 4HDQB 1AD2A 1MGOA 2R5NA 4JUAA 4L9RA 2WYVA 1KAQA 1V11A 2DWOA 4AT1A 1LNSA 2HWXA 1U99A 3B12A 4HLNA 4ANFA 4KXQA 2G9VA 2HREA 2C7VA 3QUBA 3CXUA 4MHSA 3W3ZB 5CB4B 5EGNA 3HBMA 5JMWA 2AMYA 2VHQA 3FHTA 5D84A 5I7UA 4UJ5A 3MINA 1J20A 3A1EA 3OPVA 4C05A 5HKKA 1MORA 1Y5LA 2P2YA 1PJ4A 1I9GA 2JVKA 3RQIA 2JGFA 4BNHA 1Q57A 3FJOA 3GROA 1SUDA 3L7KA 2KSQA 2OCPA 2Z9DA 1MKYA 1J7JA 1OX4B 4OX9B 2JKYA 3TPZA 2ZBUA 3DOFA 3H4IA 1U02A 3OFJA 4BRSA 4EJ6A 1EVEA 4J43A 4EUKA 1YDGA 2C7BA 2E48A 4YBZA 1J07A 4UTVA 1LPNA 1U7UA 1A8UA 2G9UA 4AJNA 4HUQA 2OAP1 3E9QA 3GUUA 2IX9A 2TECE 3A6ZA 2LDXA 3K1YA 4MPRA 2PH3A 4QWMA 1E2NA 1ODIA 4LZNA 1X7WB 2WYWA 1V5IA 2EJVA 4G1EB 1CEYA 3TWOA 1IN6A 4DF3A 2UVPA 1H2BA 1I5OA 3L0SA 5THKA 3KKNA 3OZUA 3GLHB 2WNIA 3C7AA 1L9XA 3LOQA 4Y2GA 4H3VA 1NXVA 4B6FA 5BSHA 2DQSA 1D4FA 1JV2B 4R1OA 5HBGA 4KUEA 1E9CA 4GOOD 3WKCA 2GM3A 2GCGA 4YGXB 1MX1A 1TQDA 2WR8A 3DBLB 3MD0A 4IDOA 1JHOA 1QE5A 1KJNA 3CF0A 3CINA 3RFUA 3E15A 1GKIA 3A3YA 4J7UA 3U7JA 1W5FA 2O2IA 3MC1A 4J1QA 2VAMA 3BFXA 2VDMB 4PC2A 3RC8A 1EJBA 1O08A 1AO0A 3CKLA 3VJRA 1G18A 1F0KA 1SVKA 2UYQA 3Q11A 4DE5A 2O8CA 3EBPA 1TC1A 1X3SA 4DPMA 2AN1A 4YMWA 5JO0A 1G6Q1 4BZQA 2ZQ5A 4EKNB 5J2TF 2AUTA 1R74A 1L7OA 3O8DA 3C7KA 1UKEA 1EGHA 4CTMA 1KEEB 1X8KA 2HIMA 3K7EA 1QFYA 5DCYA 1POWA 4P84A 3D9QX 3PLAE 5IKEA 2B21A 2ZB2A 3T3PB 2O2DA 1OXVA 3IQWA 1KQ3A 1L6IA 3D31A 4QHYA 3W5IA 1UDCA 3RFFA 4AZSA 2X2FA 1JB9A 1ZXXA 3K0AB 4RPGA 4YIKA 2YFKA 3GD5A 1Q83A 4BOYA 4C5BA 2Q3LA 4NBSA 4JU8A 5DI3A 2ZDHA 5C4MA 3RNOA 2IW1A 5FX2A 2Y66A 3NIGB 4XCQA 5EXEA 2HQOA 4IICA 1ZFNA 1X86B 2J33A 2XA2A 4AS2A 2Y1KA 5BUSA 2Z6QA 4A23A 4HH3C 1I2MA 2IZ6A 2VTKA 5FEUA 1LW6E 3FG9A 3SSNA 4AMYA 4DDKA 1DCKA 1MV8A 4LJLA 3A1TA 1T0HB 4NE7A 3IHLA 3AX6A 3F78A 5CDSA 1A4UA 4IGKA 1VG0B 1ENYA 3QPAA 1IMJA 1X7ZB 1Z08A 4LV5B 2P2NA 2VNKA 3AETB 2VPPA 5DK4A 4IF6A 3EVEA 2QTGA 3ABQB 2OSBA 3LXRA 5FR2A 3TKLA 5IM4F 1NA5A 5FTNA 4BP9A 1U2GC 1UBRS 4IAOA 2R6AA 1CJCA 2QRVB 3AIOA 3TTSA 2FZKA 1JFTA 3GLFA 1ZWKA 3GDWA 3KEQA 4FSXA 3W3AH 3LO8A 5DXFA 4AS1A 4RVCA 2PU5A 3AKEA 1MTOA 3NT4A 3BMQA 5HKLA 2ZU0C 1J9ZA 2JD2A 3GPIA 3S7TA 1RYBA 1SU6A 2FCRA 2GRUA 2PWPA 2H1VA 3AT1A 3HCDA 1LBTA 1A2BA 2XKBA 3M0EA 4RF5A 3W78A 3GMIA 4TRRA 4AJ4A 1FDVA 2Z2JA 1TKRA 4R9NA 5ICSA 3IO5A 4FYWA 3VHXA 3JQFA 1VG9B 3ONNA 1V6SA 3AHEA 4OQEA 5AVJA 3F73A 1P0IA 1BVHA 2NZXA 3TUIC 1DIAA 3MZ0A 4D9CA 3W5AA 1GGMA 4IX1A 4D9MA 2ZJYA 3DEAA 4RVFA 1JWLA 5CAEB 3R3VA 4NY1A 2D4HA 4UD2A 3FHLA 4HBGA 4N76A 1CP2A 2WFLB 3O0TA 4YRRA 3QM1A 1ZBDA 2Q07A 3ETHA 3A9SA 2V98A 3NDIA 3CNOA 4NYIR 5A9TA 2PZKA 5EJEA 4HR7A 1E3JA 1YKFA 2FETA 5F21A 3R7AA 3C3DA 1ZJ5A 4DW8A 4HN9A 4WKCA 3AF6A 2E37A 2H51A 1ZC3A 2WMYA 1GR1A 1HZJA 2OFOA 2XNJA 1XRNA 3CGWA 2C95A 3HV0A 4B7ZA 2CYCA 5AK5A 4A1FA 4OYRA 1HQCA 1P31A 5DNCA 1YUBA 5FBKA 1T5TA 4CV2A 1D1SA 4U1RA 4N39A 4ZQEA 4G5YA 3BWEA 3G7UA 4AKTA 5I8WA 1SCNE 4DR5B 4EHJA 3JQCA 3LGSA 1HKHA 1P19A 1Q0RA 3DZ8A 3N74A 2Y1DA 5AKJA 2B9EA 1VL2A 3X1JA 1PK9A 2QPTA 2PWZA 2F17A 5LC1A 5FPKA 1P45A 1ZK2A 2H4YA 4G6ZA 3H5WA 1K8XB 4RXTA 4XUEA 4HVTA 3Q2KA 4PC7A 3O9ZA 4E07A 3UJPA 3P26A 3S68A 1NQAO 1V1JA 2WG0A 3DP7A 3IC5A 3KFVA 4D4GA 2I80A 1PFWA 3TW0A 1U8YA 1R4AA 4M55A 3H87A 5FQNA 1M66A 2CFSA 2ZZKA 4CN9A 3EEQA 5G0SA 4NZNA 3WE7A 2PTGA 3IDFA 3QEJA 4MICA 3VJMA 1E2BA 1JALA 2HHHB 1MEOA 3BPSA 4UBMA 1N2JA 1E1KA 1JUDA 5REQB 5TVKA 1O8BA 4JJIA 2REBA 5BNFA 2QDXA 3LJKA 4TXMA 3TIIA 1VJGA 5LMNB 1FLVA 3KV3O 2EFHB 3GLFB 1CEEA 1XXHA 1GFSA 3L7NA 2WKWA 3EXFB 3MG9A 3NHRA 4P4SA 1L7NA 2XQIA 5AFSA 1T9AA 4K9PA 1RWNA 2JIOA 1AK2A 2XQGA 1M5TA 4CEIB 3DP9A 1CUGA 3GJYA 2DBRA 1PG2A 3VAYA 3D3NA 2WAOA 4CXMA 4UNPA 2WUFA 4Q03A 1O95D 4YR7A 2AEFA 5E3HA 2PL1A 1LWOA 3EMVA 3BWDD 4KV7A 5H7XA 2IPMA 1QIFA 2G1KA 1J6UA 3DV0B 1U0LA 5DM2A 5TS2A 1SAYA 2EZUA 2I67A 5ALKA 1XJWA 3EOZA 4I8IA 4M0UA 3KYCA 2OPHA 1YZYA 5EJ9A 3OPXA 1BMFA 3IJPA 3CR8A 3B1WA 3I9LA 3Q6MA 4J0IA 1UP4A 4M60A 1RXWA 1NW8A 2AMLA 1G6KA 3RJ5A 4UAUA 3ZHQA 1YCGA 3ZW7A 4C22A 2FN8A 2XDWA 1HORA 5BUZA 3AM5A 4HOYA 5C4GB 1T91A 3ONFA 1T5HX 2IXEA 5LMCA 1OXUA 2FSSA 1G3UA 1TJPB 3QE0A 3ZWMA 3GO4A 1ORTA 3VNUA 3P0HA 3DT9A 3WGYA 2QQ5A 1CK4A 2WAXA 3A6FA 4RMNA 4RJTA 2BTQB 4GHWA 3J7AC 5DLDA 3BRWA 1SR8A 1V5WA 1IXRC 1MDFA 1DAPA 2HDNB 4PAMA 1GQSA 4Z1MA 3ZZ1A 1I2DA 3V48A 2H1RA 1NQOA 4XX0B 3MGGA 3K92A 5EFOA 1JSXA 3I05A 1KQNA 4JROA 2AS0A 2QBYB 1LDNA 1SOUA 5LP6C 4C6RA 4I4IA 5FV7A 3ZHTA 1OHHD 3INRA 4IUBS 5AVKA 1L8LA 3BRQA 4KGDA 1LI5A 2XE6A 3N05A 4Q16A 2HWKA 2I4OA 3ND7A 4P83A 2BR5A 4AP5A 5BMOA 5C8DA 1YJQA 1NF9A 4D92A 1DJPA 4IDFA 5B36A 4NG5A 4CEHB 2XTZA 5I7VA 1TUBB 2GPTA 2QVZX 3L0CA 4RIIA 1U3GA 5CVJA 4JXJA 2Q5EA 3A6KA 3AP1A 4UZSA 3H1PA 1EX6A 1QGAA 3LC7O 4C5AA 2VA8A 4NJEA 3TG2A 1VMEA 3NO4A 4GPBA 3P2MA 5C31A 1UZLA 3EE6A 3TZHA 2R62A 1TRHA 5ALUA 4LGMA 2OORA 4N01A 4R81A 5TGTA 2CN1A 3NORA 2V6GA 2NXJA 4P33A 5BORA 3HJRA 1VLHA 1NMSA 1ZEMA 2Q8PA 4IH1A 1NU6A 1P1IA 1I6WA 1ZHHA 3LBNA 2XB4A 4RM3A 4UAGA 5CYFA 5C3UA 2PS0A 5TC4A 1ADJA 3KQHA 3QWBA 1CRQA 2PV7A 2GCIA 2P35A 3GUHA 3KTOA 4O2BB 4QARA 4TWAA 4DQKA 1J2YA 5JDCC 2HA2A 2I6XA 2G67A 2IYZA 4MKXA 4QFDA 3ZCTA 4L4ZA 4KPFC 5C8VA 4C01A 1Y6JA 3K8OE 3KVVA 5BPHA 3T1YB 2GBGA 5CA1F 1J97A 5JYDA 4RGYA 2AR0A 2DBVO 2WQ6A 5I5GA 4I46A 4TL9A 3UVEA 1X92A 2X8AA 4KACA 4MA4A 4ZI7A 3AEKA 4KRYA 4ZMSA 2WSSA 4NZ9A 1UP6A 4L85A 5I9IA 3OIGA 5J40A 2F55A 5C7IO 1J0BA 1G5RA 3H4VA 5JNSA 5TMEA 3ACDA 4RXUA 1OXXK 3LW8A 3U56A 3MS7A 3JATB 4D3FA 5A5DA 1FMLA 3AZQA 2XB9A 4XPIA 5U4QA 3ZD8A 4HJRA 2R87A 3TF5A 1FFGA 3FVTA 4RBNA 1T5OA 2YWGA 3EFBA 1KQOA 1T29A 4TN1A 4AF6A 3GAAA 1ACJA 1BW9B 1EESA 1ADCA 4G1MB 1GDDA 1ZN2A 4ZYLA 4LJ8A 1MJ5A 1QK3A 3OJEA 3TN7A 4ETWA 4LMBA 2A0KA 5DH9A 1RIIA 2WM3A 4IOMA 4E70A 4X61A 2V8OA 1ESZA 3QLTA 3SXJA 4FGUA 3DLTA 4G2NA 1CQXA 1BRMA 1I3LA 1NRWA 2C8VA 3DZCA 3WRWA 3O03A 4AMVA 1FS5A 1GV0A 1XLUA 4NFLA 1QFXA 5ITZA 4BVAA 3UGTA 3EIEA 4LI0A 4GPAA 2G4VA 1VXOA 1E20A 1R8JA 1QORA 2NACA 3V4RA 1YJ8A 3A3NA 1GCUA 4X20A 1WEHA 3T0FA 4BRUA 1SUEA 1IN5A 1VGVA 2O48X 4DNXA 1SXJC 2ZIEA 3AL2A 4X3CA 2BFDB 5D6OA 1XTQA 1V5EA 1C0IA 3BHMA 4MCAA 1VL1A 5LL6P 2DQ4A 4Y2UA 2YV5A 3RHFA 3WYBA 3DM5A 4Q7JB 1SK8A 4P34A 4MB6A 5DSZA 2H0RA 2I78A 1KO1A 2I2BA 4KHZA 4Q3NA 5JECA 3K15A 1PDOA 1Y1LA 4QJ4A 4JOBA 3AF1A 2J41A 5DTRA 4BEJA 4QNMA 4DWJA 1QLWA 5ECDA 3JARA 5FTMA 5EKXA 1OC4A 3TPFA 5LCXA 1DRVA 3ZLJA 2X9LA 4B6RA 3OQMA 2E49A 4B76A 1WXQA 2CBXA 1N0UA 4KFCA 4V1CB 4L74A 2YJNA 1USGA 4H6WA 4PO9A 2ZSJA 4W9NA 1M3SA 2PT9A 3VKVA 4UOZA 4ZVUA 1U9IC 2C88A 1LRJA 4QQKA 1FU4A 2XI4A 2CNWA 3JR3A 1XRJA 2PQ2A 1O1YA 3CUYA 3P94A 4JVNA 2I2WA 1NVEA 3ZU4A 1WCXA 4M9CA 4M9SA 1XOIA 1M2VB 2OCIA 2X7HA 3JD0A 2YHUA 4UM9D 3WYDA 3R9KA 3PFBA 1F2VA 1GQRA 1OI3A 4EEKA 3L1UA 3A27A 3LC1O 3R8CA 5E9WA 3RG2A 4MVCA 2G0AA 2VHCA 3K1ZA 4EVIA 3GLIE 1D2EA 4ZOLB 4FNAA 1DKQA 1DQZA 1W4ZA 3PIDA 4UHDA 2HRCA 3TJMA 2YCLA 2ZIVB 1PWHA 4ZVLA 2ERXA 1C9NA 2MYUA 2ZDGA 5ICFA 4EI8A 3A26A 5EA2A 1AKUA 1FLAA 1H8HD 4JUDX 3EK2A 3U31A 2EATA 4YX9A 4M37A 5JI3E 5JJCA 3W5UA 4W5HA 1X8LA 2CFTA 3ROTA 1G8FA 3KCNA 3D8UA 2XMRA 4KJZA 3L0IB 1P4SA 2UDPA 3TNLA 3N2GB 5LUBA 2CMGA 2O5CA 5LQNA 4I2NA 2XNDD 5JSYA 3CIFA 2F3SA 3T4EA 1NBIA 4A0QA 4I4TB 2A5LA 4GX5A 1I3CA 4A82A 3KOOA 1XEWX 2PO5A 3W4KA 2YWRA 5A03A 4C4RA 4JXZA 3ROKA 5J4KA 4I50B 3GPCA 4DJJA 1LVUA 2FPWA 1JB1A 4OQPA 1YR2A 2GQ0A 4KC0A 5HZGA 2R79A 2CJFA 5A1TA 1UBTS 5GIOE 3IAM1 4JI4B 3ILYA 4HDRA 4KFRA 3ZCUA 5J1SB 1M67A 2O52A 4GOJA 1KSGA 3SF8A 4YMTA 4B6PA 3H9GA 1HA3A 4X90A 1AN9A 1JHQA 2BSAA 4H7IA 3GXBA 2DY1A 5BOSA 1J09A 1CB7A 1HGXA 4R8VA 3KJIA 2CK3D 4Y2RA 1BWRA 3E1SA 2PNJA 1UJ6A 3CPJB 5FYDA 3M1AA 4PC6A 5H4GA 4RLFA 2NMVA 1UXJA 2HIHA 4U5QA 3RU7A 2AJ8A 3GWZA 3LTNC 4Q93A 4FEEA 2VDNB 3AI1A 2WNSA 1ZH4A 3PNLA 1EM8A 3FI9A 3ZDBA 1O89A 4Y2JA 3HWX1 3OOEA 4JXXA 1J2UA 3HN7A 2B2XA 3HG7A 4R2XA 3SKVA 5C7YA 1CRPA 1P3Y1 1PVDA 4XZ3A 2EBFX 2I3ZA 4CKYA 1RZ3A 3X0DA 5CXUA 1TD9A 2C9CA 3T52A 4B3GA 4DILA 4UUQA 3GRRA 4QXQA 5DHRA 1EE2A 3GN1A 2IEIA 2X19A 3KR9A 4M0LA 5AVTA 3EPJA 4JEIA 4E2WA 2OLJA 2NVWA 3I5AA 4H77A 1FFSA 3G2LA 4HWPA 1RYDA 3O26A 2P40A 3AJRA 4KO3S 3T06B 4H0CA 3T7CA 3TLJA 1NQUA 1EVLA 1WXDA 1HO3A 3V3TA 3U9LA 1RQRA 3PNBA 1D0SA 4IJ6A 3U3XA 3A05A 4EA7A 1R0YA 2G3YA 4PLFA 4EJSB 3GLHE 3KSRA 1XKLA 4MUNA 5BN5A 4UPDA 2QX8A 3MLBA 3MT0A 4X91A 4C4TA 4WZAB 3EFEA 1SIWA 1A5BB 2ZAIA 2VP3A 2J3EA 1ISMA 1P4AA 2ZM6B 4QWWA 4EHIA 4YUAA 1QYCA 1UBKS 1FSPA 4PAWA 3R5HA 2NU8B 4OFXA 4B45A 2AE2A 2IIPA 1KMNA 1PNOA 1YS4A 1YUNA 1RNLA 2CLIB 3O82A 1NKTA 3BGDA 4BO0A 2J0UA 3KB2A 2QRJA 2N75A 2FWBA 2ZIUB 3GY0A 3K72B 4C21A 1W36D 1SUAA 2GJ9A 3MLEA 4P4LA 1Y37A 2ZWPA 3RLIA 4XOUA 2XMCA 2QZPA 1FNDA 3WI7A 1R8SA 3H2IA 3L3BA 2FSFA 1C80A 4A2QA 3N28A 1U5BB 3ABSB 2DWPA 1JN0A 4RF3A 4YP9A 1YHZA 2IHBA 2RHGB 5T3YA 2JLSA 2YHAA 3A4IA 1F3OA 5ARDA 1Z0KA 3DL0A 1FUIA 4P31A 1NFFA 3NNNA 4HS4A 4WMLA 1QG0A 3ZNPA 5BV8A 4QJ3A 1WBBA 2BSQA 2X1MA 2OG2A 3K0FB 4IJVA 1IQ0A 3HMQA 3LDHA 3OLQA 1XLTA 4KX3A 1JLRA 5DTEA 3X1KA 1NQXA 1DXHA 3S4YA 2OMKA 2FQXA 4UDYX 4A5OA 3D4IA 5CD1A 3JQEA 3R5SA 1YA6A 4PSUA 1GGJA 1G21A 1QS0A 2ACEA 1KAGA 4N8SA 4CKBB 4QUIA 1L4EA 4OI0A 3RT7A 3CF2A 5LIRA 4G0ZA 5FWDA 1SRRA 1PT9A 5T41A 1FC0A 3G2NA 3A36A 4EG1A 5L53A 2OUIA 2LPMA 1JIXA 4RA6A 4BTLA 1JVSA 3ZWCA 4YT2A 5B30A 1A4XA 3C3PA 2CLDX 1P17A 5CU7A 4Z3OA 2JBAB 1WD7A 1F8FA 2IODA 1JT2A 4TYMA 2H1SA 5FUBA 3UQZA 1ZVVA 5AI0A 1UPAA 4F12A 2INGX 2O7SA 4LWOA 2B8JA 2FDCA 1QO0A 2VF4X 1G7CA 3OPYA 2FVYA 1E2FA 3DKVA 4IV0A 4GKBA 3DS8A 1O58A 1ZAKA 4B3DA 3C4JA 3MCAA 3HABA 4AWXA 4EKGA 4MDHA 3EZFA 3HMKA 3TCNA 3EPLA 3R4VA 2FZCA 1GTVA 1XSEA 4EHDA 2VDUE 1K8QA 2ZIZA 3N58A 1W0KA 2RHJA 4IVRA 4E30A 3G6KA 5JBNA 1KY4A 3CCCA 3PQ6A 4HYYA 3LQYA 1K7CA 5BMVF 3QBEA 3SC2B 3H5OA 4TXHA 5BNIA 1UZMA 4M1EA 1QE3A 3VPXA 2HHLA 4UQLA 2Y1XA 3FSEA 4WOKA 5HE9A 1CW2B 2IIBA 2G25A 4FGKA 4UBNA 3M6WA 4X5OA 1R88A 3UANA 2OXCA 4FCCA 1RYMA 2XVYA 3QKSA 4IQ8A 1ZJZA 1ZGZA 3IH5A 4DIUA 3CNNA 1GPNA 5KTYA 1VIYA 1RQ2A 4YIHA 3F2IA 2BM9A 3BREA 3HL4A 4KOAA 4QU9A 4D41A 3QY0A 3TX6A 4TSFA 5FPTA 3NANA 2J6HA 3QFCA 1TTPB 1VJCA 1W96A 3D59A 1RMTA 2OCGA 3EGOA 1XZPA 3DDHA 3HBNA 5KWEA 3H75A 1P4RA 2D7JA 1A9TA 2ZAGA 4ZGGA 3HQ4O 3TD9A 1NHGA 3I1JA 2C7GA 2ZUEA 2NSDA 1BHJA 2GNPA 1DG9A 3BZWA 3J7TA 1TZKA 2RIRA 1UBEA 2QL9A 2HFKA 4FZ3A 3EVNA 1OXBB 3EVAA 2QHXA 4OGKA 4ZU1X 1QHGA 3T7AA 4ENUA 3WK7A 1NGSA 3QKRB 5EPEA 2WKQA 3GRVA 4EHAA 2ZB3A 3WWEA 3AY3A 4WCFB 1QQ6A 1BKYA 1QPGA 1XA3A 4YAEA 4DA9A 2HLPA 3BXGA 1MB4A 2LKDA 3PHGA 1HDIA 3AK4A 4R5MA 4R2IA 2JAPA 3RTEA 3GVPA 4UATA 2H9AA 4C76A 4M3NA 1G8JA 1M1YB 2OWEA 3FJ1A 1JMKC 1SG6A 2GZ3A 3QYJA 3H65A 3G2MA 1MFZA 1JDBB 5B7PA 3LPDA 1MUUA 4DB4A 4LTDA 3MRXA 2Y6UA 1S8AA 3RPEA 1YD7A 2O59A 3V1KA 1E0KA 5KJCA 5G2OA 4Z7QB 2WJ3A 2Q2OA 4L8WB 4FHGA 4YR9A 3C24A 1XCJA 4IR7A 1EB8A 1B0AA 4V03A 3STTA 3OURA 4BYMA 7GPBA 1DGQA 3PWSA 2M6LA 2I1QA 2CSXA 5ITVA 4DQXA 3COPA 4CKXA 2AQHA 1E5DA 3VSDA 5JISA 1IJBA 3F2VA 1ABBA 1VECA 4OHFA 2EZ4A 3GFPA 5DLQC 2PKWA 4BGVA 1ADFA 1Z7BA 3HU3A 3IMFA 1MC8A 3PC3A 4AUNA 4B3HA 1E6CA 3ICPA 5T64A 4TXNA 3Q8LA 3FIJA 5LWHA 1H05A 4M8IA 2ZE5A 2BI7A 3QHPA 3SF8B 4EJ2A 5EIXA 3NYRA 3OZCA 3ONVA 1H9CA 1QHHB 4PZ9A 2ZUCA 4AJLA 2FWJA 1IDOA 1AXEA 2RHHA 1RQ7A 2YVKA 4UEQA 4X00A 4BNTA 2DTEA 4DOMA 4ZCTA 2X0JA 1V16B 1CUAA 3DMGA 4G89A 4GD3Q 3SZMA 1XJCA 3MHPA 5IYZF 3M6AA 1ABEA 2OYSA 2R7MA 1AQYA 5IDYA 2WPDA 4J9UE 3IUYA 4MKRA 4Q1FA 2A9VA 4NDNE 4TZTA 3TLCA 2CXNA 4AMZA 3IXMA 4KO8A 1QGED 3BDIA 4RD1A 2AYXA 2F1KA 3BB1A 5JVDF 4YRMA 1I4LD 3R6GA 3UHPA 5K8JB 3TFOA 3WK5A 3EF0A 1Y9ZA 2MSDB 2CMKA 3N75A 4WLFA 2GEDA 4YECA 3WJ2A 4OKSA 4D02A 1YBAA 2PX2A 3OI7A 3RSOA 5LQCA 3GD7A 3F4KA 4DR2B 4MR7A 5L45A 1TM1E 4X6LA 4Z1MD 1AZLA 4H7KA 2D5AA 2P65A 3WWOA 4B9EA 1QIJA 3JVVA 4UVHA 4EZEA 3EXIA 2QT1A 2J7KA 9MHTA 5GTDA 1Y1PA 1M34B 1GTJ1 4RIEA 5CXSA 3U49A 3PT5A 3NHBA 1ISFA 3W2IA 4YPVA 3U7HB 4ZT3A 2ZVJA 3VYTB 4AO8A 2CFIA 4RK1A 4YMHA 1G6OA 1HT0A 4MWGA 4KREA 4AIIA 5ARBA 3V80A 2PY6A 3FNRA 3EH1A 1BW9A 3MVEA 4OF4A 5GV7A 2C3OA 3QBTA 2VTEA 3EFOB 3C6YA 4GG1A 2CDNA 3WAJA 1SHTX 2H4XA 4C6TA 1HX7A 1IZZA 1W5EA 5BOVA 3FWZA 1NWHA 4DIEA 3DYBA 3ETLA 2Q6LA 4ZCMA 4X95A 2W98A 1JFVA 2DUJA 4NL4H 2VHZA 3WL3A 4XB6B 3AHJA 3GLRA 3KAPA 4JY7A 5B6IA 1AQLA 3R9XA 1QYRA 1KAHA 3BD8A 3PGMA 4HNQA 3OIUA 1NVMB 3C1OA 4U2EA 2O19A 1ECCA 4A0GA 3ZR4B 2H4FA 4AFNA 1NMXA 1G8YA 4YUYA 1T8TA 2JIRA 1NP3A 1M6WA 1BIFA 4JK3A 1FNMA 2GPWA 3B36A 3SHQA 1A9PA 4U2GA 3FZYA 4CR6A 4DDVA 1KTVA 3V8MA 1QMGA 3ZI7A 4OSOA 4IL5A 3PUWA 5BUQA 1VL6A 1JFFB 2XCQA 3QFFA 3WNVA 3PQCA 1B0UA 4ARIA 2NXNA 1JWBB 2AYYA 4ZEWA 5JAIA 2YKGA 4DLWA 2JKVA 4QUJA 2JK0A 2W2KA 1PD1A 2JHAA 2KM1A 4Q4CA 1Z6YA 4EPTA 1WP4A 1DFHA 1Y3FE 2IBTA 5IKXA 2NYVA 4ALMA 2NUTA 4ZI7F 3OEYA 1A1SA 4ENSA 5D6NA 3ZY2A 4HFNA 4HH4A 4D8VA 3IP9A 4G4IA 1WY5A 2B3TA 4RWEA 4EG7A 3NOXA 4ZK2A 4YUVA 3K73O 3G2OA 4L5BA 4WLVA 2JCVA 3PKJA 1J7KA 1EYZA 3I83A 5AH0A 3T1HB 2SNIE 2UUOA 1PG5A 2V7QA 1MLDA 1N92A 3LP6A 3TGWA 4JHLA 3A9CA 5IG2A 2GBLA 4ID3A 4RMIA 2XUAA 3DUWA 2PGAA 1F12A 2XKAA 4C7MA 3HSYA 1H85A 5CW2A 1RBMA 2FFQA 1M8PA 4R7TA 4UHCA 2JBAA 4UVEA 3WC4A 4A26A 4C0XA 3NGLA 3ZJ5A 1NVVR 1U8FO 3CKYA 4EGCB 2X2OA 5FB3A 4B6QA 2IT1A 1DRKA 4EDFA 5DBIA 1L8OA 1PR0A 5LYJF 1PZMA 2P6MA 1C4OA 4B5LA 3L6CA 1QRRA 4O08A 3ZD7A 3IP3A 4NZPA 3WL8A 5AW6A 5FQOA 1ORWA 4O4HB 2BCJQ 4R9UC 4JBWA 1RJEA 4D9KA 1DEAA 4PSAA 1CE8A 1LY1A 3PC6A 4B74A 3DG9A 1T43A 5F52A 1Q77A 4JP1A 3EMBA 5HG0A 3FTEA 4JELA 1H4SA 3GJ6A 4CLOA 4IIJB 3L1HA 4MVJH 5DF1A 4QOHA 4DV2B 3OQOA 3FCYA 1NX9A 3H5TA 4PU0A 4DLVA 3G0OA 4JJZA 4G26A 3I62A 1UMKA 1LLUA 1TPYA 3LPLA 3NBXX 4OHMA 4O2BA 1Y9DA 2IY9A 3HKBA 1C7EA 3QX7A 3R0XA 4RFLA 1I3OA 4YMGA 5KVSA 2A94A 2A0XA 2YHIA 4WN9A 2WIFA 3AL3A 3HN6A 4KWCA 4RZUA 2QRUA 2OXEA 4J4HA 1LW7A 3OBBA 2ISQA 1F6BA 2RBKA 4U7GA 1SOMA 4NBKA 3IP5A 4H60A 1KARA 3KNZA 1YO6A 1C1DB 1NQ5A 1H2XA 4ZTZB 2CZQA 4K9NA 1ATIA 4BNGA 3NHZA 4E11A 4XWWA 3DPIA 4BN5A 4X7RA 1E64A 2PX5A 4Q9LA 1C7FA 4BDTA 3RK4A 1XTZA 3COYA 4ENTA 3G5TA 2C9OA 2WJJA 2IPAB 3D7LA 2BN4A 4F7DA 4R6XA 2PS1A 3HI4A 4QYTA 3SICE 6PFKA 1AHHA 4K6MA 4G56A 1HTWA 3TLGB 5FBZA 4QPZA 3ZYCA 1KEVA 1V16A 4OQNA 1VC2A 1WUJS 2X23A 1UXHA 4JWKA 3MRVA 1VL8A 1RU3A 2QY6A 3OECA 1MRSA 5E6UB 1JQJC 4TV8A 2JIPA 2GSWA 4V3CA 5A2QA 3D4BA 3GUZA 3PG5A 1OPRA 1NW9B 1TQ4A 5EIFA 1ZP6A 3DDUA 3QW4B 3U09A 2DXIA 3MHTA 5DI3B 2QD2A 4D44A 4E13A 5GJCA 4AZ0A 2QTWB 5I7EA 3CF4A 2PZBA 2NO4A 2KS6A 1MOSA 5L3QB 1XIVA 2P6UA 4LY3A 3K9WA 4Q12A 5IC6A 2BY4A 3F4LA 5KOIA 3AKDA 2R85A 4GQBA 2IZ5A 4YCAA 4ECEA 1UBFA 3WYGA 5INTA 4L8LA 5TQ0B 3VZSA 2PGIA 2NU9A 3HL0A 4HEA1 3GRUA 1Y34E 1IONA 4QFCA 5J59A 3T5TA 4D4IA 4DR4B 2D1FA 5JS1A 5KX5B 1LCIA 3L7MA 4XASA 1MJFA 2P1ZA 4W1PA 4XYEA 2WQZA 2XT0A 4Y9DA 2WYHA 2W58A 3DZDA 4RH3A 2G36A 2DUWA 3W6ZA 1MXFA 5E6SB 1WMFA 3P19A 4EY5A 5LQUA 2O3JA 4JIMA 4OB7A 4EFNA 4HVCA 2VT3A 1NQVA 5FBRB 3G17A 3SQLA 5JCXA 3K70D 1JJBA 1RLMA 2GTHA 5FLYA 3KXLA 1CRWG 1YE5A 2FSPA 2XIJA 3QVGB 4TMXA 3WO1A 3BMOA 3G8DA 1T9CA 5FUXA 1PK8A 1KMQA 4YT5A 1E3SA 2C1EA 3OWOA 4ZANA 1KK1A 2PIAA 3VHXB 5KUTA 4WVLA 5K6AA 4H7PA 5E2IA 4HWKA 5ILGA 4CLXA 4ESVA 2H1OA 5EUQB 3C3KA 2QT0A 4RKWA 4YRQA 2JZNA 5BWCA 2OC4A 2FEWB 821PA 1QFZA 3U4QA 2OORC 5ICEA 2WBLC 4R2KA 3UAZA 2EBUA 3PUJA 1IVYA 2OE2A 3DMRA 4KVGA 1EB9A 3DEZA 3MMXA 3RVMA 2EKLA 4FNGA 4WA8A 5AKYA 2BKVA 4AO7A 3R9WA 1N0WA 5E7IA 5KDDA 2O23A 4JT8A 5EHXA 1T10A 1GN9A 2CWWA 1XKXA 2J4FA 4QGBA 2WM8A 3LIIA 4OK5A 4P98A 1GL3A 4G97A 1R2QA 5BN5B 3BWVA 3MD9A 3NDJA 1O6ZA 1CNMA 5ENZA 3W9UA 4A2PA 1N8NA 2Q1UA 2CXQA 2YWJA 1ULTA 3OM1A 4YASA 1V5FA 1ZW6A 3OPNA 3LBAA 3RBAA 1YZTA 1W581 3D6VA 4OBEA 1SU4A 2ZJ2A 1EGMB 3A2KA 1SG0A 2GMWA 2ZEJA 3JVIA 5BMVB 3R5FA 2WYOA 1IN8A 1DRJA 3LQ4A 1ENOA 1FFHA 2UXDB 3QWAA 4LCJA 1UMBA 3K2IA 2WAAA 2CDCA 4AUKA 3BE8A 1KTIA 4KIGA 1CQWA 1EK6A 5KTTA 1N2OA 4PG6A 2RBEA 5HFAA 2F8SA 3VZCA 1V95A 2BE9A 3ECCA 2V7VA 2HOQA 1N9KA 1AA9A 3Q15C 2HSGA 4HHEA 2IF2A 5HOEA 3SCZA 4QU8A 2Z3WA 3D7SA 4MKGA 1JJVA 3CEAA 2Q4EA 4IHQA 3CY6A 1DX4A 1AUOA 4BZPA 1KO7A 4TM8A 3VTAA 1AM4D 1K4KA 2MMCA 3EXG1 3IPLA 2VKTA 3KSZO 4YH1A 5IAJA 5BRJA 4PLTA 4HNTA 2QA5A 3PHHA 3IE1A 1TVCA 4FM9A 1WX1A 2DCMA 1RVV1 1TM5E 5L9AA 1OBHA 1E5QA 1HQKA 2JRLA 3FPCA 4IQFA 4L0MA 2CNDA 3IVMA 3PVSA 1QCYA 1C2TA 4O2AB 5A6SB 4PG8A 1EFHA 1X1RA 2D4AA 1QRTA 2BFOA 3JD3A 5K0JA 4AJEA 1H0KA 4RPIA 2FSUA 2FFJA 5JXHA 1UPFA 3E70C 5H8WA 1USKA 2D7CA 3IUNA 4QNRA 2ZT6A 4CHTA 2N9UA 3TDKA 1FNSA 1LF0A 4CNQA 3E8SA 4WZBA 4FOOA 4D2IA 4MAAA 4UUAA 2OQ2A 4XWYA 2P11A 4OHKA 4IV8A 4LVCA 5F64A 3KR2A 4AQDA 1QH0A 2BFNA 2EDAA 2YHIB 3CTPA 3B89A 2HEGA 5TEWA 4HWOA 1G7SA 5F51A 1IXSB 5JS2A 2IDKA 4AAYA 1Z39A 3K8QA 3BTVA 4U0KA 1J1ZA 3QMPA 4HDNA 2Q99A 4ZALA 4DEVA 4DADA 3EEIA 4MPDA 1AF7A 3MGKA 1PR1A 3NTQA 4FDTA 4R01A 4TWZA 3ZV5A 4D6XA 1NBMD 3JU3A 1VMKA 1ZICA 2P2LA 1PR5A 2WEKA 5EHQA 2ETVA 4HUQB 1BMQA 1BXRB 5EVCA 2HRBA 5FADA 3V00A 4C4PA 1GPDG 5DWDA 3TOZA 5DGCA 1J9EA 3NBAA 4YEDA 5CW1A 1N5OX 2VUIB 3NOQA 3PQ8A 4IRMA 4W9RA 4BHTA 2OKCA 5DSTA 521PA 4BV2A 1RQLA 3JXEA 5KVAA 2YXBA 3IB6A 3UAYA 1L7AA 4ARCA 3E1KA 1YR3A 2QBYA 5EEGA 2ILTA 1P2TA 3LK6A 4MV4A 2RD2A 3H9QA 4D3DA 4KQ2A 4GBJA 3NNDA 3W9SA 4FEYA 1WSAA 4UM7A 2W2MA 3K1JA 3SE0A 1D6SA 1ZA2A 1SHZA 2C83A 1X1TA 1A8HA 1DL5A 2HF8A 3TFQA 2K7FA 3M5CA 4II3A 1N6IA 3AFHA 3E7XA 3NYQA 2DPHA 4HPWA 4JLUA 4MB0A 4DNFA 4UMEA 1ISHA 2C7PA 3PEYA 1QGZA 3AP3A 2F3PA 4O59O 3DO8A 5TMPA 3OZFA 3EIOA 1RXEA 5CG2A 5THQA 3JQRA 4IIGA 5C1PA 2RE8A 2A9JA 4F6LA 3HSSA 4QOJA 2NOAA 4TLMB 5CXXA 2XXAB 5SICE 5AW2A 4MWDA 3ZLTA 1OIVA 3LY8A 5FAXA 3PZBA 4O02B 3HLYA 5EP3A 2V1XA 4FDMA 5SZKB 3BJEA 4KGXA 2YMPA 4ITVA 2XB2A 1INLA 3EDMA 2YBDA 2LWIA 2QAGB 1TCBA 1XTUA 2VP6A 5D51S 3CZMA 3D8NA 4ER0A 1U7DA 3FAKA 1E1CB 1CX9B 1NXWA 2HA7A 1XHFA 2VJQA 3F9RA 5GJVC 1TTTA 5JPDA 3PQ5A 1ZGBA 2GS9A 1SQFA 4OLJA 4RTQA 4LNUB 4ZOCA 2V1UA 1C9DB 3DTVA 3KUCA 4Q37A 1O0SA 2AXEA 3OPQA 1IOVA 3HZHA 1IHOA 2Q6OA 2JANA 4JA0A 1O6FA 4PLHA 4B3XA 1LJLA 4XJTA 1NNUA 4QYMA 3A1DA 3KSMA 4KBFA 1U2GA 3IV6A 4OUDB 1XQ9A 4LZOA 3NEPX 3NUQA