2J6KA

N-terminal sh3 domain of cms (cd2ap human homolog)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
b'VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2-ASSOCIATED PROTEIN
molecule tags Protein binding
source organism Homo sapiens
publication title Atypical Polyproline Recognition by the Cms N- Terminal SH3 Domain.
pubmed doi rcsb
total genus 11
structure length 57
sequence length 57
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2j6kA00
4RTXA 5I11A 2EGAA 1X2QA 2DL3A 1RLQC 2PZ1A 2BZXA 4Z8AA 2BZYA 1UUEA 2EGCA 2DE0X 1M3AA 4HCKA 1CKAA 2CSQA 1MUZA 2JS2A 2ROTA 1GFCA 1GCQA 1QWFA 4LUDA 1K1ZA 2KT1A 3VS0A 1VYVA 2X3XD 1G83A 2CH4W 2KBTA 1UHCA 4ORZA 2X3WD 1ZUKA 4RTYA 1PKTA 1A0NB 2FPDA 1QKXA 1WIEA 2HBWA 1ZUUA 3NHNA 3RBBB 1PNJA 1AZGB 2D8HA 5L23A 2W10A 3EG1A 1ZBJA 1U5SA 4RTZA 1K0XA 2RQWA 2DJQA 4RTWA 1QWEA 1WXUA 4JJDA 3KFVA 2HDAA 4J9GA 2DBMA 1FMKA 1X6GA 1T0HA 2O31A 2HCKA 1GRIA 1T0JA 1M30A 1CSKA 1TG0A 2OAWA 4DEXA 1I07A 1IO6A 3M0RA 1LCKA 1N5ZA 2A28A 2O88A 3TVTA 4AG2C 2B86A 2FRYA 5GJWB 5IHKA 2J6KA 1SRLA 4GLMA 2JS0A 2OI3A 1B07A 1ABOA 1KFZA 2MOXA 4AFSC 2LJ1A 2K7AA 4F16A 2EKHA 4CC7A 1E7OA 2HSPA 2CUDA 1AVZC 2W0ZA 1KSWA 4K11A 1BB9A 4OMOA 2EGEA 2CT4A 4CC3A 2AKLA 4OMNA 2FPEA 3EGUA 3M0SA 2L0AA 3PE0A 4LUEA 1NG2A 1UTIA 1E6GA 1VYTA 2LP5A 3SEMA 1GBQA 4HVWA 3I9QA 4Y92A 2O9SA 1KJWA 1X69A 4LE9A 1GBRA 1GCPA 3NMZC 4J9EA 2CSIA 2LMJA 2GTJA 2KEAA 1X43A 4JJBA 3VS2A 1I1JA 2ROLA 1UDLA 1ZX6A 2FRWA 2L3SA 1Z9ZA 1GCQC 3VS6A 4M4ZA 3M0TA 3NGPA 2DILA 4Z88A 4RUGA 1HD3A 4KRTA 4IIOA 3H41A 4QT7A 5IXFA 2JM9A 4GBQA 1SPKA 4JJCA 2EYWA 2L3PA 3EG0A 3H0HA 2VVKA 5GJVB 2YSQA 1OPKA 2J6FA 1XOVA 1YP5A 4Z89A 3QWXX 2BTTA 3PVQA 2PTKA 4RTTA 1PRLC 3UA7A 4WCIA 4CC4B 1EFNA 4J9BA 5ECAA 3THKA 2V1RA 2RQUA 1SSHA 1UJ0A 2DNUA 5IHNA 2JXBA 1UFFA 1K76A 2VKNA 1K4US 3TSZA 2C0OA 1QCFA 1RLPC 2K3BA 2CUBA 1JEGA 1ZUYA 4HVUA 2XMFA 2LZ6B 2DL8A 3ULRB 3M0UA 1WXBA 1WXTA 1U06A 1X2KA 4RTUA 1PKSA 2DVJA 1H8KA 2GBQA 2C0TA 1AOJA 2IIMA 2LNHB 3VRZA 1UGVA 2AK5A 2FG0A 1WFWA 2EYXA 4RTVA 1FYNA 4AFZC 1PRMC 2DL7A 3PVLA 1G2BA 2DLPA 3VS4A 4A63B 2EPDA 1YWOA 2M51A 3M0QA 2J05A 2DX1A 3A98A 1Y57A 1WDXA 1SHFA 2LCSA 3UATA 1RUWA 2A08A 1MV3A 1U3OA 2JT4A 4FSSA 4D8KA 5IH2A 1AWXA 1Z9QA 3NPFA 1W1FA 2GQIA 1GL5A 1AWJA 2RNAA 2OJ2A 2LQNA 2BZ8A 1NLOC 4EIKA 1AEYA 3I5SA 4JPBW 2EVRA 1M8MA 1JQQA 2KNBB 2G6FX 2DL4A 4OMPA 1GFDA 2DMOA 1T3LA 2D0NA 2A37A 1RI9A 3M0PA 2ABLA 4CC2A 1M3BA 1WX6A 2YDLA 1NYFA 2KR3A 3VS3A 1YN8A 3VS7A 2LJ0A 1HJDA 1AWOA 5IXBA 1X27A 2FO0A 2KRSA 4J9IA 2DL5A 5I22A 2DRMA 2RPNA 1ZLMA 2AKKA 3CQTA 2EW3A 1AZEA 2F2VA 2KXCA 1CKBA 1VA7A 1NLPC 2KT8A 2A36A 1WI7A 3REBB 3UF4A 2GNCA 3H0IA 1ARKA 2EYYA 4DEYA 1X6BA 3VRYA 2YT6A 4F17A 3JV3A 1WLPB 2GTOA 2F2XA 2K2MA 2KROA 2DBKA 3FJ5A 2J06A 2PNIA 5FWBA 1OOTA 2K79A 1K9AA 2KYMA 2ENMA 5FW9A 4OMQA 1JXOA 1H3HA 3UA6A 5HCKA 2ECZA 2YUOA 1QKWA 4LN2A 3I35A 1OV3A 4E6RA 2QDLA 3IQLA 1TUDA 1QLYA 3RNJA 2O2OA 1W70A 1SRMA 1BBZA 2CH4A 2FEIA 2YUPA 3C0CA 3I5RA 2EYZA 1SEMA 3TSWA 1ZSGA 2DM1A 4F14A 2J6OA 1YNZA 2AZVA 2VWFA 3QWYA 1H92A 1BK2A 2JMAA 2CDTA 3EHRA 1JO8A 2KGTA 3REAB 2H8HA 4R0KA 2CT3A 4IIMA 1V1CA 2EBPA 2M0YA 2KYBA 2V1QA 2I0NA 3H0FA 1NEBA 1NM7A 2C0IA 2D8JA 2O9VA 2RQRA 1E6HA 2NWMA 4ESRA 1UECA 2KE9A 5EC7A 1WYXA 1UHFA 1UE9A 3VS5A 1WA7A 2SRCA 5IHIA 1B3QA 1PHTA 2ESWA 4OMMA 1PWTA 1OEBA 2JTEA 2MIOA 2JW4A 2K9GA 4HXJA 2DF6A 3GBQA 4OMLA 2P4RA 3EHQA 4J9CA 1KIKA 1HSQA 2J7IA 2DA9A 2KXDA 2LQWA 1OPLA 4LNPA 5FWCA 2KRMA 1YCSB 1BU1A 4J9HA 2DYBA 2CREA 1UG1A 2YUNA 3VS1A 2EQIA 1AWWA 2KRNA 4AG1C 1VYUA 4AFQC 2RN8A 2FPFA 1JU5C 1ABQA 1M3CA 3EG2A 4HVVA 2SEMA 4JZ3A 1NEGA 2HEQA 1T3SA 1YWPA 2L2PA 4X1VA 3SHWA 1JXMA 2RMOA 2GGRA 1M27C 1TUCA 2K6DA 1Y0MA 2ED0A 2ED1A 2RQVA 4JZ4A 2JMCA 1NYGA 2L3QA 4J9DA 2E5KA 1MV0B 2LJ3A 1AD5A 1I0CA 1W6XA 3O5ZA 3LH5A 3U23A 1UJYA 2DRKA 1S1NA 4J9FA 2RQTA 2NUZA 2JM8A 2LX7A 2F2WA 3R6NA 4D8DA 1J3TA 3EG3A 2D1XA 2YUQA 2MCNA 2RF0A 3ZL7C 1K0SA 4AFUC 1SHGA 2AZSA 4ZNXA
chains in the Genus database with same CATH superfamily
3DKMA 4HKEA 5KCHA 3E9FA 2DL3A 2F5TX 2BZXA 4PJOD 4ELYC 3JB9F 1OQKA 2CSQA 2JS2A 1GCQA 1QWFA 3CMEA 4IUUA 2KT1A 1B34A 4JLGA 1VYVA 2CH4W 4ORZA 1ZUKA 3Q1JA 2NUTA 1KG1A 1A0NB 4E7JA 2EWNA 3ME9A 4LDUA 4C8QE 5KYNA 1JRIA 1PNJA 5KYXB 4PFOA 5L23A 3META 1SG5A 5FRMA 4RTZA 2RQWA 2DJQA 5GAN4 5GANd 1WXUA 3FIFA 1RADB 1N9RA 1BCOA 4J9GA 1Y7XA 3JB9G 2DBMA 1X6GA 1NJIU 1GRIA 1V29B 4C5IA 1VQ4A 3CCRA 4DBFA 2DZCA 4DEXA 1IO6A 2O88A 1N5ZA 3M54A 3FC3A 3VYHB 3CMAQ 5IHKA 3G71T 2RJEA 1SRLA 2OI3A 5J3BA 1ABOA 1M1GA 1M9SA 4OB3B 3GNGA 2E4HA 2AKLA 1X75C 4DA4A 4OMNA 3G1JA 3RR6A 1YI2T 3EGDB 5CVIA 3SWNC 2FHDA 5LJ5f 3CCVQ 4E7KA 3EG9B 4BACA 4LE9A 1FMWA 3E9GA 4A4GA 2QGGA 2QI2A 4JJBA 2ROLA 2YWWA 2DK3A 3HSBA 1W2BP 3VS6A 2DILA 2GQVA 1TWBA 4BB7A 1VQ8A 1PD0A 3RIRA 5IXFA 2JM9A 5KYWA 4JJCA 3I55T 1ZSZB 2EYWA 4MZPA 3H0HA 2DTOA 2MMPA 3BE3A 1IB8A 2LX9A 2E41A 4P5NA 3CMET 1H3ZA 3PVQA 2E5QA 2KQWA 2PTKA 3HKSA 3UA7A 4CC4B 1C1AA 1UJ0A 2K3XA 1BI2A 1M2OA 2C0OA 4HCBA 1QP3A 2K3BA 4II1A 3CCLQ 5HK3A 1JEGA 3QXEB 2V8IA 3GNFB 3JCMX 1XNIA 2P0PA 1U06A 4M7AB 4C8QC 4WTOB 3CCRT 4IUTA 1PKSA 3D7SB 3LW5E 2EYQA 2DVJA 2GBQA 2RO0A 4J8OA 5IAYA 3M5AA 5AT1B 4F7UB 2YRCA 1WFWA 4XTUA 4FYYB 1PRMC 4HCCA 4BE0A 2LVMA 1OZ2A 3FB9A 1YJNQ 1JBMA 4A63B 5KYWB 1YWOA 3HFNA 2C06A 3AHUA 3M0QA 1VQ9T 1VUBA 6AT1B 2DTIA 2HBPA 1SHFA 2LCSA 3UATA 3I55A 3J80E 1K9MR 4FSSA 5IH2A 1AWXA 4DBHA 4D6WA 1KQ1A 3UWNA 1GL5A 2LQNA 1D0ZA 3EGDA 4M75A 1TXQA 4XTVA 5I2SA 1I8FA 2CYZB 3RUXA 2DL4A 1D1CA 1NPRA 2E10A 2D0NA 1N6AA 1VQ9A 4CC2A 4FYXB 5KCOA 2YDLA 3MHXA 4JRPA 1NYFA 2DFUA 1Q81R 2KR3A 2KY9A 2HD0A 3VS7A 2LJ0A 1LPLA 1X01A 2PVDB 4GLKA 3ZFJA 4KULA 1YJWQ 1WJSA 5I22A 2V8JA 4ME7A 2AKKA 3CCUA 1D1AA 1BYMA 4JUVA 1WZOA 3L2VA 2QAZA 1VA7A 4DOWA 2KT8A 2DD5A 3UF4A 2GNCA 1WHKA 4LXCA 4PFZA 1UGPB 4MDWA 2NUPA 2YT6A 4C5HA 2GTOA 2MPXC 2FZCB 5CKBA 3X20B 1MMGA 4BI3A 3OSVA 1K9AA 1MMAA 4C5GA 4M7DD 2ENMA 5FW9A 2HAXA 1JXOA 3UA6A 2QQSA 2LNVA 4E2FB 2MF2A 4Y28E 4IUPA 3EGXB 3HRUA 2QXFA 3CC4T 2YUPA 4OMFB 3M53A 2PUKB 3EAEA 3LYIA 2EYZA 2ZAEA 2DM1A 4F14A 2J6OA 3EFOA 3SWNB 3OYKA 2CKKA 3CCMQ 1VQKT 3OBYA 4MMKA 3VU3C 3V8JA 5FU7B 5LJ5h 4R0KA 2GCXA 4XU1A 4C0DC 3CMAA 2M0YA 3BW1A 4C8QA 1VQLQ 3H0FA 1WNLA 1VQ6A 5GAMh 1N8RR 2DD4A 5C0MA 2O9VA 2RQRA 1PSFA 4FL6A 3JCMc 2DEUA 3RMSA 5GAOn 5KYUA 2NWMA 1WYXA 2OTLA 2IPOB 2DZ9A 1UE9A 5IHIA 2MK5A 2BE7D 5CKDA 2D6FA 4C0FA 1OEBA 2RA2A 1YI2Q 1RI0A 4HXJA 1VQPQ 4EMKB 3OW2A 1RABB 3GBQA 2OTJT 1G3YA 4J9CA 1QMCA 2DERA 1MNDA 2VASA 2JN0A 2OAUA 1N8RU 4M7AE 5GMKj 4XTXA 3OYGA 4QVDA 1YCSB 2EJFA 4J9HA 2YUNA 1UG1A 1M2VA 4M77A 5GAN2 4AG1C 4AFQC 3JCMW 1M2VB 2K2VA 2KI7A 3VUBA 2FYKA 1VQOT 2COZA 1PSEA 1FX7A 2FPFA 1JU5C 1QVGA 4PJMA 3EG2A 1KK7A 4XTZA 4M78A 1JJ2S 4RMOA 1NEGA 2HEQA 2CZ0B 3QDFA 2LQKA 2DXCA 1ZHIA 2LT1A 2LRQA 2GGRA 1PCXA 3M4YA 4ZN3A 1NYGA 2L3QA 2NYSA 2HNIA 3OQ5A 2G3RA 5CQYA 1AD5A 4C0DB 1VQOQ 2DXTA 3OYFA 1YJ9T 4J9FA 3JCMP 5KYUB 4JS4A 2F2WA 3CEYA 4F7UG 3EG3A 3RKXA 1I81A 4HT9A 4C0GA 4N4GA 2RF0A 3ZL7C 4AFUC 3A8MB 1SHGA 2CP5A 1C0MA 1X2QA 1VQKA 4J7FA 3QO3A 2A7YA 2RJCA 1YBYA 4Z8AA 3JCMb 4X9CA 2XICA 1M3AA 2O4XA 1CKAA 4ZGJB 2LT4A 5LJ3d 3L2RA 5FROA 4PFPA 1WGSA 3QSUA 2HQHA 3CCEQ 2KBTA 2BIVA 1WHLA 2FPDA 3EFRA 5GANj 3RBBB 3GPLA 5LL6S 4NL3A 1EIFA 2JNGA 2KVQG 4XU0A 3T9NA 4JJDA 5KE3A 3OYNA 3MEAA 3KFVA 2HDAA 1Q82U 2DIQA 1Q81U 8AT1B 3RKWA 4KUDK 4BDYA 2FL7A 1TG0A 3MP6A 2AHJB 3SDZA 3CXCA 2GF7A 3M0RA 1LCKA 1U8RA 3M58A 1K8AU 1GXIE 2B86A 2FRYA 2CS7A 3CCJA 3CC2Q 4GLMA 1X6OA 3X24B 2X4YA 5GAOl 4DQ2A 4E7SA 5A0DA 4LD6A 1K9MC 2EKHA 1MMDA 1AT1B 2CUDA 5CCAA 1ZA1B 4IKFA 1VQ5A 2EGEA 2CT4A 1OYXA 4CC3A 2ATCB 4KH1B 3F70A 4C92A 2FPEA 2DEQA 2L0AA 3M0SA 1NG2A 1VYTA 4M77G 1VQLA 2V26A 1OI1A 1PD1A 3I9QA 4OGCA 3CMAT 2O9SA 1QVFP 1X69A 1K73U 3CCLA 3MEVA 2HKQB 2CSIA 2GTJA 4C8QB 4M7AC 5IN1A 1UDLA 1XJWB 1ZX6A 3X26B 2MYSA 2VXEA 4M75B 2D0QB 2LCCA 4XAXB 4RUGA 2EFIA 3CXCS 5FU6C 3WXMB 4QW2A 1VQNT 1YIJT 1YI2A 3CC2A 3SWNA 4N0AA 2VVKA 2J6FA 3CC2T 3CXCP 1V76A 3QWXX 5LJ3e 1XTDA 4RTTA 4MDXA 1PRLC 1EFNA 1UB4A 1NPPA 3C95A 1UFFA 4EMKC 1K76A 3H6ZA 3I55Q 2VUBA 5GMKe 1VIEA 3ULRB 3M0UA 3M57A 4HA8A 3CCQQ 4FYVB 4RTUA 1O75A 2ZPFB 3HTRA 5GMKm 3LH0A 1VQLT 3BY7A 1G3SA 2C0TA 3WVDB 1Y71A 1AOJA 2IIMA 2LNHB 2EQKA 2R5AA 3VRZA 5LJ5j 1UGVA 4OGEA 2YRVA 2AK5A 4R55A 2QTXA 5GAOq 1FYNA 3OYIA 1S72A 3I56Q 1VQMT 1G2BA 1OULA 3UT1A 2DLPA 4M75F 3BDLA 4EDUA 3OB9A 1VQ7Q 2EPDA 1YJNT 1VQ9Q 3PIPA 5GAMg 3EFOB 2DX1A 4PJOA 3QKJA 1WDXA 4JJNK 5LJ5g 3RERA 1M4ZA 1U3OA 2JT4A 3C94A 1YJWA 2BKDN 1Z9QA 4C92G 3JCMJ 3A5ZB 3NPFA 1YJ9Q 3OS5A 5FLXE 2RNAA 2OJ2A 4M75E 2EIFA 3QJYA 2L5QA 2PU9B 1SKUB 5GAMj 1M1KR 1VQNQ 1AEYA 3JCMd 3FLGA 2EVRA 1M8MA 3OYEA 3GP8A 5J26A 1KHIA 2G6FX 4LDXA 2DMOA 3CCQA 5GAN8 3M0PA 2DJZA 5D7UA 1BIBA 1R77A 3QZ5B 1M3BA 2JOYA 4KUIA 1TTHB 4PK4A 1K73R 1FXXA 1YN8A 5EG2A 5FRNA 1HJDA 5IXBA 1X27A 1MNEA 2EJ9A 3FDRA 3TU4K 4EMKA 2H3EB 2KRSA 3RDVA 3M4GA 4L5GA 2DRMA 3ER0A 1ZLMA 3CC7Q 3CQTA 3OS2A 1AZEA 3V7CA 3CCVA 2KXCA 1BIAA 1IXDA 4IUVA 2IG0A 1YITT 2A36A 3S6WA 2MWOA 3H0IA 3MJXA 1Y07A 2WSFE 4DEYA 2P0KA 3KUFA 1QVFS 2RK1A 3CMEQ 2ZPGB 1YJ9A 2K2MA 2AIRB 4RCCA 2KROA 1MMNA 3FJ5A 1Q86C 1KD1U 2RHUA 1OOTA 3JCMQ 2K79A 2Y90A 2P4TA 1Q95G 1QVFA 1LJOA 1H3HA 2ECZA 3CCST 3JAME 1OV3A 3QYGB 1PG5B 4X34A 1U1SA 5I21A 3V8LA 2FZGB 5CKEA 2O2OA 4M7DB 3I5RA 1BBZA 2CH4A 2FEIA 1HXDA 1UEBA 3TSWA 1VQOA 4AT1B 1TS9A 4PJOF 4JRQA 2RI3A 1ZSGA 1VQ8Q 1R0BG 3EGXA 1VOMA 1YNZA 1M90R 4PJLA 5C6SA 3JCMf 1H92A 4JDSA 2NLUA 5CAIA 1BCMA 2CT3A 4IIMA 4AMCA 2V8KA 5LJ3g 4E7IA 1V1CA 3GLXA 2KYBA 3O8VA 2V1QA 2DIGA 1EX4A 3NFCA 3S3NA 1NM7A 1JJ2P 3ASKA 3E2UA 4RCBA 3A8LB 2RI2A 1VQ5Q 9ATCB 1UECA 3AT1B 3OMGA 3VS5A 3CD6A 3MP8A 4BE1A 4C92E 1B3QA 2ESWA 1PWTA 4M7AD 2E64A 4M75G 2MIOA 2F1LA 4M75D 3OSSC 1YITQ 2CP7A 4OB1B 3EHQA 3DB3A 2VYTA 4L6V5 3HRSA 1HSQA 2J7IA 5HKCA 4M7DF 2XK0A 4HT8A 1ZSZA 2IVWA 4PJOB 2X35A 3CBPA 2CREA 2EQIA 1Y96A 2OTJA 2KRNA 4FT4A 4EMGA 3FJPA 4M7DG 3CC7T 4BY6B 2RHYA 2RN8A 5GMKi 4CI0C 1N9SA 4M7DC 3PMTA 1PM3A 3G4SQ 4HVVA 3OYLA 5LJ3f 4DOVA 2X9HA 1T3SA 1YWPA 3KXTA 2PUOB 4FCYA 1S72T 1VQPT 2RHIA 2RMOA 3MPUB 4N4HA 2RQVA 2JMCA 1IGQA 1RAHB 5CIUA 2LJ3A 2QEXA 1VQ7T 4KGXB 5CR2A 2GFAA 2K4YA 1RAEB 2DRKA 1M90U 4M78D 3PGGA 3C4SA 3QIIA 3V7RA 2P0QA 2NUZA 5LJ5e 3X25B 2E65A 4D8DA 3VJPA 4MZMA 1I5OB 1RAAB 1K0SA 2QQBA 3L42A 3JRZA 2B8AA 2R5MA 2AZSA 2RH2A 1QVGP 3PNWC 4RTXA 2EGAA 5DLOA 2OTLQ 4F7UA 2PZ1A 4J83A 3EFSA 2QGFB 4ATOA 1UUEA 2DE0X 4HCKA 3P8HA 2DKGA 5GAMd 4M77E 1MUZA 3LGFA 1ZBXA 4UC4A 4OVAA 4M7AA 1K1ZA 4A4EA 3OYHA 2K5LA 3CCMT 4FU6A 3JSCA 3P8DA 1UHCA 2X3WD 4RTYA 1PKTA 3OW2P 1WIEA 2JTMA 1RACB 1YIJA 1YCYA 4MMLA 2XDBA 1ZBJA 1U5SA 1QWEA 1VQ4Q 2DVEA 4OB0B 2K3YA 1RL2A 4QKUA 1FMKA 1H641 1TU0B 4XTWA 4A54A 2LTOA 4FM4B 2COYA 1T0JA 1CSKA 4KGVB 4FW2A 4Z02A 3JCMh 1B34B 2OAWA 1UGSB 3RKYA 2A28A 3TVTA 4BI8B 2JJ9A 3L1AA 2HKNA 1R0CB 2HQXA 2J6KA 2JS0A 4KBMB 1B07A 1KFZA 4AFSC 2LJ1A 2E12A 2CZ1B 2GFUA 2K7AA 2MAMA 4PJOG 4CC7A 1E7OA 2HSPA 1AVZC 3V7SA 1KSWA 4C8QG 4PJJA 1YHQT 1TH7A 4OMOA 1M1KC 1SSFA 4C92F 5GAMf 4LUEA 1G8XA 1E6GA 2QASA 3SEMA 5IT9E 1KJWA 1KQSA 3TCJA 5KH6A 4MZTA 1WHHA 3NMZC 2E6ZA 2QA4T 1X43A 2KEAA 2HL5C 3VS2A 1I1JA 3BDUA 5M9OA 4M78B 4M4ZA 4BE2A 3M0TA 3NGPA 4Z88A 1BI1A 4KRTA 3QHSA 3H41A 5CKHA 2RD1A 1D09B 2DXBA 2NUPB 3EG0A 2PVGB 1YP5A 4Z89A 2BTTA 4FIBA 2E6NA 3G6EA 4OB2B 4WCIA 2OTJQ 5ECAA 1VQ8T 2X51A 2QK0A 2V1RA 2DNUA 5KYYA 3HFOA 2VKNA 1K4US 3TSZA 1DJ7B 1P92A 1RLPC 3A8OB 2DO3A 2X4JA 2NUTB 1ZUYA 4HVUA 1WJRA 2XMFA 2DL8A 4RG8A 3E1SA 4C92B 1OZ3A 4KGZB 3I56T 3JCMV 2COWA 2RHZA 1X2KA 3RMQA 2WSCE 3MCAB 3A8GB 3H9NA 3UDCA 4KT0E 4QQ6A 3URGA 2QEXQ 1D3BA 1QVGS 2KK4A 5LJ5d 4JRIA 1EZZB 2M1HA 2EYXA 4RTVA 2JTFA 4ZGEB 3NTHA 1OU8A 3PVLA 2CZ6B 2VC8A 3VYGA 2M51A 4XU2A 3G4SA 8ATCB 1NJIR 3OBWA 2J05A 3CCJQ 1QCOA 1Y57A 2QA4Q 2YLBA 3OW2S 3G71A 4A4FA 3CC4Q 1RUWA 2Y4YA 1MV3A 4LD9K 2QYZA 2JZ2A 3QYHB 3L2UA 2M16A 1G3WA 2GQIA 1AWJA 1Q7YC 2ZZDA 2CP6A 1NLOC 4EIKA 5GAN7 4JPBW 1OX9A 1SF9A 4OMPA 4A53A 1T3LA 4NS5A 4JLIA 2ABLA 1M5Q1 1RAIB 3DB4A 3CPFA 1WX6A 1VQNA 2BUDA 5LJ3h 1UGRB 3NTIA 1K8AR 4PLIA 2X4XA 3HRTA 2JUFA 3M56A 5CKFA 4XQ3A 3EH1A 2DL5A 1PC0A 1WHMA 1M90C 1VQ6T 3LLRA 2RK2A 1C6VX 2QA4A 3JB9H 3CPWS 1TUGB 4LDYA 1CKBA 2EQJA 1VQ4T 1WI7A 3OS1A 3OYCA 3OYYA 4N0AC 5I2MA 1QQJA 4IURA 1ARKA 1YFNA 2EYYA 4F17A 1G5VA 3JV3A 1WLPB 1BI0A 1LOJA 3FRNA 3MKDA 4BY6C 4C8QF 2F2XA 1W2BA 2L3RA 3RESA 5CQXA 2O01E 4Q5WA 2K5IA 2KYMA 2VGMA 4BI4A 1HK9A 3CCSA 5HCKA 2YUOA 1QKWA 4LN2A 3I35A 4EMHA 2HQEA 3CCRQ 1U1TA 2QDLA 3IQLA 1XQHA 1TUDA 4PKCC 3CD6T 3CBOA 2ZPHB 3SD4A 4M7DE 2M0OA 2P84A 2XU8A 1SEMA 2X4WA 4O6JA 4QVZA 4YTLA 3G6EQ 2JVVA 2AZVA 3OY9A 1MHNA 1BK2A 1Y96B 2DTHA 2L89A 1IRXA 2VXFA 3EH2A 3VUZA 1KD1C 3CCET 3L2QA 3TEEA 3L2WA 1NJIC 1QW1A 1YIJQ 5D6XA 2F5KA 2R58A 2ZCFB 4M7AG 2YHTA 4PL6A 2QQAA 4FYWB 1NEBA 4C0ZA 1M1FA 5A2QE 3WVEB 1YHQQ 1E6HA 1YHQA 1Q7YR 5GAN3 5EC7A 1UHFA 4Y91A 2DXUA 3N5BB 3VKIA 5HK0A 5CO7A 1KC8R 3HHTB 2QQ9A 3QBYA 4J6YA 4M77B 2JTEA 4NL2A 2E1HA 3S3OA 4X9DA 2JW4A 2K9GA 3QZ9B 1K9MU 4KH0B 4HCZA 4OMLA 2DETA 5KYXA 2P4RA 3CD6Q 4EPCA 2KXDA 2LQWA 3HL8A 1NBEB 1OPLA 4LNPA 5FWCA 2RJFA 1R8OB 2QQRA 1BU1A 3VS1A 2HSEB 2YXYA 2M9UA 2VV5A 3G7ZA 5GMKh 2EQMA 1M3CA 2SEMA 2HMAA 7AT1B 4M7DA 2L2PA 4X1VA 2E3IA 3SHWA 4CRIA 1JXMA 5DY9A 1FMVA 1M27C 1TUCA 1ZA2B 3CC7A 1B7TA 2ED0A 4C92C 3CCMA 2OTLT 2RHXA 4J9DA 5DLQE 2E5KA 1I0CA 1WQ7A 2LDMA 3O5ZA 2FB7A 3U23A 1UJYA 5LJ3j 1S1NA 1VQKQ 1BKBA 1M1KU 4A4KA 3LX7A 1KQSP 2D1XA 2XG8D 1Q86U 5HY6A 2MCNA 4M7AF 4M77F 1KQ2A 3QG1A 5GAN6 3CPWP 4QQGA 5I11A 3OYDA 1KQSS 3GF5A 1RLQC 3OYAA 4LDWA 2YLCA 2BZYA 2EGCA 4F7UF 3CCUT 4PLLA 4FT2A 4JRKA 2ROTA 1GFCA 5GMKl 4LUDA 3VS0A 2X3XD 1G83A 4PJOE 2XKOC 3DLLA 1VQPA 1QKXA 2HBWA 3SB2A 1ZUUA 3E19A 3NHNA 3CCSQ 1Q82C 1AZGB 1I5LA 2D8HA 2D9TA 3JCMe 2W10A 3EG1A 1VQMA 1K0XA 3EG9A 4RTWA 4F7UE 3JCMg 3PMIA 3OYJA 3GIBA 5J39A 2CZ7B 2KMTA 1T0HA 4J7IA 4PNOA 1YJWT 2O31A 2HCKA 1M30A 4ANJA 2XI9A 2Y4XA 1LNXA 1I07A 4JS5A 3LWHA 3PT9A 2VGNA 4AG2C 4C5EA 5GJWB 3TQ7P 2K57A 4VUBA 1WHJA 2MOXA 2QTVA 4GY5A 4F16A 5L8RE 1VQ5T 1I4K1 2W0ZA 4J6WA 4ZN1A 1NZ9A 4K11A 2XDPA 1BB9A 4M78G 2CP0A 1D0XA 1JB0E 3FEOA 3R6OA 3EGUA 3PE0A 2BE9B 1LVKA 3PFSA 3DLMA 3L2ZA 1RAGB 3QDRB 1UTIA 1VQMQ 2LP5A 1BI3A 1GBQA 4HVWA 3HP9A 4Y92A 4N4IA 3OMCA 5DM7R 4M78C 3CCUQ 4OF1A 1GBRA 3QJ6A 1GCPA 4J9EA 2FZKB 2LC4A 2LMJA 1K8AC 4DBQA 2FRWA 2L3SA 1Z9ZA 1GCQC 3LWIA 4B6MA 3G6ET 1IHWA 5GAN5 1NE8A 2I2LA 3J81E 2A3LA 1WQWA 2RJDA 1HD3A 4IIOA 4QT7A 5AYFA 3QUIA 4GBQA 1SPKA 3G4ST 2XDDA 4J6XA 2L3PA 1OU9A 5GJVB 2YSQA 4BDZA 1QCNA 1OPKA 2LQ8A 3CCQT 4J5YA 1XOVA 3NTKA 1S72Q 3TREA 4NOYA 4J9BA 2E3HA 3THKA 2DAQA 2RQUA 1SSHA 5IHNA 2JXBA 5GANh 4O5VA 4TVRA 3CCLT 1QCFA 4RKUE 2CUBA 2LZ6B 2CGHA 1WXBA 4M77D 1WXTA 4ZTJA 1Q82R 3A8HB 5D6YA 1H8KA 2QDYB 4QVCA 1K73C 4A4HA 4M77C 2FG0A 4AFZC 2DL7A 3OS0A 4PJNA 3JB9I 1KHCA 4OP0A 3VS4A 3CCJT 3CPWA 2CP3A 2ZPEB 2ZGWA 3A98A 3S3MA 3X28B 2A08A 5FU7C 4R56A 4D8KA 1VIFA 1W1FA 2EJGA 1D0YA 3H8ZA 2BZ8A 1OX8A 2XD0A 2CP2A 5GANg 3I5SA 1JQQA 2KNBB 1GFDA 2K5FA 1KC8C 2A37A 1RI9A 2EKOA 2E70A 2MI6A 2WSEE 2PQWA 3C12A 1YJNA 5GAOp 3VS3A 5GAMe 1ZSZC 5A0LA 4BUGA 1AWOA 1JJ2A 4XTYA 2FO0A 4J9IA 4IUQA 1IREB 2RPNA 2YRDA 3BFMA 1VQ6Q 1KD1R 2EW3A 4F04B 2KDSA 2F2VA 1IGUA 1G3TA 1WHGA 1NLPC 1Q7YU 3V8KA 5GANe 3REBB 2DYIA 3I56A 2R57A 2OX7A 1X6BA 3VRYA 2WACA 1WPYA 2MWPA 2HL3A 1F1BB 3ZBDA 1QVPA 4ZTFA 2DBKA 4M78F 2J06A 2PNIA 5FWBA 3CC4A 2PVOB 2RI5A 4ELZC 4OMQA 1RAFB 3J7AF 3MEWA 1M8VA 1WJQA 4E6RA 2H3JA 1QLYA 4M75C 3M9QA 3GOXA 3RNJA 3UPUA 2O4XB 5GAOr 1W70A 1SRMA 3C0CA 3LGLA 5FU6B 3JB9D 1QP2A 3SFMA 2LCLA 3KBGA 1N27A 3QPHA 4C8QD 2VWFA 3M55A 3QWYA 3PIOA 2VB6A 2JMAA 2CDTA 3VV0A 2XIDA 3EHRA 2FVUA 3M59A 1JO8A 4ZGDB 2KGTA 2XHCA 1ACMB 3REAB 2H8HA 4BD3A 3OA6A 2EBPA 1W2BS 2EAYA 2A0FB 1D3BB 5GANf 3PTAA 2I0NA 4V2SA 2QEXT 1VQ7A 2RB6A 2C0IA 2D8JA 4DBRA 1IZ6A 1ZQ1A 2M02A 1Q86R 3HPWA 1TSFA 2RM4A 4ESRA 4RG2A 2KE9A 3MO8A 1WA7A 2SRCA 1PHTA 5KYYB 3A1PA 4OMMA 2QG9B 2EQUA 2KAFA 1D1BA 2AT1B 2DF6A 1W4SA 1Q81C 1IHVA 1KIKA 3ZEHA 2DA9A 5A0GA 5KE2A 4C92D 2HZYA 2KRMA 4E7HA 1O9SA 2DYBA 4E47A 3JB9J 4QQDA 1AWWA 1VYUA 4XK8E 1FWZA 3MEUA 1YITA 1ABQA 3G71Q 1AHJB 4B9XA 4FW1A 4JZ3A 3CCVT 3MP1A 4E7ZA 3OYBA 4M78E 5CK9A 4L59A 2ZPIB 1N8RC 2F69A 2L8DA 4WF2A 2K6DA 4LDVA 1Y0MA 2ED1A 4JZ4A 1MV0B 2KSSA 3P8BB 1KC8U 1W6XA 4FSXA 5GAOm 1TOVA 3LH5A 4XU3A 4B9WA 3INZA 2RQTA 2JM8A 2DPPB 2LX7A 1HYOA 5D6WA 4PJOC 3R6NA 1J3TA 2YUQA 1MGQA 3CBMA 1UGQB 2ZPBB 3OYMA 3CCEA 2Z0WA 4E7LA 4ZNXA
chains in the Genus database with same CATH topology
4RTXA 5I11A 2EGAA 1X2QA 2DL3A 1RLQC 2PZ1A 2BZXA 4Z8AA 2BZYA 1UUEA 2EGCA 2DE0X 1M3AA 4HCKA 1CKAA 2CSQA 1MUZA 2JS2A 2ROTA 1GFCA 1GCQA 1QWFA 4LUDA 1K1ZA 2KT1A 3VS0A 1VYVA 2X3XD 1G83A 2CH4W 2KBTA 1UHCA 4ORZA 2X3WD 1ZUKA 4RTYA 1PKTA 1A0NB 2FPDA 1QKXA 1WIEA 2HBWA 1ZUUA 3NHNA 3RBBB 1PNJA 1AZGB 2D8HA 5L23A 2W10A 3EG1A 1ZBJA 1U5SA 4RTZA 1K0XA 2RQWA 2DJQA 4RTWA 1QWEA 1WXUA 4JJDA 3KFVA 2HDAA 4J9GA 2DBMA 1FMKA 1X6GA 1T0HA 2O31A 2HCKA 1GRIA 1T0JA 1M30A 1CSKA 1TG0A 2OAWA 4DEXA 1I07A 1IO6A 3M0RA 1LCKA 1N5ZA 2A28A 2O88A 3TVTA 4AG2C 2B86A 2FRYA 5GJWB 5IHKA 2J6KA 1SRLA 4GLMA 2JS0A 2OI3A 1B07A 1ABOA 1KFZA 2MOXA 4AFSC 2LJ1A 2K7AA 4F16A 2EKHA 4CC7A 1E7OA 2HSPA 2CUDA 1AVZC 2W0ZA 1KSWA 4K11A 1BB9A 4OMOA 2EGEA 2CT4A 4CC3A 2AKLA 4OMNA 2FPEA 3EGUA 3M0SA 2L0AA 3PE0A 4LUEA 1NG2A 1UTIA 1E6GA 1VYTA 2LP5A 3SEMA 1GBQA 4HVWA 3I9QA 4Y92A 2O9SA 1KJWA 1X69A 4LE9A 1GBRA 1GCPA 3NMZC 4J9EA 2CSIA 2LMJA 2GTJA 2KEAA 1X43A 4JJBA 3VS2A 1I1JA 2ROLA 1UDLA 1ZX6A 2FRWA 2L3SA 1Z9ZA 1GCQC 3VS6A 4M4ZA 3M0TA 3NGPA 2DILA 4Z88A 4RUGA 1HD3A 4KRTA 4IIOA 3H41A 4QT7A 5IXFA 2JM9A 4GBQA 1SPKA 4JJCA 2EYWA 2L3PA 3EG0A 3H0HA 2VVKA 5GJVB 2YSQA 1OPKA 2J6FA 1XOVA 1YP5A 4Z89A 3QWXX 2BTTA 3PVQA 2PTKA 4RTTA 1PRLC 3UA7A 4WCIA 4CC4B 1EFNA 4J9BA 5ECAA 3THKA 2V1RA 2RQUA 1SSHA 1UJ0A 2DNUA 5IHNA 2JXBA 1UFFA 1K76A 2VKNA 1K4US 3TSZA 2C0OA 1QCFA 1RLPC 2K3BA 2CUBA 1JEGA 1ZUYA 4HVUA 2XMFA 2LZ6B 2DL8A 3ULRB 3M0UA 1WXBA 1WXTA 1U06A 1X2KA 4RTUA 1PKSA 2DVJA 1H8KA 2GBQA 2C0TA 1AOJA 2IIMA 2LNHB 3VRZA 1UGVA 2AK5A 2FG0A 1WFWA 2EYXA 4RTVA 1FYNA 4AFZC 1PRMC 2DL7A 3PVLA 1G2BA 2DLPA 3VS4A 4A63B 2EPDA 1YWOA 2M51A 3M0QA 2J05A 2DX1A 3A98A 1Y57A 1WDXA 1SHFA 2LCSA 3UATA 1RUWA 2A08A 1MV3A 1U3OA 2JT4A 4FSSA 4D8KA 5IH2A 1AWXA 1Z9QA 3NPFA 1W1FA 2GQIA 1GL5A 1AWJA 2RNAA 2OJ2A 2LQNA 2BZ8A 1NLOC 4EIKA 1AEYA 3I5SA 4JPBW 2EVRA 1M8MA 1JQQA 2KNBB 2G6FX 2DL4A 4OMPA 1GFDA 2DMOA 1T3LA 2D0NA 2A37A 1RI9A 3M0PA 2ABLA 4CC2A 1M3BA 1WX6A 2YDLA 1NYFA 2KR3A 3VS3A 1YN8A 3VS7A 2LJ0A 1HJDA 1AWOA 5IXBA 1X27A 2FO0A 2KRSA 4J9IA 2DL5A 5I22A 2DRMA 2RPNA 1ZLMA 2AKKA 3CQTA 2EW3A 1AZEA 2F2VA 2KXCA 1CKBA 1VA7A 1NLPC 2KT8A 2A36A 1WI7A 3REBB 3UF4A 2GNCA 3H0IA 1ARKA 2EYYA 4DEYA 1X6BA 3VRYA 2YT6A 4F17A 3JV3A 1WLPB 2GTOA 2F2XA 2K2MA 2KROA 2DBKA 3FJ5A 2J06A 2PNIA 5FWBA 1OOTA 2K79A 1K9AA 2KYMA 2ENMA 5FW9A 4OMQA 1JXOA 1H3HA 3UA6A 5HCKA 2ECZA 2YUOA 1QKWA 4LN2A 3I35A 1OV3A 4E6RA 2QDLA 3IQLA 1TUDA 1QLYA 3RNJA 2O2OA 1W70A 1SRMA 1BBZA 2CH4A 2FEIA 2YUPA 3C0CA 3I5RA 2EYZA 1SEMA 3TSWA 1ZSGA 2DM1A 4F14A 2J6OA 1YNZA 2AZVA 2VWFA 3QWYA 1H92A 1BK2A 2JMAA 2CDTA 3EHRA 1JO8A 2KGTA 3REAB 2H8HA 4R0KA 2CT3A 4IIMA 1V1CA 2EBPA 2M0YA 2KYBA 2V1QA 2I0NA 3H0FA 1NEBA 1NM7A 2C0IA 2D8JA 2O9VA 2RQRA 1E6HA 2NWMA 4ESRA 1UECA 2KE9A 5EC7A 1WYXA 1UHFA 1UE9A 3VS5A 1WA7A 2SRCA 5IHIA 1B3QA 1PHTA 2ESWA 4OMMA 1PWTA 1OEBA 2JTEA 2MIOA 2JW4A 2K9GA 4HXJA 2DF6A 3GBQA 4OMLA 2P4RA 3EHQA 4J9CA 1KIKA 1HSQA 2J7IA 2DA9A 2KXDA 2LQWA 1OPLA 4LNPA 5FWCA 2KRMA 1YCSB 1BU1A 4J9HA 2DYBA 2CREA 1UG1A 2YUNA 3VS1A 2EQIA 1AWWA 2KRNA 4AG1C 1VYUA 4AFQC 2RN8A 2FPFA 1JU5C 1ABQA 1M3CA 3EG2A 4HVVA 2SEMA 4JZ3A 1NEGA 2HEQA 1T3SA 1YWPA 2L2PA 4X1VA 3SHWA 1JXMA 2RMOA 2GGRA 1M27C 1TUCA 2K6DA 1Y0MA 2ED0A 2ED1A 2RQVA 4JZ4A 2JMCA 1NYGA 2L3QA 4J9DA 2E5KA 1MV0B 2LJ3A 1AD5A 1I0CA 1W6XA 3O5ZA 3LH5A 3U23A 1UJYA 2DRKA 1S1NA 4J9FA 2RQTA 2NUZA 2JM8A 2LX7A 2F2WA 3R6NA 4D8DA 1J3TA 3EG3A 2D1XA 2YUQA 2MCNA 2RF0A 3ZL7C 1K0SA 4AFUC 1SHGA 2AZSA 4ZNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RTX A;  5I11 A;  2EGA A;  1X2Q A;  2DL3 A;  1RLQ C;  2PZ1 A;  2BZX A;  4Z8A A;  2BZY A;  1UUE A;  2EGC A;  2DE0 X;  1M3A A;  4HCK A;  1CKA A;  2CSQ A;  1MUZ A;  2JS2 A;  2ROT A;  1GFC A;  1GCQ A;  1QWF A;  4LUD A;  1K1Z A;  2KT1 A;  3VS0 A;  1VYV A;  2X3X D;  1G83 A;  2CH4 W;  2KBT A;  1UHC A;  4ORZ A;  2X3W D;  1ZUK A;  4RTY A;  1PKT A;  1A0N B;  2FPD A;  1QKX A;  1WIE A;  2HBW A;  1ZUU A;  3NHN A;  3RBB B;  1PNJ A;  1AZG B;  2D8H A;  5L23 A;  2W10 A;  3EG1 A;  1ZBJ A;  1U5S A;  4RTZ A;  1K0X A;  2RQW A;  2DJQ A;  4RTW A;  1QWE A;  1WXU A;  4JJD A;  3KFV A;  2HDA A;  4J9G A;  2DBM A;  1FMK A;  1X6G A;  1T0H A;  2O31 A;  2HCK A;  1GRI A;  1T0J A;  1M30 A;  1CSK A;  1TG0 A;  2OAW A;  4DEX A;  1I07 A;  1IO6 A;  3M0R A;  1LCK A;  1N5Z A;  2A28 A;  2O88 A;  3TVT A;  4AG2 C;  2B86 A;  2FRY A;  5GJW B;  5IHK A;  2J6K A;  1SRL A;  4GLM A;  2JS0 A;  2OI3 A;  1B07 A;  1ABO A;  1KFZ A;  2MOX A;  4AFS C;  2LJ1 A;  2K7A A;  4F16 A;  2EKH A;  4CC7 A;  1E7O A;  2HSP A;  2CUD A;  1AVZ C;  2W0Z A;  1KSW A;  4K11 A;  1BB9 A;  4OMO A;  2EGE A;  2CT4 A;  4CC3 A;  2AKL A;  4OMN A;  2FPE A;  3EGU A;  3M0S A;  2L0A A;  3PE0 A;  4LUE A;  1NG2 A;  1UTI A;  1E6G A;  1VYT A;  2LP5 A;  3SEM A;  1GBQ A;  4HVW A;  3I9Q A;  4Y92 A;  2O9S A;  1KJW A;  1X69 A;  4LE9 A;  1GBR A;  1GCP A;  3NMZ C;  4J9E A;  2CSI A;  2LMJ A;  2GTJ A;  2KEA A;  1X43 A;  4JJB A;  3VS2 A;  1I1J A;  2ROL A;  1UDL A;  1ZX6 A;  2FRW A;  2L3S A;  1Z9Z A;  1GCQ C;  3VS6 A;  4M4Z A;  3M0T A;  3NGP A;  2DIL A;  4Z88 A;  4RUG A;  1HD3 A;  4KRT A;  4IIO A;  3H41 A;  4QT7 A;  5IXF A;  2JM9 A;  4GBQ A;  1SPK A;  4JJC A;  2EYW A;  2L3P A;  3EG0 A;  3H0H A;  2VVK A;  5GJV B;  2YSQ A;  1OPK A;  2J6F A;  1XOV A;  1YP5 A;  4Z89 A;  3QWX X;  2BTT A;  3PVQ A;  2PTK A;  4RTT A;  1PRL C;  3UA7 A;  4WCI A;  4CC4 B;  1EFN A;  4J9B A;  5ECA A;  3THK A;  2V1R A;  2RQU A;  1SSH A;  1UJ0 A;  2DNU A;  5IHN A;  2JXB A;  1UFF A;  1K76 A;  2VKN A;  1K4U S;  3TSZ A;  2C0O A;  1QCF A;  1RLP C;  2K3B A;  2CUB A;  1JEG A;  1ZUY A;  4HVU A;  2XMF A;  2LZ6 B;  2DL8 A;  3ULR B;  3M0U A;  1WXB A;  1WXT A;  1U06 A;  1X2K A;  4RTU A;  1PKS A;  2DVJ A;  1H8K A;  2GBQ A;  2C0T A;  1AOJ A;  2IIM A;  2LNH B;  3VRZ A;  1UGV A;  2AK5 A;  2FG0 A;  1WFW A;  2EYX A;  4RTV A;  1FYN A;  4AFZ C;  1PRM C;  2DL7 A;  3PVL A;  1G2B A;  2DLP A;  3VS4 A;  4A63 B;  2EPD A;  1YWO A;  2M51 A;  3M0Q A;  2J05 A;  2DX1 A;  3A98 A;  1Y57 A;  1WDX A;  1SHF A;  2LCS A;  3UAT A;  1RUW A;  2A08 A;  1MV3 A;  1U3O A;  2JT4 A;  4FSS A;  4D8K A;  5IH2 A;  1AWX A;  1Z9Q A;  3NPF A;  1W1F A;  2GQI A;  1GL5 A;  1AWJ A;  2RNA A;  2OJ2 A;  2LQN A;  2BZ8 A;  1NLO C;  4EIK A;  1AEY A;  3I5S A;  4JPB W;  2EVR A;  1M8M A;  1JQQ A;  2KNB B;  2G6F X;  2DL4 A;  4OMP A;  1GFD A;  2DMO A;  1T3L A;  2D0N A;  2A37 A;  1RI9 A;  3M0P A;  2ABL A;  4CC2 A;  1M3B A;  1WX6 A;  2YDL A;  1NYF A;  2KR3 A;  3VS3 A;  1YN8 A;  3VS7 A;  2LJ0 A;  1HJD A;  1AWO A;  5IXB A;  1X27 A;  2FO0 A;  2KRS A;  4J9I A;  2DL5 A;  5I22 A;  2DRM A;  2RPN A;  1ZLM A;  2AKK A;  3CQT A;  2EW3 A;  1AZE A;  2F2V A;  2KXC A;  1CKB A;  1VA7 A;  1NLP C;  2KT8 A;  2A36 A;  1WI7 A;  3REB B;  3UF4 A;  2GNC A;  3H0I A;  1ARK A;  2EYY A;  4DEY A;  1X6B A;  3VRY A;  2YT6 A;  4F17 A;  3JV3 A;  1WLP B;  2GTO A;  2F2X A;  2K2M A;  2KRO A;  2DBK A;  3FJ5 A;  2J06 A;  2PNI A;  5FWB A;  1OOT A;  2K79 A;  1K9A A;  2KYM A;  2ENM A;  5FW9 A;  4OMQ A;  1JXO A;  1H3H A;  3UA6 A;  5HCK A;  2ECZ A;  2YUO A;  1QKW A;  4LN2 A;  3I35 A;  1OV3 A;  4E6R A;  2QDL A;  3IQL A;  1TUD A;  1QLY A;  3RNJ A;  2O2O A;  1W70 A;  1SRM A;  1BBZ A;  2CH4 A;  2FEI A;  2YUP A;  3C0C A;  3I5R A;  2EYZ A;  1SEM A;  3TSW A;  1ZSG A;  2DM1 A;  4F14 A;  2J6O A;  1YNZ A;  2AZV A;  2VWF A;  3QWY A;  1H92 A;  1BK2 A;  2JMA A;  2CDT A;  3EHR A;  1JO8 A;  2KGT A;  3REA B;  2H8H A;  4R0K A;  2CT3 A;  4IIM A;  1V1C A;  2EBP A;  2M0Y A;  2KYB A;  2V1Q A;  2I0N A;  3H0F A;  1NEB A;  1NM7 A;  2C0I A;  2D8J A;  2O9V A;  2RQR A;  1E6H A;  2NWM A;  4ESR A;  1UEC A;  2KE9 A;  5EC7 A;  1WYX A;  1UHF A;  1UE9 A;  3VS5 A;  1WA7 A;  2SRC A;  5IHI A;  1B3Q A;  1PHT A;  2ESW A;  4OMM A;  1PWT A;  1OEB A;  2JTE A;  2MIO A;  2JW4 A;  2K9G A;  4HXJ A;  2DF6 A;  3GBQ A;  4OML A;  2P4R A;  3EHQ A;  4J9C A;  1KIK A;  1HSQ A;  2J7I A;  2DA9 A;  2KXD A;  2LQW A;  1OPL A;  4LNP A;  5FWC A;  2KRM A;  1YCS B;  1BU1 A;  4J9H A;  2DYB A;  2CRE A;  1UG1 A;  2YUN A;  3VS1 A;  2EQI A;  1AWW A;  2KRN A;  4AG1 C;  1VYU A;  4AFQ C;  2RN8 A;  2FPF A;  1JU5 C;  1ABQ A;  1M3C A;  3EG2 A;  4HVV A;  2SEM A;  4JZ3 A;  1NEG A;  2HEQ A;  1T3S A;  1YWP A;  2L2P A;  4X1V A;  3SHW A;  1JXM A;  2RMO A;  2GGR A;  1M27 C;  1TUC A;  2K6D A;  1Y0M A;  2ED0 A;  2ED1 A;  2RQV A;  4JZ4 A;  2JMC A;  1NYG A;  2L3Q A;  4J9D A;  2E5K A;  1MV0 B;  2LJ3 A;  1AD5 A;  1I0C A;  1W6X A;  3O5Z A;  3LH5 A;  3U23 A;  1UJY A;  2DRK A;  1S1N A;  4J9F A;  2RQT A;  2NUZ A;  2JM8 A;  2LX7 A;  2F2W A;  3R6N A;  4D8D A;  1J3T A;  3EG3 A;  2D1X A;  2YUQ A;  2MCN A;  2RF0 A;  3ZL7 C;  1K0S A;  4AFU C;  1SHG A;  2AZS A;  4ZNX A; 
#chains in the Genus database with same CATH topology
 3DKM A;  4HKE A;  5KCH A;  3E9F A;  2DL3 A;  2F5T X;  2BZX A;  4PJO D;  4ELY C;  3JB9 F;  1OQK A;  2CSQ A;  2JS2 A;  1GCQ A;  1QWF A;  3CME A;  4IUU A;  2KT1 A;  1B34 A;  4JLG A;  1VYV A;  2CH4 W;  4ORZ A;  1ZUK A;  3Q1J A;  2NUT A;  1KG1 A;  1A0N B;  4E7J A;  2EWN A;  3ME9 A;  4LDU A;  4C8Q E;  5KYN A;  1JRI A;  1PNJ A;  5KYX B;  4PFO A;  5L23 A;  3MET A;  1SG5 A;  5FRM A;  4RTZ A;  2RQW A;  2DJQ A;  5GAN 4;  5GAN d;  1WXU A;  3FIF A;  1RAD B;  1N9R A;  1BCO A;  4J9G A;  1Y7X A;  3JB9 G;  2DBM A;  1X6G A;  1NJI U;  1GRI A;  1V29 B;  4C5I A;  1VQ4 A;  3CCR A;  4DBF A;  2DZC A;  4DEX A;  1IO6 A;  2O88 A;  1N5Z A;  3M54 A;  3FC3 A;  3VYH B;  3CMA Q;  5IHK A;  3G71 T;  2RJE A;  1SRL A;  2OI3 A;  5J3B A;  1ABO A;  1M1G A;  1M9S A;  4OB3 B;  3GNG A;  2E4H A;  2AKL A;  1X75 C;  4DA4 A;  4OMN A;  3G1J A;  3RR6 A;  1YI2 T;  3EGD B;  5CVI A;  3SWN C;  2FHD A;  5LJ5 f;  3CCV Q;  4E7K A;  3EG9 B;  4BAC A;  4LE9 A;  1FMW A;  3E9G A;  4A4G A;  2QGG A;  2QI2 A;  4JJB A;  2ROL A;  2YWW A;  2DK3 A;  3HSB A;  1W2B P;  3VS6 A;  2DIL A;  2GQV A;  1TWB A;  4BB7 A;  1VQ8 A;  1PD0 A;  3RIR A;  5IXF A;  2JM9 A;  5KYW A;  4JJC A;  3I55 T;  1ZSZ B;  2EYW A;  4MZP A;  3H0H A;  2DTO A;  2MMP A;  3BE3 A;  1IB8 A;  2LX9 A;  2E41 A;  4P5N A;  3CME T;  1H3Z A;  3PVQ A;  2E5Q A;  2KQW A;  2PTK A;  3HKS A;  3UA7 A;  4CC4 B;  1C1A A;  1UJ0 A;  2K3X A;  1BI2 A;  1M2O A;  2C0O A;  4HCB A;  1QP3 A;  2K3B A;  4II1 A;  3CCL Q;  5HK3 A;  1JEG A;  3QXE B;  2V8I A;  3GNF B;  3JCM X;  1XNI A;  2P0P A;  1U06 A;  4M7A B;  4C8Q C;  4WTO B;  3CCR T;  4IUT A;  1PKS A;  3D7S B;  3LW5 E;  2EYQ A;  2DVJ A;  2GBQ A;  2RO0 A;  4J8O A;  5IAY A;  3M5A A;  5AT1 B;  4F7U B;  2YRC A;  1WFW A;  4XTU A;  4FYY B;  1PRM C;  4HCC A;  4BE0 A;  2LVM A;  1OZ2 A;  3FB9 A;  1YJN Q;  1JBM A;  4A63 B;  5KYW B;  1YWO A;  3HFN A;  2C06 A;  3AHU A;  3M0Q A;  1VQ9 T;  1VUB A;  6AT1 B;  2DTI A;  2HBP A;  1SHF A;  2LCS A;  3UAT A;  3I55 A;  3J80 E;  1K9M R;  4FSS A;  5IH2 A;  1AWX A;  4DBH A;  4D6W A;  1KQ1 A;  3UWN A;  1GL5 A;  2LQN A;  1D0Z A;  3EGD A;  4M75 A;  1TXQ A;  4XTV A;  5I2S A;  1I8F A;  2CYZ B;  3RUX A;  2DL4 A;  1D1C A;  1NPR A;  2E10 A;  2D0N A;  1N6A A;  1VQ9 A;  4CC2 A;  4FYX B;  5KCO A;  2YDL A;  3MHX A;  4JRP A;  1NYF A;  2DFU A;  1Q81 R;  2KR3 A;  2KY9 A;  2HD0 A;  3VS7 A;  2LJ0 A;  1LPL A;  1X01 A;  2PVD B;  4GLK A;  3ZFJ A;  4KUL A;  1YJW Q;  1WJS A;  5I22 A;  2V8J A;  4ME7 A;  2AKK A;  3CCU A;  1D1A A;  1BYM A;  4JUV A;  1WZO A;  3L2V A;  2QAZ A;  1VA7 A;  4DOW A;  2KT8 A;  2DD5 A;  3UF4 A;  2GNC A;  1WHK A;  4LXC A;  4PFZ A;  1UGP B;  4MDW A;  2NUP A;  2YT6 A;  4C5H A;  2GTO A;  2MPX C;  2FZC B;  5CKB A;  3X20 B;  1MMG A;  4BI3 A;  3OSV A;  1K9A A;  1MMA A;  4C5G A;  4M7D D;  2ENM A;  5FW9 A;  2HAX A;  1JXO A;  3UA6 A;  2QQS A;  2LNV A;  4E2F B;  2MF2 A;  4Y28 E;  4IUP A;  3EGX B;  3HRU A;  2QXF A;  3CC4 T;  2YUP A;  4OMF B;  3M53 A;  2PUK B;  3EAE A;  3LYI A;  2EYZ A;  2ZAE A;  2DM1 A;  4F14 A;  2J6O A;  3EFO A;  3SWN B;  3OYK A;  2CKK A;  3CCM Q;  1VQK T;  3OBY A;  4MMK A;  3VU3 C;  3V8J A;  5FU7 B;  5LJ5 h;  4R0K A;  2GCX A;  4XU1 A;  4C0D C;  3CMA A;  2M0Y A;  3BW1 A;  4C8Q A;  1VQL Q;  3H0F A;  1WNL A;  1VQ6 A;  5GAM h;  1N8R R;  2DD4 A;  5C0M A;  2O9V A;  2RQR A;  1PSF A;  4FL6 A;  3JCM c;  2DEU A;  3RMS A;  5GAO n;  5KYU A;  2NWM A;  1WYX A;  2OTL A;  2IPO B;  2DZ9 A;  1UE9 A;  5IHI A;  2MK5 A;  2BE7 D;  5CKD A;  2D6F A;  4C0F A;  1OEB A;  2RA2 A;  1YI2 Q;  1RI0 A;  4HXJ A;  1VQP Q;  4EMK B;  3OW2 A;  1RAB B;  3GBQ A;  2OTJ T;  1G3Y A;  4J9C A;  1QMC A;  2DER A;  1MND A;  2VAS A;  2JN0 A;  2OAU A;  1N8R U;  4M7A E;  5GMK j;  4XTX A;  3OYG A;  4QVD A;  1YCS B;  2EJF A;  4J9H A;  2YUN A;  1UG1 A;  1M2V A;  4M77 A;  5GAN 2;  4AG1 C;  4AFQ C;  3JCM W;  1M2V B;  2K2V A;  2KI7 A;  3VUB A;  2FYK A;  1VQO T;  2COZ A;  1PSE A;  1FX7 A;  2FPF A;  1JU5 C;  1QVG A;  4PJM A;  3EG2 A;  1KK7 A;  4XTZ A;  4M78 A;  1JJ2 S;  4RMO A;  1NEG A;  2HEQ A;  2CZ0 B;  3QDF A;  2LQK A;  2DXC A;  1ZHI A;  2LT1 A;  2LRQ A;  2GGR A;  1PCX A;  3M4Y A;  4ZN3 A;  1NYG A;  2L3Q A;  2NYS A;  2HNI A;  3OQ5 A;  2G3R A;  5CQY A;  1AD5 A;  4C0D B;  1VQO Q;  2DXT A;  3OYF A;  1YJ9 T;  4J9F A;  3JCM P;  5KYU B;  4JS4 A;  2F2W A;  3CEY A;  4F7U G;  3EG3 A;  3RKX A;  1I81 A;  4HT9 A;  4C0G A;  4N4G A;  2RF0 A;  3ZL7 C;  4AFU C;  3A8M B;  1SHG A;  2CP5 A;  1C0M A;  1X2Q A;  1VQK A;  4J7F A;  3QO3 A;  2A7Y A;  2RJC A;  1YBY A;  4Z8A A;  3JCM b;  4X9C A;  2XIC A;  1M3A A;  2O4X A;  1CKA A;  4ZGJ B;  2LT4 A;  5LJ3 d;  3L2R A;  5FRO A;  4PFP A;  1WGS A;  3QSU A;  2HQH A;  3CCE Q;  2KBT A;  2BIV A;  1WHL A;  2FPD A;  3EFR A;  5GAN j;  3RBB B;  3GPL A;  5LL6 S;  4NL3 A;  1EIF A;  2JNG A;  2KVQ G;  4XU0 A;  3T9N A;  4JJD A;  5KE3 A;  3OYN A;  3MEA A;  3KFV A;  2HDA A;  1Q82 U;  2DIQ A;  1Q81 U;  8AT1 B;  3RKW A;  4KUD K;  4BDY A;  2FL7 A;  1TG0 A;  3MP6 A;  2AHJ B;  3SDZ A;  3CXC A;  2GF7 A;  3M0R A;  1LCK A;  1U8R A;  3M58 A;  1K8A U;  1GXI E;  2B86 A;  2FRY A;  2CS7 A;  3CCJ A;  3CC2 Q;  4GLM A;  1X6O A;  3X24 B;  2X4Y A;  5GAO l;  4DQ2 A;  4E7S A;  5A0D A;  4LD6 A;  1K9M C;  2EKH A;  1MMD A;  1AT1 B;  2CUD A;  5CCA A;  1ZA1 B;  4IKF A;  1VQ5 A;  2EGE A;  2CT4 A;  1OYX A;  4CC3 A;  2ATC B;  4KH1 B;  3F70 A;  4C92 A;  2FPE A;  2DEQ A;  2L0A A;  3M0S A;  1NG2 A;  1VYT A;  4M77 G;  1VQL A;  2V26 A;  1OI1 A;  1PD1 A;  3I9Q A;  4OGC A;  3CMA T;  2O9S A;  1QVF P;  1X69 A;  1K73 U;  3CCL A;  3MEV A;  2HKQ B;  2CSI A;  2GTJ A;  4C8Q B;  4M7A C;  5IN1 A;  1UDL A;  1XJW B;  1ZX6 A;  3X26 B;  2MYS A;  2VXE A;  4M75 B;  2D0Q B;  2LCC A;  4XAX B;  4RUG A;  2EFI A;  3CXC S;  5FU6 C;  3WXM B;  4QW2 A;  1VQN T;  1YIJ T;  1YI2 A;  3CC2 A;  3SWN A;  4N0A A;  2VVK A;  2J6F A;  3CC2 T;  3CXC P;  1V76 A;  3QWX X;  5LJ3 e;  1XTD A;  4RTT A;  4MDX A;  1PRL C;  1EFN A;  1UB4 A;  1NPP A;  3C95 A;  1UFF A;  4EMK C;  1K76 A;  3H6Z A;  3I55 Q;  2VUB A;  5GMK e;  1VIE A;  3ULR B;  3M0U A;  3M57 A;  4HA8 A;  3CCQ Q;  4FYV B;  4RTU A;  1O75 A;  2ZPF B;  3HTR A;  5GMK m;  3LH0 A;  1VQL T;  3BY7 A;  1G3S A;  2C0T A;  3WVD B;  1Y71 A;  1AOJ A;  2IIM A;  2LNH B;  2EQK A;  2R5A A;  3VRZ A;  5LJ5 j;  1UGV A;  4OGE A;  2YRV A;  2AK5 A;  4R55 A;  2QTX A;  5GAO q;  1FYN A;  3OYI A;  1S72 A;  3I56 Q;  1VQM T;  1G2B A;  1OUL A;  3UT1 A;  2DLP A;  4M75 F;  3BDL A;  4EDU A;  3OB9 A;  1VQ7 Q;  2EPD A;  1YJN T;  1VQ9 Q;  3PIP A;  5GAM g;  3EFO B;  2DX1 A;  4PJO A;  3QKJ A;  1WDX A;  4JJN K;  5LJ5 g;  3RER A;  1M4Z A;  1U3O A;  2JT4 A;  3C94 A;  1YJW A;  2BKD N;  1Z9Q A;  4C92 G;  3JCM J;  3A5Z B;  3NPF A;  1YJ9 Q;  3OS5 A;  5FLX E;  2RNA A;  2OJ2 A;  4M75 E;  2EIF A;  3QJY A;  2L5Q A;  2PU9 B;  1SKU B;  5GAM j;  1M1K R;  1VQN Q;  1AEY A;  3JCM d;  3FLG A;  2EVR A;  1M8M A;  3OYE A;  3GP8 A;  5J26 A;  1KHI A;  2G6F X;  4LDX A;  2DMO A;  3CCQ A;  5GAN 8;  3M0P A;  2DJZ A;  5D7U A;  1BIB A;  1R77 A;  3QZ5 B;  1M3B A;  2JOY A;  4KUI A;  1TTH B;  4PK4 A;  1K73 R;  1FXX A;  1YN8 A;  5EG2 A;  5FRN A;  1HJD A;  5IXB A;  1X27 A;  1MNE A;  2EJ9 A;  3FDR A;  3TU4 K;  4EMK A;  2H3E B;  2KRS A;  3RDV A;  3M4G A;  4L5G A;  2DRM A;  3ER0 A;  1ZLM A;  3CC7 Q;  3CQT A;  3OS2 A;  1AZE A;  3V7C A;  3CCV A;  2KXC A;  1BIA A;  1IXD A;  4IUV A;  2IG0 A;  1YIT T;  2A36 A;  3S6W A;  2MWO A;  3H0I A;  3MJX A;  1Y07 A;  2WSF E;  4DEY A;  2P0K A;  3KUF A;  1QVF S;  2RK1 A;  3CME Q;  2ZPG B;  1YJ9 A;  2K2M A;  2AIR B;  4RCC A;  2KRO A;  1MMN A;  3FJ5 A;  1Q86 C;  1KD1 U;  2RHU A;  1OOT A;  3JCM Q;  2K79 A;  2Y90 A;  2P4T A;  1Q95 G;  1QVF A;  1LJO A;  1H3H A;  2ECZ A;  3CCS T;  3JAM E;  1OV3 A;  3QYG B;  1PG5 B;  4X34 A;  1U1S A;  5I21 A;  3V8L A;  2FZG B;  5CKE A;  2O2O A;  4M7D B;  3I5R A;  1BBZ A;  2CH4 A;  2FEI A;  1HXD A;  1UEB A;  3TSW A;  1VQO A;  4AT1 B;  1TS9 A;  4PJO F;  4JRQ A;  2RI3 A;  1ZSG A;  1VQ8 Q;  1R0B G;  3EGX A;  1VOM A;  1YNZ A;  1M90 R;  4PJL A;  5C6S A;  3JCM f;  1H92 A;  4JDS A;  2NLU A;  5CAI A;  1BCM A;  2CT3 A;  4IIM A;  4AMC A;  2V8K A;  5LJ3 g;  4E7I A;  1V1C A;  3GLX A;  2KYB A;  3O8V A;  2V1Q A;  2DIG A;  1EX4 A;  3NFC A;  3S3N A;  1NM7 A;  1JJ2 P;  3ASK A;  3E2U A;  4RCB A;  3A8L B;  2RI2 A;  1VQ5 Q;  9ATC B;  1UEC A;  3AT1 B;  3OMG A;  3VS5 A;  3CD6 A;  3MP8 A;  4BE1 A;  4C92 E;  1B3Q A;  2ESW A;  1PWT A;  4M7A D;  2E64 A;  4M75 G;  2MIO A;  2F1L A;  4M75 D;  3OSS C;  1YIT Q;  2CP7 A;  4OB1 B;  3EHQ A;  3DB3 A;  2VYT A;  4L6V 5;  3HRS A;  1HSQ A;  2J7I A;  5HKC A;  4M7D F;  2XK0 A;  4HT8 A;  1ZSZ A;  2IVW A;  4PJO B;  2X35 A;  3CBP A;  2CRE A;  2EQI A;  1Y96 A;  2OTJ A;  2KRN A;  4FT4 A;  4EMG A;  3FJP A;  4M7D G;  3CC7 T;  4BY6 B;  2RHY A;  2RN8 A;  5GMK i;  4CI0 C;  1N9S A;  4M7D C;  3PMT A;  1PM3 A;  3G4S Q;  4HVV A;  3OYL A;  5LJ3 f;  4DOV A;  2X9H A;  1T3S A;  1YWP A;  3KXT A;  2PUO B;  4FCY A;  1S72 T;  1VQP T;  2RHI A;  2RMO A;  3MPU B;  4N4H A;  2RQV A;  2JMC A;  1IGQ A;  1RAH B;  5CIU A;  2LJ3 A;  2QEX A;  1VQ7 T;  4KGX B;  5CR2 A;  2GFA A;  2K4Y A;  1RAE B;  2DRK A;  1M90 U;  4M78 D;  3PGG A;  3C4S A;  3QII A;  3V7R A;  2P0Q A;  2NUZ A;  5LJ5 e;  3X25 B;  2E65 A;  4D8D A;  3VJP A;  4MZM A;  1I5O B;  1RAA B;  1K0S A;  2QQB A;  3L42 A;  3JRZ A;  2B8A A;  2R5M A;  2AZS A;  2RH2 A;  1QVG P;  3PNW C;  4RTX A;  2EGA A;  5DLO A;  2OTL Q;  4F7U A;  2PZ1 A;  4J83 A;  3EFS A;  2QGF B;  4ATO A;  1UUE A;  2DE0 X;  4HCK A;  3P8H A;  2DKG A;  5GAM d;  4M77 E;  1MUZ A;  3LGF A;  1ZBX A;  4UC4 A;  4OVA A;  4M7A A;  1K1Z A;  4A4E A;  3OYH A;  2K5L A;  3CCM T;  4FU6 A;  3JSC A;  3P8D A;  1UHC A;  2X3W D;  4RTY A;  1PKT A;  3OW2 P;  1WIE A;  2JTM A;  1RAC B;  1YIJ A;  1YCY A;  4MML A;  2XDB A;  1ZBJ A;  1U5S A;  1QWE A;  1VQ4 Q;  2DVE A;  4OB0 B;  2K3Y A;  1RL2 A;  4QKU A;  1FMK A;  1H64 1;  1TU0 B;  4XTW A;  4A54 A;  2LTO A;  4FM4 B;  2COY A;  1T0J A;  1CSK A;  4KGV B;  4FW2 A;  4Z02 A;  3JCM h;  1B34 B;  2OAW A;  1UGS B;  3RKY A;  2A28 A;  3TVT A;  4BI8 B;  2JJ9 A;  3L1A A;  2HKN A;  1R0C B;  2HQX A;  2J6K A;  2JS0 A;  4KBM B;  1B07 A;  1KFZ A;  4AFS C;  2LJ1 A;  2E12 A;  2CZ1 B;  2GFU A;  2K7A A;  2MAM A;  4PJO G;  4CC7 A;  1E7O A;  2HSP A;  1AVZ C;  3V7S A;  1KSW A;  4C8Q G;  4PJJ A;  1YHQ T;  1TH7 A;  4OMO A;  1M1K C;  1SSF A;  4C92 F;  5GAM f;  4LUE A;  1G8X A;  1E6G A;  2QAS A;  3SEM A;  5IT9 E;  1KJW A;  1KQS A;  3TCJ A;  5KH6 A;  4MZT A;  1WHH A;  3NMZ C;  2E6Z A;  2QA4 T;  1X43 A;  2KEA A;  2HL5 C;  3VS2 A;  1I1J A;  3BDU A;  5M9O A;  4M78 B;  4M4Z A;  4BE2 A;  3M0T A;  3NGP A;  4Z88 A;  1BI1 A;  4KRT A;  3QHS A;  3H41 A;  5CKH A;  2RD1 A;  1D09 B;  2DXB A;  2NUP B;  3EG0 A;  2PVG B;  1YP5 A;  4Z89 A;  2BTT A;  4FIB A;  2E6N A;  3G6E A;  4OB2 B;  4WCI A;  2OTJ Q;  5ECA A;  1VQ8 T;  2X51 A;  2QK0 A;  2V1R A;  2DNU A;  5KYY A;  3HFO A;  2VKN A;  1K4U S;  3TSZ A;  1DJ7 B;  1P92 A;  1RLP C;  3A8O B;  2DO3 A;  2X4J A;  2NUT B;  1ZUY A;  4HVU A;  1WJR A;  2XMF A;  2DL8 A;  4RG8 A;  3E1S A;  4C92 B;  1OZ3 A;  4KGZ B;  3I56 T;  3JCM V;  2COW A;  2RHZ A;  1X2K A;  3RMQ A;  2WSC E;  3MCA B;  3A8G B;  3H9N A;  3UDC A;  4KT0 E;  4QQ6 A;  3URG A;  2QEX Q;  1D3B A;  1QVG S;  2KK4 A;  5LJ5 d;  4JRI A;  1EZZ B;  2M1H A;  2EYX A;  4RTV A;  2JTF A;  4ZGE B;  3NTH A;  1OU8 A;  3PVL A;  2CZ6 B;  2VC8 A;  3VYG A;  2M51 A;  4XU2 A;  3G4S A;  8ATC B;  1NJI R;  3OBW A;  2J05 A;  3CCJ Q;  1QCO A;  1Y57 A;  2QA4 Q;  2YLB A;  3OW2 S;  3G71 A;  4A4F A;  3CC4 Q;  1RUW A;  2Y4Y A;  1MV3 A;  4LD9 K;  2QYZ A;  2JZ2 A;  3QYH B;  3L2U A;  2M16 A;  1G3W A;  2GQI A;  1AWJ A;  1Q7Y C;  2ZZD A;  2CP6 A;  1NLO C;  4EIK A;  5GAN 7;  4JPB W;  1OX9 A;  1SF9 A;  4OMP A;  4A53 A;  1T3L A;  4NS5 A;  4JLI A;  2ABL A;  1M5Q 1;  1RAI B;  3DB4 A;  3CPF A;  1WX6 A;  1VQN A;  2BUD A;  5LJ3 h;  1UGR B;  3NTI A;  1K8A R;  4PLI A;  2X4X A;  3HRT A;  2JUF A;  3M56 A;  5CKF A;  4XQ3 A;  3EH1 A;  2DL5 A;  1PC0 A;  1WHM A;  1M90 C;  1VQ6 T;  3LLR A;  2RK2 A;  1C6V X;  2QA4 A;  3JB9 H;  3CPW S;  1TUG B;  4LDY A;  1CKB A;  2EQJ A;  1VQ4 T;  1WI7 A;  3OS1 A;  3OYC A;  3OYY A;  4N0A C;  5I2M A;  1QQJ A;  4IUR A;  1ARK A;  1YFN A;  2EYY A;  4F17 A;  1G5V A;  3JV3 A;  1WLP B;  1BI0 A;  1LOJ A;  3FRN A;  3MKD A;  4BY6 C;  4C8Q F;  2F2X A;  1W2B A;  2L3R A;  3RES A;  5CQX A;  2O01 E;  4Q5W A;  2K5I A;  2KYM A;  2VGM A;  4BI4 A;  1HK9 A;  3CCS A;  5HCK A;  2YUO A;  1QKW A;  4LN2 A;  3I35 A;  4EMH A;  2HQE A;  3CCR Q;  1U1T A;  2QDL A;  3IQL A;  1XQH A;  1TUD A;  4PKC C;  3CD6 T;  3CBO A;  2ZPH B;  3SD4 A;  4M7D E;  2M0O A;  2P84 A;  2XU8 A;  1SEM A;  2X4W A;  4O6J A;  4QVZ A;  4YTL A;  3G6E Q;  2JVV A;  2AZV A;  3OY9 A;  1MHN A;  1BK2 A;  1Y96 B;  2DTH A;  2L89 A;  1IRX A;  2VXF A;  3EH2 A;  3VUZ A;  1KD1 C;  3CCE T;  3L2Q A;  3TEE A;  3L2W A;  1NJI C;  1QW1 A;  1YIJ Q;  5D6X A;  2F5K A;  2R58 A;  2ZCF B;  4M7A G;  2YHT A;  4PL6 A;  2QQA A;  4FYW B;  1NEB A;  4C0Z A;  1M1F A;  5A2Q E;  3WVE B;  1YHQ Q;  1E6H A;  1YHQ A;  1Q7Y R;  5GAN 3;  5EC7 A;  1UHF A;  4Y91 A;  2DXU A;  3N5B B;  3VKI A;  5HK0 A;  5CO7 A;  1KC8 R;  3HHT B;  2QQ9 A;  3QBY A;  4J6Y A;  4M77 B;  2JTE A;  4NL2 A;  2E1H A;  3S3O A;  4X9D A;  2JW4 A;  2K9G A;  3QZ9 B;  1K9M U;  4KH0 B;  4HCZ A;  4OML A;  2DET A;  5KYX A;  2P4R A;  3CD6 Q;  4EPC A;  2KXD A;  2LQW A;  3HL8 A;  1NBE B;  1OPL A;  4LNP A;  5FWC A;  2RJF A;  1R8O B;  2QQR A;  1BU1 A;  3VS1 A;  2HSE B;  2YXY A;  2M9U A;  2VV5 A;  3G7Z A;  5GMK h;  2EQM A;  1M3C A;  2SEM A;  2HMA A;  7AT1 B;  4M7D A;  2L2P A;  4X1V A;  2E3I A;  3SHW A;  4CRI A;  1JXM A;  5DY9 A;  1FMV A;  1M27 C;  1TUC A;  1ZA2 B;  3CC7 A;  1B7T A;  2ED0 A;  4C92 C;  3CCM A;  2OTL T;  2RHX A;  4J9D A;  5DLQ E;  2E5K A;  1I0C A;  1WQ7 A;  2LDM A;  3O5Z A;  2FB7 A;  3U23 A;  1UJY A;  5LJ3 j;  1S1N A;  1VQK Q;  1BKB A;  1M1K U;  4A4K A;  3LX7 A;  1KQS P;  2D1X A;  2XG8 D;  1Q86 U;  5HY6 A;  2MCN A;  4M7A F;  4M77 F;  1KQ2 A;  3QG1 A;  5GAN 6;  3CPW P;  4QQG A;  5I11 A;  3OYD A;  1KQS S;  3GF5 A;  1RLQ C;  3OYA A;  4LDW A;  2YLC A;  2BZY A;  2EGC A;  4F7U F;  3CCU T;  4PLL A;  4FT2 A;  4JRK A;  2ROT A;  1GFC A;  5GMK l;  4LUD A;  3VS0 A;  2X3X D;  1G83 A;  4PJO E;  2XKO C;  3DLL A;  1VQP A;  1QKX A;  2HBW A;  3SB2 A;  1ZUU A;  3E19 A;  3NHN A;  3CCS Q;  1Q82 C;  1AZG B;  1I5L A;  2D8H A;  2D9T A;  3JCM e;  2W10 A;  3EG1 A;  1VQM A;  1K0X A;  3EG9 A;  4RTW A;  4F7U E;  3JCM g;  3PMI A;  3OYJ A;  3GIB A;  5J39 A;  2CZ7 B;  2KMT A;  1T0H A;  4J7I A;  4PNO A;  1YJW T;  2O31 A;  2HCK A;  1M30 A;  4ANJ A;  2XI9 A;  2Y4X A;  1LNX A;  1I07 A;  4JS5 A;  3LWH A;  3PT9 A;  2VGN A;  4AG2 C;  4C5E A;  5GJW B;  3TQ7 P;  2K57 A;  4VUB A;  1WHJ A;  2MOX A;  2QTV A;  4GY5 A;  4F16 A;  5L8R E;  1VQ5 T;  1I4K 1;  2W0Z A;  4J6W A;  4ZN1 A;  1NZ9 A;  4K11 A;  2XDP A;  1BB9 A;  4M78 G;  2CP0 A;  1D0X A;  1JB0 E;  3FEO A;  3R6O A;  3EGU A;  3PE0 A;  2BE9 B;  1LVK A;  3PFS A;  3DLM A;  3L2Z A;  1RAG B;  3QDR B;  1UTI A;  1VQM Q;  2LP5 A;  1BI3 A;  1GBQ A;  4HVW A;  3HP9 A;  4Y92 A;  4N4I A;  3OMC A;  5DM7 R;  4M78 C;  3CCU Q;  4OF1 A;  1GBR A;  3QJ6 A;  1GCP A;  4J9E A;  2FZK B;  2LC4 A;  2LMJ A;  1K8A C;  4DBQ A;  2FRW A;  2L3S A;  1Z9Z A;  1GCQ C;  3LWI A;  4B6M A;  3G6E T;  1IHW A;  5GAN 5;  1NE8 A;  2I2L A;  3J81 E;  2A3L A;  1WQW A;  2RJD A;  1HD3 A;  4IIO A;  4QT7 A;  5AYF A;  3QUI A;  4GBQ A;  1SPK A;  3G4S T;  2XDD A;  4J6X A;  2L3P A;  1OU9 A;  5GJV B;  2YSQ A;  4BDZ A;  1QCN A;  1OPK A;  2LQ8 A;  3CCQ T;  4J5Y A;  1XOV A;  3NTK A;  1S72 Q;  3TRE A;  4NOY A;  4J9B A;  2E3H A;  3THK A;  2DAQ A;  2RQU A;  1SSH A;  5IHN A;  2JXB A;  5GAN h;  4O5V A;  4TVR A;  3CCL T;  1QCF A;  4RKU E;  2CUB A;  2LZ6 B;  2CGH A;  1WXB A;  4M77 D;  1WXT A;  4ZTJ A;  1Q82 R;  3A8H B;  5D6Y A;  1H8K A;  2QDY B;  4QVC A;  1K73 C;  4A4H A;  4M77 C;  2FG0 A;  4AFZ C;  2DL7 A;  3OS0 A;  4PJN A;  3JB9 I;  1KHC A;  4OP0 A;  3VS4 A;  3CCJ T;  3CPW A;  2CP3 A;  2ZPE B;  2ZGW A;  3A98 A;  3S3M A;  3X28 B;  2A08 A;  5FU7 C;  4R56 A;  4D8K A;  1VIF A;  1W1F A;  2EJG A;  1D0Y A;  3H8Z A;  2BZ8 A;  1OX8 A;  2XD0 A;  2CP2 A;  5GAN g;  3I5S A;  1JQQ A;  2KNB B;  1GFD A;  2K5F A;  1KC8 C;  2A37 A;  1RI9 A;  2EKO A;  2E70 A;  2MI6 A;  2WSE E;  2PQW A;  3C12 A;  1YJN A;  5GAO p;  3VS3 A;  5GAM e;  1ZSZ C;  5A0L A;  4BUG A;  1AWO A;  1JJ2 A;  4XTY A;  2FO0 A;  4J9I A;  4IUQ A;  1IRE B;  2RPN A;  2YRD A;  3BFM A;  1VQ6 Q;  1KD1 R;  2EW3 A;  4F04 B;  2KDS A;  2F2V A;  1IGU A;  1G3T A;  1WHG A;  1NLP C;  1Q7Y U;  3V8K A;  5GAN e;  3REB B;  2DYI A;  3I56 A;  2R57 A;  2OX7 A;  1X6B A;  3VRY A;  2WAC A;  1WPY A;  2MWP A;  2HL3 A;  1F1B B;  3ZBD A;  1QVP A;  4ZTF A;  2DBK A;  4M78 F;  2J06 A;  2PNI A;  5FWB A;  3CC4 A;  2PVO B;  2RI5 A;  4ELZ C;  4OMQ A;  1RAF B;  3J7A F;  3MEW A;  1M8V A;  1WJQ A;  4E6R A;  2H3J A;  1QLY A;  4M75 C;  3M9Q A;  3GOX A;  3RNJ A;  3UPU A;  2O4X B;  5GAO r;  1W70 A;  1SRM A;  3C0C A;  3LGL A;  5FU6 B;  3JB9 D;  1QP2 A;  3SFM A;  2LCL A;  3KBG A;  1N27 A;  3QPH A;  4C8Q D;  2VWF A;  3M55 A;  3QWY A;  3PIO A;  2VB6 A;  2JMA A;  2CDT A;  3VV0 A;  2XID A;  3EHR A;  2FVU A;  3M59 A;  1JO8 A;  4ZGD B;  2KGT A;  2XHC A;  1ACM B;  3REA B;  2H8H A;  4BD3 A;  3OA6 A;  2EBP A;  1W2B S;  2EAY A;  2A0F B;  1D3B B;  5GAN f;  3PTA A;  2I0N A;  4V2S A;  2QEX T;  1VQ7 A;  2RB6 A;  2C0I A;  2D8J A;  4DBR A;  1IZ6 A;  1ZQ1 A;  2M02 A;  1Q86 R;  3HPW A;  1TSF A;  2RM4 A;  4ESR A;  4RG2 A;  2KE9 A;  3MO8 A;  1WA7 A;  2SRC A;  1PHT A;  5KYY B;  3A1P A;  4OMM A;  2QG9 B;  2EQU A;  2KAF A;  1D1B A;  2AT1 B;  2DF6 A;  1W4S A;  1Q81 C;  1IHV A;  1KIK A;  3ZEH A;  2DA9 A;  5A0G A;  5KE2 A;  4C92 D;  2HZY A;  2KRM A;  4E7H A;  1O9S A;  2DYB A;  4E47 A;  3JB9 J;  4QQD A;  1AWW A;  1VYU A;  4XK8 E;  1FWZ A;  3MEU A;  1YIT A;  1ABQ A;  3G71 Q;  1AHJ B;  4B9X A;  4FW1 A;  4JZ3 A;  3CCV T;  3MP1 A;  4E7Z A;  3OYB A;  4M78 E;  5CK9 A;  4L59 A;  2ZPI B;  1N8R C;  2F69 A;  2L8D A;  4WF2 A;  2K6D A;  4LDV A;  1Y0M A;  2ED1 A;  4JZ4 A;  1MV0 B;  2KSS A;  3P8B B;  1KC8 U;  1W6X A;  4FSX A;  5GAO m;  1TOV A;  3LH5 A;  4XU3 A;  4B9W A;  3INZ A;  2RQT A;  2JM8 A;  2DPP B;  2LX7 A;  1HYO A;  5D6W A;  4PJO C;  3R6N A;  1J3T A;  2YUQ A;  1MGQ A;  3CBM A;  1UGQ B;  2ZPB B;  3OYM A;  3CCE A;  2Z0W A;  4E7L A;  4ZNX A; 
#chains in the Genus database with same CATH homology
 4RTX A;  5I11 A;  2EGA A;  1X2Q A;  2DL3 A;  1RLQ C;  2PZ1 A;  2BZX A;  4Z8A A;  2BZY A;  1UUE A;  2EGC A;  2DE0 X;  1M3A A;  4HCK A;  1CKA A;  2CSQ A;  1MUZ A;  2JS2 A;  2ROT A;  1GFC A;  1GCQ A;  1QWF A;  4LUD A;  1K1Z A;  2KT1 A;  3VS0 A;  1VYV A;  2X3X D;  1G83 A;  2CH4 W;  2KBT A;  1UHC A;  4ORZ A;  2X3W D;  1ZUK A;  4RTY A;  1PKT A;  1A0N B;  2FPD A;  1QKX A;  1WIE A;  2HBW A;  1ZUU A;  3NHN A;  3RBB B;  1PNJ A;  1AZG B;  2D8H A;  5L23 A;  2W10 A;  3EG1 A;  1ZBJ A;  1U5S A;  4RTZ A;  1K0X A;  2RQW A;  2DJQ A;  4RTW A;  1QWE A;  1WXU A;  4JJD A;  3KFV A;  2HDA A;  4J9G A;  2DBM A;  1FMK A;  1X6G A;  1T0H A;  2O31 A;  2HCK A;  1GRI A;  1T0J A;  1M30 A;  1CSK A;  1TG0 A;  2OAW A;  4DEX A;  1I07 A;  1IO6 A;  3M0R A;  1LCK A;  1N5Z A;  2A28 A;  2O88 A;  3TVT A;  4AG2 C;  2B86 A;  2FRY A;  5GJW B;  5IHK A;  2J6K A;  1SRL A;  4GLM A;  2JS0 A;  2OI3 A;  1B07 A;  1ABO A;  1KFZ A;  2MOX A;  4AFS C;  2LJ1 A;  2K7A A;  4F16 A;  2EKH A;  4CC7 A;  1E7O A;  2HSP A;  2CUD A;  1AVZ C;  2W0Z A;  1KSW A;  4K11 A;  1BB9 A;  4OMO A;  2EGE A;  2CT4 A;  4CC3 A;  2AKL A;  4OMN A;  2FPE A;  3EGU A;  3M0S A;  2L0A A;  3PE0 A;  4LUE A;  1NG2 A;  1UTI A;  1E6G A;  1VYT A;  2LP5 A;  3SEM A;  1GBQ A;  4HVW A;  3I9Q A;  4Y92 A;  2O9S A;  1KJW A;  1X69 A;  4LE9 A;  1GBR A;  1GCP A;  3NMZ C;  4J9E A;  2CSI A;  2LMJ A;  2GTJ A;  2KEA A;  1X43 A;  4JJB A;  3VS2 A;  1I1J A;  2ROL A;  1UDL A;  1ZX6 A;  2FRW A;  2L3S A;  1Z9Z A;  1GCQ C;  3VS6 A;  4M4Z A;  3M0T A;  3NGP A;  2DIL A;  4Z88 A;  4RUG A;  1HD3 A;  4KRT A;  4IIO A;  3H41 A;  4QT7 A;  5IXF A;  2JM9 A;  4GBQ A;  1SPK A;  4JJC A;  2EYW A;  2L3P A;  3EG0 A;  3H0H A;  2VVK A;  5GJV B;  2YSQ A;  1OPK A;  2J6F A;  1XOV A;  1YP5 A;  4Z89 A;  3QWX X;  2BTT A;  3PVQ A;  2PTK A;  4RTT A;  1PRL C;  3UA7 A;  4WCI A;  4CC4 B;  1EFN A;  4J9B A;  5ECA A;  3THK A;  2V1R A;  2RQU A;  1SSH A;  1UJ0 A;  2DNU A;  5IHN A;  2JXB A;  1UFF A;  1K76 A;  2VKN A;  1K4U S;  3TSZ A;  2C0O A;  1QCF A;  1RLP C;  2K3B A;  2CUB A;  1JEG A;  1ZUY A;  4HVU A;  2XMF A;  2LZ6 B;  2DL8 A;  3ULR B;  3M0U A;  1WXB A;  1WXT A;  1U06 A;  1X2K A;  4RTU A;  1PKS A;  2DVJ A;  1H8K A;  2GBQ A;  2C0T A;  1AOJ A;  2IIM A;  2LNH B;  3VRZ A;  1UGV A;  2AK5 A;  2FG0 A;  1WFW A;  2EYX A;  4RTV A;  1FYN A;  4AFZ C;  1PRM C;  2DL7 A;  3PVL A;  1G2B A;  2DLP A;  3VS4 A;  4A63 B;  2EPD A;  1YWO A;  2M51 A;  3M0Q A;  2J05 A;  2DX1 A;  3A98 A;  1Y57 A;  1WDX A;  1SHF A;  2LCS A;  3UAT A;  1RUW A;  2A08 A;  1MV3 A;  1U3O A;  2JT4 A;  4FSS A;  4D8K A;  5IH2 A;  1AWX A;  1Z9Q A;  3NPF A;  1W1F A;  2GQI A;  1GL5 A;  1AWJ A;  2RNA A;  2OJ2 A;  2LQN A;  2BZ8 A;  1NLO C;  4EIK A;  1AEY A;  3I5S A;  4JPB W;  2EVR A;  1M8M A;  1JQQ A;  2KNB B;  2G6F X;  2DL4 A;  4OMP A;  1GFD A;  2DMO A;  1T3L A;  2D0N A;  2A37 A;  1RI9 A;  3M0P A;  2ABL A;  4CC2 A;  1M3B A;  1WX6 A;  2YDL A;  1NYF A;  2KR3 A;  3VS3 A;  1YN8 A;  3VS7 A;  2LJ0 A;  1HJD A;  1AWO A;  5IXB A;  1X27 A;  2FO0 A;  2KRS A;  4J9I A;  2DL5 A;  5I22 A;  2DRM A;  2RPN A;  1ZLM A;  2AKK A;  3CQT A;  2EW3 A;  1AZE A;  2F2V A;  2KXC A;  1CKB A;  1VA7 A;  1NLP C;  2KT8 A;  2A36 A;  1WI7 A;  3REB B;  3UF4 A;  2GNC A;  3H0I A;  1ARK A;  2EYY A;  4DEY A;  1X6B A;  3VRY A;  2YT6 A;  4F17 A;  3JV3 A;  1WLP B;  2GTO A;  2F2X A;  2K2M A;  2KRO A;  2DBK A;  3FJ5 A;  2J06 A;  2PNI A;  5FWB A;  1OOT A;  2K79 A;  1K9A A;  2KYM A;  2ENM A;  5FW9 A;  4OMQ A;  1JXO A;  1H3H A;  3UA6 A;  5HCK A;  2ECZ A;  2YUO A;  1QKW A;  4LN2 A;  3I35 A;  1OV3 A;  4E6R A;  2QDL A;  3IQL A;  1TUD A;  1QLY A;  3RNJ A;  2O2O A;  1W70 A;  1SRM A;  1BBZ A;  2CH4 A;  2FEI A;  2YUP A;  3C0C A;  3I5R A;  2EYZ A;  1SEM A;  3TSW A;  1ZSG A;  2DM1 A;  4F14 A;  2J6O A;  1YNZ A;  2AZV A;  2VWF A;  3QWY A;  1H92 A;  1BK2 A;  2JMA A;  2CDT A;  3EHR A;  1JO8 A;  2KGT A;  3REA B;  2H8H A;  4R0K A;  2CT3 A;  4IIM A;  1V1C A;  2EBP A;  2M0Y A;  2KYB A;  2V1Q A;  2I0N A;  3H0F A;  1NEB A;  1NM7 A;  2C0I A;  2D8J A;  2O9V A;  2RQR A;  1E6H A;  2NWM A;  4ESR A;  1UEC A;  2KE9 A;  5EC7 A;  1WYX A;  1UHF A;  1UE9 A;  3VS5 A;  1WA7 A;  2SRC A;  5IHI A;  1B3Q A;  1PHT A;  2ESW A;  4OMM A;  1PWT A;  1OEB A;  2JTE A;  2MIO A;  2JW4 A;  2K9G A;  4HXJ A;  2DF6 A;  3GBQ A;  4OML A;  2P4R A;  3EHQ A;  4J9C A;  1KIK A;  1HSQ A;  2J7I A;  2DA9 A;  2KXD A;  2LQW A;  1OPL A;  4LNP A;  5FWC A;  2KRM A;  1YCS B;  1BU1 A;  4J9H A;  2DYB A;  2CRE A;  1UG1 A;  2YUN A;  3VS1 A;  2EQI A;  1AWW A;  2KRN A;  4AG1 C;  1VYU A;  4AFQ C;  2RN8 A;  2FPF A;  1JU5 C;  1ABQ A;  1M3C A;  3EG2 A;  4HVV A;  2SEM A;  4JZ3 A;  1NEG A;  2HEQ A;  1T3S A;  1YWP A;  2L2P A;  4X1V A;  3SHW A;  1JXM A;  2RMO A;  2GGR A;  1M27 C;  1TUC A;  2K6D A;  1Y0M A;  2ED0 A;  2ED1 A;  2RQV A;  4JZ4 A;  2JMC A;  1NYG A;  2L3Q A;  4J9D A;  2E5K A;  1MV0 B;  2LJ3 A;  1AD5 A;  1I0C A;  1W6X A;  3O5Z A;  3LH5 A;  3U23 A;  1UJY A;  2DRK A;  1S1N A;  4J9F A;  2RQT A;  2NUZ A;  2JM8 A;  2LX7 A;  2F2W A;  3R6N A;  4D8D A;  1J3T A;  3EG3 A;  2D1X A;  2YUQ A;  2MCN A;  2RF0 A;  3ZL7 C;  1K0S A;  4AFU C;  1SHG A;  2AZS A;  4ZNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...