2J73A

Alpha-glucan rcognition by a family 41 carbohydrate-binding module from thermotoga maritima pullulanase pula
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
103
structure length
103
Chain Sequence
FTETTIVVHYHRYDGKYDGWNLWIWPVEPVSQEGKAYQFTGEDDFGKVAVVKLPMDLTKVGIIVRLNEWQAKDVAKDRFIEIKDGKAEVWILQGVEEIFYEKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PULLULANASE
publication title The Structural Basis of Alpha-Glucan Recognition by a Family 41 Carbohydrate-Binding Module from Thermotoga Maritima
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 21
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature ec 3.2.1.41: Pullulanase.
pdb deposition date 2006-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03714 PUD Bacterial pullanase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2j73A00
3AWFA 3AWGA 3V0EA 2J71A 2FHFA 2FHBA 2FHCA 2YA1A 5BUGA 2J44A 3V0FA 3AWEA 3V0DA 3N0AA 5BZZA 5BZXA 3V0GA 2J43A 2YOCA 2J73A 3V0JA 3V0IA 1D5RA 3V0HA 2J72A
chains in the Genus database with same CATH superfamily
2A2QT 5HHQB 2ATKB 2C9SA 5I15L 3SE4A 1MCWW 2A9MH 3G6DH 2VISB 3O3AB 3OR7B 1F02I 5AWNH 2IQAA 3QP3A 3Q05A 3KVDD 4LBEB 1NMCC 3LMJH 2B5IB 2XI9A 2FX8H 1BD2E 4JZOA 3SGDH 4PS4H 2F1AA 3MCKB 3NQIA 4JRYD 4GW1A 2GSGA 3T0EB 2OR9L 4HETA 2XWDA 5H37G 1Y6NR 3VSVA 3EH2A 4M6NL 4KK5D 4P23D 3POCA 1E40A 4QRSA 3CFKB 5HDQL 4RGOH 1B90A 3POHA 5GS1A 3QA3A 3O4LA 3HFML 3BO8B 1DUZA 2F08A 2VLJE 3GJFA 4XP9H 3LRSB 5DMGD 5EEWA 3UP1A 2NYYD 3BH9B 2HPOA 4LLWA 4G6FD 5CKAA 1JHLL 2B59A 3DX8B 1KCRL 1KPRB 1UWEH 2QDVA 4YNYB 2OSLA 1SHMA 5F6HI 3ULUF 3DHUA 3EO0B 1H3PL 1N64H 2OPCA 1WCBA 2ODHA 4WI6A 3AQZA 1GHFL 5HTSA 1OAQL 2EDRA 4L8DA 5C97A 1G9NH 4JGNA 3EFOB 4I48A 4LB8A 3RNQA 2KLTA 2WXPA 3FH7A 3S3PA 4OCXH 3V5KB 2ARJA 1CFSB 1EIBA 4O51B 4YGVA 4Y2NA 1K8DA 4RAHA 1CIUA 4XMXA 1XIWB 1YG9A 2JTDA 1MWAH 4LDEB 4XBEH 2F7QA 4MMYB 3HI5L 2VDOL 4WI8A 2J21A 3RL1B 4EIZC 1M3IA 3PWJB 1BECA 4NOFA 3LNEA 1F3DH 5L6YL 3QQXA 4GP5B 4X2UA 2ZIDA 4KNSA 2CIIB 2WVUA 2YKLL 4R4FH 1JV2B 1U95B 3FF7A 2X4RB 3VFPB 1AGBA 1FG9C 4PJ5E 1DVFA 4FABH 3N40F 4GIAA 5IBTL 4FA7B 1WAAE 3E8UH 4LHUD 5C86A 1IC7H 3OKKB 4LVHB 3RI5K 1XSKA 3LRMA 3MQIA 3MRMB 2AJZA 1SJEA 3L3IB 5CLZA 3EH3B 3FOLA 5FLUA 1FGNL 1C08A 1N3NB 2QVMA 3QT2A 1JGUL 1CL7H 1ZA6B 1R0AH 3TJEH 1E2WA 4FFVD 5JYLA 3MRPA 3OJDB 1F4YL 3RJDA 3HJ0A 2EIBA 4W6XB 2R69A 2X44D 3VYOA 1O9VA 1AFVH 1ET7A 1E6OH 4K9EL 4I9XA 1ADQA 1FFRA 1RKRA 3FU6A 4Z3IA 1DZ0A 1JFHA 4H13C 5MERA 4LCIH 4K7PY 1TXKA 1GGCL 4RMRA 2A6DA 4LLVB 4A63A 3N42B 1JRHL 4P5KA 5DFTA 1A4KA 3ESPA 1SJMA 3FSWA 5D7HA 4GBXA 2Q76B 5J3HC 2XKUA 1ZDSA 4HFUL 4HS8H 2GSIB 1WUNT 5GGVH 3SDAD 3GBNL 2JFCA 4D9RE 1J9CT 1J5OL 5EU5B 2F8XC 2I32A 3MV7A 4LSDA 3DHJA 1HHIA 3FUJA 5DUPH 4Y2DD 5JW3L 4QXGH 4X4YA 1P53A 2G0KA 4IDJH 4ZUVB 1CS6A 2NSMA 3FOMB 2EE0A 5E5MB 1AIFA 3BP7A 1EFXB 4XHJC 5HI5C 4GQ9H 4OLUH 4MGXA 2EE9A 4OZIF 3DTDA 5DJ0A 5HYJD 4QOKD 2OSXA 1UXWB 4PB0H 1FVCB 5D1XC 4BFBD 5TQ0H 1F00I 2ZE0A 3CZFB 4MQSB 3C8KB 4LL4A 2HFFB 4NM4H 1D3CA 5DVPA 1EZVY 1H3GA 1K6QL 4GPVA 4HF5L 2Z8WC 3R7RA 5BCAA 4IBYA 3V5HB 1UD5A 5HHVL 1JPGA 4NQSB 5F1SA 1LQBC 3HS0B 3EOAB 1CFNA 5HYQB 3GXNA 2GJPA 1HVXA 4RMWA 2ZAIA 2FHCA 3WELA 2OFQA 4OCYH 1UWXH 5ANHA 5LQBL 5E2UL 2YIHA 3WIFA 4PJIA 3KM1A 2BNUA 1OZUA 1A4CA 1UXSA 3QYMA 4WGVB 2WKGA 1QLEL 3C9NA 2DZEA 1BJ1H 3BD4A 3KGTA 3NN8A 4UIKL 4ZS6D 4B0MB 1PG7W 2I24N 2OMYB 4B9GA 4XVTH 3BT2L 1J0YA 4DW2H 4MD0B 2JV6A 1HHGA 2VAAB 2H3NB 1MUJB 4HCRH 3QG6B 4UTBH 3X2QB 4TNWF 1AD9B 5KVDE 1IGML 2XTJD 5D7KD 4NQXA 4BFIB 2D7QA 2Z31B 2FEJA 5JA9A 4LPWA 2A99A 2WC7A 4L4TD 2NUPB 1J5IA 4NDMB 1MOEA 3FFCE 1EHAA 2G2RB 3OZ9L 1HNYA 3HAEA 1QMUA 4OZFG 5T3XH 4JFPB 2I85A 3VFWA 5A3IC 5K9KA 3NIDB 4MWFB 2Z8RA 2QGBA 5HYFA 2IO5A 2XWRA 3IDXH 2PTTA 2X7LB 1JPTH 3BWUC 5E9DA 1U3NA 5FR3A 2NSQA 4QHUA 3VXQB 1Z9MA 4GRLC 1W72H 3U1QA 2AK4A 7TAAA 1IBBA 5CGBA 2DIEA 2F5AL 4YR6B 1PZ2A 2O30A 3D0AA 4JM2B 5C8JA 3T1WA 3OSVA 1PAMA 3H4FA 4ZOEA 4PLKD 5IVOA 1HCFX 1XFPA 4LIQE 2ZUQC 3PUUA 4MXWH 1F6AB 3RX5A 3BWAB 3HI6L 1B3IA 3L95A 3HG4A 5D71L 4ESKA 3TS8A 1IFRA 4AEFA 2J44A 4ZPTB 1FYTB 2XBZA 5CO1A 4PUBH 3CFEB 4DZ8B 4IEFA 5HGHA 3S97C 5FA3A 3PDOA 1N5YL 4B6ZA 1KELL 3D85D 3PGFL 3C60C 2G4GA 4OLYL 1OARH 2XVGA 5AOMA 2NNFA 4U0RC 4DJMA 5BW7A 2G60H 4HK0B 4AIZB 4JRFA 3GSOB 3X11A 2DQUH 2WXMA 4WUUD 5C0FA 1VEMA 1S7UA 1E8YA 4NJ9L 1AS6A 2YPLA 3M8OL 3MNWB 1MHEB 1RU9L 5EWIH 4AKQA 1WTLA 1Z5LB 2B20A 3NH7L 4P2QE 5EUOE 3TCTA 1OCCB 4XBPA 1S5IL 1XF1A 4ICXA 1YNTB 3EOBB 3Q3GA 4U6XA 4XNUL 5ETUB 4P2RE 4F57H 2Y7NA 5D2LB 4B53A 1KC5L 4LOVA 4ZXBA 1FRGH 2VABA 4L8SA 4KOBA 3U9UB 5DJDB 2YEZA 4OU3A 4CVXB 3LS5L 2EIKB 4OLVL 4TXVB 3SE6A 2OL3B 1JXKA 4HUMB 1I1CA 3WS3B 2EEAA 2R59A 5HGBA 2VR6A 2EIZB 4JY4B 4E41D 1PFCA 4JR9H 5DJXA 2UUDK 1L0QA 2L7QA 1MI5E 3CVHH 1M71B 2F54E 3KBPA 4HPOH 2JCCA 4P2OB 4U2ZA 4AL8L 3VDBA 4R96B 4KJWC 3W56A 3EHBD 5E6YA 4LARL 5F72S 3U4AA 4ELMF 2OYMA 4GP4B 5F0JB 5GZNC 1XF2B 1KIQB 4GQRA 2PXYC 5IVXB 3SKJL 2J1YA 1MH5A 5DRXA 4FQ1H 3RWCA 2ZP8A 5D5ME 1CQKA 4HKBB 4MZIA 5AVQB 2HRHA 3S37L 4MD5B 3WHXA 1UEMA 2NDFA 3UYRH 4NBXB 1ETJA 5I8KH 2Y6SD 5A43C 2FX7H 5CIPB 2QVIA 3IDGA 2CRYA 4NPYA 1HWGB 3K6NA 1T7WA 2BSBA 1WA2X 2CH8A 2CR0A 5JHDB 3OAYH 5C08E 3DX6A 4MNQE 4A68A 2GT9A 1R5VA 1BREA 1OK8A 1JK8B 4HSAC 3TTYA 2LU4A 1A0QH 3CVDA 5KANI 1GYAA 2P3YA 4G72B 3ZQXA 2VDLH 5FYKU 5L0QC 1E9PA 2OK0L 4OIAA 5FYKH 5F8RC 1QLFA 3BAXA 2BMKB 2VM9A 3FO2B 4CADA 4OJFL 1KJMA 5DD0L 3TU6A 3ZIMA 1ZA3B 1D2PA 3A21A 4DZBB 1YUKB 3WAKA 5IGXH 3CVIH 4HBQA 4Y4KA 3QIWB 3VXUD 1G7IA 2UWEE 1CLVA 2HFTA 3VW3L 3P4NA 3TNMA 3ASWA 1WA0X 4V1DE 5C71A 4HT1H 2I9LB 2JK5B 2F1EA 2R29A 4W4NA 3ISWA 4BZ1H 2YQ2A 1MAML 4Z9KB 3W9DA 3BP4B 1KBKA 3LKNA 2V2WA 4RWYL 4N0UA 3S34H 4RIRA 4M00A 5FYJU 1NCGA 3JBG7 5D9SB 5FYJH 3GJFH 1SNRA 3U9PL 1FSKB 4R7DA 5KYNA 3OLIA 1MQ8A 3UZQB 2PPCA 5FEBA 5IB3B 1XH3A 1IM3B 1BYPA 1SDDB 1DVSA 2EECA 3ARUA 1CGSH 3R0MA 1MSPA 1DBJH 5TFSH 1BOGA 3QUMH 1ZSDB 5DRWB 3HC4H 5E4EC 1JZFA 2A9ML 3F64A 3G6DL 3ILPB 1H5BC 4WENB 2DIAA 5JW4R 2JB5L 2XV3A 3WFEH 2GI7A 2OSWA 1MWOA 1WITA 3OKNA 3OC8A 3D4YA 5IV2B 4H25B 3INUH 3U6XA 3IU4H 3P0YL 4XGZA 5TPWL 3KPSD 1N12A 4HDIB 2YEQA 1QRND 3BIBX 5IW1B 3BMVA 2W80C 3QK0A 1BGXH 5HVHC 1W0YT 1EEZA 5E94A 2CLZA 2QQNH 4B5ZA 1YEHL 5IKCA 4HIEB 3D7PA 3FO1A 4RGOL 2FAUA 3ZU8A 1DDTA 4DP9X 5BVJA 4NUQA 1KNOB 1ZHLB 2AJUL 1EUUA 5E1QA 4AY0A 2ODIA 2EDLA 5BPPA 4N0FA 4XP9L 3G6JB 1C16B 2VDML 2ZKMX 4UWQB 1KTRL 2E8ZA 4HXBH 1KXQE 1DUYA 2V4LA 1TCRB 2WWMD 3PL6D 5EEXA 5DJZA 2WLJA 2KZKA 1OT2A 3L6FA 3WKMH 2F8VA 2IAND 1A6TA 3DOHA 2QQLH 1ETZA 4M1CC 5DVKA 1A3ZA 5IY5B 2YOCA 4F8QA 4YMPA 1BD2A 4AMKH 2FH8A 3SYQA 3PV6A 4L0YA 1QBAA 5IJVA 3BPNB 5IBUB 4HULB 1M1XA 5CMAB 5GGSA 2XBDA 1IEAB 3K4AA 1NBCA 4W9FC 4ANXA 1PKQB 1BOYA 4NKIH 5CSGA 4DN3H 2VQ4A 1J12A 2FJUB 4JDZA 4J3UA 1WS8A 3BT0A 1ADQH 3CFNA 1MWAL 1JDDA 5BS0A 1FZKA 2GW5A 3P9WB 3QCUL 4Z78A 2XA8L 2Q86B 3WFDL 1DVUA 3IDNB 2VR9A 3KBEA 4MMXC 4PRHE 1H3VA 3GS4A 3HOGA 4K07A 4A7GF 4DP6X 5CD5C 3D34A 3HN8A 5KSAD 4B9JA 4F80A 2ED7A 4O58L 1FIGH 3AUVA 3KPQA 4PJEE 3SPCA 3CZKA 4PWJA 2FHBA 4F58H 2XZAH 4YJZL 2H32H 1KXVA 1H8SA 2GBAA 1UB6B 3C09B 4KI5E 4WKZA 2VR3A 1IC7L 4ZD3L 3SPHA 3ZZLA 1KTLB 4JG1H 5CUSH 2HH0L 5I6MA 4BH7A 3ECVA 4Q7DA 4D9QD 1LO2H 3D6GA 5IROD 3QNXA 4ODUB 3S4SA 4DTGL 1ODUA 1CL7L 1P2CA 2F53B 2OZNA 2RQEA 1ZPUA 2J2ZB 2VYRE 4BD4A 4U1LA 5I8OH 1ORSB 3CAFA 4UQ3B 3GMOB 2OULB 1HDMB 3T3MB 1X5XA 1FZOA 3QJRB 1U3ZA 5D7JB 5EZLB 3AREB 3STLA 4PJHE 1ZE3H 3QISA 1T0NA 2Q3XA 1RMFH 3KBFA 4R2GC 5FUOH 1L9PA 3RDTA 5L4JA 3FO9A 4YS4A 2I60L 4N2HA 4FYSA 1PLGH 1E5AA 3N06B 5FO9B 4PJ5A 3QXVA 3VI3E 2QELA 1WAAA 5GGVL 4HKZA 3QXDA 2WZPD 5I0WA 4MJ4A 3O2VH 4BZ2L 1G6RB 1WO2A 3CK0H 4OLXH 2X2IA 1HOCA 4KK8C 4YSDA 1TENA 1MLCB 5DUPL 1FVEB 2OMTB 2TSBA 5AOIA 3L7FA 4QXGL 4LXFA 4IDJL 4JKPH 3HKFA 2OQJA 1MCQA 4OLWL 3C8HA 1DL7H 5GJTH 4IOSA 1J8HE 1KFAH 1RUPL 1INQA 2ZXWB 3B37A 4HWZB 4OLUL 3SKUD 4FQQB 4P4KA 3DX0A 1M7XA 2EDYA 3WNNA 1OTSD 2H9GA 2JJUA 4ODBD 5LUMA 4PIBA 4EUPB 3KVPA 2AVGA 4LSPH 3MA9H 5CS7A 4Q9QL 3FT3B 1CK0L 4JN2A 1KGCD 3Q6FA 3HUJF 5TQ0L 5F6HJ 5CCHE 4PRIE 5KVEL 1MJ8L 3BZFA 4ODXA 3TOPA 3CFTA 5DI8B 2JTYA 3GD1C 3HAEH 1URZA 4ONHA 3QIBD 4D0BA 2R0KH 1A14H 5AW8B 3VFMB 1BPVA 1QFWH 5C07E 4LHJB 3CZSA 4XPHH 3S5LA 3QPXH 2CGZA 1FBIL 3ES6A 4I0PD 2FLBT 3SKMB 4ZFGH 1QSED 1TJHH 3TVMD 4CMHC 1KIPB 4G6KH 5DA0B 1TYJA 4QYAA 4MX7A 4LCCA 4N8UA 2DOCA 5AW7B 2XWEA 3KWVA 5HHOD 3UFIA 3TT1L 4HD5A 2MMXA 3DARA 4QRPD 3LSOB 5K59E 3QUYC 4GP8B 5D1QA 3V6ZA 1MJUL 1TQVA 2XX0A 4JDVA 2VLRD 4IS6A 5E6IB 1NANI 4I2XB 5IFJB 3RVWD 3P9LA 5I76B 4R26L 3RU8H 2O6EA 1WWCA 1CGUA 4GKZA 2JIXA 5ILTH 1NFDF 1PZDA 2OTWB 4L4VA 5T3XL 3ESMA 5IEHA 4IGBB 3TV3L 4U1HB 4YVUA 1R17A 4UDUB 5ITFA 3NJLA 5JHLA 2JKRM 3GHPA 3EO1B 4PRPD 4ODHH 4W9DC 2BDNL 1KJ3H 1OEZW 1W72L 4U1SA 4Z7UF 3HI1A 1KPVA 4ZPVB 5DMKA 5A2AA 5A2FA 3QFJE 2HKAA 4J2XA 3NK3A 1FNAA 1UYWH 3L4WA 5HHPB 2B1HH 2ZXEB 3LH2H 5J57B 3S36X 4H1LH 1E5YA 1BCIA 2I25N 3NCYS 5TDPA 3TCLB 1AHWB 1PYWB 4MXWL 3NA4A 3SEPA 4HIQA 4R4BB 1I85C 1M6OA 3K6SA 4DHLA 4F2MA 3DVNB 4PJAA 5DD3L 4CU8A 4MMXA 4R3SB 1XR9B 3VVVA 3N43F 4KKCD 3VGFA 1JZ6A 3TO2A 3FFCA 5IOKA 1Q9OA 5ESVB 1UA3A 3OF6A 1P7QA 5E2TH 3RPBA 5L8LB 3PAYA 3B6SA 3GSWB 3VYPA 3RTQC 5EN3A 4JM4L 2FNBA 2X6BA 1F56A 4B41A 2MPAH 3O4LD 4DGVL 5T1JA 5F9JA 4B0MM 4XRCB 4ZRGA 5BRZE 1EZUA 3BLKA 4JRYB 2IH3B 1JTOA 4M6ML 4MS8C 4PY8I 1TZHA 4CBPA 1FCCA 1CICA 4FG4A 1BG1A 1I7UB 3EOYG 4PWIA 3L3HA 3NCEB 4P23B 2ZZUT 5MENE 2DBJA 1E27A 3R19A 1KFGA 2CDEB 4Z7QF 3FQTB 3UO1H 3ZR5A 1F8TH 1Q9KB 3QFDB 3ZE0F 4AH2B 5IK3A 1NEZG 2DJUA 2OMZB 5CCJA 4NCDA 1TVHA 1PJ9A 3ZX1A 5JW5A 2HG5A 3FS9A 1J18A 3BSZA 1A6ZB 3P2DA 3CFBA 4DPCX 4DVBB 1Z0NA 2YA0A 2VERN 2WXRA 2N3JA 1QEWB 1MJJA 3L9YA 4GAGL 2J5LB 3B9KC 1ZEAH 2X4SB 4AYSA 3B1UA 1URIA 2WBJC 3MFFA 1BP3B 4MJ6B 4P9HC 5CLYA 4ZX5A 1OPOA 2AAAA 2LLGA 3DK0A 5D7SL 4NO2A 3MRBB 4V2CB 4BK5C 4MA1C 3VXME 4P2QA 1NMBH 2Z64C 5C6PB 1DVFD 2P7TA 1R3HB 3C5JB 3FTGA 4UZGA 3KWWA 4HG4J 4Z7IA 1RJYA 4WW1B 4L8CB 5L9DH 3DV4A 3OGOE 2XV0A 3GJEA 3LCYA 1WYJA 5B8CB 3ULVL 4PJBB 4AYBA 3L9RB 1EEQA 1XB3A 3CQPA 2BVPA 3F65A 2R29H 3DJRA 1YEDB 1QTPA 2HN7A 3WJLA 4IU2A 3QWQB 3UYRL 1K4CA 2OMNA 5IR1A 5A1AA 3AT9A 1PCSA 1DQJB 2PTUA 3DIFA 3LEYL 3MNZA 4NZRH 4GKNA 4LOFA 3RVTD 4CW1B 2Q1EA 1WIPA 3EJCA 1LEGA 2BP8A 4LHUB 2HJFA 1X9LA 4S1DC 3ESVF 5FFGA 3VTMA 2FJHA 5A6LA 3DVFA 5DQ9A 1ZKAA 3FXIC 4DKDC 1MI5A 1IC5H 1NCWH 3KPPB 3L7EB 4GBXD 1FQ9C 2C1OA 3L2LA 5T1KA 4K3EH 1HE7A 4XPFH 4P8QA 4F2EA 3OR6B 1P7KA 4JY5H 4RGND 1A65A 4YHKH 1PZ5B 4FFYH 3WDIA 4PLJD 2VMEA 3MV7D 4XXCA 1MHCB 3WFBL 4GUQA 1L7IL 5CILH 2HFEB 2ADJB 2ERJC 1S9KC 2BFGA 2N0MA 2R8SL 5IGXL 4X9GA 4Y5VC 1KG0B 4TSAH 3ZDZB 4XT1C 1S9XB 4YHPA 1U8HA 4BZ1L 4ETQB 4YSEA 5B38A 1ML0A 3SDAB 5D4HA 1DFXA 3EOTH 1J11A 1RLBA 4WY7H 3V6FA 3MRHB 3BSHA 4JHAL 3KJ4B 4E9LA 4J1UA 4PG2A 4X98A 1XV8A 4YK4B 5EPMA 2C34A 4Y2DB 1NIBA 3ESOA 1U4FA 3BDXA 3MNMA 3WJMA 5TJWK 5EEVA 4IKKA 2WXKA 2UXVA 3NCWA 3F62A 4A2EA 5HYJB 4QOKB 4Y4HB 2EKSB 3KGSA 3LQAH 3CBRA 3MGOA 2V9QA 2VUYA 5D96C 5F1KC 3RWGB 4B9IA 1TZGH 3MJ9L 4GUCA 3KEDA 4WNSA 3HZ3A 3TJHD 3SDXF 4V1DA 4U1GC 4BFOA 3HLAA 4DETA 1V8HA 4K5PA 1IAIH 5DDHB 3U0PA 2BXYA 3CBKB 4KKRA 3RTQA 4OZHB 2J57A 2R1YA 3N5AA 1JHTB 4X5QA 1ZGLA 4O5LL 3L5WA 4GW4A 4MDRA 3KNBB 2NY6B 1Z9NA 2VLLB 3RIAK 2CR3A 3VFTB 3STBA 3QWNA 3Q8FA 4EOWH 3H7LA 4HXBL 5MP6L 4DEPB 1R1CA 3HG1E 3AQXA 3WKML 1TQBC 3WD5L 1A7BA 3IRCA 2DI9A 4JK0D 1QUNB 1SBSL 3ZDXF 5E9DD 3SGEI 1DJHA 2D3LA 2AK4D 1S7QA 3VJ6B 3VSUA 1SJHB 1XGQA 1IKFH 1PZBA 2XTJB 3IS1X 1TJIH 1S8DB 1WT5C 1QBMH 3DGGB 4L4TB 3GHBL 1MFBH 4PYHA 4Q2ZA 1GTNA 1JD9A 4NKIL 4DN3L 2GITA 5KVFE 3MRKB 4MQXD 5CXPA 1YUHB 1M05A 4CKQA 4YDJB 4FFZL 3ML9A 1JWUB 4IBWA 4WDIA 1YNKH 2BRRL 1RJLB 5TK4A 4ODWA 2ZT9C 4FQHB 2VLKE 1EO7A 3GSQB 1UASA 1JGIA 4XWGL 3NIFB 4HLJA 3FUHA 2J8HA 3MUY1 4PJDA 5IF0B 3QORC 4OGYH 3UCQA 2DQIL 1GYWA 3QB7C 1CR9L 1QA9A 1ZT4B 1BF2A 2VLMD 3MRDB 2YXVA 4PREA 3QFGA 3ABLB 1SGKA 4F58L 2XZAL 3ZE2E 1H3WM 4AYGA 3MLVH 1I8IA 1T1ZB 4IKIA 5CUSL 2YPLD 2J88H 4LL9A 2W9DL 2Z34A 1N6VA 1LO2L 4ZFQA 1L0YA 3VTTA 2MTPA 3D33A 3T0DA 1KXHA 3QRLA 4JZJB 5C0IB 2YXMA 4Q89A 4XP6L 4BKLB 4E0RB 1FFOA 3II3A 1P84J 2X4TA 4JHVA 3GIVB 3PWUA 4GRWE 3LKOB 4NWTL 5MEPB 5INDB 1SVCP 5L4IA 1CO1A 3WHE0 1G7JA 4WUUB 1LP9B 2AKRB 1UT2A 5J12B 4ZUSA 4WFHE 3FQ1A 2AEWA 3ZL1A 3GMMB 5E8OB 4OGAC 4ZXBD 4JO4L 2RFXB 1QWUA 2DQGH 2WMPA 3LDBC 4JFEE 2WVVB 4FXKB 5IM7B 2IAMC 4UAHA 3TBYA 3IYLW 3N0AA 2Z7UA 1OY3B 2K3TA 1KWGA 4JFDA 5J8OA 2FSDA 3NGBC 2FWSA 2ITCA 4LMQE 5LG1A 4UDTA 3ZQ9A 2HVBA 2YGPA 1GW0A 3N55A 5CCKH 3FTYA 5DD1L 3LD8B 2CLRA 4Y5VA 4PP1D 4S10A 3S8FB 2LV4A 2CXGA 1NCAH 4KRLB 2P5WB 2Z92A 5FA4A 3VRLF 1VGKB 5IMLB 4JKPL 4OV6F 3JV4A 4ATWA 4MYWB 1DL7L 1E43A 1T0PB 3C5ZA 5HGAA 4QRRE 4UNUA 1N0XH 4ANUA 1Q94A 4PJHA 3RB7A 4PJ9C 1J87A 3RWHA 3B3BA 3HZMA 4I9WD 2P24A 4WFEE 4Z77B 3I6KB 4JO3L 4E41B 2YSSB 1NGPH 1Y0LA 1ED3A 1CD1A 4GQQA 5K39B 4WUKH 4L1BA 2GAZB 2Q0ZX 3U79A 1Z5YD 4MB4A 5HJ3A 3EH5B 2FDBP 4BH8A 1LWHA 3EHBB 5IW3A 2MCPL 4J3VA 4AGPA 4FZ8L 4Q74A 2R0KL 2QDWA 2JWYA 3H53A 4XPHL 3CU1A 2O5XH 3K81A 1BBDL 1F1AA 1ZJAA 3QPXL 3BLPX 3K3QA 4NQDA 4LEXH 5J1AA 1EBPA 1VHPA 2NQ3A 4A2LA 5L88L 1D9KA 2WLYA 3ZKNC 5CEYA 2W94A 3ETBJ 3ZL2A 3DLQR 4FI6A 3CUPB 3ASNB 2FIRT 1RPQA 1BX2A 1N26A 1U92B 5DUBB 4E5XG 1TTUA 3FUEA 3M1BB 1IGCL 5JMRA 4TUKH 5DWUH 1DQKA 3MOAH 2I9TA 3U6RB 1CBVL 4J2QA 5I5RA 5KVDH 5HHXL 5KTEL 3BPLB 3I50H 5DJ2B 4UV4L 2MHAB 4IRZL 2FEDD 2O6DA 1UKTA 5JIQA 4Y4KD 4M29A 2BS8A 2MNJB 2UZIH 5AYQA 4FEIA 3RRQA 3FUFA 4G8FB 5I28A 1FORH 1FH5L 3TTSA 4UINL 4NC0B 3O6FA 1DO6A 3B9EA 3DSFL 3TH4T 2QR0A 1IC4H 1IAIM 3PIQA 2CLVB 3QUXB 1DHKA 2IQ9L 1Q0XH 4LCWE 4F15C 1WC7B 4ZS7H 5JXEC 3VXUB 1LMKA 1UXMA 4G9DA 3SN6N 4LIQH 3WMQA 1AGEA 1WT5A 3ZE1E 4KNUA 4LLQA 4P57A 5KS9B 4K9EC 1JWMA 1HQ4B 2O5YL 3VVWA 3TZVC 3ABKB 1I8LA 2KUTA 4A37A 4X4XB 3K2KA 3LRKA 1LD9B 2IPKA 4M61B 3BSZH 2UX6A 4UQCA 3JV6A 1VENA 4JPWH 5EOTA 5H35A 4PGCA 1YAIA 2XV6B 4YHZH 5BV7C 4YHOH 3FCSA 5I5MA 2V2TA 4CJ0A 4L48A 3UTSE 3CMOL 4PB9L 1A7NH 4ZNEE 5AUMB 1IGYA 1OP5K 5BMFL 2IDQA 4J4PC 2XICA 4URTB 3D3VA 4KVCL 4G9FE 4X4ZA 2R1WB 3GPSA 5CEXA 1JZDC 1LNUB 3QFJA 2WNXA 1IBZA 4JHUA 4DGUA 1I8UA 1GY1A 4LKXB 1KGWA 2DWTA 4ECNA 4RZKA 4PWFA 5E2WH 2BIMA 4RRPM 1PPIA 3LVEA 3G5VB 5DFAA 3C6LB 3UO1L 4PRDB 1IMHC 2J55A 3HPLB 5DK3A 1FGVL 3HLKA 1NGYA 1BD2D 5LAXB 5J1TC 1I9EA 2NZ9D 3UJJL 4G6JL 4ALAL 3UMNA 2B8OT 1F3JA 4TLSA 1S3RA 3VXOA 4MZRA 4NERA 4OUUA 4S0TD 5GQBA 5ALBH 5DLMH 1YMHA 2A6IA 1TZAA 2IPTL 4EBQH 3PDGA 1ET8A 3DPBA 3EADA 5MEQA 1UT9A 4JHBA 1XGTA 1PQZA 2AV1B 4GLRI 1BXXA 3ZRCC 1BVZA 4Y5YA 2W81C 1NCCH 3CHSA 3TBSA 5EBMA 2FD6H 3KYNB 2ZCLH 1A7OH 2B2XH 1K5NA 3OHXC 3WUWA 3IDYB 2AEPL 3QEUB 1G7MA 1E9OB 4P3CH 4RMUA 1AGFB 4ZUUB 4Y2LA 4TN9A 1HHHA 3QQNA 4BGLA 1BIIB 4Y7OC 1P6FA 1OTTC 2F15A 3KR3H 1WVZA 3I85A 3OSKA 4JHWL 3UYPA 3WMSA 4AXWA 3HC0B 2JJTA 2F19H 2QSCH 5L9DL 4O2CB 1VF5C 2C3WA 5EF1A 3EDJA 2IXQA 5C0BA 1YY9D 4UYQA 2CAKA 3GZQA 5EBGA 1IB5A 4PJXA 4B9ZA 2CO6A 4MAYB 3PG2A 2YD0A 4FDWA 4K7FB 4QHMB 4FG0A 2XQ0A 3BUDA 3CFCH 3O3BA 1N8ZA 5K9QG 5EORL 3TBVA 4RBPH 2GK0A 1U8IB 1TLKA 4MA7L 4NUPA 4S2SB 1IBGH 5E8DH 3SKOB 1AQDA 3V4LA 4MNHB 3RDTD 3MYJB 4ZMZA 4MDJA 5D6DC 2HYMA 4FOMA 4JJ5B 4LAJH 4AQ1A 1IC5L 1B0RA 1P5UC 1IL1A 4ADJA 4PJ5D 1T04B 1OM9A 2XETA 1CFTA 4M8QB 4CNIB 2ZX6A 2HG0A 4YHKL 5FM4A 1CFQB 1U8JA 1T66C 3ZDYB 3VFOB 4FFYL 4L29A 1FDLH 4NP9A 2GFBB 3BLBA 2PCYA 2ZXQA 4XTRC 1GGBL 2OXHA 3UAEA 5D70L 4NZ8A 4YL9A 1TYRA 2A9NL 4OSUH 4H2CA 2XQBH 3Q1EA 4PPTA 1HHJA 2BHYA 2G75A 1N6UA 4KGJA 4TSAL 1B9ZA 1AG6A 2X0UA 4M5ZH 1JK9A 4IOSD 4MXQC 1HJCA 2YA2A 3RPIA 4P4KD 1YJDL 1Q0YL 4DEWA 4F7EB 2Z91B 5C9JB 4MJIE 4QXWA 1YEJH 1NBYA 3DECA 2WLIB 4F3FA 1FPTL 3DMMC 4U05A 5FK9B 5C0CE 5DRZA 1MY7A 1TVBB 3KCPA 1EJOL 3TYGL 1JGLH 1TQTA 4Q52A 2NY0D 3B7YA 3BQUA 1KSRA 2Y1ZA 4QO1B 3CN4A 4TLKA 2CKBH 1PF3A 4UUJB 3DX7A 2WOYA 4F7TA 5JIIA 3H56A 1G6RL 3LQAL 4JPQA 4JPKL 4U1KB 3VWJA 4CVUA 4NUGH 3CH1A 4XVOA 2QVKA 2NXYC 5I75B 1V27A 2ZWNA 4PJCF 1IQWH 1AR2A 2X6UA 3L5XL 4QJ4B 1YEFH 1IAIL 1T4KA 3QIBB 1FFQA 1R3JB 2EILB 5D1QD 1N0LA 1QG3A 3CHXA 2H3KA 4NRZB 2PTVA 4I0PB 3ULSB 4KKAD 2G3XA 4AL8C 1E4KA 2I5YH 5FF6A 3UDWC 3TVMB 4WU7A 2V5YA 4UIMA 3S3CB 1TTRA 2JIXD 4JQIH 2PO6A 4LSRH 3RWJB 3SQBB 3GXFA 4L4VD 3BIAX 5KVMC 2ZUYA 3DYMA 4WI0A 5LAPA 2AP2A 5AKRA 5E51A 3JVGA 1JNHA 4QRPB 1L6ZA 4P3WA 3BDYH 1WZ1L 4P5MA 3KPMB 4ABUA 2VLRB 4HMEA 2VDQB 3OMNB 3UG4A 1ZWIA 1XGPB 4TTDC 1CD8A 1A6UH 4LPUA 4YQXH 4XPBL 2H26A 2OZ4L 4HC1A 4FXLA 1NM9A 1QBML 2ALWA 4DUVA 2GHWB 3H7BB 4U2YA 1S7VA 2YJLA 5I6XB 4KPHL 1H9VA 4GKSA 1I8KA 1SYSB 1NLDL 4EIBA 5CGTA 2AZAA 4PRPB 3FB6B 2QKIC 4N25A 2GI0A 2VXUH 1NAKH 1RCYA 2QZ5A 4U6VH 3GI8H 1AZVA 1GGYA 3OHXA 2ZSVB 1T89C 3FFCD 5IQMA 4NC2B 3DSNA 3F83A 3OF6D 1P7QD 1QFUL 4PJFF 4OGYL 3DIVA 1UM5H 1YEEH 4OTXH 1KCVH 5CJBA 2IQAB 4GMSH 2W88A 1AJ7H 4X9YA 4I1PA 2ISDA 1A3LL 2NCMA 4JZOB 4GW1B 4FNQA 1ZANH 3MNVA 4OI8A 3DXAA 1CICD 3O9WC 5ITBH 3ABGA 1JNNH 3D2UA 4NFCA 5EA0H 4PCSA 3ZHNA 1D7FA 1G7HA 1HNGA 1CGWA 3A6BH 1NIAA 4NP4L 3VSQA 5GS1B 3QA3B 3O4LB 5EFIA 1OHQA 1DUZB 5FHAH 5A2IH 1A9EB 1X6LA 2CGRL 4X6CE 2CCLA 1NCUA 3GBML 4LLWB 1WQVT 2B59B 5DHYB 1I7ZA 4UT9A 5D6DA 4QRUA 2OSLB 3FB8A 4FTVE 2P8MA 2EE2A 3N1PC 3RURA 2DTMH 3V5DA 4Z7VA 1S7XA 2X4UB 4L8DB 3V0IA 5KJRL 4WEUD 1H3UA 5HYSG 4I48B 3V0EA 2A6JA 5F9WB 3ULAB 4DCQA 4NHCH 3CSTA 2ARJB 4NBZB 4QXVA 5HJGA 4FD0A 2QSQA 4YGVB 3T0XA 3TLRA 2XHNA 4TVUA 1WIUA 2WKOF 2ARWA 1T1YA 1CC3A 2NNXA 3L1FA 2W38A 2YJQA 3BVNA 4P2QD 4AV5A 4Y2OA 2RACA 5AAWC 4LSUH 2VC2B 5KZCD 1ZVYA 2E75C 3FZUD 5HHMD 4RISH 3RX8A 3ZHFA 2YAPA 3BGFB 1B2WL 5IUCA 2WXGA 3W37A 1N0XL 3FTZA 4ZMVA 1JYNA 1HZKA 1F13A 4YAQA 3WLBA 2FT8A 3VMNA 2E74C 5JPMB 2A9DA 4YBLB 5F7WC 4JFEA 4E36A 5CN3A 2DLFH 4XVJH 3GMNA 3WL9B 3OAZK 2Z35A 4Z3GA 4PBDA 1AGBB 1TKWA 2DQTL 1DVFB 2XG4A 2D4FA 4J3SA 1CYGA 4Q9RH 2VDNH 3KLHC 2PP9A 1HESA 1QHOA 4LSSL 4LNVA 2CALA 4KQ3H 4P46A 1CFVL 3EKCA 4TQEH 1SJEB 3AWEA 4K15A 1NBZA 3FOLB 3HG5A 3WIHL 5C2UB 1C08B 4U7KA 2Y5QA 1MI5D 5GGTA 3L1GA 4JHZA 1ZAGA 1JGVH 4ZSOA 2TRYA 3MRPB 4KJQD 5T1KD 1JOIA 3RWDA 5IFAH 2P49B 2LGNA 4XZUA 1BLIA 3KG5A 5MERB 3MOAL 4JREB 4G7VH 4AENA 2A6DB 3RZCA 1N7MH 3KW7A 3REWA 4B5EA 3CLFL 4P5KB 3UACA 1A4KB 2AGJH 3SYCA 1C8PA 4KVNH 3K0WA 5I1CL 4GBXB 1X4XA 1QAWA 1FORL 5J9PA 1UOLA 4X8JA 3TCXA 2C3XA 4RGNB 3TBCA 3OXRA 3V79C 3JTBA 2YGOA 3DJ9A 3MV7B 1XH1A 2M26A 1IC4L 2FUQA 2K9FB 3GM0A 1X4YA 4OCWH 4QUOA 1HHIB 2G0LA 4P5RA 4XCYB 2ZOWA 4X4YB 2D7TL 1ITBB 5K69A 4FQCL 1SYVB 2RMNA 3CSFA 4OFPA 4JN1L 3CHOA 1AIFB 1K2DA 3BP7B 2YAMA 2P8PA 4XI5D 4E9RA 2VO5A 3ARFA 4CMMA 5IB2A 4BXSV 5DJ0B 5BVPL 1UH2A 1ICTA 2WKLA 4YWGL 1TR7A 4I5BA 4X7TA 3L54A 3M1CA 3MODH 1E42A 1SM3L 2V8MA 3CMGA 3H2WA 1EAOA 2IJ0C 1V3LA 4RAVA 1JMZA 2YQBA 4V1DD 4FNLL 4Z3FA 4CN1A 3QCTH 2VDRH 4WTQA 4L5FE 4Y88A 3STZB 2R0ZH 1JPGB 3CXDL 4LT7A 1GCYA 3UBFA 3RTQD 1X44A 1KJ2H 2AJXH 4Y4FA 3UTQB 3NZUA 3ZGHA 1F6LL 1OSZB 4AIEA 3B43A 1WIOA 2E7LC 2RHEA 1NMCB 1CDBA 2OMVA 3QDME 4LCWA 4DIXA 4HHWA 2WLHA 3BIKB 4J8RB 4M7KH 2FYVA 4UV7H 4PIRF 4PJIB 1QSFE 1DQDL 1T6BX 1WZMA 2BNUB 3BEWB 2X41A 1FJ1A 1UXSB 4PVNA 5CP7A 4GEJA 2LVEA 3C9NB 3NN8B 1WD9A 3FL7A 1OGPA 2DN7A 2QPUA 4WFGE 4DGYH 5HPMB 3MBWB 4A6YL 1HHGB 1ZLWH 3CQFA 1AQMA 1J10A 2NSXA 3QIUA 5F7BA 4FXGC 4BFNA 3C12A 4OF8A 4JZNA 4NQXB 4BE6A 3O6LH 3P4OB 4QGTA 3TO4C 5JOFA 1OCOB 3GT6A 4ELME 5DLML 3UTSA 2H1XA 3HAEB 3JWOL 4PS3A 2NY2D 2A6KB 1LQSR 3ZYZA 3VFWB 4HAKA 5K9KB 2KKQA 2VW7A 1GOHA 1IGTA 2R2BA 2LT9A 2PTTB 3UZEA 4MDIA 3HN3A 2ZD0A 1HEJC 2IFFH 4QHUB 3UJTH 2AK4B 3U0TA 1NCCL 5CBEA 4Y5XA 5HY9A 2ZCLL 2E27H 2B2XL 4BSVA 4EO5A 2GIMA 1Q9LA 5C8JB 4R6UA 2XWCA 1RZJH 1DJIA 2V7HB 4JG0L 1XGUB 4GS7C 1HOEA 1OGAA 3MCLH 4U33A 5AAWA 3A4DA 3L95B 4PJ7F 3TEWA 2XKSA 5I26A 2YXFA 4P99A 2BCKA 4B3EA 1LEKB 2F19L 4KC3B 1AACA 5H2BA 5E6UB 1FG2A 5DO2C 2VAJA 1U6AL 3M6DA 5FA3B 5IEKA 3IMWA 4F9LA 4AQZA 3PDOB 3KHOA 1YNLH 3ZKMC 1C9SA 3BE1H 2NOYA 3K8KA 1BQRA 3D4GA 1E4HA 2LQRA 1HZHL 4PTUA 2WTOA 5E99H 2WP3O 1T0MA 1TYEB 2R0LH 2SEBA 1T03H 4HCGA 3UPRA 2Y36L 2D7MA 3NACL 3O3DA 3X11B 3D9AH 3A67H 2Z4QA 4G3YL 2W0PA 1S7UB 2YMOA 3LS4L 2YPLB 1U58A 1N5AB 5JORA 3DO7A 2HSIA 1YPZE 3FQRA 4FADA 1RIHH 2WJ7A 2W0KA 4KROC 4UT6H 3HC3H 2ZUXA 5F89A 5AVSB 3D39A 4JFDD 3GMLB 5CEZE 5EO0A 4GEIA 3Q3GB 4HWUA 1FDLL 4U6XB 4M7ZB 2YN3A 4XO3A 1UGKA 4BKTC 3BWZA 3SGJA 3FHAA 5LDSA 3NIDF 5E6RB 3IJHB 4H26B 1TO4A 3HBPA 3X1GA 1MZZA 5KSBE 1PZ3A 4XNDA 1MFCH 1A6AA 4K3JH 4L8SB 3L16A 3LB6D 2VQUA 2YEZB 2D2CC 3PP4L 4M5ZL 3ZTJH 4JFZH 2YPVA 3C5ZD 3SE9H 1GAFH 4XC1L 3V0GA 3VFVA 2HLFC 2WUCH 5HGBB 5JR1H 1OE2A 3BEVB 3JVFC 1USZA 4OFQA 4OR1A 4PQXA 5J13C 5DJXB 1IUZA 3L4VA 3VFRB 1A25A 4G42A 4NIYE 2JCCB 4WFFE 1JGLL 4PRNA 2WNWA 5FS5A 1MPAH 3C08H 3WS6C 4YSOA 5I24A 2VM3A 3RJOA 1PS3A 2Y7QA 2F5BL 1OQOA 2B5IC 1ZDQA 3RUGB 1A7QH 3S3BB 4NQDD 4RESB 3TWCH 5D1XB 1MH5B 5DRXB 3RWCB 4ERSH 4NUGL 1D9KD 2YC1A 3VACA 3KEHA 1VDGA 3KLDA 3FH5A 4HC1H 4R97C 3WY1A 3V2AR 3WHXB 5ISZA 1EVUA 2X3CA 2XVKA 3VWKA 3KPNA 1ZVNA 5BQ7A 2XN9E 1CE6B 2XN0A 3ARXA 4JFXA 2BNQE 3NCXA 4IYKA 4NPYB 3FAWA 4TL5A 2X9XA 4MJIA 5C09E 1CBJA 3VI4B 4K8RC 1A47A 2AK1L 5C0CA 1RQ5A 2GT9B 1R5VB 1MCHA 4GJTB 2OYLA 4YC2C 5KVGE 4KXBA 3OKOA 1YNTF 1T83A 3S48A 3EYUH 4JQIL 4PV9A 4M5YH 1UATA 3O6FD 1E9PB 3B7RL 4N2BA 1QLFB 1DLFH 1NCIA 2Z6FA 2KMWA 4JFTA 4CADB 1KJMB 4DK3A 5JZ7C 4B9PA 3V0WH 2BNRE 2OBGA 5D7IB 3ULVC 4KXCA 1FAKT 4B7LA 2LTQB 4MMZC 1GZPA 4FXGA 1G7IB 5KVFH 1NINA 3P4NB 4PAZA 3TNMB 1CFMA 1U42A 2IOOA 5FCUH 3LKNB 2V2WB 4N0UB 4RIRB 4N0CC 1AY1L 1QFOA 4G5ZH 4GSDH 1F90H 3N85L 5DHDA 3HRZA 3KPRE 5GIRA 1ACYH 4R7DB 4NPJA 1I1FA 3KDPB 4N4YB 5DVMA 1XH3B 3GSNH 1I1AA 5CINH 2LR4A 3UTPE 3GI8L 3MCG1 5JIHA 5IWLC 2OKMA 3PGCA 4GT7A 1OPGL 5ADPL 1DBBL 1BOGB 1LO5A 3MLWH 3K5SA 4RMSA 1CJYA 1BVLA 5K93A 2AQSA 4GMTL 4M7JL 1VFUA 1I3VA 2PCFA 4LVHC 2YXWA 4GMSL 1AJ7L 4BFFA 3OKNB 3D3VD 5CU5A 3I3DA 4Z8FH 25C8H 2RIKA 3QFJD 4N2FA 4ONGH 3O0RL 4XGZB 5F88A 2ETWA 3LTVA 3NJHA 1GW6A 2VXQA 4A7TA 1GOGA 1WEJH 2V5TA 5ITBL 3IGUA 2HA1A 3HFFA 4AGLA 3MU3A 3WNLA 1QD0A 1JNNL 1EEZB 1NDMA 3W0WE 4OKDA 5E94B 2CLZB 2IALB 5HI4C 2D4DA 3P3TA 3ZYIA 3EYVA 3IETA 4GRWH 4U0RB 4A7UA 2XVLA 4N0FB 2W92A 3BKJL 3AS2A 4HALA 3WTXA 1MG2C 3IDJA 4OIIH 4LK4A 2VR4A 5EC1A 1DUYB 5FV2A 4KMTH 5DJZB 3L6FB 3UXFA 1A6TB 1ETZB 2KLSA 2X70A 4PSPA 4CVWA 1ZXQA 3HUJE 5JYMA 1SXSA 3P54A 1NC2A 1E3ZA 4JGJA 3L17A 3IF1A 1BD2B 4DK6A 3BP5A 1FAIL 3PV6B 1UM4H 5IJVB 1OF2A 4W9JC 1M1XB 3U2SA 1UB5A 4OGXL 3RI5F 4CC0A 4NHCL 4IRSA 4NKDB 3RHWK 1W80A 1MQKL 1NCBH 2WGXA 1CDCA 1HJBC 4L1DA 1X5YA 1L6XA 3ILEA 4TS6A 1WDAA 1FZKB 3JWDC 2AEQH 5FO7A 3SODB 4RISL 1CGTA 4PSRA 4Z78B 4FMKA 3IXTA 1IRAY 1G9ML 1BAFH 3MLRH 5K5YA 5E08H 5C0BD 4YXKH 1WP6A 4OZIA 3NP4A 2VUOA 2HTLC 4XOBA 1XAKA 3HS0C 4HJIA 4EI5A 2GYSA 4AEHL 3KPQB 3VH8G 1E3XA 4X8XA 4N6RB 1AQKL 1ZIAA 3GK8H 4Q9RL 4UANA 5AENA 4XMWA 1CGYA 3GDBA 4KQ3L 1FO0H 1NFDE 2L7EA 3BAIA 4BH7B 1TTGA 4WNQA 2X4PA 2X0VA 5GS0H 3QNXB 1FL5A 3S4SB 3K4ZA 1P2CB 3T4YA 1KEGL 3I84A 3G6JF 2XN1A 4H8WL 1KB5L 4U1LB 3PU7A 2PW1A 4FQPA 1RUQL 5CFHA 4DKEL 4WVRA 5HSFA 3STLB 3LZFL 1KIRA 1T0NB 3RDTB 1O0VA 1N7ML 3MRIA 4N2GA 2FLRT 3FO9B 2CR6A 1CVSC 5CGYD 1JHKH 4PJ8A 2OAAA 4KVNL 1GTFA 1LK2A 4WAFA 2PKDA 2CUHA 4WSGA 3KXFA 2K0RA 1W6LA 5LO7A 4J8QA 3A6CH 3K6FA 5L0QB 4HKZB 3QXDB 5HJBA 4PRAA 3D1MC 2V37A 1UWYA 3R1GH 1HOCB 1V7ML 4YFLF 4JM2C 4OQTH 1AYOA 4MMZA 5I18H 3DBSA 3L4ZA 1MCCA 5JQIB 3L7FB 1HU8A 5BS0E 4LSVH 4R0LA 4H20H 2UZYA 1BVOA 3BQUD 5F44A 2OQJB 1LE9A 3L8QA 3E0GA 2QHRL 4Y1SA 3KZ8A 1EBAA 1INQB 2MCAA 3JSSA 2WTRA 5DS8A 5DK2A 5AALA 3DX2A 1VSCA 2H9GB 3U7AA 3VWJD 2A4EA 1INEH 3AY2A 3OD3A 3P73A 3Q6FB 5DEGA 4L1SA 2AVFA 1I9JH 4R7VA 3PFQA 4Z7QE 3RKDC 5H37H 4ODXB 1SXBA 3ZE0E 1HXKA 4H1LG 1AO7A 2HX9A 3FN0H 4LEOA 3IWVA 4JL2A 4ONHB 3BP6A 3ZO9A 3HR6A 1MNUL 2ZYHA 1HINL 3FRPA 5E4EB 3QBTB 4YSTA 1H5BB 1KJ2L 5BVPH 3S5LB 3RBSA 3IPBA 1VB9A 2AV7A 5C0GA 1T7ZA 3KD4A 3VU1A 3ESNA 1HEZA 1VLXA 2DQFB 1E5BA 3M1OA 3T3MF 3R4RA 1WV7T 4HX1A 1BVNP 3S5YA 3V7AG 2HT3C 1SUJA 1RZ7H 1GZHC 1AI1H 1NBQA 5B7FA 4JCLA 5I1GL 4APXA 3ZL4L 5FECB 2PO6D 4MX7B 4LCCB 1GGIL 1E4XH 3FFDA 4D0CA 4BRVA 2UY6A 3OQRA 1FNFA 1U8NA 4EAEA 3H3BC 4Q9BA 4L37A 5D1QB 3V6ZB 3L5HA 4K3DL 3LOWA 1FWXA 3US1A 2ARJQ 3K71A 1XR8A 5FDWA 4LZKA 3LRHA 3P9LB 1TF4A 4O02L 1NUFA 4ZMLA 4L3FA 4TF4A 4KTYA 5T1MA 1JYXA 2H8PB 1RUKH 2JIXB 4GKZB 5E4OA 4L4VB 1QFHA 4Y7MA 5IEHB 7CGTA 1GYVA 1NPUA 4L2YA 4LP5A 1ZLSL 4MVBD 4X7FC 5ITFB 3ARVA 3GRWL 2EIEA 4XPTH 2IFFL 2P4AB 1NAMA 4K94L 4MS6A 5ESAA 4U1SB 5DMKB 1OWWA 2CSPA 1JD7A 3HI1B 5IJCC 2GG1A 1QSFA 3QNZA 3FU7B 3V0AC 1MELA 4P2OC 5C0NC 2ITFA 1HH9A 1DN0A 1WGVA 2FO4A 1JGDA 4YBQC 2AJVH 3FSAA 4FG6D 3RGVA 2X88A 5TDPB 2E3VA 2CHZA 3SDCC 4B27A 4FLQA 3IGLA 1M6OB 4FXTA 3K6SB 3OC5A 4F2MB 4PJAB 5JXAL 3A22A 4YFDB 4MMXB 1SF5A 5DD5H 2B08A 3DXAD 3NPSB 4ELMA 5DZJA 3TO2B 3FFCB 3J2PA 5D8JL 3ML8A 2XYCA 3VXTA 1HXMA 4F91B 3D2UD 1P7QB 3QJVB 1ODAA 3SOBH 3UC2A 1SVZA 3B6SB 1K3ZA 2YPVH 1URLA 4JDEA 2FHFA 4PBWD 1FLRL 1T03L 1EGJA 1BXAA 3KM2A 5F9JB 3WFCH 3BD3A 3OPZL 1LGVA 1IGIL 1M56B 1TZHB 3A67L 3VXRE 5F1OB 1CICB 4NN7B 2RBLA 4YHML 4NNPH 5KSVA 1PFOA 1LHZA 4GG8A 3H3PL 3EYSL 4UT6L 1E27B 1SLWA 3NSCA 3X1FA 5TF1L 3MSPA 5IK3B 2J71A 1T22A 2W07A 1C5CH 4NHUA 4KKBD 4TNFA 1TVHB 5F0MB 5GRJL 5I8CA 5F0PB 2FGWL 3QIWC 2HG5B 5EZIL 2VRKA 4J3OF 4RNRA 4U4BA 2JB6A 2E7BA 1NEPA 3CFBB 4NCC2 3OAUH 4HJ0D 1P0SE 1V55B 2WP3T 4G7YH 3EBHA 5ENWB 5AZ2H 3F00A 5LN8A 2GJRA 2HJLA 1COBA 3SE9L 1U9KA 3V95A 4OBSA 3SDXE 5FO8B 1GAFL 4B97A 5TF0A 1PAZA 3MFFB 2WUCL 2ICWA 3VA2C 4UTAL 1G0XA 4JO2L 1GMEA 4WFHD 1CURA 3WY3A 4WQOA 3KGUA 4NO2B 3D8MA 4JFED 3IXAA 3T2PA 4M48H 1HC1A 3Q6GH 3U7YL 3IU3A 3VX1A 1MPAL 2FTAA 2VXTL 3C08L 3S98A 2ZX5A 2P7TB 1X7QA 2X5PA 4XOEA 3T0VA 3KWWB 1I4FB 1GS7A 5HHMB 3NJXA 5I74C 3DV4B 2OA9A 3GJEB 4P46D 2VWEC 3TWCL 1HL4A 2PWGA 4Z6AT 2VERA 2NXYD 1MVUA 1GYCA 3AT8A 2HN7B 5FHBH 2R9HC 4NYLA 4ZDHA 5FGSA 4XNZB 1K4CB 1PCXA 1GZQA 5IR1B 5IQOA 2VC2L 3DIFB 3QYCA 3MNZB 4GKNB 1MW1A 2IF7A 2BZCA 4ZTPH 3KLLA 2MNUA 2BP8B 4XHQA 5TQ2H 4WFED 2HJFB 3RZCD 4G6MH 4HUUA 5CJOH 1Q8MA 4AV4A 2FJHB 4XAKD 5DQ9B 5KG9A 1BA9A 4ZQKB 1MI5B 1OWRM 1A64A 4CMHB 2C1OB 4HEME 4OZFH 5F1IB 4OFKA 5T1KB 3V8OA 5FFLA 4M5YL 1WUZA 1HYSD 2FEEI 4MHHI 4PWEA 4HQQH 4JFFE 3BPNC 3QUYB 2XCMC 2K7QA 4J6RH 3H1ZA 1F45A 3GS7A 3TBWA 2VXQH 4NO5A 2HKHL 1D6EB 4MXVF 2MQGA 1SEQL 3FFOA 1C8QA 5KVFL 2J1ZA 1XWVA 2ZXBA 5PAZA 2VN5A 4A66A 2CRIA 1U8HB 2XN9A 4YHPB 3ARFD 3VA6A 3L3KA 5B38B 3Q01A 5KYXA 4HHAA 4G5ZL 1D5XB 1F90L 3GDCA 4J1UB 5EPMB 4X98B 3V0HA 1NDGA 4LEEA 5BRPA 3DX9A 3T2NH 3RYMA 2VN6A 1DJXA 1UACL 2YMTA 5JQ6H 2JKWA 5LWYH 3PXJA 3WJMB 1Q1JH 1TCMA 3U1SL 4JDTH 2WSPA 1S9WA 4U6YB 4PJBF 4A7GA 1M4KA 1YN7B 1ZJBA 1FI8C 2QVFB 1DDHA 1GSKA 4Y4FD 4WKXA 1JPSH 3EZJB 3C09C 2Z1PA 2BNRA 2EICA 3MGOB 5KN5A 2QBWA 4LCWD 1ZY9A 4RRPG 1P7HL 4XB7A 4Z8FL 2YR3A 5ANMA 1G7PA 3TN0C 1UA6H 2NMSA 2NY7L 3SGKC 2X2YA 1RZ8A 1NCHA 2PLTA 2C3HA 3HLAB 3PYCA 3CNKA 1V3MA 3V0JA 3PNRB 5F7MC 3S2CA 5ACZA 4J3OG 1UUSA 1ZK5A 2VKWA 4X6EA 3RTQB 5TE7H 3IE4A 2R1YB 4PVLA 1JZ8A 4H8UA 4C56E 3AREC 4AEIL 2N1TE 3SJVA 1ZGLB 3L5WB 2UY7B 3ATEA 3QIUD 1GRWA 4M43H 4OIIL 4WJG3 2ITEA 2QV4A 4JFOA 3SE3A 5GJSH 3UTSD 1H19A 2V9UA 4ZYKA 2CNYA 4JFQB 1X5ZA 4M4PA 4F7MA 1FNEA 4GAJH 1HL8A 3Q1SH 4LVOB 4P3DA 4CILA 3CZNA 3ZDZF 5CLWA 4F5CE 3QXAA 3MV9E 4GRMA 2Y0SA 1S7QB 1IIIA 4GKOA 1XGQB 4R90H 2QGDA 1UFUA 5F1NA 3WN5A 3ECQA 1RSFA 3SCMC 1UOVA 4BKSC 1S7RA 3ZTCC 2BOCA 4ATTA 4Q2ZB 3VRJA 1O9ZA 4FJZA 4ZTEA 2X9YA 3FN9A 3VQMA 2NY2B 4E9QA 1M05B 3IEAA 3LZQA 3Q0HA 5J11C 5IREA 1OGAD 4Y1AE 3X13A 4UM8A 1H15A 3B1TA 3HVNA 4Z95H 3B9KB 4WDIB 3AROA 2AEQL 3ELAT 3N40P 4ODWB 4C4UA 3HHMA 4OLEA 2X6AA 2W65A 1BAFL 1YEIH 4HD9A 5CSZA 2CUMA 4UTCA 2V3DA 2X1QA 4M93C 8CGTA 4PJDB 3BAJA 3BKYL 1KCUL 2EACA 1ZV5A 3HR5A 3NJFA 4IOFD 1QA9B 4PREB 2IGLA 3UO8B 1D5ZB 1G1OA 2HLAA 2MOVA 4HWBH 4M6AA 4LDCA 1JSYA 2F6AA 3X1NA 3QJXA 1KENH 1I8IB 3CQQA 2ORBL 2VSKB 1PD0A 3LNHA 1UH3A 3U7WL 4A2DA 5E2JA 3GSRA 4OD1H 3GLEA 3ATFA 4LRNH 2GTWA 2J43A 2HFGH 1CE1H 2O6PA 1A4JB 4C47A 1GGUA 1IAOA 3W39A 1SLUA 2VO8A 3P4MA 3GMRA 1Y07A 4ES8A 3D39D 4H8QA 5DEZA 1C5BL 2X4TB 3PWUB 4AIXA 4U6HA 5T5FH 3MLUH 1CXEA 1V54B 1G7JB 3DKHA 5G55A 4GQZA 4UMSA 5IQ9A 4ZUSB 1HTYA 1PIFA 2PYEE 4X5PA 3V4PH 2WMPB 2ATPB 4IGBC 4PGEA 3G5XA 3MXVH 4C54A 3JZYA 1KGXA 3ZZSA 4JPIA 3TBYB 3A6CL 2DQDH 4KTDH 2OCFD 4JFDB 2ITCB 35C8H 4UDTB 3WNJA 1NFDA 3H3KA 3N9GH 5DEJA 3GSXA 1SN5A 3AB0B 4OQTL 5EBWA 5B4MC 1JMXA 1SOXA 2CLRB 3AZUA 4OCSH 4W6YB 4Y5VB 2Z92B 5D7LB 5FA4B 2O93L 4YEEA 3BYYA 3V4VB 3ASOB 4Z7UA 1IE4A 2CGYA 1Z3GH 3JV4B 4I4WA 1BW8A 1KLUA 2CRMA 4X4MA 3VG9C 1R3IL 2DH2A 2XC8A 2DBLL 3EGSA 1O6SB 3C5ZB 3IDMA 3NIFF 4LHUG 2ICWI 5HGAB 1LO3H 1Q94B 3MLXH 5DSCA 3VRIA 4HJUA 1CD0A 3B2XA 3NZHL 4Q8BA 1T5XA 5F9AC 5HI3C 3HZMB 3RWHB 2P24B 3FQXA 5JOPE 5E7BA 2D3NA 3BWSA 1Y0LB 3VSTA 5BUAA 4L5FH 3GHEH 1I9JL 1ED3B 1CD1B 1ET5A 4HXAL 1KGUA 1EHLL 5CGMA 1KTDA 2IG2H 2OJEA 1ECZA 2Y3AA 2FECI 2WWKT 4WW2F 5ISZD 2GKIA 4H7VA 3VWKD 4R5XA 2UWEF 5HJ3B 4BH8B 3T6ZA 2NQDA 1IKNC 5I6OA 1DP0A 4TSCH 4MJID 3PP3H 5FKAA 1VCAA 4NQDB 5C0CD 5E8NA 2BW4A 2YK1L 4FQLH 5J1AB 1V7NH 1LWRA 3FUNA 1U8OB 1D9KB 1FE8L 5D6CA 4ZW8A 1KTKE 2A4CA 1FHGA 4GXFA 4XAWL 5CEYB 3TN0A 3SGKA 4KK5C 2EQDA 4P23C 1BHGA 1TZIA 2VOTA 1MCPH 1BX2B 1LP9F 1QWNA 4YX2L 2AJSH 4RA3A 2YD1A 3HMWH 1DBMH 3L1OL 3PWPA 4I3GA 5JHMA 1E4XL 4FP8H 2YN5A 1YQVH 2XZCH 5IHZA 5K9JH 1S2EA 3BUIA 2I9TB 1RJCA 3ARSA 2HRLA 3KYKH 3ULUD 4PY7A 1BMWA 1F58H 1TIUA 3QDGA 1NBVH 3L08A 3RGHA 2J5WA 1A7PH 1VCBC 2Z3FA 4CBZA 4PD4J 2Z8VC 1NIEA 3T8XA 3NIGE 1Q0EA 2GC7C 4N8PA 4G6AD 4JQXA 4TVPD 1WBXA 3T3PB 1IT9L 1L9OA 4AX3A 2QHLA 3DUSA 2DRUA 4XNXL 3P0VL 2J5LC 2F18A 1JI1A 1R3KA 3HBZA 3O6FB 4QHPA 4W4OC 4DKAA 1EGJH 1MCOH 3IMVA 1XF5B 3MA7B 4MNGE 2QR0B 2ZAGA 2IDCA 4QAWA 1UZGA 4ZOCA 2ZONA 3PIQB 3PJNA 5B1JA 3BN9D 4QRQB 3CHPA 1B2YA 1MRDL 2QMJA 2OTPA 1BJMA 1I1AD 3I9GL 5IESH 1LYQA 3IJ7A 2NXZC 5F7AA 5E8PA 3S8GB 1WS7A 1AGEB 4ZFOL 4PLOB 5EIIG 1P4UA 2QKSA 3PWVA 4P57B 1J05A 2AJVL 1HILA 1JWMB 3CDGA 3SYOA 2Q7YA 1RIUL 3DDFA 5I2IA 4M3HA 4WNJA 1UCBH 2GABA 4W70A 1CYXA 1KACB 2IPKB 5A7EA 2WLNA 3RVVD 5F7UA 3JV6B 3KLSA 5F3BB 1NKRA 3CC5A 4QTIL 3U6XS 1KGYE 2I07A 3C6EA 3O0LA 4O2EA 4WEBL 1KLGA 3FCSB 2V2TB 3MUGA 4AVKA 1JUFB 2JJVA 3WHE1 1G87A 1U2CA 1T20A 3ET9F 1TNMA 2YARA 5EIQA 3SOBL 3AADB 5ICZA 4N9OB 1IGYB 3LEVH 1OCZB 5FYLE 1KB9J 4PW3A 3D3VB 1UWFA 2NR6C 3GTVA 4YE0A 5CEXB 2W60A 2WQVA 5DTFA 3WFCL 3IJYA 1ZS8A 2CJUL 4LU5L 4AC2A 1W0VB 3GLZA 3GO1L 4M1GH 2QLYA 4XH2A 5FGRA 5SX5K 1UD2A 4FFVC 2PNDA 2ZSWA 4NNPL 3KPLB 4J28A 3CX2A 5GISH 2VTFA 5CEZH 1BZ7A 2DKSA 1RZQA 1NC2D 3T04D 3HW7A 3X14A 2MEJB 1NGYB 3MC0A 2KQNA 5EZOH 1QFPA 1F3JB 3VXOB 3EYQD 3O41A 4K7PL 2FB4H 4ORZC 4KI5F 2FBRA 4IRSD 1OAYH 4OUUB 1YMHB 2A6IB 3LH9A 2VDRB 3QQ4A 5LGHH 5EEZA 3LV3A 2CJTA 3BKCL 3DPBB 3SDAC 5MEQB 1JYWA 1XGTB 1PQZB 1PG7H 2PPAA 3RB5A 3H9ZA 3RTLA 1FNSH 3MV8E 5AEAA 4EN3A 4YK4C 3TBSB 2HLFD 3DX1A 5EBMB 4Y2DC 3K91A 2MKWA 1K5NB 3ZO0A 2IBGA 1GGTA 4I7ZC 4CC4C 1JNJA 4EI5D 1HHHB 1OAXH 1ZTXH 5F7LB 4NSKA 3I6GA 4Z7OB 4FQXA 2Y5EA 2WQAA 4L3EB 5PCYA 3UYPB 3ABMB 4HJTA 4AXWB 5I1DB 3VI3F 2JLPA 1CXKA 1NMAH 4PJ9B 5ICUA 3R06B 3MR9A 3T6VA 2IXQB 3ECWA 1BQUA 5C0BB 4IBSA 4PJXB 1XDTT 2CO6B 5KVEE 2DAVA 2ZTBA 2JJWA 5FHBL 3TEUA 4YLQT 3CCHA 3O3BB 1N8ZB 2AMGA 3SDXA 2EDOA 1IKNA 2C4FT 4K3GA 1JAEA 4WK2B 1AQDB 1CLYH 5KVGH 4P9HH 3F7YA 2KI6A 3OZKA 3QJQB 2FX9H 4I13B 4HUXB 3K2UL 4PJ8D 2C1PA 1O9WA 2FO1A 1Z2KA 2E7DA 4ZS6C 5DMYA 5C0EA 1IL1B 3KXFD 4B3VA 1F86A 4A2GA 3DIDA 1VGEH 3NVQA 2BWQA 5C6WH 1CFTB 5CLTA 2ZWLT 5F21B 4HCFA 1BLNA 1U8JB 4L29B 3DK2A 4KZDH 2XTJC 3GUTB 5CZVL 4GY4A 2FT7A 4PJFE 5T3ZD 2WXNA 3MUUA 2KS0A 2G75B 1HNFA 1JK9B 3BZ4A 3VO0A 4HS3A 3OKYA 5ICXA 3RPIB 4BA0A 3Q06A 2KYIA 4Q0XL 1SMDA 3B5TA 3FQNA 4HHGA 4BUHA 5JPNA 1JJUA 1A1OA 1NBYB 3PXHA 3LN4A 3FT4A 3UBGA 5K1NA 1JXGA 4W81A 5E4AA 3IMRA 3Q9QA 5DRZB 5K59F 4F15B 3KCPB 4XN2A 3V52L 2A7BA 5E00A 2EVIA 4PLKC 2DQHL 4JFHE 4HEMA 4YDVA 3VD2A 1YY8A 1JPEA 5DUMH 1AO7D 1JWSA 5TGBA 2GBVA 3BQUB 4YHIA 1ASQA 2F7IA 3Q8CA 3QEGH 4JDTL 3T8VA 1DQMH 1E8WA 3DX7B 1HKLH 1JPSL 1KEML 4JFFA 4F7TB 1VADA 4JANA 1NTDA 4G71B 5D2NC 3VWJB 1E30A 5IOPA 2YD3A 3V0DA 5J5EA 5T1DH 1YYCA 2CBMA 1CG9A 3E9UA 2RJMA 5HJDA 4XMLH 2XQYK 5HXMA 2KBGA 1R5IA 3GFUA 3OKEA 2KZBA 1Z66A 4DAGH 3BH4A 1T4KB 3CDCA 5I16A 2M1KA 2P5PA 2W9EL 3RILA 2R4SH 4ELKA 4NQCE 5DK0A 5IQLA 4YGAB 2CPUA 2O26U 3WIAA 4PD4K 2YUXA 4MA8H 1N0LB 1LO4L 6FABH 2NR6A 5J12C 3NP3A 3Q43A 5AVXB 4X6DE 4KTGA 1L0XA 3A6OA 4H2AA 4M43L 3ZDYF 5FF6B 3CN1A 3KCWA 4ZX6A 4WU7B 4NRYA 4UIMB 5GGVY 4NC1C 2PO6B 1CT8A 5SWQA 3DC0A 1NLBH 5F9OH 4WI0B 1KY7A 3SO3B 1JNHB 4JGUA 2I7SA 1EVTC 1KCSH 4FULA 5FUZL 2FVNA 5GGRY 5GS2D 3FW6A 4P5MB 4U31A 2JKJA 1BQKA 4WO4C 4AOFA 1HXYA 1QSFD 2OV0A 3NA9L 3LD8C 3T0EE 1ZWIB 2P52A 5F9DC 3TH2T 4QCIA 2H26B 5EOQH 2DB8A 3WFZA 4JFVA 1S7VB 1UVQA 2C7UA 4FQ2H 3RGVD 4UQDA 4GKSB 1R34A 3BUYA 1I8KB 1RFDL 4MZ3A 4Q56A 2OW6A 4AZ8A 2XRAH 5SX4I 4KDVA 4YSRA 4HV8A 4HH8A 3FB5A 4PCYA 4ODTH 4XNYH 4P9ML 3TA3A 1HSAA 3OHXB 1MY5A 2GY7B 2GSMB 3S35L 1S3KL 2ADFH 3EYOB 4JM0A 1BQHG 3DSNB 3WCYA 2C9UA 3EHBC 1DEDA 1TO5A 2LFGA 3B7SA 1KB9K 1KIUA 1K85A 2HKFL 4ZBJA 5I0VA 1XSJA 1G9NC 3MV9A 2ZOLA 3W5MA 3EBIA 4B9FA 2EAEA 1EZLA 3PJSA 5I17A 5HPOA 2HRGA 4NQTA 3ULVE 3MNVB 3D69B 3DXAB 5DZPA 1G7QA 1VERA 4JAMA 1ZGLM 2Y6SC 3D2UB 32C2A 2HT2D 2JI1A 3QULA 1G84A 5F7EH 4KI1A 3QVAA 3AWGA 1J9QA 1G7HB 3KH4A 5KUKA 5EB9A 1QO3A 5EFIB 3BPLC 4OZGA 5FKPA 5C6TL 3W5NA 2AXJA 4TVSa 5T5FL 3TBBA 5C0RH 1I7ZB 3NFSH 3RWFB 4KUCF 1Y18A 3FB8B 1OL0A 4JX0A 1UKSA 2IBBA 2P8MB 4LKCA 3U4BL 3P30H 3V5DB 4Z7VB 5L2KB 3RY6A 4E9WA 1HSBA 1MFMA 4QTFA 4N2EA 1L9MA 4JB9H 3BUQA 1U33A 1UM6L 35C8L 3ZIYA 2A6JB 4G11A 3WENA 5BO0D 4DCQB 5E0FA 1FCGA 2N01B 5JDJA 4UB0H 1II4E 2KERA 4G80A 4U3HA 4Y9CA 3P77A 1KPUB 2CDGA 3BVNB 4Y2OB 3HRPA 2C8NA 2FO8A 4HIHA 2J6EL 3D5OF 2YD6A 4TL4A 1LO3L 2WB7A 4ZTOL 2A83A 2X6VA 4YAQB 1MW2A 5KYYA 3B9DA 1O5PA 3KGRA 1YHPA 4N2IA 1VA9A 4P5TA 4L5FL 3GHEL 1UOKA 3RKDD 4ZZKA 5I15H 5I23A 2H2SD 2GIYA 2IG2L 3UBXG 3GMNB 4ADGA 3CDZA 3OX8A 2Z35B 1HE8A 2CHXA 3LXBA 5GHWL 2BVUA 2D31B 2XG4B 3EJZC 2DLEA 4F7KA 4N8VB 2XFGB 4TSCL 4OB5L 4XN8A 1G9HA 4CDGC 6CGTA 2DL9A 5JW4M 3N0PB 3AU1A 3E6HA 4QRTA 4P46B 5D2NA 2WYHA 2OR9H 5CZRA 1M2OA 2NXYB 3DHPA 2AEIT 4M6NH 1D7BA 1OQXA 3APCA 5L8KB 4C4KO 2A74A 5EU3A 4ZSOB 5I19L 5HDQH 1EAJA 2HTKD 4QHKI 2QZQA 3RWDB 5KBNC 3QDJB 4XZUB 3HFMH 3Q2LA 3S88L 5DD6B 2VJ8A 1XVSA 3S5ZA 3V0VA 4AENB 3K5RA 1G9MC 3VMOA 3FPXA 1P69B 3REWB 1JHLH 3LZPA 3L5IA 1KCRH 3EDKA 3I3EA 5C0DB 2WWMC 3PL6C 4KOCA 1BG9A 4HIJB 2H0PA 4G7RB 1LJMA 1UZ8A 2X1OA 5J9PB 2XN9D 5DHXB 4Z5RA 4X8JB 1Z9SA 1JGEA 3OXRB 4ZK8A 1GS6X 2QSTA 1JIBA 2BFVL 3VD1A 1E28A 1EFQA 2CPCA 4WO4A 3RBGA 1B4TA 1T2XA 2ZOTA 5C0ND 4KQ4L 1G4RA 1F1DA 1K2DB 4MSWA 2FRGP 1RHHB 2Y22A 1XGZA 2P8PB 3I74A 5IJKC 3HI5H 2VDOH 3ARFB 4CMMB 1I1RA 4YDZA 5IB2B 1FL6A 5E4IA 2DDQH 4YDLB 4X7TB 4NAJA 5L6YH 2BNRD 3J7HA 3VTAA 3UAJA 2ZKHH 3GRGA 2YKLH 3A0OA 1Z7JA 2VSCA 1A5FL 4DNLA 5DJAA 2FCBA 4RWHA 4R7NA 5KSAC 1U8LB 1CLZL 1BV8A 2J72A 1VRSA 2QSVA 4KKNA 5EU4A 1FHNA 2WN3A 4WI4A 5IBTH 1CFBA 2DQEL 4Y4FB 4D0DA 1CLOL 3NIDE 1OTUD 2XTLA 3T71A 4YHNA 4CKVX 3SO5A 1XGYL 3FH8A 3MKKA 3NK4A 3SJVD 4K2UL 3F3HA 1ASPA 3DUHA 3KS0J 4F9PA 3UTPD 3BVDB 5IROC 1JGUH 5IMOB 1RJZA 4TUOA 4NIKB 3MRJA 1ESOA 1FJ1B 1F4YH 4HPYL 1SFDA 5CP7B 2DTSA 2R0WL 4RAUB 3RLSA 1TZ8A 1MFNA 4K9EH 2ICWJ 2Y7SA 4D94A 4IBQA 5GISL 1MWAA 5CJXC 3W11C 3JV5A 3EBAA 3L5JA 2VL4A 1GGCH 3ZHDA 1JRHH 2G5BA 1SY6L 4HP5A 2UXGA 1OAJA 2WOBA 4TMPA 5LDUA 3ZE2F 3W2DL 4OM1L 2FJFB 2ICEC 5BV7H 5AL8A 3II2A 3P4LA 4HFUH 1KDJA 5AVRB 1YYML 3GBNH 3DVGA 4J3BA 1J5OH 5JIDA 1IGTB 2R2BB 2UZXB 3BAEH 4MDIB 2GHZA 4MA3A 1MCSA 3VGEA 4WGKA 3U0TB 5CBEB 4Y5XB 5KSUA 2RGSA 1J0ZA 1S7SA 5JW3H 2O6CA 2VIRA 1X5MA 3QRGL 1Y7VA 4GRWF 1Q9LB 1UG9A 3U0WL 3QEQA 3QI9A 4GFTB 5I0XA 1IGFL 1VFOA 3FAXA 2ENSA 1OAXL 1ZTXL 4X8CA 1OGAB 3EFDL 5F96H 2CUAA 3GUFA 3BAWA 3NEOA 4TNWK 1NFIA 4PBXA 5CWSA 3TFKD 2BCKB 4RX4A 5I75C 2F7PA 5H2BB 4BSJA 5HYSA 1FG2B 3CDFA 1K6QH 4B9CA 1UADC 3ZHLA 4S1RH 1HIML 1N6QL 5D2LE 5HHVH 4G1EA 2R9HD 3I9IA 3QIBC 4QXUL 4OGZA 4PTUB 2ZOKA 2P5EA 2SEBB 2VR7A 2OMXB 1UURA 4PJCA 1JZHA 1EHXA 4S1QL 3UPRB 3B2DC 4BZ2A 4FEMA 1ZV2A 1SHXA 3VNYA 4J5VA 1WBYA 2IV8A 2VW4A 3MRCA 2PW2A 3O3DB 4I0PC 5E2UH 3TIEA 5GGRA 2Z4QB 4BE5A 1RK0A 2FX9L 1U58B 3TVMC 1IGJB 2WV3A 3ZSSA 5JORB 1QLEH 3FQRB 4Z0BL 3DO7B 3GBDA 4XNBA 4UIKH 2E9JA 4KAQL 2EDWA 2ESVB 4GUPA 3F6JA 5F89B 2EVFA 2A77L 3UTZB 2VN3A 4AVHA 3D39B 4MAUL 3Q8BA 5EO0B 1GKEA 1IGMH 2GJ6A 5IVXE 4XPAH 1CU4H 3RVWC 2IOIA 1B4JH 1SRDA 5SWZA 3ETBF 1I82A 3REVA 5J06A 2BHFA 3OZ9H 4KDTA 4KKLD 4HIXL 4PG9A 1A6AB 3H55A 5I6XC 1N59B 4JE4B 5K9QI 4EN2A 4AGOA 1UJTA 5I82A 3IB4A 4FI7A 1DCEA 4O2FA 1XF4B 3IE9A 3PNWA 1XGRA 2J8UA 4N1EA 5LCVH 3VFVB 2F5AH 5JHDE 5AAMC 2Z65C 1EO5A 5E2VH 4G59C 4XO9A 3D4ZA 4G42B 3T65B 3SE4C 1EDYA 4JO1H 4G1MB 4PRNB 3SPIA 3HI6H 4LSTL 1ES0A 5D71H 3QEGL 4YO0A 2Y7QB 1TTBA 1HCVA 5I6PA 4ZUTA 2IWGA 3A47A 4XMPH 3WUZA 7PCYA 3IDIA 3D25A 4PJFA 3BN3B 2HVKA 4KKCC 2YC1B 4KV5F 3T4AA 3TN0D 5BS0D 1XTMA 1N5YH 3GMQB 2R2CA 3NJJA 1KELH 3QXUA 4LQ1A 4M6OL 5DZVA 3PGFH 5ISZB 3BH8A 4OLYH 4M4RA 5FWQA 3VWKB 3V4VL 3KPNB 4LVEA 1F2XK 2O1AA 4FLRA 4P04A 3PWPD 5GS1C 4MQ7A 2NQCA 2P80A 3ZE1F 4JFXB 1RZGB 2X05A 3WXVH 2F9BT 3HKZA 1HH6B 4MA8L 3QDGD 1W72A 6FABL 4NJ9H 5C0CB 3M8OH 3M88A 4KVPA 1RU9H 3OKOB 3GSVA 3LHPL 1JCVA 1OSYA 2IEPA 3IKCA 4QYOA 2EE6A 2DQJH 4PV9B 1WG3A 1S5IH 5F9OL 3PY9A 1IBHA 2EC9T 2ZUTA 3ZR6A 1ULVA 3I6LD 1KCSL 4XNUH 3ZMRA 4X99B 3FC8A 5F9WC 3FUKA 1KC5H 4KZCA 4RSVA 4ACPA 2E47A 4FXGB 3TO4B 2VWEE 2XTSA 4JY6B 4YXHL 4XMUA 3L1EA 3SDYL 2L0DA 1JF1A 4XXDA 1FVDA 1OSPH 1EV2E 4NQCA 4OLVH 1JV5B 1OAZL 3VXNA 2C9AA 2XPZA 3SGDI 4GQPH 4PVBA 3HRZB 4QHNB 2EH7L 2WKOA 1I1FB 1JNLL 1DFBL 2HCZX 3Q8AA 5SWSA 1L9QA 1WSST 1DR9A 1I1AB 2ZG3A 3G6JE 4PN6A 4YBLC 1L6PA 4AL8H 1AVAA 3RUGF 2OX5B 3CN2A 4IDLA 2ATKA 1ZIBA 3PGCB 1PLBA 2XY1A 4LARH 5FGBA 5ALCL 1DVFC 3OR7A 1BVLB 3ARDC 4GS7B 5EU6A 3QG7L 2PCFB 1NC4A 2YD8A 3QNYB 2DF3A 2PCPB 4KZEH 3SKJH 5EU7C 3CSPA 3MCKA 4G8GA 5F88B 3MMEA 1A6PA 3S37H 3LPPA 4PI0A 4JG5A 4JPSA 1CYWA 3VI4F 2V5RA 1PKQE 5DWPA 1NDMB 3AMKA 3RVTC 1HZLA 3EYVB 4JREC 2XZQL 4ZMYA 3BO8A 4XE0A 2B77A 2FATL 5IVZB 3TIDA 3OXSA 3VE0A 3IDJB 5AKSA 3ELQA 4GBXC 5C0RL 1KPRA 5EC1B 1QWHA 4YNYA 1NUNB 5E5LA 1USQA 3NFSL 4CAGA 4WI3A 3CVHA 4U1JA 5D7IF 4F8OA 4RGNC 1MCFA 1PNCA 4BCYA 2X70B 4DKTA 4OJFH 5DD0H 4PLJC 4BQ9A 1NC2B 2X28A 5DQDL 1WBZA 3BVTA 3IF1B 4MLSA 4EN3D 3EFOA 2BVYA 3AXIA 3BP5B 2WLLA 3LXCA 3S3DB 4NKOB 3VW3H 4JVWA 4P5SA 1O7DC 4KHXL 4LOEA 3V6OE 3U2SB 1UB5B 3D4CA 4ZOAA 1CFSA 2ZUVA 4IRSB 5ELIA 3BWUF 4YLCA 1MAMH 3CIQA 4RWYH 3UC0L 2F53E 4C4BA 4FZEL 5DGRA 1BQ5A 1UJ3A 1XIWA 3V8CA 1AP2A 4FQXD 3U9PH 3N91A 3T3ME 2VH5L 4K5LA 4TULH 5FO7B 2D0GA 1X5AA 3ZSTA 2YAQA 4IKLA 5BOJA 2HRPL 5HI3D 3IXTB 5G4NA 1CL7I 3PF2A 3KE0A 3IFNL 3QUZC 4OZIB 1U95A 2AXFB 4PHXA 3Q8EA 1FFNA 3DVIA 4EI5B 3MUHL 1ECYA 3A3YB 2JB5H 1XZWA 4XODA 1I8MA 2CRZA 3AXLA 5F7KC 3OKKA 3P0YH 1X5GA 4GI8A 5TPWH 1KWKA 1YMMA 3MRMA 2YOAA 3TJHC 3ECUA 1V10A 3QWOB 1QKZH 1N3NA 4WNQB 1DE4A 3BCDA 3LIZL 4R97B 3TXAA 1FL5B 1QBBA 2Y4SA 2EDNA 1A02N 4PYGA 4BZ1A 3MGTA 1YEHH 2MQCA 1CWVA 2AJUH 3D0LA 3V9CA 4Y89A 3DRTA 3BRDA 3PCYA 2VDMH 2K9UA 1KIRB 4ACTA 1QPPA 1WHOA 3MRIB 3ARRA 4PJ8B 3NYKA 4YC2B 1DQLL 4L9DA 4LLYA 3UL4A 2ZKYA 3K72A 5K9OA 4H0HB 4EZLA 3KXFB 3QUMA 4M62L 3DI2B 3V4UL 2QFPA 1EWHA 4NNXA 2Y1YA 3T9WA 5EU5A 4PRAB 1PD1A 2JE8A 4UMGA 1J1XH 1EUTA 1V3JA 3NJVA 1OW0A 1Y6KR 3MJ9A 4MMZB 1BZ8A 3VD5A 2NXZD 4C4KT 4R0LB 4ZUVA 3VFUA 1DCLA 4MQXC 4ZMOA 1XBRA 2UZYB 4GG6A 2QGEA 1U8MA 1LE9B 4LPVA 4HZLA 3TJPA 2QTEA 3CJJA 3QCUH 2IBZX 2V7NB 2WTRB 5EH1A 5DS8B 3F2LA 3ZQWA 4QD2E 4DPAX 2DDQL 2XA8H 2X12A 4JFFD 4FKKA 3WFDH 4MJ5A 2ZKHL 3P73B 1LDSA 5DEGB 1WFUA 3KBHE 4PJ7A 3HNTH 2YFNA 1KT2A 4I2XE 4O58H 2BP5M 2W95A 4WGWB 5I73B 1AO7B 2XSKA 4NUJA 3LPFA 3BP6B 3FRPB 5FYLH 3Q2VA 3O2DL 3ARDA 5BW7C 5HYQA 1DN2A 1F6FB 4BJLA 4ZD3H 2YBGA 1VACA 2P42B 2YGVA 2ZWYA 3EFFA 3CZEA 5C0GB 2BINA 2HH0H 2NR6D 1N4XH 1HEZB 2DM7A 1SLVA 1Y1DA 4HX1B 4PR5A 4DTGH 1V5JA 5LNGA 3WBDA 2HVJA 1SQMA 3SHSA 2NTFB 5KJ4A 1U8CB 3DWTA 1LE5B 4APXB 1AYRA 3LZLA 3OPUA 1AS7A 4GFXA 4ZNCD 1UC6A 4HA1A 2IAAC 2OMYA 4FFZA 3FFDB 5AKTA 4D0CB 1THCA 2UY6B 1H6EA 2QJDA 3FYIB 1KYOK 1E5ZA 1TMQA 1U8NB 4NQEA 3FRUA 4M7ZC 2VAAA 2H3NA 1DBKH 3QG6A 4LVNB 1BM3L 1CDHA 3WAJA 2EZ0D 2I60H 4PJGF 4UILL 1Y6MR 3K71B 4BFIA 1XR8B 2XZZA 4ZXBC 5FDWB 2NUPA 4L8SC 4KMQA 5BV7L 3K46A 5T1MB 4MAZA 2G2RA 4CUCA 2ADIB 1P6AB 1H6UA 1PW3A 2V17L 4YEFA 4BZ2H 5ERWB 2H32A 3BAEL 2WXOA 1NAMB 4JFWA 2E76C 1ZHNB 3VDAA 5D72H 5E9NA 1QSFB 1WFNA 3QNZB 3BI9X 1NSNH 1T1WB 2XX1A 4PP1C 4RLDA 4WI7A 3TA3D 1HH9B 2B15A 4OLWH 4X6CF 3NTCL 2FO4B 3P69A 5CM1A 1RUPH 1JGDB 3SDDA 1CMOA 1DSFL 2Y07H 3RGVB 1F6AA 4MB3A 1T7VA 2DLTA 4U49A 3FONB 5F96L 4QLWA 3OG6B 3MV9D 5GGSY 4Q9QH 1QPKA 1CK0H 2ENQA 4IJ3C 2YD2A 3S9DB 3HG3A 3GZPA 5KVEH 1VKXA 1MJ8H 2Z93B 4J12A 3QUZA 4ELMB 4XCFH 4PV8A 4S1RL 2W9LA 4EZMA 1EAPA 3VXTB 2HMIC 1HXMB 2JKXA 3MOQA 3B4NA 5F70A 1F3RB 4JDEB 4AE1A 2D2OA 3TASA 4MXVE 1NICA 3K2IA 5E70A 1CLCA 3RY5A 1FBIH 3HHRB 4O4YL 1SUHA 4WCYL 3H9SA 4XXWA 3PABA 4OD3L 1IEBA 2MIZA 4KJPD 2MTAA 4GG8B 4NZFA 2AAVA 4HJ1A 3TT1H 4HYTB 3UAFA 1W8EA 4MCYB 3VH8A 1MJUH 4UBDC 2XN2A 3QARA 1WFMA 3AU0A 3SBWA 1YNTA 4ZO6A 1T22B 2FEDC 1HN1A 2LTQ