2J73A

Alpha-glucan rcognition by a family 41 carbohydrate-binding module from thermotoga maritima pullulanase pula
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
103
structure length
103
Chain Sequence
FTETTIVVHYHRYDGKYDGWNLWIWPVEPVSQEGKAYQFTGEDDFGKVAVVKLPMDLTKVGIIVRLNEWQAKDVAKDRFIEIKDGKAEVWILQGVEEIFYEKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis of Alpha-Glucan Recognition by a Family 41 Carbohydrate-Binding Module from Thermotoga Maritima
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords PULLULANASE
total genus 21
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature ec 3.2.1.41: Pullulanase.
pdb deposition date 2006-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03714 PUD Bacterial pullanase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2j73A00
3V0IA 2J73A 3V0HA 3AWEA 3AWFA 5BZXA 2YOCA 3V0DA 1D5RA 3V0FA 3V0JA 5BZZA 5BUGA 2J43A 3AWGA 3V0EA 3V0GA 3N0AA 2J71A 2FHBA 2FHCA 2J44A 2J72A 2FHFA 2YA1A
chains in the Genus database with same CATH superfamily
4FYTA 3VTAA 5B8CA 2DM7A 4ANXA 1H6EA 3PFQA 2JKTM 3EBIA 1P7QD 5GGUA 3BJ91 2Z31B 3TH4T 1A7PH 5DVKA 2PPDA 1S9YA 4B5ZA 4JZJC 1R24A 4L4TE 1DBBH 4E9XA 2IPUK 4KI5D 5D1ZA 1G9NL 2EQDA 2ZUVA 4G9DA 2MWCA 1XO8A 2O5NA 2WSKA 3H2WA 1EAOA 3DIDA 4Y19E 1HS6A 5I71C 1LHZA 4UNUA 2GEQA 4NP4H 3MRFB 5HI3D 3B9DA 2ROYA 4GNKB 4LCWA 4X6BA 4G6JL 4CILA 4Z3EA 4E0RB 2DQHL 1OQXA 2FNBA 3K2IA 2YC1A 5JORA 1EHAA 1FBIL 4OZGB 4XGZB 3AMKA 3INUL 2I5YH 2CRIA 4UQBA 5DR5L 1SEQH 2FSDA 3QZLA 1ILUA 2IMNA 4JQVA 1CXHA 4WKZB 5F9DC 5J4MA 2WVUA 1SLXA 5DC0A 2EVGA 1JS4A 2PNDA 1SY6H 4JN1H 4BUHA 2LABA 3VCLB 3L4UA 5B38B 4I77H 5JIQA 5FWQA 1P1VA 1A7RH 2V5YA 4LLMB 4HVBA 3A6CL 4ODVH 5C0NC 1Y1DA 5LGJB 1T1YB 4NNYA 1X5ZA 1G9MH 2MPAH 1HKLH 2GCYB 2ERJB 1A22B 3BCDA 5DD1H 1BZ8A 1IGTB 1QYGL 2DQDH 2EXTA 2VR7A 4L1TA 1IQWL 2XKUA 4X6CB 2BRQA 1U8KA 3ZE0F 1L0YA 4FP8L 3QPXH 1U8PB 4HT1L 5IVZA 1KFGA 5J9PA 4WSKA 2N1KA 4AQAB 4A2MA 4OD2A 3WNPA 4NC2B 3BVXA 2HN7B 2XG4B 3GMMB 4K7PY 1A65A 3AM8A 2NXZD 3KPOA 3FAXA 1I8LA 3TJHD 4RIRB 3CMOH 1ZV2A 2UWEA 5TK4A 4G8GD 1RHHB 1W0VA 4KY1H 2DTMH 1HHGB 3QIBD 3WDIA 3U0WH 3LX9A 2EUWA 3MV9E 3HI5H 1T7XA 1UATA 1U92B 1FFPA 1AO7B 5LBGA 3EDEA 1AJ7L 3TT3L 2BZ7A 3ILDA 2XACC 1U6AH 2R0WH 1JZIA 4OIAA 2X2JA 5ERWA 1BX2B 2VC2H 4KI5F 1YUHB 3TZVA 2CBPA 4IBYA 2EDKA 3EJZD 3MREA 4YBLB 2MCPL 4DW2H 2BK8A 5EZJB 4TLSA 5I23A 5F0PB 3MJ9L 3WFHA 2F6AA 4AK2A 5I1AA 1HIML 1SLUA 1UJTA 2QSQA 3DTDA 4RFOL 4ZPTA 3ZDZE 2V17H 4GFTB 1RUPL 2ARJA 3V4PL 2GJZB 3HN8A 1S7XA 4PP2B 4ERSL 4KZEH 4PJ7B 4WEMB 3EYVA 4WGVB 1JE6A 2CPUA 4ATTA 3VFMB 3OLGA 3BSHA 2NYYD 3QQDB 1YEFH 1XCTA 2D7OA 2AZAA 1JRHL 2VDOH 2RCSH 3AXHA 4FKKA 4LLWA 2CLRA 1YNTF 1D5MA 1QO3B 2BVEA 4ELKA 4Y4FD 4ETYA 3OMAB 4RDQG 2D9QB 2ZNXA 3CVIH 3H9ZA 2VR8A 3L4ZA 1TDQA 4LCWB 4JFYB 4NQVB 3WJLA 2MH4A 4UT6H 1EZVX 4XC1H 3R4DA 4RDBA 1JPFA 4LHJB 1ZY9A 1UKTA 3V5HB 3NACH 4HK3N 2EKJA 2FAUA 1W6LA 5C0RL 4GP5B 2OTWA 4NRZB 3WIIL 3VG9C 3QXAB 4OCRL 5D71H 2YZ1A 4P59L 3MQIA 5HJ3B 3SE9H 3TBTA 5GZND 4TSBH 3O9WB 4UILL 2Q3AA 3MMEA 5E94A 2XZCL 3WEXB 3RTQB 1NKOA 4JVPA 5FXCH 1C5BL 4UAHA 1JNJA 1JXKA 2OW6A 1HZHH 4IRSB 3QUXC 1MG2C 4HPOL 4N2CA 4AEFA 1KCVH 4DT2A 1ETA1 2IADA 2OXHB 4B3VA 3HRZC 3VU1A 5C92A 4XPFL 3RX8A 4NRZA 5EU3A 3H4HA 5IKCA 4S1RL 2PP9A 2FIRT 2BS9A 2E4FA 4WI3A 4B9KC 1IAIH 4ZO6A 1TJXA 5INCA 3IWUA 5J11B 3CV5A 2LGNA 5CKGA 1MCJA 1JZFA 5E4EB 3BZFB 1OK0A 4XTRD 2BP0B 2G3ZA 4MA1C 3E6HB 1GZPB 3LPPA 1NIFA 1TTGA 2ZKXA 2FLRT 3DJZA 3L17A 2HT3C 4F9PC 1JGEA 3SE3A 2YD4A 3UJJH 1AH1A 4I4WB 4EDXB 1JXDA 1MWAL 1MFUA 1AOZA 4D0DB 2UXFA 5I19L 3QXTA 1TF4A 3KPSD 4AZUA 5IGXH 5DGRA 3DBXA 4Y4KC 3FO9A 5AOZA 1SDYA 1U95B 4U7KA 1PZ5A 3PAVA 5F8RC 2IG2L 1PY9A 1WUZA 1YMHB 1N19A 5JMRA 1UKQA 4YDKL 2ZYRA 3ME0A 5IJDC 3K72A 3KS0H 3QWRA 4WDIB 5IMMB 5AZUA 4EUPB 5D8JH 5D7LD 1NFIA 4P46C 4G8EB 4J3SA 3TBSA 3FRPA 5IEHA 2R0ZL 3MI6A 1BEYL 1RUAL 2J55A 2IAMC 2EC9T 2FWLB 2GC7C 3D25A 3IMTA 4LVOC 3HCVA 1SJMA 3QRGH 2A0LD 2VMJA 1OQOA 3ARSA 3N9GL 4OT1H 4E5XA 1KBGH 5DRXB 4PGJA 4HS8L 1O7SA 4JPWL 4N0FA 5I30H 1JSYA 3FSOA 4R8WL 1VGEH 3OKLA 3MV8B 5IJVB 2CCWA 5FO7B 1ACCA 4YLBA 4HIEB 4WI0B 4Y2DA 3DX6A 3HC3L 3EADA 3TCTA 4FERA 5ID0B 2AJYH 5I76A 1Q4NX 1ZXQA 4O4YH 4FQQB 4F8LA 1KT2B 2P45B 4O2CB 4ODTL 5B1JC 1BD2A 1ORSB 4NOBA 4G83A 3LS5L 3UL4A 1KIRA 5TF0A 3OBAA 3VXOA 5EOQL 4PJ9A 2AVFA 2X2YA 1IL1B 4L5FL 3DKHA 3I3EA 3WFCH 3D69B 4XP4H 4JPKH 1AFVL 4BV1A 1ECZA 1RZIA 4Y0GA 5C0JA 3FQNB 4GLRI 3KCWA 3P3UA 1EO8H 4V11A 4HALA 3GNML 2I07B 2W9DL 4A7UA 4NJAH 4OF8A 3EFFA 5IWLC 1SVCP 5J1AB 3DJSA 4HKXA 4AJYV 5HJBA 3LEYH 5IM7A 1DVFA 4Q9RL 5D2LA 1RURL 4O2FB 2ICWA 4JN1L 3EF7A 1T66C 3AJ7A 4FFWC 2D2CC 3NRFA 1W91A 4D0CB 4HJ0C 4XO8A 4HV8B 1NGXB 2AP2A 1VENA 4FQ2H 1K3IA 3L1EA 2FE0A 3LRLA 5FYJL 4F7MB 3WFDH 1CICC 4MNQE 2Z31D 2VXVH 3K6IA 1XQ4A 2XZZA 2QGDA 1H3PH 2Q3XA 3U46A 1CTMA 4PI2A 4FCHA 4PV8B 3JVFC 2A9MH 2R4RH 5I17A 5SX5H 2NTSP 3ZHKA 3WS3A 4WHTB 2EECA 4OQ1A 3IFPB 1UXSB 4F7KA 2PPEA 2UVFA 3KPTA 3P0GB 4K3EH 4Q52A 2VL5A 3CSGA 4E9YA 2BIPA 3CDZA 5DJXB 1JGEB 4K94L 4Q8BA 1ZDQA 3PL6A 2WKLA 5KSBF 3MNDA 3X3GH 1LMKA 3GZQA 5ILTH 1ZXKA 2GY5A 2X6MA 3VX0A 1ES0A 4JKPL 3DBXB 4MX7A 4S11A 3V6ZA 2ZCHL 2X9WA 4KHXL 4R2GD 1AHWC 1EFXD 1VSCA 2DIAA 3G6DH 4PREB 4EZMA 5DF0A 3P2DA 1WC7B 3MRNA 1MCIA 3HB3D 2HVBA 1A7NL 4JPIB 2XPGB 3G5YA 4P2OB 4R97C 4W6YB 5DA0B 1KWKA 1G1OA 3CFJB 4S1QL 3ZKSD 2MPVA 4BSWA 5B38G 1OZTG 1VADA 2AXWA 2JCCF 3QR1A 3MXWH 1AZCA 2XBDA 2VN6A 3I75B 3ZIMA 4S2SB 2OSLA 3ZYOA 1DFBL 4G8EA 3LPWA 5SV3A 5IZ7A 1M6UA 1PLAA 1PTZA 4ALAC 4BZ2L 1OD9A 2H4EA 4GO9A 2WO3B 5KYWB 4OFVA 1AFVH 4YVUA 4IMLA 3GLEA 4XP4L 1N4XL 3VGAB 3NK3A 4LXFA 3HEIB 3ULVE 3DTXA 3GPSA 4PR5A 4AQEB 4OZIE 3U6XA 1M71A 1KB5L 2BNUB 4GAFB 3RE0A 2ZUTA 2WLLB 4ADJA 3TBBA 4OF7A 3T65A 3CZEA 4DFIA 1P4BH 2IQAA 3UTSD 2VDQL 2KKQA 3ARWA 5BMFH 2NXZB 2RQEA 4MA7H 5CN3A 3I75A 5GSRA 4P05A 3TWYA 2WWMC 3LN5B 4I1PA 3L81A 4GUPB 3ARRA 1AI1H 3AVEA 1X3DA 1I1CA 2WVSA 5FFGA 1CGWA 5KYWA 3HMXL 4FEIA 5DURD 2EIDA 1EWHA 5L4MA 3N85H 3RWIA 4LHUA 4PM1A 3QZBA 3APFA 4XBPA 1Z9SB 1ZLVH 4XE0A 3FUJA 2VR3A 2R0ZH 1I1FB 4MS8D 4YHML 1ZIBA 3QZPA 1TYRA 3ESNA 4XNYH 3TO2A 1FL6B 3F7YA 2R1XA 3GMOA 3OKDA 2GFBA 2QLVB 3QWRD 5GRWA 3BT0A 4OCLC 3MGOB 4XBGB 5GRJH 2HPTA 1Q9LB 3RWJB 3ZT6A 4PG2C 3G5ZB 4AXWB 4P49A 4KROD 4J27A 3D87B 4OCYL 3GMRA 1OWRM 2V7HB 1M1SA 1MCOL 4ZDHA 4X7DC 1T83C 4UOJA 1P5VB 3WUWA 2ENQA 3NSFA 2D03L 2D03H 1G7JB 1ZIAA 3U0PB 1IFRA 1D9KD 5CZXD 3OHXA 1DTUA 3AWGA 4P04A 3ZL4L 3IGFA 4I0CC 1E90A 2AQRA 1AKPA 1V27A 3O3DA 1QAWA 2EH8L 1DVTA 3UJJL 1D6EB 3U46B 1M53A 1GGCL 1Q72L 2IGFH 4GRLB 4TNGA 5C0IA 1AC0A 5F7LB 3H85A 4OTXH 5K33A 3W5MA 4NO3B 4HGMA 2NY4B 2RBLA 4OD1H 2HG0A 3CSYB 3A0OA 1NUGA 3DX7B 1E28A 5DRWB 5FS5A 4F80A 4PJ9B 1T83A 4P5KA 1J5IA 3BP4B 4Y4FB 1ZEAL 3X1BA 2DD8L 4NQCA 2WKOF 3W0WE 1YEIH 1BPLB 2OW7A 1UCBH 3W1ZA 3VVVA 4U1GB 5CJBA 5JQHC 1OW0A 1YCSA 2FO4B 1D5XB 3HMXA 5D7SH 3SGEH 1CXEA 1O9ZA 4U33A 4ZJ9A 1JGLH 3LQAC 4GAJL 3UIZA 2ENYA 5SWZD 1TKWB 4LVHB 2AFNA 4WVRA 2UXTA 4U3SB 5HGAA 2WXMA 3TONA 2IPTL 1GSMA 2Z3FA 4MA7L 5FUZH 4HQQL 5EOCJ 1RSYA 3K4DA 5JQ6H 4PS8A 1C5CH 3WEBA 2DLFL 3B3IA 3GXIA 3PAYA 1RPQA 1W72A 2P24B 1T4KA 1JDDA 3MVSA 4NBYB 5FCUL 4R9HA 4IOFD 5FCUH 4LBAA 5F44A 1TT6A 3KLDA 1M7IB 4C83B 2OKMA 3WAJA 3DMMD 3HZMB 1A6UH 1AR2A 3UBHA 5KBLA 4JR9L 1BOYA 2ZP0T 5A2KH 1IKNC 1PQZB 2D73A 1E65A 3TN0C 4F8TA 1TO5A 2BNQB 5LBSA 2X4QA 3BH9A 5IQ7L 3QFJD 3EJJX 5FOBA 1I8MA 1A1OA 1Y0LB 1JFQH 2WLJA 2ZXCA 4YHLH 4XMLL 4FLHA 3WTYA 1YEIL 2HJLA 4FI6A 4M4RB 3HPJB 1UYWL 4ZSOE 4F8OA 5DWUL 1PSKH 1YEJL 3G6DL 1I8AA 2HWZH 2NY6C 3TIDA 1HOCB 3WOVA 3MNZB 5EU6B 5JIPA 4M00A 5BO1H 4PRID 2C3XA 4HJ1A 2Y7NA 5JNYB 3C6SB 2IPUG 1G5AA 2W65A 3K46A 4NQXB 2CO6B 2NW2B 1UADC 2ATKB 3FU6A 4XO3A 3W82A 4OZGF 4NGHL 5DD6B 5G2NA 4RFOH 3BGAA 4NX0A 3D85A 1RK1A 3F7QA 4PJDB 3MLWL 3NJHA 4UBDD 1ZANH 5JOEA 1MJ7L 1IAOB 3D51A 1EEQA 4GMSH 5CLTA 4LRIC 1FFTB 2PXYA 5IW6B 1JYVA 5DRZA 2UZIH 1YN7A 1QFWH 5F9WB 1X5HA 4IQHA 3BYYA 2R0WL 2X0VA 3EFDH 3IFNH 1Q9KB 5A40E 5BPPA 1FGVL 2EXSA 4Z95H 3TIDB 3FQYA 5EZPA 3L5HA 1IIIA 4XNYL 3PXJA 1OTSD 4OD3H 1Z66A 2E75C 4MB5A 3HG5A 4KOCA 3RI5K 3P4NB 1DZBA 1X7SA 1BLIA 2ZQKA 5KN5A 3AS2A 2XZAH 4FZEH 5C7ZA 1J9RA 2FB4H 5KJRL 5EDXA 1U3HA 3EUDA 3HMWL 2XBTA 4LSPH 4XCYA 1CDGA 1C12B 1XF3A 3G04B 3LV3A 4QRRE 2OMVA 3ZTJG 1QD0A 4LNVA 2Q8AL 3CBKB 4HW6A 4WWKB 5I1GH 5BVJA 1SF5A 3NRQA 4JZNA 5C0CD 2H1LM 4JPSA 5EO0B 4A38A 1GRWA 1WEJL 3HAEA 3N6YA 1TLMA 1AGDA 1TJIH 1MRDH 2FGWH 1CG9A 3IGAA 5FYJD 4BK5A 4W68A 2AEQL 3O6LH 3Q8AA 1EZVY 3WMQA 2PYEE 1Z9PA 2PYED 1QPXA 1HEHC 4BGLA 3QYMA 1IBHA 4Y7OC 5JA9A 3BGFB 4TSCH 4OGAC 3MLRH 4WJKB 1L7IH 3LHAA 3Q6GL 4IBUA 2BDNL 3ZDYF 2BXYA 1IAIM 2HUEA 4ZXBC 4YHNA 1DP0A 2ZSVA 4WFEE 4XBMA 3OJ2C 2EIBA 5HDBE 3US1A 3IJYA 4AGLA 3ZUCA 1LNUB 3GSRB 3NZ8B 2NXYD 4NZ8A 4RBPK 1G7HB 1A7OH 3GRWH 4XPHH 4AT6B 1I8UA 2P8PA 4KJWD 3EH5B 5I30L 3B9AA 1N5YL 2UVEA 5D6CB 4KRPB 4ZUTB 1HZLA 1ZT1B 3HHRB 5KJRH 4FI7A 3AROA 2O6PA 1NEZB 1M7DA 1T4WA 2AXGB 3GJEA 4E9TA 5KS9F 4P5KB 2F53A 1FVDB 3TA3A 1VLXA 2BOCA 4M62L 3BQUD 5A6LA 4HZLB 5D8JL 2J8OA 3JZYA 5LO7A 2PO6C 3V4VH 2YLHA 4PCTA 2BDNH 1S5HB 3J8F7 1RPKA 5DS8B 2IGLA 3BUPA 5D6DC 4KX7A 1CDUA 4C4BA 3LMJL 1DJGA 1IC4H 3Q2CA 4AC2A 1MNUH 1U36A 4F91B 1L6PA 4P46D 4K3EL 5FECB 1LP9F 1FL3A 1PDKB 3KLSA 4U1SB 5E95B 3SBPA 1J48A 1ZWIB 2CKBH 2ZWSA 3UPRA 5IUSA 4QJ4B 4BDVA 1ICTA 2YPVA 4X2UA 3RUGF 2AXHA 2QQNH 5EUKB 1NEZA 3WKYA 1KCSL 43CAA 2X4PA 4NQDD 3SYCA 5I0ZA 2W5PA 1W72B 2IBBA 2P24A 1BX2A 2F53B 4HGKC 3TA3B 1SRDA 1YN6A 4BJLA 2DTSA 3SDXE 5ITBL 3RWGA 2YGOA 4PBVC 2CK0H 3QDGA 5FUOL 3FU0A 2Y2WA 3TIEB 2Y2YA 2VR5A 2ZCLH 4YSEA 4TLKA 1A9BA 2WHVA 3H55A 1OP3H 5D6DA 4RAUB 3IETB 2QFRA 5FGRA 5K39B 2EAEA 4WI4A 3V0DA 4MD5A 5DUBA 5ECGA 4F9LA 4L1BA 5SX4H 3CC1A 5BUGA 5EUKA 35C8L 1QSED 3HE7A 1GJIA 1R6VA 4G80B 3WENA 3UTSB 4DIXA 2FEDD 1YA5A 3FQTA 4HS3B 1WA2X 2NX5A 3I9GH 4GG8B 3MLUH 4LEXL 4M7LL 4PGBA 4WUKL 4PJBB 2NY5C 1NBZA 4P59H 1KFAL 4LAJH 3K81A 1K8DB 2Y5TA 4RWYH 1BZ9B 1C5CL 4WU5A 2XHNA 3FB5A 3AQXA 4B53A 4EUPH 4AMWA 5LB1A 1LO0L 1NAMA 5HGDB 5D5MF 3RPBA 3GPEA 1OVZA 2A2QT 4MXQD 5K9KA 4Z7NE 4PJ8C 5BO1L 4KUZL 4HUUB 3W39A 3WS6C 4P4KA 3FF7A 2VO8A 1RJLA 1W0YT 2J44A 3H9SA 5E94B 4BK5C 2IWEA 1HCZA 1AKJA 1ZOXA 4PTUB 4TVSa 1XR8B 3DJRA 4BEIA 5ADPH 1I3RB 3R0NA 5J6HA 3ZGIA 4EAEA 3EH3B 5FX3A 4DJMA 4F20A 4QY8A 4MLSA 2HP4A 3P4NA 3VM5A 2BM3A 1MJJB 4X8JB 4LDCA 5BZXA 2OR9L 4PY7B 1NGPH 1F4AA 2C5DC 3EYUL 1IEBA 1UM6L 5FUCC 3QNXA 3FQUB 2EVFA 2XWXA 3KGRA 1ZHKB 1D9KB 3U4AA 1IAKB 4LIQH 1CVRA 4S0HA 4U3XA 3RDTB 2FX8H 4HEPG 4BD4A 1O9VA 2OMYB 4N5UA 1Y6KR 1CLCA 1ID2A 3M7OA 4XCNA 4PJ8A 1CCZA 3EH2A 4KMTL 4WW2B 4YEFA 3LQMA 3ORJA 3WS6A 2P42B 1GMEA 4KDTA 2RHEA 5LQBL 5FHAL 5GS1B 4NCC1 2CLZB 3SQBA 2B0SL 5GGTL 5C2BH 1BZDA 1CG9B 1MCPH 1T0NA 3D9AH 4PS7A 3G5VA 5EHFA 4MJJA 2X10A 1XGYH 2R2BB 3V0FA 3FTVA 2B20A 3H9HB 3BEWA 3BMWA 4K3JH 3C87A 4E2OA 1CDCA 2KERA 5FOJA 1I8KA 1JWUA 1X5FA 3QEQB 1AZZC 1D9KA 5KVFE 2FRGP 3TBWB 4PU2A 4QGYA 3FO1B 5ESQB 2Z7ZA 3TA4D 1J1PL 3S8WA 1AXTH 1J0ZA 4R0LB 3H54A 5DMKA 4JFPB 1XDTT 2PN5A 4LEEA 1JV5A 2P48B 2XN2A 5FM5O 1J0HA 1EAJA 3BGFC 5IVXF 2F8XC 2P5WE 3C6EA 4BH8A 5EOCL 4L3EB 3WHE0 1NGQL 4MA3B 3ZL4H 1J8HB 3MYZA 2MCG1 2XWZA 1VCBC 3A67H 3VFVB 4DQAA 3LKQA 1PS3A 3NRPA 2JK5A 2PWGA 3IDXH 4Q6IC 1J5HA 3Q5OA 5IB4A 4PJ6A 3GSXB 1EEZB 3ZTEA 4MNHB 1UJ3C 4IEFA 4YHPA 2WINA 3A6CH 1DLFL 4U6VH 4UV4L 5CR1A 1MVUA 4QRSB 1F58L 3SKJH 1ZT4B 3TBYB 1NCTA 1T20A 4PJBA 4EUPG 4KITB 3FU3A 5D96C 2W80C 4FNSA 3O8XA 2Z64C 1V3LA 5J13B 1DVSA 4L37B 3ISWA 4A1RA 2WCSA 2X4PB 1VEOA 1S9WA 1HCVA 2CO2A 1N3NA 4PJ7A 2I9LA 5K59F 4AEHH 4F7CA 1PY0A 2AK1L 2X40A 4P5SA 5HI3C 4YAQA 3ABGA 1AY1H 4YE4H 4XI5D 5HPMA 4XVSL 3DRTB 3M86A 3FU8A 3V95A 5BQ7A 2N1TE 4NFCA 4JRYB 1EAPA 2GJ6A 2DRUA 1YLBB 5HHXL 5KSBE 3WYRA 1Q0EA 3CDCA 5L7XH 2XPYA 3C2AH 1KWGA 3C2AL 1N10A 3BKCL 2XQBL 1SUHA 3V2AR 4F27A 1KXHA 1WLHA 4O5LH 2X7LA 4JFOA 3IVKA 1G7PB 2X0WA 5HYEA 1BCIA 5D1ZB 5BRZE 5EORH 2D3LA 1MCSA 1MIMH 1QP1A 4PMEA 4YFEA 3QQ4B 1EDYA 2C34A 1R3JB 5HGHB 32C2B 1GZHC 3GB7A 1CIUA 3KBHE 3AUWB 1X9QA 3JYCA 4H8PA 5B8CB 1AGEA 3ULVF 4W9HC 5DTFB 3L48A 1MJ8L 3B7YA 1JDAA 3MJ7A 4OZIF 2V9RA 4YGVB 3HAEH 4ZS7H 3FFDA 3Q9PA 3BN9D 3FQWA 3LSOA 4GAYB 1B9ZA 4QUOA 3SE6A 2E9IA 3QEQE 4B9FA 1YVLA 1OPGH 2FHBA 2VMFA 2NQCA 3RY6A 3U7WL 4CSSA 4EO5A 2WIIA 2R1YA 1R0AH 1LVEA 1KLGB 2QR0A 3A22A 3CHXA 2VIRA 3EBAA 4Z7UE 1MRDL 3WFCL 1YEKH 1A3RL 4DN3L 3G6AA 1H3XA 3CGTA 4QNPF 3WCYA 2DQDL 2WXOA 1NPNA 4XP9L 2CHWA 2FATH 4LCIL 3QJFB 4K71B 2PWDA 3H3BC 3QNXB 2GTZB 5FV1L 4EN2A 1NUNB 1NUFA 4MJIA 4ZK8A 4A6YH 4WI6A 1IM9B 5DGQA 3MX0B 4LCVA 3AT0A 2PR4L 4B9PA 1BJ1H 4G8GA 4ONGL 4R5XA 4EI5C 1VEPA 4CMHB 4UNVA 4NUGL 4RGOH 4NUJA 2IH9A 4OLXH 1B0RA 2OJEA 4BRVA 1GZQB 4JRWA 4ZD3H 3BP5A 3MBEC 2VIRB 3HC0B 8CGTA 1OT1A 1X5LA 3ZDYB 3IJSA 4M9OA 1T0NB 5E8PB 1YECL 4CVUA 4P4RA 1NPJA 3MNVB 3CHPA 4MSWB 5IMMA 5EU5B 2Z4QA 4H25A 4R6UA 4F8NA 2KLTA 3O11A 1HSBB 1QFWL 4MDIA 5BO0D 1E4XI 1BJ8A 2XQYG 2J88H 4Z7VF 3TESA 5A43C 3VXQA 2YRZA 1VKXB 3QUZA 5E2TH 4LLQA 4P23D 3S37X 5AOKA 2HLAA 3E1ZA 1IM9A 4P46B 4XHQA 2CUIA 2YEZA 2YK1H 4Y2DD 5C09A 3F6IA 1HXKA 3KAAA 1UA7A 2Z35B 3WIFA 4ALAH 2GB2A 2R29A 1UQSA 4YAQB 2YAHA 1DHKA 3HUJE 2XIDA 5HPMB 3WFHB 3RWFB 2LTQB 1PLBA 1NCGA 2VDQB 1XSIA 2QMJA 1KIRB 1XGUB 3EYUH 1MUJA 1QBBA 1CLZH 2XN1A 3B2VH 3F04A 2GITB 4M9PA 5D70H 5AKRA 5KVFL 4IRZL 3BVNA 1YEJH 3QJSB 3FCGA 1TETL 3SDCD 1A3ZA 3S37H 4HHAB 1OCWH 2VJ0A 5IJCC 4HUVA 4KKBD 2WYHA 5AKVA 4W6WB 2WBJB 3RL2A 3UC0L 5ENWA 1OGAB 1X7TA 2I07A 4XPAH 3UDWA 2R51A 3UTTE 1XGYL 4EOWH 4AZ8A 5I6NA 1PYWB 1QLEB 4WZ9A 1BQ5A 4LOFA 5JO5A 2XPGA 3G5YB 2NY0B 4H8VA 1MCHA 1O7VA 4N5ED 4BZ1L 4ELMB 4XCFH 5JHMA 4DP2X 3NJGA 1VADB 5C6WH 2Z0BA 1EFXA 3P3TA 5LKNA 4LEOA 1MCCA 2YPLA 4XWOC 5A2BA 1I9JH 3C8DA 4JBSA 3DARA 3DX9B 2J20A 3EH4B 5ECJE 1AQDB 1LDSA 4JJOA 3MTXA 3QXVA 2B1AH 5D2LB 4WUKH 1JGUL 2NR6C 1X5MA 3RFZC 1B3JA 1NMAH 2GAZB 3DPBA 4ZFOL 4HQQH 4JANA 5CEZL 4LSDA 5CM1A 4RMTA 1OEZW 3L2NA 3OAZH 1MQ8A 1PX4A 2FQEA 1T66D 5JXEC 1PYWA 3ETBJ 1SMDA 4CN4A 1BF5A 1QA9B 2XJLA 2AQPA 5IW1A 1XF4B 5JMOC 2Y6SC 5HHQA 1KN2L 2K3TA 3QO1B 3QXUA 1CURA 4KMLB 3UTTD 2A9NL 1JMXA 4CVWA 1HJCA 4FXKC 5EPMA 5ABDE 4RESB 1DQDL 2R4SL 1M42A 4L8DB 5KOMC 1C5DB 4H5SA 5GJSL 1INQB 4AUYA 3BH4A 3T0ED 3BWZA 4LLDA 2Z93A 5TD4A 3UTQA 2WSDA 1I75A 1XGTB 3SE4C 2FSEA 3CFCH 3D50A 2AV7A 4YDIL 2AEIT 4N8VB 3SDXB 1P84J 4I88A 4PGEA 5B3JF 3P0VH 2GUOB 4IIQA 4U05A 3TEXA 3CDGB 4UIKL 3I3DA 3VG0H 3BZEA 2FJUB 3X11A 4HHWA 2OX5B 2A99A 3CU1A 4CU6A 5J56B 1Q9LA 3II2A 3IDYB 1QWUA 1NTDA 4AXWA 4APXB 1NCHA 4BUQA 2VT0A 3W57A 4Q89A 3EOBA 1SVBA 3RQ3A 3SE9L 2GUYA 3VQ2C 5LGKA 4QTIH 4HXAL 5EBMB 1RJCA 1YNKH 4R7NB 4KAQL 4NNPL 1X7QA 5DLML 3L6FB 3LS4H 2VM3A 4AEEA 1HEZA 2DLEA 2WYTA 2ZWNA 3OX8B 1QR4A 4BZ1H 2SEBA 2DM2A 1X4XA 1U6AL 1QFOA 1UKSA 5FA4B 1Z9OA 3CLEH 3MRPB 3R18A 4O2EB 2P1YA 3VI3F 1CICA 2G4GA 2J8UA 2WPGA 3UH8A 4MZ3A 3KWUA 3RVVD 3KDMA 4E68A 4Y4HC 5IHZB 3QORC 2VLJB 4DP8X 4D9QE 1T1ZB 4HGWA 4EBQH 1XB6A 1UXLA 4ZPVA 4S1DC 2GY7B 1E50A 1FSKC 2OZ4H 3O4LA 3HBGA 4YSPA 5GSRB 3GHBL 3DRQB 4YPGB 1G9HA 3BYTA 5DZOA 4BFJA 3GHEL 1BECA 3KWWB 1MLCB 3SDDA 4HWZA 1CLZL 1M4KA 2Q20A 2Q9OA 1FE8L 4MB3A 4TMPA 5DO2D 5T1KA 4H8WL 2DMCA 5SX4I 2CDEB 4ERSH 4KZEL 1T1WB 4LHUB 1T2XA 1FAIH 5HHMB 4J3WA 3RY5A 4DTGH 3NIFE 3G6JE 2ZCKL 4DF9A 4LOUD 5F71A 3DHJA 3V8CA 4FHKA 2DEYX 1KJ3L 2CQVA 1AHWA 2NYYC 3KPRD 5HYFA 5EOTB 4GINA 1F3JB 3DMMC 5MHSE 4DP4X 5BRZA 5DUPH 4ONHA 4KXZI 3KH4A 3QB7C 1A1MA 2YRBA 4GKOA 4M5ZL 4Y89A 5A2AA 2GAZA 3EGSA 1AJ7H 3TT3H 5AW7B 1DO5A 5CJ8A 3DHPA 3RBGA 2ZNWA 2IANE 2L4OA 4X99B 1YEEL 5PAZA 3ULAB 3F6LA 4Q97A 1A4AA 1ZA3B 4AV5A 3SZKC 2Q7YB 3GSNA 1QSFB 3ASNB 4FZ8H 4OFYA 5H37H 2A4ZA 4OD3L 4QF1A 4Y4KB 4CNIA 2ICWB 4RGOL 4Z76B 3B8SA 4FRWA 1WJ3A 2UYLB 4J8RB 1TXKA 3EFOA 1DBJL 1TQTA 1TFPA 3DV6B 1SUJA 1F8TH 5DUMH 1D5IH 1XSKA 4W4NA 1E40A 1RLWA 1AANA 1SDDB 2P5EB 3ILEA 5DHVB 4A63A 3WO3B 5BUPA 4PI0A 4OY9A 4PV8A 3B7TA 3EYFA 3F64A 3VNYA 1JWMB 5JPMA 4D8PA 3OPUA 5K9OA 5F6HI 1KEMH 1QWHA 2LR4A 1MAJA 3BQVA 5TQ2L 5C3IA 1I1AA 1N8ZA 1M57B 5F3BB 4TNEA 1A7PL 4QF1B 4Y4KA 1CGSL 4XNXH 3T04D 4LPCA 2V3EA 2VZSA 2FB4L 1KCWA 5ANME 5JZ7C 3TOPA 1DEDA 1HL9A 4WFGE 4EEEA 3GM0A 4K7FA 4ZW6A 1FG2B 1SLVA 2EVIA 3F00A 2E4TA 2ESVE 1O75A 4ZMLA 5C9KA 3F5WA 4NKOA 1K9TA 4JHWL 5EEXA 3NEOA 1YSOA 3OMNB 1BVLA 2KLRA 3BAEL 3EBHA 3ROLA 1JHLH 4KDWA 5JDJA 4U6XB 4XPBL 3SKUD 1F1AA 2CR6A 1JCKA 1AG6A 4LU5L 2W92A 4MMZA 4L5FH 1I1AB 1N8ZB 3QR0A 3MLWH 5DLMH 3HZ3A 3HR5A 5BQDA 3D30A 3MV8E 3O3BA 3A24A 4PYGA 5FB8A 3H9SD 3QZOA 4RDQF 5D1ZI 4TXVB 4IKLA 4X5XB 2BVTA 4AWJC 5CD3A 4QHUB 4YJZL 4NKIL 3UAJC 4OAWA 1GGUA 5AVWB 4L8BB 3IDGA 4FQIH 1A6WL 1JBJA 4D9LL 4JZOB 4PB0L 2HCZX 3GYRA 1AY1L 3LKRA 1YQVL 5KANG 2ZOTA 3ZKXC 2ATKA 5F6IB 1JZ3A 5D5ME 1G84A 3QCTL 5EUOF 4G43A 2WY3B 3BPLC 3V55A 5KYYB 2PYFB 3WKQA 2JQMA 3QXDB 4M61B 1CFTB 3TEZA 1OV8A 4JRXD 4AJ0A 4GG8A 1JN6B 1U0QA 3WFZA 4E0RA 4UMSA 4RETB 3AREC 1MPAH 3Q1EA 1XGRB 5GS2D 3U30C 5B3JE 1P9MA 1DJZA 4PGZA 1A3LH 1Z9SA 2WXLA 2ID5A 3MRBB 2BNUA 5KEZA 4I13B 1N6QL 4PRDB 2QSCL 4NPYB 4UV4H 5BW7C 5JTWA 3H3PL 4PJ5A 4DKTA 1KDJA 3MUGA 4H0LC 3NZSA 4M7KH 2EDWA 1HHJA 5C08A 3TPKA 2QKSA 2AQ1A 4KGJA 3FSZA 3HFMH 4QJ3B 4POZD 4WCYL 1GS6X 1FH5L 4X98A 3QI9A 1MW3A 3I6GB 1OP9A 3CN0A 4M93B 3BD5A 1M2VA 5EOCH 2QADD 5KZCB 5I5MA 4HAGA 4XE5B 5BS0D 5KSVA 1OALA 4BYHA 4GH7B 4OV5A 4HUCA 3QQ9D 5GIRA 1XGRA 1KV7A 2M2DA 2ZAIA 3GGWA 1XH3B 3NIGF 5BVJB 1SVZA 4OLWH 2VXUH 2CKBB 4C56B 3N91A 1GR7A 3LKOB 3CXFA 3RGVC 4I9WD 4OU3A 1P2CB 3DROA 5TE7H 3DX0A 3QUYA 1CBJA 1ZEAH 4M8QA 4XCCH 1CE1L 3I6KB 3ZHFA 1SHSA 2XG4A 3GMMA 2VR9A 4LPUA 4Z78A 5L6YH 3CXHJ 4G7RB 2VDMH 4XOAA 3LOWA 3IFLH 4DP7X 5C1MB 3HE6C 4MDJB 1T04A 2E27L 5E9NA 5HI4C 1IMHC 1RPUA 5IMLA 5C07B 3NN8A 2OMWA 2ZUUA 4X9YA 3C08L 3C5SA 4L0PB 2B5IC 2G9KA 4F1ZA 3ZBMA 2KQMA 1NAML 3SQOH 4TVPD 4FFZH 5AYUL 3PGFH 1P5UB 3PHOB 2ETWA 3ARFD 3B2UC 1KB5H 1MZYA 5FPIA 3EFOB 4NFDA 1E8ZA 3H9SE 4G6AD 4KJWC 5L8LB 1VFBB 4B7IA 4Z8FL 1FFOA 3ZYIA 5FECA 5I6PA 2KMWA 4JM4L 2F53E 2MIZA 3Q48A 3VWJD 1MPAL 4XMTA 1INEL 1BVNP 2CO4A 2WMPB 3EZ8A 1E0OB 5DS8A 3ZTCC 1T89C 2Q7AA 5ITFB 3T8XB 4FNQA 1LO2L 2LHAA 3QWQB 2IV9A 2BNRE 4L3EA 3L3OA 1RZ8A 5IR1A 4RISL 4MYPA 5I6MA 3LPGA 2RCSL 3PHSA 3V0HA 1A1NA 3RU8L 2NXYC 4H1LG 3HMXH 4FXLA 1NDMA 1JNLH 1MF2L 2QV4A 4JZOA 3KWTA 4GG6A 1XIWD 1MFMA 2ITCB 1LEKA 3BPOC 5EC2A 2HFEA 1NFDE 2VM9A 4WJ5A 4DKFH 3H8NA 4IEFB 2F18A 2HG5A 3WI9A 3ZDXB 3RY4A 4E9VA 1PKQB 1XB3A 4MGXA 5BNXD 2MHAB 3IETA 3LZNA 2B77A 1L7TH 2VDPH 3KYAA 12E8L 3BE1H 1MH5A 1KFAH 2CNYA 4HJSA 5KYUB 3BW9B 5BV7B 2XXGA 1R33A 2HT3D 1CL7L 2H1XA 4HPYL 1MREH 4UU9A 3VXUB 3KPLA 4IDJL 3OL2A 1U8NB 1WIOA 4JCWA 5GZNA 1A6TB 2QGCA 4FQXA 2XTLA 5EO9A 1CLYH 4JDZA 3C5ZD 3IS1X 3VQ1C 1JZHA 4QHMB 4QYAA 2YD0A 3QDGE 1H3PL 2VAAA 5SWQB 2EUXA 1KG0A 1BM3L 3BIBX 2XWBA 5BZDB 3WNNA 2HFEB 3ENEA 4X83A 3NGBC 4ZMYA 1Q9KA 3HFFA 1A2YB 3KGTA 4PGDA 2EO9A 4LFHG 1OLZA 4G7YL 1C7TA 1XMEB 2DTML 2DYPA 5DT1H 4G7YH 4L29A 2FX9H 3MODL 4Z7VA 1T0PB 3GKZA 3QA3A 2P8MB 3JTTA 3WNLA 2V6HA 4HXBH 3KGUA 4PJ7F 4AYMC 3SHSA 4TNVK 5FFLA 4Z7IA 5ISZB 3T1FA 3DPDA 1EJ8A 3ZTJH 4M8UA 3IAGC 2O5ZL 3QPXL 3V5DA 3RGHA 3VI3B 3MLZL 4HU8A 3VFSA 2E6JA 4V2CB 4X6BB 1JHKL 2RB8A 3U83A 1OAQL 4JHUA 2DAVA 4B96A 3QWNA 3X14A 4MASA 1IB5A 1IC0A 3AT8A 2V2WA 2XYBA 3S34L 4WHCA 4P99A 2AJYL 3AGVA 2HB0A 2ICWI 3H3KA 3CFQA 1SY6L 3OXRB 5E9DE 4ZO8A 5LHDA 2NY6B 5DJ8B 5GS2H 5E6IC 4YDJA 5ANMA 4HIIA 4GPVA 6FABL 1JD9A 3T6QC 1YC7A 1FCGA 1FCCA 4Z18A 2AK4E 3AXLB 1U58B 2VN3A 2P28B 3OR6A 1N5YH 1NBYA 3LRHA 3FSWA 2WN3A 3ARZA 4U0RB 4FA7B 3C5XA 3MCKB 3PWLB 1MFVA 3ECWA 4IMKA 2HH0L 4NO0A 2OQJB 2YAOA 4RFNC 2P5WD 1ONQA 4M02A 4WW2C 3UJIL 1FGNL 4WFFD 4ADGA 4MXVF 3EJYC 4JY5H 2VUKA 3ROOB 1LEGA 1DVYA 2A74B 5DHYA 5I9QB 1F2QA 2ZKHL 1HXYA 1NGYB 4K9EH 4K8RC 4X5WB 1HSAA 4QT5A 1Q0YH 4LIQE 3ASOB 4GUCA 2FGWL 3K5RA 2JKRM 3QJQB 3QIWD 5H37G 3U6RB 1WEJH 2CA4A 3ETTA 4I2XE 4S10A 1NC4B 1NWPA 1B4LA 4APQB 1ZAGA 1JHTA 1EIBA 1BMWA 3RVVC 4FNLL 1EMTH 1ETJA 3OGOE 4X9HA 5L6YL 4JFOB 1ONQB 2JV6A 5B39B 3QUXD 1E4XL 1G7IB 2RH0A 4MKTA 2AQNA 1KB5B 4M8RA 4NZTL 3S96B 4XXCA 3QRGL 4MB4A 2WQSA 3L13A 3ZPDA 2ZOKA 1REIA 5D1XD 1A6AB 2J5WA 5LG6A 5HYJD 1H5BA 4NQVA 5GZNC 1KCUH 3OGCB 4NQDB 5IP4A 1CXKA 1WG3A 3QUZC 1U8CB 4FE9A 3FYIB 4R90H 3FHQA 1FC1A 1NC4A 3NOIA 3PUUA 1ZT4A 1ZHNA 4GRLC 4TVPH 4YLQT 5GQBA 2UZXA 1C5BH 4H8WC 1QFWM 4U7SA 4RX4A 3KW7A 1YDPA 4NAQA 4BDVB 3C6LC 3ZZQA 3VFMA 2XN9A 3CPLB 1TFHA 1YJDH 2QQQA 4U2YA 3BT2L 1ACYL 1BG9A 3ZX1A 1BA9A 1HZKA 1SOQA 5E0QA 1I1YB 5D96B 2WGXA 3GS7A 4JFVA 1KB5A 5LDSA 4RAHA 3GTVA 2BWQA 4ELMA 2XFGB 1BQSA 1KY6A 4XHJC 5I17B 4I3GA 3PDGA 2KLSA 1JDCA 2PW2B 2JQZA 2AGJH 4JFDD 1UM6H 4NN6C 2G5RA 4UCFA 5BQ7B 2YPLB 1NGPL 4GBXA 4B3EA 4BHUI 4OUOA 1BFVH 2GIXA 5J6GA 1A4JA 1PSKL 2BY3A 1G4RA 1OGTA 2LLNA 5J1TC 1ZHNB 5CS7A 4CU8A 5DJZA 1XB8A 5JQIB 5LXVA 1NSNL 3IS0X 1T1XA 4CSPA 5EEWA 3NJMA 5IV2A 1KUMA 1CF8H 3BWAA 3FRPG 3BRGC 5F7NC 2YLKA 2YA2A 1INDH 3RZWA 4TQIA 2QADC 5EIQA 2EVJA 1HQRB 2O5XL 3WD5L 1GC1H 2NUTB 3OF6A 3TYGH 1KEGH 2V2TA 4N8VG 1B88A 2IH1A 3I02A 2WBKA 3OXSA 3DOHA 4G6FD 2SODB 4OF6A 3DO4A 1PEZA 3FN9A 3QSKB 2FECI 4GKNB 4ODHL 1B0WA 2GPZA 5F21B 5B1AB 5JXED 3LN9A 1URLA 4QPEA 3RNQB 2I85A 3FQUA 4NKDA 2QR0B 1W2KT 1CGYA 1KDIA 1A47A 3A6BL 4ZFOB 5C0RH 4CDHA 4ZAKA 3CFDA 2VO5A 4QWWC 1DVFC 3E8VA 2LFGA 4UUJA 4EKXA 2IPTH 3X1FA 4D9RE 2MNJB 2WP3O 2X4RB 4P2RB 1ROWA 2WWKT 4XPBH 4CBPA 3TT1H 2Z34A 2VL4A 3NPSC 4NNYB 4JZJB 3V6FA 4Y16D 1FI8C 3FCSB 3G5VB 4YVNA 4U6YB 1OGPA 3S37L 1QABA 5IJKA 1XF5A 3CG8A 3PXLA 2XA8L 1GZQA 1F00I 2JI3A 3FB8B 3HCVB 2DIEA 1X7QB 4OD1L 3FDWA 4M5TA 1U8PA 1WFJA 3FO1A 1FNHA 5E2VH 3G9VA 4KJPC 2VLKA 4PRAB 4F9LC 2AV1B 1DUYA 3NIDB 5D4QA 1P7HL 3X13B 4ALAL 4KVNH 4XXDA 5HD8C 4NI3A 2IEPA 2EE3A 1EVUA 1IQWH 1ND0B 4NRYA 4BFIB 2I9TB 4LLQB 3BVDB 3S35X 5FYLE 2BRRL 1RK0B 4QXGH 2EYSA 3V0GA 3NCMA 2OXGA 1HINL 3D8MA 2R69L 4WENB 4CN1A 5C0FA 1DFXA 1ZLEA 1P7KA 3ATDA 4MS8C 5H94B 2ZXAA 1DR9A 1PPIA 5TDNA 3SJVB 1KCLA 5HHOB 1A7RL 1E27A 2FJHA 1XCXA 2HA1A 5DK2A 3T09A 2VXQL 4WFED 2X41A 3VGDA 1WSST 3MGTA 4NQQA 4QRTA 2GTWB 1P4LA 2VLKB 3D69A 3U0WL 1S78C 3FOLA 1SEQL 3LQAH 3MSPA 3LKSB 5CJOH 4Y5XA 5TF1L 3D2TA 3FUMA 4XNBA 3Q13A 4G1MA 3KL3A 4GYBA 3PWNA 1N12A 3MRKB 3N43F 2K6YA 1NGXA 3NA4A 4KRNA 2ARJB 3WEMA 3LXUX 4N2LA 3BESR 4FQXC 2C26A 2R1WA 3BHBA 2VW4A 3EDJA 5A6MA 2CALA 3M8OL 3VFPB 2TSBA 1AO7E 3FUEA 4PRPB 1S46A 3L5XH 4OVUA 1NLBH 3M46A 3WS3B 1A02N 4DERA 2Q2LA 3ESOA 1EFXB 4WFGD 4JRYA 4PWIA 3TCLB 1ETZA 4GSUA 4NQUA 3VJ6B 5H35B 4AM0A 1QLFA 3ILPA 4X9IA 1BVZA 4GRWF 3RB7A 2JXMA 4PLNC 1CZ8L 2ZX7A 4M43L 5D2NB 3SPJA 3ZE1F 1WTGT 1QEWA 3WKPA 1OB1B 1N59B 4OI8A 3RGVB 2VLLB 4LEOB 2MNWA 4YHOH 3KPQB 3BLBA 2TRYA 5C0BA 2PO6D 2YFNA 2XCMC 5AOMA 4BZ2H 5IVXB 1I53A 4FFYH 1NCWH 3RZCB 1U2CA 2IF7A 2YO3A 5H2BB 2B4CH 3VXSE 3MXVH 2ESVA 2FGZA 4JANB 5A1AA 5D1ZD 1KGYE 4XAKE 4P5RA 4TPRL 4KKPA 5FW7A 5FFOA 5I8KH 4E5XG 2UWEF 4O02L 1B2WH 5DQJB 1S78D 5EMYA 4EIUA 3B5GA 1LD9B 5JIIA 4GI6A 3GF8A 3Q0HA 1TEGA 2BOBA 3PE9A 3B37A 2VXSL 4FLQA 5T33H 4FLSA 1FO0A 2VDLB 4ZZKA 5B7FA 3JZ7A 3VWKD 1L9PA 4Y8DC 3RAJL 3QI9C 5DURB 1ZANL 4DVRL 1ET8A 5L0QC 1T2JA 4HSCX 2A9ML 2R4RL 3LXBA 3L4VA 2XVGA 1YPZE 3FTGA 4M6AA 4WGWB 1GGIH 3HG1E 3VD0A 4L1SA 2J1YA 3E3QE 4M7ZC 4NC0B 5D5MA 1B0IA 2NY3D 5AW3B 1YG9A 3CXDL 5FYKD 3VXMA 4JFSA 1SQMA 5GJSH 4ZG1A 3EO9L 4YFLI 3BKYH 2PXYC 1UXMA 3HKFA 1NH6A 2WZ5A 1KXQE 4JAMA 5C3LD 2W0LA 1DQQA 1BF8A 3FO9B 2K9UA 3WLWD 2A4CA 1SNRA 5HHOA 4YHLL 2F74A 2JI2A 4NJAL 4B9IA 4HHGA 2D31A 4JZJA 3MOQA 3CH8A 3V6FB 2E47A 1CLOL 1E2VA 1K2DB 1XEUA 5E2WL 3PNWA 3NPZB 1ADWA 2J4WL 3CAFA 3SDDC 1OOAA 4LSRH 4JR9H 4CMHC 1DDHA 3UZEA 4FTDA 3KWWA 5EOQH 1OZUA 4IDJH 2PCPA 1I7ZB 1YMME 2ZX8A 3BO8B 3CTTA 2ED6A 2IVFC 1F4WH 4WI8A 4HLJA 2K4WA 2GYSA 2YBGA 1DSFL 4ZPVB 5F2FA 3B2UD 3S2AA 3LZQA 3T3MB 4CKQA 4BGDA 1SDDA 3O4LB 4XMZA 5CZVL 4N2OA 4KHTL 4IOFC 4RLDA 2I7OA 3WXVH 4ODHH 3H0TA 4IBLT 3BN3B 5E56A 2IALA 1QBAA 3MUGB 2EYSB 3SD2A 1XIWA 4JLRB 1VGEL 1N2RB 2WXPA 3KJ4C 1FDLH 3SBQA 4DGIL 5ABAA 5D1QD 4PJGA 1W9XA 3DA0A 5JW5B 3B83A 4U1HB 4WWOA 3MROA 5CLZA 4TL4A 5C0AB 3DMMB 4JCLA 3O3UN 1FAKT 1FNEA 5H4YA 1N68A 2WBJD 2JJSC 3QCVH 2YD9A 4HH9B 1QKZL 4OTXL 3KBEA 5I0WA 4HD9A 1QATA 3CSTA 4CMMA 1NKGA 1QLEH 3E8UH 3Q6FA 3JQOB 1A4CA 3QUYB 4A7TA 3CQFA 2ZSWB 1QPKA 4YZFF 5I8CB 1HTYA 5IMOA 3RUGB 4XPGL 3WKNA 3FT4A 3MCG1 4G42B 1F02I 4HHAA 3ULVC 4K23L 4EF3A 2N3JA 2VJ8A 4X5XA 4XH2A 2JJWA 1MAML 1QSEE 3L95B 5IUCA 1EFQA 1FO0B 2X1PA 2E7MA 2H45A 2YAQA 5C07A 4QOKD 1GCYA 3QORA 4FDWA 4QHNA 4YL4A 5EWIL 5AB9A 1M7IA 2P46B 4MAYC 2ZKMX 1CGTA 1DCEA 3WV0A 3UPRB 5IW1B 4FTVA 2N7AA 3CLFH 3SYQA 2A73A 3GLZA 1NLDL 4G8FB 5J6SA 5GGVL 4KQ0A 4DP0X 1TJHH 5C08E 4MNGA 3OV6A 3HPJA 4LCCC 2OSLB 3FFOA 1FYTB 1KC5L 4XO4A 1P53A 3HVNA 1VFBA 5KYXB 2OYKA 5I0VA 2GJJA 1WIPA 1KIQB 1JPGB 1I8MB 4G6KH 3EXJA 3RWGB 1DO6A 2H8PA 3WHXA 3DETD 3QIWC 4FNLH 4ZAKC 5BZZA 4HWBH 1PU0A 1OCOB 5BOJA 4UTAH 4KZCA 4MX7B 4A2LA 1FN4A 4TLTA 1NIEA 1P7QB 1WBXB 1H0DA 2Y3AA 4YHIB 4OM0L 5FM8A 1KCKA 1EERB 1NBCA 2OZ4A 3BOVA 3ZE1B 1A9EB 1G7QA 3GSUA 4OJFH 4NXKA 1AD9B 1KIPA 2F0CA 1AGFA 2YAEA 3H6AA 3V4PA 5EEUA 3ROLB 1WH0A 3IPEA 1AKJD 4XMKL 3APNA 3MO1A 1NIAA 1PKQA 5AD0B 1GCFA 3K6FA 4UYPA 4D2NA 4EQ3A 4ZS7L 5CGYC 3MLVL 5K9JL 3LZLA 3D6GA 2APSA 1T2QH 1LQSR 3L3DB 1BXUA 4YXKH 1TEFA 3VRIB 4GQZA 2EZ0C 3KYKH 4HIXL 4MKMA 4AENA 1UB5B 1YEHH 2OULB 3STZA 4EE2A 2FJGA 4TRPH 1CDHA 3H0TB 3VDAA 3LKOA 5D7LB 5LVEA 1BVNT 1N0LB 4PJXF 1NWOA 3NCYS 5EEZA 5JIDA 1D7BA 1BQHB 3ARDA 1DEEA 2DYPD 3ISYA 4U31A 5DJAA 3SKNB 1O7DC 3LKNB 5LAXB 4L8CB 4PJGB 3MBWA 1MW0A 1MI5D 4RMUA 1ZKAA 3MV8D 3HAEB 5EO1B 5LG1A 4PJAA 5BV7H 2DQJL 3HZYB 1JPTH 2R8SL 3IEAA 2OJZH 2GSIB 2NPLX 4KZ0A 4MMYB 3PWUB 5BV7L 5EBLA 2IOOA 4ZS6C 3NVQA 3S4SG 5KN5B 4W6XB 3SJVD 3C9NA 2EEDA 5HHOD 1OAKL 5DJYA 1OTUC 4NIKB 3PHOA 1UUNA 4L4TA 1QQDB 4L48A 4N1EA 5HGBB 3TO2B 1XHHA 2JJUA 2W38A 2ZX6A 3PAZA 1UH3A 1P1ZB 1WAAA 3K6OA 3LB6D 1CYGA 2WXKA 4HJEA 1U42A 5ETUA 2Z92A 4PSPA 4XXCC 5DHDA 4WW2A 4AG4H 3QQXA 4YXKL 4YPGA 4FYSA 1GOHA 5TTRA 4TUKH 5EO1A 1N8OE 2R0LH 3C8KA 5MENE 3QIBA 1TU2A 2FWOB 3QCUL 3GMNB 4JFWA 3X1NA 8FABA 4OJCA 4OH2A 3IDMA 3RIFF 1DLFH 4U6VL 3FFCE 2XUWA 2Y1VA 4RQQA 3WLBA 4KWUA 3VGHA 5IJBC 1T6VN 2FT7A 2B9AA 5DQ9B 4QCIB 1KXTB 1KPVB 4JRFA 4P23C 4G70B 4ZW7A 4IIQC 3CFBA 4UI2A 5FLUA 5LCVH 4HFUL 1CDIA 1XGQB 3DSFL 3GIZH 4LSSH 3RGVD 3LS5H 4IS6A 2AZUA 5GPRA 4ONFH 2PO6B 4R84A 5E08L 3P77B 1GKEA 3S5YA 3VD1A 4Y5VB 4BFEA 2E76C 3D3VA 3MV7D 1EHLH 2BP8A 3BUTA 5AOLA 4NZFA 5F3HB 1JPEA 5CLXA 3CDZB 3M6DA 3ECBA 1A1OB 1Y0LA 1TQBC 3C60D 4HCRH 4OFYD 1JZ6A 1RJZA 2QSTA 4JQIH 1A14L 3MR9A 1SFHA 1MKFA 1EK3A 1YEEH 3CC5B 3QPQD 2MOVA 1MWOA 3SOBH 2EYRB 1KYUA 2R15A 4ZQKB 5ADOH 4ZO7A 3QC6X 3L9BA 2A9CA 5FYKL 4R2GB 4FOMA 1CIDA 3TO4C 2DQHH 4S0TD 4NP4L 1JNHA 4JDEB 2XG5B 3L7FB 3A23A 3FTZA 4GBXC 4J3BA 4WI7A 1PQZA 2ZOUA 1FYTA 4I0KA 1J05B 2GEEA 3EZJB 3VWJC 4HLEA 1MFNA 2HT4D 5DEJA 3T4AA 2NZ9D 2R7EB 4UZUA 4PWJA 3HUJF 3O3BB 5DYOA 3VGFA 5KVDE 1WWWX 4WJ5B 4TVUA 4QHUA 4MD0A 3N5AA 1AC6A 1P7QA 4LPVA 1R3LA 4M48H 5IK3B 2XA8H 4IRSD 3HZVB 3VDCA 4FFTA 5T5FH 4UQ3A 2ZUQB 2BSCA 4XMLH 2ENSA 3KPMA 1NCUA 2N4IA 5DC4B 4B27A 1JFQL 3TFKD 4P4KB 4UU9B 5EU4A 4RSVA 1AIZA 1HH6A 4L3EE 4OW6A 3T8MA 5IVNA 4DPAX 2BY2A 3ZKNC 1W8EA 2ZP8A 3NESA 5HGDA 2F58L 4GSRA 4PRIE 5IROA 3IXAB 1NINA 1OB0A 1N6VA 2BVQB 3MBED 3OKNA 5F1IB 3PWPE 4KDVA 1NC2A 3ML9A 4ZMVA 4K5NA 4LLUA 5KTEL 4QTIL 4NS0A 2Q8BH 1R75A 4ESKA 1XR8A 1E4HA 3HZVA 3RKPA 1E5CA 2UY6A 3UMTA 4ODUB 1BZEA 2DEXX 2TSAA 3ROOA 2ITFA 4ICXA 4U1GC 2OTUA 3V7AG 35C8H 2CJTA 2WIMA 4HEMA 4P3DA 4GAJH 3VGGA 3C75A 2ZX5A 4KU1A 3SKOA 1P5VA 4LAQL 4HJGA 3D0VB 2PCFA 2R23B 2X70A 2R2BA 2CIIB 3FSVA 1JG9A 5D1QB 3E6FA 3CSPA 4JMNA 2FLBT 3QJFA 1H8LA 5BRQA 5E5LA 1KZYA 4HC1H 4MNGE 4UDUA 1BD2E 5HGBA 1MHEA 3NP4A 4JRLA 4KDTC 4XO5A 3OG6B 1ITCA 4J7RA 4NN5C 3UZVA 5C0DB 4DKDC 5F9JA 3IWVA 3GBNL 1Q72H 5HDBF 4XCNB 2Y7QA 4PVNA 4Z78B 4C4UA 4KKAC 3QI9B 3MLYL 3QS2A 3TBWA 3SKOB 3LNFA 1SEBB 1SBSH 2R27A 5HBBA 1I31A 1NAKL 2OR8A 1OF2A 4C58B 3GBML 1BAGA 3AT9A 3K4ZA 3WY1A 3NZHL 1AQKL 2XLLA 3RWEB 2EIJB 2CKBA 3NYKA 2I60L 2OJ1A 4C56A 5L2JA 2X1XR 2EVHA 4X9BA 2IXQA 5C07D 4QOKB 1X5KA 4WNQA 1NCJA 4P2AA 1UURA 4JFHE 1S9KC 1BIIB 4MAYD 5EZIL 1QFUL 4XN9A 5FGBC 5DMKB 1U9KA 3MJ8B 1G6RB 1MW2A 2B5IB 1L3WA 1FYTD 4ZODA 1OE2A 4ZTOL 1SOXA 2Y4SA 3F2LA 3RKDD 3ZXAC 1A9BB 1J8KA 3L3JB 1AXSB 1JJUA 1MVUB 4A6YA 3JVGC 1UOVA 3VXPA 3IDJB 3KDPB 4KO5A 4N6RB 3QFJB 5F7MC 2BWDA 3DRTA 2DWTA 3GBEA 3O3EA 4QOKA 1I9RL 1VB9A 3GXPA 1QRKA 3QARA 3B2DC 4KVCH 4KVPA 3SEPA 5E1AA 3ET9F 3GSQB 3S5LA 2HX8A 4RA3A 3RIAF 1BGXH 4NHUB 3U4KA 2DLGA 4R5VA 5DEGB 5BW7A 3IXAA 3OKNB 1IJ9A 4PRIB 4GKNA 2BHZA 2J2ZB 1A21A 1AGBA 1G0DA 3HRZA 2X7LB 3COOA 5I15H 1NCBL 3A4FA 3FB5B 5IHHA 1DSWA 3FB7A 2ERJC 3VFTA 4N2DA 3QWOB 1CFNB 3QIUA 5FYKH 5ESVB 4ZUWA 5I0YA 4UUJB 5HGHA 3B9KB 3VD5A 5GRUL 3R8QA 5ICYA 4XAKD 5JHDA 3KYMA 5EZOL 4MQXC 2DL9A 1NMBH 3C6LB 1Z1WA 2N0MA 2K4AA 5J12B 1R19A 2D0FA 2H2PC 5E9DD 2XXCB 3S3SA 2DYPB 4BQBA 5J3HC 3T77B 3IPFA 2PCFB 4EZJA 5IEKA 1IGYB 2Z91B 5TDPB 3EFDL 3IFNL 3Q43A 1TYEB 1DL7L 4M5ZH 4RMRA 1BLNB 1WA1X 4A6YL 2UZIL 1N64L 2R59A 3QULA 5AVQB 5E9AA 3AITA 1IZJA 1U3HB 1HQRA 1NCAL 4YBQD 4YGVA 1NDTA 3KJ6H 1D3CA 3MA9L 2CSPA 3PP4H 1W6WA 5DD3L 3UG3A 1K5NB 1RZKH 3DOSB 3D4ZA 1A4BA 2WJ7A 4XBEL 3EKCA 3QUKA 4Q9BA 4L4TD 2XYCA 4LVNB 4RGNE 4WWKD 4P4KC 2BH0A 1GS7A 1T0OA 2D7TH 3R1GL 4AMKH 5K9QG 1FE8H 5T5NF 5J6HB 3QDHA 1HESA 1TSRA 1GOGA 4OZHB 2QVTA 1B6DA 1MHPH 1OSPL 1RIUH 4Y2OA 2WXGA 4OCXH 2PYEB 3FW6A 3LD8C 1L0QA 3CIAA 5DJ8A 4HIEA 2AVGA 4OCSL 1PZ5B 1THAA 3PDDA 4KNUA 4Y2DB 3MX0A 1WZ1L 4GQQA 1M56B 2VLRE 4B0MB 1Y18A 2QEJA 5J9PB 4M8VA 1OM3L 4NHCH 3LKSA 3O2VH 5EU5A 3V4UH 4Z3GA 2WW8A 5D7JD 4LESA 4JPKL 3S3CB 2N56A 1AO7A 4C55A 2Q87A 4EQ2A 1AYOA 2P4AB 3D25B 3CLWA 4AW4A 4NLAA 4P2CG 3OKDB 4KQ3L 5GHWH 5EDSA 1DVXA 1D7CA 2WZAA 4JY4A 3SDCC 3DUUA 2XKSA 2FHCA 2JE8A 2CRMA 3N42B 3NPSB 4OJFL 4GO8A 4X8CA 1L7TL 3S48A 4NT6A 2CM6A 3AAZB 1NOFA 3GMRB 3VRLE 5JQ6L 4X5WA 2NY7L 4R4FH 3QJVB 4NNXA 1IC5L 5DJDB 4P46A 1G7JA 1PLCA 3FULA 3E9UA 3G6JF 4RFEA 1GC1L 3U0PA 1KEGL 5L4IA 3U1PA 1BQLH 5MEOA 4JQVC 2W95A 2X2UA 3IJHA 1MRCH 4FG6D 5LBSL 4GP8B 2YA0A 3K2MC 4HZAA 4TV3A 4OCWL 4F15B 4MCYA 1EXUB 3ZY7A 4NI6A 3KBFA 5CHNA 3DXAD 3EGDB 3FYEB 5DK2B 1NC4D 1BMGA 5DRWA 2LTQC 2E9WA 1JGDB 1Z0NA 1HK6A 1P7KB 1UWXH 2VXTH 3CLFL 1RI8A 1S7QA 2OCCB 2X89D 4W70A 1OAUH 4FQHB 4NNXB 4GQPH 1J7VR 1KPUB 1GW0A 2EEAA 3CVDA 1C1EL 5CIPB 5G4NA 5I1EH 1KGWA 3RILA 3CD4A 4ZYKA 5KBPA 4NXSA 3UZEC 3EG9B 5E99H 3QIUD 5EUOB 3V0VA 4UOW0 1ZTXE 5DJXA 1RQ5A 2J5LC 2YMXL 3SE4A 4ZUVA 3KCPA 3V9EA 3CVCA 4X6DA 3KYNA 4TF4A 3DC0A 2UY7A 3O0RL 3RWCB 4LMQI 3JTSB 1HILB 5E8OB 5I18H 4L3FA 1BLNA 1DJIA 3UAFA 4P2RE 1C9SA 4FNUA 3WEXA 3MRJB 4N5EC 3IDIB 2LT9A 3PJSA 4K5LA 1ULVA 1RFDL 4O02A 3KH3A 5FYLL 1G7MB 3NSCA 3Q9QA 5DQDL 4LO9A 5D1XA 5DK3A 2QHRH 4XCFL 2JJTA 3NJXA 5DSCA 5BXFB 2WXHA 5KUKA 2QHRL 2GJ6B 1E7UA 2NCEA 4BXSV 4BWUA 3MA7A 1E5BA 1YRKA 2ADIA 4JL2A 1QA9A 3O3AB 4CSZA 2H6OA 2YRLA 4OLZH 2YBRB 1FNSL 1RIHH 1T1XB 3ULVL 1QEWB 4GI8A 1AI1L 3CE1A 2BSBA 2Y36H 1FNFA 3MV9A 5D7IF 5FHBH 2EDRA 3D33A 1IC5H 4MHHG 4NN6B 1EHXA 4PREA 1V10A 3ARPA 3LZPA 2DF3A 4X6DF 1CFQA 3FQ1A 3BZ4B 2DW5A 1K2DA 2C1PA 3NZUA 4K9EL 2XETA 3P73B 3EDFA 3UGEA 3QAZC 2ZKHH 4APXA 4PH8A 4UF7C 1D2OA 3DX4A 4A37A 4DN4H 3MDJA 3ZE0B 5IQMA 2J72A 4LSQL 5HJDA 3RVXD 2VLJD 4KKCC 3VFRA 3O3AA 4H0HB 3WAKA 4R0LC 1FV1A 2F8OA 3MRIA 2G3MA 4NQED 1OM3H 4BQCA 3L5JA 1IEAA 3D39B 3GSVA 1G7LA 3KXFB 4PD4K 5I28A 4HBQA 4JHZA 2WK2A 3GJFH 1FORH 4K0OA 4JUTA 4XTRC 3KWXA 2WXJA 2EDFA 5I6OA 3RP1A 3T65B 1WWBX 3P9LA 2E7LA 3SQBB 1A9VA 3UPCA 5E6SB 1USQA 4JFXB 1ZSDB 1IFHL 1EJOL 4P5TB 2W0FA 3EIFA 2R9HD 4K07A 5JPMC 1USZA 5IEHB 3OHXC 1EHLL 4JFQA 3UEQA 5DFWH 3S6CA 3S34H 3VFRB 1K6QH 2ED7A 1IM3A 4CADA 1CFBA 2BINA 1IL1A 3GJFK 1DBAL 2OA9A 2K8MA 5EN3A 2G75B 4ICWA 5C0CB 4LARH 4G5ZH 4J12A 2MQGA 1ORQA 1CGVA 4JFEE 4PLJC 2YKLH 1CICB 2J8UB 5JW4M 4LP5A 3LD8B 4BZYA 3BVNB 5ID0A 1R3IH 3IXTB 1HN1A 4EXKA 3HTLX 1QRNE 4DGUA 1KJ2H 5CP3H 4AMXA 3REWB 3TNMB 4I3RL 1E5UI 2VQ1A 4NZUH 2A77H 3BGMA 4KK8C 2H32B 4RFEB 3RVUC 1AGCA 2CG9X 1J11A 1OAZH 4G7SB 4RX4D 4MJ2A 3ARUA 4M6ML 1N2RA 4O02B 1ZGLM 4Y5XB 1RZIB 4C47A 3X13A 5C0JB 2A38A 1CFVL 3SPIA 4U1LB 4ZUSB 4N26A 5J8OA 1S9VB 1YMMB 1KEML 1AHWB 1IJNA 4YHOL 4LKXB 2Y1AA 4X6FB 4YSQA 4PBXA 1I9EA 3B1TA 4BCXA 3EJYD 4JLRA 3DYMA 3MRCA 2H5UA 1CL7H 5DD1L 1FH2A 1MOEA 2Y69B 3PWVB 2H47C 4L2LA 4MA1B 4PB9H 4AYFB 3FH5A 1AIFA 1DBJH 1DL7H 1H8OA 3GSWB 4MQ7B 1JPTL 2AI0L 5HDLA 2FWOA 2DWSA 5LWYL 2AK4A 3CFIC 1AS6A 4Y1AB 4CRPA 1EGJL 2ZSWA 3ZMRA 2HKFH 4GI9A 5FO8B 3B9KD 2Q76B 4XVSH 4HX1A 3SDAC 3RVXC 5AZ2H 1NMBL 2FTAA 3HG4A 3UYOD 4ZFGH 5EZOH 3ATBA 4R8WH 2VERN 5CF3A 2H3XC 1HEJC 3DSNA 3HIZA 5AQ0A 5CLWA 3T6WA 2F54B 3ULUH 3QZMA 2EDYA 4NM4H 5EU3B 3DK2A 1INQA 1Z9NA 4YSSA 4PJGE 3LQAL 3H42L 4AGQA 2E74C 3REVA 3L7EA 1XH1A 5INCB 1BFOB 3VFGL 2J1KA 5I8EB 4J6IA 2XWJB 4QHPA 1ZDSA 3N0AA 1U3HD 3LIUA 4XWOD 4CVXA 3EJRA 3OKEA 3FBKA 4QHLA 4JREC 4NAMA 5IBLC 4AKPA 4I3SL 3WGUB 4GG6B 3SPGA 1VZIA 2A6KB 4AL8C 3EJTA 5F6HJ 1HOEA 1QSEB 2VR4A 3PGFL 4B0MM 5F0LB 3SQOL 3PRZA 3IAQA 1EZLA 3TURA 5CGMA 5EPMB 1PD0A 2VDPB 3UTSA 2EYRA 1NGQH 3GHEH 4GKSB 4JRXB 1WPCA 4X6EA 3MNZA 5EU6A 1M1XB 1J0KA 2NX5B 4Y4HD 5C7XH 5IOPB 4PJCE 4A2DA 2YMTA 4HWBL 4B41A 1FNSH 1RIHL 4R7DB 2IWFA 1WV7T 5DZAA 5C07E 3UP1A 3D85D 2EDTA 1A6TA 2ZWLT 4FQXB 1EHNA 1Z32X 5EH1A 4XCYB 4KK9C 3UGUA 1CGUA 3OZ9H 4G9FE 1FV1B 3QXWA 5EEYA 2EJ1A 5FB8B 2XN9E 4HETA 4XMPL 4WEBL 1M2OA 1RFDH 3BVTA 4K3JL 4NWUH 1DQQB 1V3JA 2NY4C 4ETQA 2CUHA 3ZKXB 1R3LB 4GKSA 4JRXA 3GJFA 1N0LA 1YHPA 2OP4L 4D9RD 3V7AE 4DKEH 1FL6A 3K4AA 2B59A 3BH8A 2OLDA 3MNVA 4MSWA 1FWXA 1P7BA 4C56D 4GRLA 3GHPA 4LKCB 2BNRB 4UDTB 2XU9A 3AREB 1BV8A 2WNGA 2XZQH 1AAJA 4JE0A 1A6ZA 3I9PA 1V05A 3TV3H 4TQEH 5A2JH 4YHNB 4Z7WA 2DJ4A 4XNUH 4YL9A 2HLAB 3FN0H 3V6OC 4ONHB 1XZWA 5GIRB 1DDTA 5CEYB 1W8OA 1B2YA 2ICWJ 3D4CA 3ZE2F 4DP9X 4ZMNA 3L45A 2Y5QA 3GUFA 4RAVA 2FIKA 1BOGA 2WO4A 3DVNB 3HPLB 5JHAA 1M2VB 2GSMB 3ARVA 3OWEA 4NCC2 4KKNA 4Z7WF 3H6JA 1JV2A 1S7SA 1QQDA 1S7UA 3ARBB 3DVIA 1NBVL 1YPZF 5MEQA 3MACL 5ADPL 1WRFA 5DJ6A 4UQ2A 4GY4A 3IDYC 1GTFA 4PMFA 5G4OA 1FVDA 4AGNA 1BQHG 3ECBB 4WO4C 3HZKA 1FDLL 3JYBA 2YJQA 4WWPA 5HHNA 5C0IB 3PQYE 3PREA 4HUVB 2Z6FA 1DJYA 5ABZA 3PU7A 2ZSVB 4MCZB 1HC1A 3IFOB 4KOBA 4NZJA 2DQIL 4UV7H 1R5IA 2VCOA 4WEEA 3R7RA 3HC2A 3Q2LA 1X6LA 2C4FU 4DGYH 2A0LC 4HH9A 1RUML 2R56L 3NG5A 5H37A 2XG5A 2MQ0A 2XZQL 4L3ED 4CU7A 4N3TA 4WI9A 4OZIA 4Q9QL 5HDWA 4AY0A 4C56E 1MHEB 5B4MC 4JFDE 4MA3A 5T3XD 1ITBB 3IDMB 4K73A 3VGAC 3KWVA 4KNSA 3AUVA 3Q7JA 3HZKB 2O4EA 1JZ2A 1CLVA 4TVPL 5ID1A 2QZQA 1X5AA 2YKKA 2KT6A 3ZN6A 5K59E 1FIGL 1XFPA 2VMDA 3R4RA 4QKXB 3P9MA 4OCSH 3MRHB 4JK0D 5I1CH 1E8YA 3L1OH 2EH7H 4XOCA 3NFNA 5SWZB 5FOBB 2FEEI 3C6SA 4UQDA 2FZ3B 3O6KH 1OAYH 2DI7A 1DUZB 1IE5A 3O2DH 5EU4B 5TPWH 2HTLD 1KTCA 2Z4TA 2BCKB 4F1SA 4ZFZA 4OZIB 1F4XL 1VPOH 4DEUA 2FH6A 3T6XA 4WI5A 4H5SB 5C7XL 5L8KB 4OZ4A 5LCVL 1TTRA 4XP1L 4PW4A 1JZDC 4JEGB 2C9VA 2FSEB 4W9CC 1YJDL 2GI0A 4BA0A 4GT7A 5C0EB 4PGEB 1HKLL 3SDXA 1G9ML 2E46A 2X09A 1IEHA 3CDGA 1F56A 3MOBH 4F15C 5IG7B 2EXYC 3FB6A 2KL6A 2OTUB 1WO2A 5F1NA 5DD6A 5HDRA 4PRPE 4HLZH 1DN0B 5SV4A 2E3VA 3TPUB 4YR6A 2O72A 1FL5A 3HNVL 3I6LD 2VWEC 2YOAA 3QEHB 3LRMA 1KCBA 2G2RA 2PR4H 4Y9EA 1QSFE 3K2UH 2EADA 5DLLA 3T0DA 3RWIB 4A04A 3E6FB 1Z3GH 1TITA 4PRBB 3WY2A 4C4KO 1UB5A 1J8SA 4P07A 3HPLA 4OAWB 3SGKA 5C0EA 4A7GF 4WO4D 5I16B 3NGBB 1RZ7L 5K9KB 5I6LA 1KTBA 3L8QA 3TVMA 1HI6A 2VRKA 3KPRA 3WO4B 5DJ6B 5AAWA 1A3RH 3AG1B 5AVTB 2B8OT 1L7IL 2FVNA 1E7VA 1QW9A 2NY6D 4TSCL 1ACZA 3DO3A 2KH2B 4L8CA 3LQZA 1QX1A 1IARB 1JVOA 1CT8A 2BVOB 3CHQA 1IGIL 4FEMA 2V7HA 4KVCL 1FVCB 1WGVA 1CPUA 1OE3A 3FU7A 2QTEA 3HE7C 3L9RB 1I9RH 1HHKA 3N06B 4XN1A 3BUQA 5T3ZD 1YJDC 1Q0XL 1CQYA 2XV0A 1UM5L 4DCQA 4R83A 3O3DB 3PPEA 2WP3T 2EICA 2OZ4L 4G3YH 2IAMA 3AREA 3HN3A 5E70A 2HH0H 5E5RB 3GK8L 4P2QA 5AVUB 1E30A 1SF3A 4U6HB 2JCWA 5CJXA 3GJEB 5IF0B 1OAZL 4G8GB 2WB7A 1T2QL 3QDAA 2GSGB 3OR6B 1NZRA 4CGUB 3WE1A 3GIVA 3GXFA 4W93A 3S9DB 4OI7A 3PP3K 2CO1A 5INDA 1AO7D 3O6MH 5T1MB 1WHOA 3CN3A 2FJFA 2WWNA 2WQ8A 5AUMB 5KSVB 4FMVA 5E8PA 3UTZB 4FA6A 1J8HA 3VXRB 1OO2A 4QGTA 3NZHH 1P69B 2H41A 2DMKA 5D6CA 1M3JA 3VXQB 2V33A 4Z0BH 3D0AA 1DQJB 3NH7H 3QEQA 4ANWA 1AMXA 3T0BA 4Z7NF 5KS9B 1P2CA 3DROB 3P0VL 2AQ3A 4IGBD 2L0DA 2LU5A 1OP3K 1IM3D 12E8H 3BE1L 2P52A 5DHYB 1Z3GL 3CVHA 2DBLH 2QKIB 2QQLH 3E1F1 4WV1B 4CL7A 1S5HA 3IMRA 4AKOA 4NO0B 3F7VB 4D8PB 4UB0L 5D7KE 3VMPA 2F54D 3NN8B 3EJQA 5EU7C 5JYLA 3NCWA 3FB7B 4M7JH 4TULL 1BIIA 2LAAA 5K9JH 4DVBB 2DKSA 3PV6A 5CCKH 1A66A 2AABL 1UWEH 3FB6B 4HBCH 3PXHA 1H5BB 2PTTB 3C8HA 4L0ZA 2D7PA 2WTRA 4PN6A 4G80A 4L3AA 5E8NA 4HPHA 2YEVB 4FG4A 3TNNA 2DJMA 3U9WA 3FTXA 4MD5B 4XPGH 5DUBB 5CEZH 4PJHF 1PZ3A 3ARYA 4Y5YC 3WL9A 2CO6A 1LYQA 3BSZA 2A9AA 3ZT7A 2WWOA 1HX0A 4UQAA 2VB5A 4D3CH 4R7XA 4MMZB 4Z7WE 1H3TA 4FGMA 2J57A 4S1SH 4ADIA 2F53D 3TA3D 4PJBF 4UT9A 2AANA 4G6ML 2VSKB 1K5WA 2DYSB 3DV4A 2K8QA 3DI2B 1AD0B 3KD4A 2IO5A 5EN2A 5FUZL 1X5XA 3O45B 1JF1A 3RDJA 4WNJA 2G4EA 4ZYKB 2Y36L 4XX1G 3WD5H 2Q6WB 5F7HA 5EFIA 4EOWL 2J73A 3IDGB 1NJ9B 3ULUF 1JNLL 1MF2H 1XGPB 3ZZSA 2J7LA 4WEUD 4XCCL 4WO0A 1J9QA 3QA3B 2YXVA 4HZ1A 4M1DH 2J8UF 5LNEA 1LEIA 3ZE0E 3K1KC 4OKDA 1MAMH 2HRGA 1FVEA 5GS1C 3T1FB 2Z8RA 4OZGA 1IBDA 2PYFA 4MQTB 4I18C 2BSEA 1H3UA 4DFHA 1WBZA 2GIYA 3OTTA 3CZFA 4GS7C 4P2RD 1T0MA 4K7PX 4EUPA 1VRSA 1KJMB 5AW6B 2K1MA 2FCBA 4FNPA 2E9GA 2EDBA 4GKLA 3P3YA 4UNTA 5CINH 2YAFA 2FO1A 1Q1JH 3V5KB 3F12A 3LEXB 1G0XA 2VSDA 3KM2A 3OB0K 4HK0B 3GD1C 3DUUB 5IEKB 3GTNA 3L9EA 4BKTC 4DPRA 4FXKA 3UTOA 2FEDC 1XV8A 1HH6B 4GG6F 1ZHBB 1N6QH 4Y88A 4HG4J 15C8H 2DKUA 4XNMB 2BWIA 2VDLH 3MJGX 4W9JC 3B7SA 3OKKB 4Y19A 5IBUB 1IAIL 1U8QA 4EZKA 5IY5B 1F4YH 1IKNA 4OLXL 1AZVA 4KX9A 1AVAA 1DVQA 1IKFH 2WD0A 1WICA 3WXVL 1E4XH 2O6EA 4KKRA 1CFMA 3LNEA 2BC4A 4KNTA 4MJID 1E4WH 2R0KL 3B6SB 4FYQA 3VSVA 4LSSL 3T0AA 4LEXH 3DSFH 3GIZL 4W1TA 5DA4A 4UQCA 2LVEA 1JVKA 3EAKA 1OTSC 1JV5B 4XOBA 3CVHL 1EVTC 2QELA 1IQDB 1GOFA 3BP6A 1BW8A 2RFXA 2VLKD 3R06B 5AKSA 4JFEA 5KVMC 4JGNA 3JWNE 4OR1A 4PRAA 2QPUA 3CFTA 3C5SB 4KXBA 5CFAA 1RZJL 3EYOA 3QG6A 1BZ7B 4WTWA 4WEBH 2GJ6E 5KSBA 5I1JH 3RVWD 4JO1L 5A16A 1WWCA 1ZJBA 4TPRH 5E8OA 1FPTL 4HEPA 2H3NA 4PV9B 3S4SB 4QR7A 5DZLA 3QEQD 3ARFB 3IF1B 3RB5A 1J0IA 4LRIA 4GIPD 1OANA 4DGVL 1P4LB 4PRHD 3EO9H 1SOSA 1EHKB 1MLBB 1DN2A 1NCWL 1DBKL 3ARDD 3EHBD 1XCWA 2JK5B 4RBPH 1MVFA 2DWEB 5ISZE 2EDDA 3UROR 2AMUA 3SDYH 1E27B 4L0YA 4OSUL 3KMDA 4YFLF 3HG1D 3LXCA 2OSXA 1ROCA 3SPVB 4OGAD 4HC1A 1CZ8H 3BDYH 1T20B 1A7QH 3OR7B 2HJKA 4O5LL 5L2JB 3VXNA 1EH9A 4H0IA 4E9LA 4I9XA 5IQNA 5CHNB 4TN9A 3N1QC 2VXSH 1LO3L 3DV6A 3WN5A 3BHBB 5IFHL 1NGZA 4NPKA 3CH1A 1TCRA 4XNDA 5IVXE 3ZJAA 4L18A 3FT1A 3TWCH 1MCQA 2G2PA 1NCCL 3EYSH 1OT4A 4IRSA 5GGTA 3PHQA 1N64H 5MENA 5D72H 2YD1A 5I74C 3FT2A 1H5BC 2FQGA 5J6GB 3MLTB 5ADOL 4JDZB 4WHYG 3UDWC 3H7LA 5JR1H 5JIKA 3G6JB 3UG4A 4HAKA 1Y1UA 4HUUA 4FQPA 4JO2L 1ES0B 3A5VA 2VXQH 3V6ZB 4PCKA 3QQDA 4JPQA 3ALPA 2HJFA 5I8OH 4Y1AA 1FNAA 3BPNC 3MA7B 2GUOA 2R29H 5E51A 2VN7A 1L9SA 4WUUB 4N2MA 2BSTB 4R96B 4GAYA 3U1SH 4U1KB 1BM3H 1M05A 5AW9B 4X8JA 1VGKA 4PVBA 2P7TA 4DQOL 4H0GA 3IE4A 4XP1H 3QULB 4OM0H 4N0RA 1NQBA 1QI5A 5DJCB 3UIYA 1U8KB 2OZNA 4JL1A 1MDAA 3QXAA 4U4BA 4E9RA 5B3SB 4LPXA 1MI5E 2G30A 3VH8G 5IJKC 2EO1A 2MPAL 3B4NA 4L4VB 2ESVB 3PABB 4LLVB 4EIGB 1ZLWK 1ZV9A 3UACA 4ZMWA 5C0CA 5KANI 3W38A 3V0WH 2ZXQA 2VW6A 2AJ3B 3QDMA 4K5PA 1MIEL 1PG7W 1WBXA 3CXHK 1XTMA 4BUGA 4F8PA 1HDMA 3LB6C 4K2UL 2KPNA 4JHVA 5DHEA 1CF1A 1W0VB 3HS9A 2EIZB 3I02B 4KJPD 3F12B 5TFSL 3L1OL 1GW6A 3TN0A 4KQ4L 2JMRA 1WS8A 4KTDL 5JR1L 4HFWA 5KSBB 3TJPA 1S3RA 4RISH 1PX8A 5K1NA 3WUWB 3BQUC 1SMOA 2CGRH 2WWKO 8PAZA 1MCPL 3D9AL 1UD5A 3VXMB 3T0WA 4IOSD 2V8MA 1FO0H 1IEAB 4AUUA 3QJRB 1EGJA 5DJ0B 1D6EA 4JFFE 3OB0H 1UQSB 5FV2A 1HAUA 3MRMA 3V4VA 3WEOA 1BXXA 2ITEA 2UUDH 5AW2B 4B5EA 1BD2B 1ORSA 4IBVA 4H44C 1CDBA 3EJPA 3W9EA 1XSJA 2DQJH 2R8SH 3GXMA 2BC4B 1FYHB 3LN4B 4HUXA 4JFZH 4LRNH 4XBGA 5D7JB 5AW1B 1V7ML 2CCVA 3O11B 4OBSA 2VLJE 4MQSB 3NQKA 1I7TA 2QADB 5E00A 5LLIC 4FADA 5GS0L 3TJEH 4LP8A 3NCYP 4R3SA 5SWSB 4UTAA 1MLCA 3SDDB 2HTKC 2O6DA 3ZE2E 4F37K 2GITA 2BIOA 1WF5A 1BYOA 1I4FA 2EDHA 3LHPL 2DDQL 2Q7YA 3NCJH 4NZDA 4K9EC 3S5LG 1ZPLA 5FO8A 3RPKA 1UA3A 4K4KA 4YSDA 3FRPB 1DQDH 2R4SH 4N25A 3QQ9C 4QRPA 4NUQA 2OV0A 5ACMA 2HLFC 4M1GL 3I9AA 2WQVA 5C0AA 4IU2B 4RZCA 4U3HA 4GXFA 3T6VA 4X4ZA 5FO7A 1QRNA 4JO3L 4U1HA 4WK2B 4AVJA 1C7SA 2W0KA 3DETC 3MNWA 3JWDL 1O6TA 2C9SA 3N41F 2XOTA 4TOYH 1EPFA 1MJUL 4GBXD 4YHKH 4X50A 3KYOB 4DETA 3HB3C 5SWZE 1INDL 3EO1B 3N42F 4H8QA 4DUVA 4CMMB 5L2KD 1J5DA 4XH2B 3O9WC 3HS0C 4F92B 4O51A 1A5FH 3WN5B 5DO8A 2CCLA 1ZLVK 4B9CA 2WXQA 4F2EA 1LO4L 3QK0A 5CNHA 2DD8H 2QTVA 3OB8A 4LLDB 1ZT7A 1G7MA 2VLME 3HE6A 1XWVA 2BSDA 2NY0D 4AYFA 1JK9A 3D5OF 1UFUA 4KC3B 3TL5A 1CXLA 1IE4A 1QNZH 1G1CA 1TJGL 4S2SA 4FL4C 3E3QC 1AE6L 5B38A 5J89A 3PWPD 5EWIH 4ZQTA 1BBJA 1GMIA 1KB9K 1G1KA 4PTTB 2JQAA 1OGSA 5I8CA 4HJ0D 4O58L 4BK8A 4XVJL 2NMSA 2VQ4A 4IMLB 3KCPB 3ES6A 5HHQB 3RNKB 1YQVH 1FRGH 4X6DB 3OC8A 5MEPB 2HJLB 1F4HA 5GSVB 1J8RA 5IHUH 4F7MA 1K4DB 1NPUA 1TNMA 3VDBA 1F6AA 4W4OA 1TZAA 1QSVA 5DFVD 4AIEA 4IK7A 1QLRA 2YWYA 2APTA