2J73A

Alpha-glucan rcognition by a family 41 carbohydrate-binding module from thermotoga maritima pullulanase pula
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
103
structure length
103
Chain Sequence
b'FTETTIVVHYHRYDGKYDGWNLWIWPVEPVSQEGKAYQFTGEDDFGKVAVVKLPMDLTKVGIIVRLNEWQAKDVAKDRFIEIKDGKAEVWILQGVEEIFYEKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PULLULANASE
publication title The Structural Basis of Alpha-Glucan Recognition by a Family 41 Carbohydrate-Binding Module from Thermotoga Maritima
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 21
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature ec 3.2.1.41: Pullulanase.
pdb deposition date 2006-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03714 PUD Bacterial pullanase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2j73A00
2J73A 3N0AA 2FHBA 2FHFA 2J71A 3AWEA 3V0DA 2FHCA 3V0EA 2YA1A 3V0HA 3V0GA 1D5RA 3V0JA 5BUGA 5BZXA 2J43A 2J72A 3AWFA 2YOCA 2J44A 3V0IA 3V0FA 5BZZA 3AWGA
chains in the Genus database with same CATH superfamily
2VQ1A 3QEQA 4MX7B 1JN6B 5IMOA 1G7PB 4WDIA 4A2EA 2WLIA 4FXKB 4P4KB 5DFTA 4FD0A 1JYNA 3SZKC 1T2XA 2A6KA 4AGOA 5DFVD 4JZNA 2XFXA 1ORSA 2OMZB 4PV9A 4RETB 1SHWA 2BVEA 3NSFA 4IDJL 4CMMA 1W0VA 4L2YA 1A3RL 1A7RH 5FYKE 4M1CC 3LNIA 4HEME 3DVNA 3PGCB 5C7XL 4WIQA 1YPZF 2W0FA 3ZE2E 5E6ZA 4QCIB 3FF8A 3QIWA 4HIIA 4U1NB 3KDMA 4G8IA 4O5LL 3NCCB 3OTTA 1REIA 4JRYB 3AQXA 5ADOH 4I3GA 1RUPH 4OF8A 2VDML 3UC2A 1L7TH 1U2CA 4L4TA 4KDWA 4R7DB 1KCVH 4TPRH 2R29H 5EU6B 5MENE 1XF4B 3HB3B 4L5FH 3IWUA 3QO0B 4X0KA 3CPUA 3JWDL 1U8CB 2BOCB 2WXNA 4LQ1A 2IIJA 3QPXH 1R17A 4ZUTA 1OSPL 5IQ7H 2OMWA 3HI6L 5HYSB 4MQ7B 2OMVB 1YMME 1TQCC 1CFMA 1F97A 1BZ9A 1NGPL 5I8CA 4JM2F 5HSFA 4NO2A 3KPRA 2NNAB 4LLWB 4PCKA 2EXTA 1I9JH 2PNDA 2Y36L 3LKPA 4Z18A 3SD5A 3T6XA 4B3VA 4YEFA 1FIGL 1YQVH 1VGKB 4ERSH 4UB0H 2C26A 2OFQA 1IFHH 4Q6IC 4A2FA 1S3KH 4X99B 2J8UA 3BGMA 3TOPA 4BWWA 1BECA 3ZUNC 4U1LB 1G6VK 1D7FA 2V2WA 3PAZA 1INEL 1U3HD 1WO2A 2UX6A 3QUMA 5TD4A 5CKAA 2E7MA 1T1ZA 3ENEA 3TO4B 2DWEA 4PB0H 4ETQA 1T4KB 3GSNL 5FF6B 3T65A 5JORA 3U9UA 4MNGA 4R83A 3VI4A 2EXWC 4G5AA 4XCFH 3INUL 3QIWC 4ONHB 4H26B 4ZTPH 3D50A 2ZX8A 3HBPA 2AJVH 5I5IA 4KROC 3W0WB 3QFDA 4PU2A 1FL5A 5CD3B 3SDXF 2FRGP 1I8MB 4NWTL 3BPCB 3FO0L 3WJJA 2Q86A 5ILTH 4HIPA 3UDWA 5CLYA 4UTCA 4ZTEA 3LKNA 5AW5B 4XN9A 1IM3A 1U6AH 5FO9A 2OMXB 1B0IA 1HINH 3TN0B 2E7BA 4FFVD 3BFQG 3QO1B 2OR7A 2HKAA 3PNWA 4BWTA 3D9AH 4KK8C 5I1AB 2BCMA 4F91B 3V4UL 1UURA 1JV2A 4Z7NB 3U6RB 2OQJB 2QPSA 1KACB 5DQ9A 1CJYA 3HC0A 1W72B 2COQA 4U3XA 2AXWA 3CVHB 2A6DA 3KGTA 1AI1L 2R1YB 3O6FB 5JOPD 5E9DD 4K3DH 2WAHA 1BVLA 4NNPL 2FGZA 1XZWA 3VSUA 1RUQH 2EDWA 4XPHH 4WTXA 3LZRA 4MBOA 2YKLH 3WO3B 2IAMB 2GSGB 3DETD 3U4BH 3BWAB 4XGZB 3IS1X 3TASA 4J8QA 4TLSA 4D0DB 3IFLL 1YAZA 5F9DC 2VN6A 4K7FA 4OIIL 3V0HA 4DGIL 4P8QA 1P7KA 2WUCH 1E2WA 3FMGL 4IBUA 1ZY9A 4XMKL 1WWBX 4LSQH 4AJVA 4FQIL 1IBDA 1N2RA 4XVOA 5DVPA 5F70A 5GGTA 3AZUA 3VXUD 3TF7C 2XPGB 5D93B 1KWKA 2Y72A 4M9OA 2I7OA 5D5ME 3FTUA 4XN8A 2XWEA 3AU1A 3B9KA 2EKSB 2NY0B 2XZQH 5BZWB 1SFHA 3HR6A 2WLYA 3ETTA 3IFOA 1TSHA 5ABAA 1KB9J 2VM3A 5I1DB 4BKTC 3ZE2F 4MA8L 2Z91B 2XNAB 3WJJC 4PGEA 2Z65C 3C60B 3KEDA 3MLRH 5IK3B 3RPBA 2WV3A 1AS6A 1ZEAL 2A83B 1S9VA 4CU6A 1I3GH 3QNFA 5FYJH 3U4KA 1UGKA 2VXQA 2ZKHL 4G5ZL 3ZIYA 5LKNA 4M4PA 1KBKA 3MV9B 1UENA 3WLWD 3TYGL 4NQCA 4NUPA 3EYOB 5C0AD 4YHIA 1CYGA 4FTVD 4XZUA 3RAJH 3V6ZA 1I3RA 4QOKE 4YDIH 3TFKC 3ZE0F 4D9RE 2AJSL 4JFWA 1TVHB 4HS8L 4CAGA 5DC0A 1CGUA 4JMXA 4PRPB 2CGRL 3NCBB 1OB1A 1JPTL 1PX4A 3RWCB 3WTTA 4O00A 3D34A 3BH4A 1NCWH 4G80A 3QEGL 3AAZA 3GHEL 3L3IA 2XA8L 4UU9B 4HPYL 3SKMB 1F41A 5IROD 3M1CA 3HBGA 3MBED 2G75B 2DM7A 2OMBA 1VACA 3H54A 3LAFA 4MMZA 1HIMH 4TUJB 4IBVA 3A4EA 1ACZA 3HHSA 1P4BL 1ZGLP 2DQCL 2X87A 4X80H 2TSAA 3OKYA 5EBGA 5A2AA 4E2OA 4OIFA 5EIIB 3MLYH 3BE1L 5CMAA 5SX5K 3B9KC 3TA4D 4O2EA 5IV2B 1D9KA 1NFAA 1I7RA 4KGLA 2NX5E 1SXSA 3E3QC 4J3OC 4WGKA 1MWAA 4Y4KD 5F7DA 1ONQA 3BSHA 2BIHA 1NINA 1LILA 1P4LB 3RWGB 4ZMOA 1LP9B 2FUQA 4Z23A 3ZZSA 4MHHI 5KS9E 4YC2B 2VXSH 4TUKH 1LWRA 1MWOA 4PRBA 3QJQB 4KU1A 4NENB 1QOKA 4X5XA 4IGBD 4RMVA 1CD8A 3HG3A 3V5KA 1NMCB 1E9PB 1U8QB 4FHKA 1G0DA 2DYSB 1VFBB 1D7DA 1SN0A 2B0SH 3NZ8B 1PZAA 3PIQA 4MVBC 1WFIA 4JFPB 2OJ1A 4HJIA 2EECA 1RJZA 1I7TA 2VZTA 3HW7A 4AYEC 1FNEA 2DLGA 4R4FH 1JPEA 4PVMA 4ADIA 5F2FA 3MN8A 2KI6A 1WFTA 4V11A 1Q9LB 1SVBA 4PGBA 4TVSa 3HC4L 1UKTA 3DHPA 2DWYA 4TSCL 1T03L 3GHBL 3Q0HA 1E4WH 2ESVA 3V0EA 2XETA 1BFVH 4G82A 3MJ8A 3HRZA 2G9HA 3PGDB 1CFBA 2DLFL 3SDAA 4DP5X 3OKDB 2LTQC 4MLIA 2ZUSA 1J0JA 4I2XA 3OXRB 4M56A 1IV8A 1OQOA 2DQJH 4E9QA 2BZ7A 1LD9B 2DRUA 2XG5B 3D8MA 4NOBA 3QFJA 1IGCL 1UH4A 5IFAL 4M5ZL 3F7LA 1D9KC 5FUZH 2R56H 1CIUA 3KNBB 1SJVA 2FX7L 4OVUA 2FD6L 2Z6FA 1EFQA 5D5MF 2B20A 2QTEA 4CVUA 3T6ZA 1GMIA 1AJ7H 3TTYA 2MOVA 2KZWA 3BN9D 3D3VE 4BUGA 1F45A 4P2RD 2PPAA 4G9FA 1KJ2A 4U1HA 4BHUI 2IWEA 3E6HA 4M5YL 5FYKL 1PLGL 2HJLA 3STZA 4WWKB 4Z78B 1UEYA 4YL4A 5HGHA 3RX9A 1KF9B 4E9RA 5CJ8A 5JQHC 3FYIB 3ALWA 1PNDA 4GRWH 4F7EB 3MFGB 3MBWB 2AQ1A 5DMIH 2PWEA 3Q8BA 5LCVL 1S9XB 1OTTD 3FKUS 3HN5A 4ZI8A 3C5XA 1NSNH 3H2WA 5CIPA 1NMBL 2CK0H 3V4PA 4G43B 3GPEA 3X11A 4Z3IA 1YEHL 5BJTA 1Q1JL 1HYRC 3QRLA 4A1RA 4NM4H 1RERA 3DPDA 4L18A 5IMLA 4OLWL 1IEAB 2YRZA 2Z34A 3B6SB 4PJGA 1SXZA 1NM9A 3G5ZA 5IKCA 4EIUA 2L8AA 4ZUUA 3KLAA 3GUFA 3HRZC 5SWSA 3M1BA 3UZVB 1YQ2A 5JR1L 2WBJB 5HI5C 2PPEA 4C4UA 2GIXA 3EFFA 3CFCL 4APQD 1DBKH 2FX8H 2ZCKH 1ZDSA 3RTQA 4M8RA 5F88A 3OAWA 1IAOB 3UBXA 5A6MA 5SWZD 1EO7A 4FX5A 5DJ6B 4WEMB 4KUZL 5FA4A 2RFXA 5E5MA 2HRLA 2PTTB 5FWQA 2X4SB 4QXUH 3BQUA 2EQDA 2CR6A 4HFUL 4H8WC 5B1CA 1NEZB 2D9QB 2KL6A 2ED7A 3GM8A 4CRPA 4OD3H 4GT7A 1J48A 1F5WA 3NFNB 3CFMA 2BERA 1NA8A 2IEPA 3DYMA 3EYUL 2YAFA 4NZUL 2OV0A 1U30A 4JQIH 4M43L 4P23A 1NL0L 3D4ZA 4XI5D 3C6LA 3T6WA 1JHLL 1KCLA 2CRYA 5H35A 1Z7JA 3AS1A 3GB7A 3BZDA 5ESAB 1D5RA 4OM0H 5LWYL 4K5MA 5KS9F 5D7LA 1XF1A 5TE7L 3AMLA 1WWAX 4Z0XB 3VXPA 4X6CB 3K71B 4LDEB 3VXTB 4OVVA 4KHTL 2FYYB 3G9VA 3D2UD 4BK5C 5F0MB 3L7EA 4NQSA 5J6GA 2JKNA 4M8QB 4UOJA 2CBQA 3ZT5A 1MNUL 1ZXKA 2F54A 2WO3B 4K4KA 2EDHA 3VGAB 2FEDC 3SGDI 1HL9A 1JS4A 4R9HA 3DOSB 4N8VB 3TZVC 1F2XK 1T89C 2WBXA 3S4SG 1RZGB 4HT1L 4U3HA 1LWJA 3K6SB 1XGRA 4WUUD 3VFUB 3DO7A 1ZGLA 3ARSA 1XIWA 3CZLA 3EJJX 2M83A 2PYED 4FHJA 4Y19E 5ERWB 4DP9X 4WHTB 1ID5I 2Q7YA 1DUZB 4UT9H 1NBZB 1B88A 2DLIA 3Q8FA 3CN1A 2E4FA 3I2CL 4JHAH 3STLA 1DQLH 4HJJH 3HE7A 3PLYA 3QCVL 3CFBA 1P7QD 5FX3A 4Z7QB 3DOHA 4JFTA 3ARQA 3MV7A 4XBGB 1UYWL 5GZND 1DQMH 2BP8B 2IH1A 2PYFB 3QH3A 1OM3L 2IJ0C 1RFDH 3ZY7A 3S36H 5HD8C 3RUGA 3BUBA 2DB8A 1UD6A 4G8GB 2F5BL 4KNUA 3BQUC 1USZA 4UQIM 5K9JH 4YXKH 4AQ1C 5L88L 4G6FD 3MLSL 3NT0A 3V2AR 1SYVA 1OSZB 3VFMA 1A6VL 3C5SB 3OHXC 1BOGA 2X42A 3WIIL 5F3FA 3CZFB 4GW5B 4AGLA 3CZUB 2NNCA 2VXTH 4XMLL 1TO4A 1K6QH 1A6WL 1YUKB 3C6LC 4OLYL 4PEEA 4ZXBD 2VDMH 4FEMA 4ZG1A 5B8CA 3MACL 4B9KC 2F0CA 5IHHA 4U2ZA 5LAXB 4IHOA 1BMZA 3PWPB 4MS8C 2COVD 2M2DA 1UQSA 1NCCH 3GSRA 2YPVH 4GG8A 3QS3A 4NQDD 1S9WA 1A6TA 2WO4A 3Q1SH 4R5XA 3ARVA 5DGRA 2KDYA 5GGTH 2WCPA 2NSXA 3D6GA 1JDCA 4Y7OC 3SN6N 1KV3A 3B37A 4YHPB 4IJTA 5AVSB 4JZOB 5TE4H 1Q38A 4KJQD 1IC5L 1WLHA 1GCYA 4BSWA 4PAZA 1JNNL 1EZLA 4BWUA 4LQFL 2VDQL 4HGWA 1VEOA 3BD4A 4J3OH 4HD9A 4YSAA 2Y36H 4ELDA 1XIWC 4ZMNA 1MAKA 4LNRB 4XP6L 3WL9A 2FZ3A 1IQWL 5CSZA 4Q0XH 1BMGA 3QEUB 4BKSC 5A43C 4G83A 5DMGC 3HE7C 2AQRA 1BYOA 1T5XB 2R2EA 1BQHA 3V0GA 1JGLH 3QZBA 1TQCB 4NQED 4PD4J 2DLHA 3PNRB 5K33A 2RCSH 5JQIB 1G84A 1QRND 4DOHE 3MLXL 2G2PA 3QI9D 3WIAA 4ZO9A 3UCRA 4R96A 2N1KA 3LS5H 5EO9A 5I8OL 2R27A 3OKNA 5J1AA 3VDBA 1B4LA 3K6IA 4ZO6A 2CA3A 4I85A 2BRRH 2F15A 4WFHD 4XB8A 3Q5TA 3GS0A 2PCPB 4Q6IB 3N06B 3PV6B 4BZ1H 1XCQA 4LGSB 2VQ1B 3QEQB 1XCTA 5IMOB 3T8MA 3T2NH 1WE5A 3OC8A 2WLIB 2Z64C 3BCDA 4J3UA 2BDNL 1OWWA 3FFCD 4GRWB 2A6KB 5HY9A 5JTWA 2XFXB 1ORSB 4PV9B 4CMMB 5B8CC 3P40A 3QEHA 1ITBB 3MJ7A 1EZUA 2DQHH 2KLRA 3S3SA 4NWTH 4K5PA 1DJZA 4DUWA 4I1NB 2QT6A 3W39B 4AEIL 1M1SA 1IRAY 2E7CA 2XA3A 3DVNB 2VN4A 2F58H 2W0FB 3QIWB 3CK0L 4WTWA 1JIBA 1QQDA 4HIIB 5ITBL 4G8IB 3HLKA 5E0QA 5A7EA 4KROB 4L23A 2WWMC 4RAUA 4JG5A 3MLWL 4WWNA 2LLLA 1GXEA 3V55A 1NDMA 2HLAB 3D39D 4L4TB 3ZTCC 3QZWA 1JFQH 3FN0L 2GYSA 4X0KB 4ODTL 4KMQA 3V52H 3PV7A 5AVXB 1CR9H 3FTGA 4ZUTB 2OMWB 1KCKA 4Y1AE 4M6AA 3I6LE 1DFBL 3BESR 2CKBL 1RLWA 2LFGA 2HFEA 2WXPA 3S48A 3V7AG 3UTZA 1BZ9B 5FYKD 1VFOA 1IC4H 4WW2F 3QORA 5E8PB 4BFKA 4B97A 3QJOA 1YECH 4XXWA 4JFUA 3BZEA 1W15A 1P69B 3VD9A 4GW1A 2AVFA 3QR0A 4HS3A 2VM4A 4FQIH 1TEGA 5HVHC 2FT8A 5GS2D 2J8UB 3BGMB 4UT6A 5TDNA 1E2ZA 2H2PD 5GGRA 2V2WB 2D2CC 2LHAA 3PWNA 4JFFD 4KQ3H 5CEXB 4TSBL 1T1ZB 1MEXH 2DWEB 2QVFB 3FTXA 5HGAA 3KGRA 4ETQB 3T65B 2VZ3A 4MHHG 1MCSA 1SXCA 2B1AH 1FYTA 3FQWA 4Z9KB 2BY2A 4QTIL 1PSKL 3A6OA 4MNGB 4ONFL 3ECWA 2NYZA 4NQXB 4XPFH 3VI4B 2BY3A 1G9NC 1RZ7L 1QASA 3N04A 3CDGB 1I1FA 2B8OT 3QFDB 3VX1A 3T8XA 3UJJL 2VMDA 3TYGH 4KGJA 4D0CA 3IMTA 5FFOA 4HF5L 4AE0A 4XRCA 1BFOA 1NOLA 2Q86B 1N6QL 1MSPA 3KXFE 3ARBD 1KGXA 4HC1L 4Z7VA 2XI9A 1IM3B 1BGXH 2Z92A 1HT6A 3KE0A 4HS8H 5FO9B 2BWQA 4PLJC 4YLBA 3HMXH 2AAVA 3ARXA 2HUEA 1JYWA 1JGVL 2AXHA 2CGRH 2BJML 3PNWB 3X3GH 3LVTA 1JPTH 4LARL 1O6VA 2BY1A 3KLSA 4WO0A 4UF7C 1JV2B 1ZTXL 2XN9D 3N42F 3A47A 4I5BA 2B15A 5DQ9B 1IEHA 3BKCL 4YDKH 3HC0B 3GHEH 1YJDL 4NO5A 5T3ZE 3IE9A 1PZ5A 1DQQA 2NY5L 2A6DB 3QORC 4ZSOE 2IVFC 4C4KO 4NJ9L 5LQBL 1GA2A 4AGQA 1BVLB 4UQ9A 3ULSA 4DNLA 2NY3C 4R4ND 1UUNA 1ZLWK 2EDKA 1J11A 1DVYA 4OY9A 1CG9A 3IDJA 2Z1KA 2UYLA 1HZKA 3K7UA 4KWUA 3DV4B 3T2OA 3BE1H 4AQEB 3ECUA 3OKMA 2PR9A 1QNZL 3GMLB 3E6FA 2VDRB 4K7FB 4YHOL 1P53A 3N2JA 1MCWW 4IRSA 4WEBH 5M7QA 1KCBA 1XAKA 3V0AC 3VXMD 4ACPA 4Z3TA 4L37A 3LY6A 3Q5OA 1N2RB 3TBTA 3EUDA 2I69A 3VMNA 5C92A 2ZOUA 4QXGL 1KB5A 5DJAB 5G4OA 1AC0A 2O72A 2CPUA 3AU1B 2DYRB 4J6RH 4AYID 2JKRM 3B9KB 1E28A 3FU3A 2WYHA 4LDLB 4K3GA 2NR6A 2XUWA 3ARDD 4P5RA 3IFOB 1IGMH 2JCCE 4MNHA 1FE8L 1ZV9A 4LEXH 4NIYE 4X42A 1Q0YL 3RJDA 3TJHC 3VE0A 3GRWH 2WLHA 1OF0A 1KGYE 3F6JA 1L9SA 4PGEB 3OQRA 2IH8A 5HVFB 1J0YA 3B2MA 3E9UA 3CC5A 3PHOA 1S9VB 1ZXQA 3O6LL 4BCZA 2QHLA 4LCVA 2HCZX 4NP4L 4ODBD 4PG9B 2DTSA 4NO0A 3UCQA 2YD1A 1B2WH 1WICA 3SODB 2IADA 2JI3A 3QG7L 1G9EA 1ILUA 3QAQA 3U4EA 2WKLA 4YHIB 4LAQL 4XZUB 3V6ZB 5BW7A 3N41F 3GJFK 5SWQA 2OYPA 1I3RB 4IOIA 4GXUN 3GHBH 2RR3A 4KK6C 3FTVA 2CXKA 4FFYL 1WAEA 1A7BA 4JDTL 4KDTC 4BGLA 1HSAA 2XSKA 1TPXC 3MOAH 5D96C 1OB1B 1ZANL 2J5WA 2HPOA 4WEUD 3ZDXB 3RY5A 2EZ0D 1HU8A 5IT2H 4G80B 4GNKB 3AAZB 4CN1A 1IGCH 4P59H 3WOVA 4A7UA 3L4CA 1G7IB 4A55A 2R0ZH 1QW9A 4M5ZH 4QF1B 1FPTH 4DP8X 1VACB 2KPNA 3UYOD 4MMZB 1KYOK 3AT0A 2LTQB 2DWSA 3RWEA 4Q4EA 3HHSB 5CHNA 2IV8A 4NN7C 3AWEA 1LQBC 4Y5XC 2Z7WA 5EO0A 2G5BA 4P05A 5L8KB 2Q8AL 4UNTA 5CMAB 4M5YH 2BOBB 2DYPB 2QQQA 2J6EH 3R0NA 1LM8V 2J57A 4O2EB 4OCXL 1D9KB 5HJDA 3RU8L 1XTMA 2NR6C 2O6PA 1I7RB 3AT8A 3CFIC 2Y1VA 2IFGA 4B9CA 4U7KA 5CINH 5DRZA 1WGOA 2A77H 3QUZA 2HUHA 2DQEL 3GZKA 5F7DB 3DJ9A 4D7BA 1ONQB 5GS2H 2ICES 4J1UA 2ZX6A 3MJ9H 2YAEA 1DBJL 1NMBH 3L4TA 1JGEA 4PRBB 3TURA 4X5XB 3PXJA 1BW8A 2WXRA 4WVRA 3V5KB 5CCGE 4IOSA 4UILL 4UOQA 1JXKA 3I9IA 3FPYA 3PIQB 4ZW8A 4OJYA 1NKGA 4AYGA 4NOFA 1Z5LA 1RJZB 3M8OL 1I7TB 2H7WA 3P9MA 4I0CC 1UD3A 4OCLC 4JRXD 5FM8A 3ZHFA 1M53A 2YFNA 2OZ4A 5E8NA 3MROA 1NBQA 2X88A 3CFCH 4PGBB 1DANT 3F05A 2WZPA 5I66A 3CDZA 4FQPA 2P5WD 5IVOA 4YXLL 4R84A 4H88H 4N8CL 4CGTA 2CNYA 4BH7A 2ESVB 4UBDD 1S7SA 4LOVA 1NUNB 1A7NL 4RFEA 3HRZB 2G9HB 4JFEA 4N0YL 4PJXF 4N5UA 1NKRA 1FC2D 4RMRA 1AZRA 3UMNA 1OCOB 2R7EA 3LQAC 4FFZH 4NAJA 3Q1EA 4I2XB 5CP7B 4F5CE 5EU4A 4M6OH 1CICA 1J18A 1HEHC 1UZ8A 4MA3A 5D4IA 3UXFA 1MVUA 4HJUA 4WJ5A 3IJ8A 2XJLA 3QFJB 2Z8VC 3D85A 5AVVB 3NIGF 4JKLA 1EZVY 3I02A 1N8ZA 3V79C 2CHXA 1JHLH 4IBLT 4LAJH 3PPSA 1TQUA 5LWYH 2BWDA 3QUZC 5TF1L 4YIQB 3BUTA 1Y18A 3U46A 2GUOA 4IRJA 3LNEA 4LSUL 5CBAA 1OOWA 4G9FB 2UWEF 2W92A 3LHPL 4N1CA 2YN3A 3LQZA 3E6HB 2VJ0A 3QW9A 3ORJA 2HJLB 4XCCH 3IM1A 2C9XA 3DI3B 1M57B 1ZLSH 5JHLA 2VDPB 5M95B 1MNUH 1SF5A 3O6KL 5DVNA 2NW2A 3PP4L 4ODSH 3IFNH 3HZVA 4QWWD 4OUUA 1PL3A 2JI1A 1YMHA 3KWXA 3DSFH 4BFEA 3L6FA 3FK3A 1QBLL 5CIPB 3V4PB 3C8KB 3X11B 4BV1A 1G9NH 2XV0A 3I2CH 1DQJA 4L0ZA 2V2XA 1WEJL 3P73A 4JRYE 2PTUA 3TZVB 3NFSL 2A4EA 1TMQA 1UYWH 2Q3AA 2VZSA 4KRMB 4XVSL 5I6XC 3G5ZB 1BVNT 5IKCB 5KW9L 2VKWA 1E4XH 1C9SA 5EU6E 4XN7A 4ZUUB 3KLAB 3BPLC 5AYUL 2DI7A 3OAYK 6PAZA 3M1BB 2GI0A 4Y16C 4FDWA 2H6PA 1FZOA 1EUTA 4WI2A 4BA8A 2AJUH 2WLNA 4ONGL 1CICC 4F57H 4KI5C 4A63A 1K4CA 3MLSH 5F88B 3NRFA 3QIBC 4OI9A 3V8OA 1B6UA 3CSYB 3WIIH 4JHZA 1XMEB 1WC7A 2F9BT 4H13C 2O61A 2GKIA 2H5UA 5JYMA 4XMLH 2YD2A 5FA4B 2DQUL 2RFXB 1A6WH 3M17A 4FG0A 4OLYH 5E5MB 5JOFA 3BQUB 2QV2A 3VD0A 4XH2A 1IAII 1KPUA 4H40A 4QRRA 2N59A 3B9EA 3MUY1 4PJEA 4B53A 2Y1AA 4IRJC 4CBZA 2BIQA 4L1LA 3OHXB 3BWZA 1QSFA 3NQKA 2K9FB 2YD7A 3VVVA 1USQA 3BP5A 4FI7A 3C6LB 4OD1L 4P2QD 5H35B 3WNJA 4FHBD 5J5EA 1WFMA 3HMWL 3ZKMD 5CFAA 5DZOA 2IH9A 3CFNA 5D7LB 3ASNB 3NDYE 1XD0A 1IC5H 5E9AA 5KSVB 2WVTA 1OHZA 2YMXH 3N43F 3HS8A 1KDJA 2JVUA 5BVPL 3L7EB 4F15C 5J6GB 2ZCLL 4NXKA 1L9TA 2YPLA 4GYBA 2EDRA 2F54B 2XRAH 3W0WE 4ZNEE 2MPAL 1YEDB 4YHLL 3B2UC 4QHNA 4XMXA 5K1JA 3D48R 2ZYHA 3M7OA 5F7HA 2FJGA 4R5VA 3KW8A 4LOUC 3DO7B 1QFUH 2E8ZA 2ZG2A 4OZHE 4A7QA 5AG8A 1XIWB 1ZGLB 1OLZA 2DMKA 2XWCA 4FG6D 2Q7YB 3KG5A 2FO1A 3IN2A 3WXWH 2FUTA 3STLB 3VTAA 4XNQA 3HE7B 1L6PA 3CFBB 1U4FA 3MV7B 4F58L 3IPFA 1Z9SA 3QH3B 5L8LB 2EH7H 3N0AA 3MQIA 1NC4A 3SGKC 3QDGE 1XXFC 3CMOL 3FO9A 3IJYA 1CK0H 1GS6X 2DBLH 1TF4A 1FGVH 4HAGA 1AMXA 1FI8C 3T77B 1M9WA 3X1BA 1M3JA 3DV6A 3E80A 3RKDC 4KKLD 1P1VA 1SYVB 3AB0C 4WWOA 1JF1A 4POZD 1BOGB 1QLEL 3Q2CA 4OZGF 4CC4A 1WIUA 3L81A 4M4RA 4JL2A 2YGVA 2QDVA 4AENA 1QD0A 5CZXD 5B8CB 1BBJA 4Y19D 1VERA 4J39A 2Y22A 4C56E 1RUAL 2Y07L 2YN5A 4N6QA 4JS7A 3BZFA 1UQSB 3FN0H 5CD5C 3CHPA 3GSRB 1WWCA 4OB5H 1PKQE 4GG8B 4K9EL 4BINA 4OV5A 1C8QA 2YARA 1S9WB 1A6TB 4V33A 4XC3L 1RJCA 1URZA 1OQXA 4GUCA 1OHQA 3K2UH 2DQIL 1DVUA 3K72A 1F4XL 3DUSB 1QFHA 3GXFA 2QEJA 1F3JA 2VR9A 1LO2L 3NOIA 3NJMA 1ASQA 5A6IA 5G4MA 1SM3L 2JK5A 2CKBH 3U36B 3ARZA 3VFSA 5C0BE 2FLMA 4BSWB 1KIQA 2ITEA 4K5NA 1E40A 1MCJA 4R4BA 1JCKA 4HGWB 2ZCHH 4ODUA 3S5LG 3MUZ1 3O4OC 1IAKA 1CD1A 1GGUA 4ZD3L 5C0FA 4YDNA 2FZ3B 3A22A 3C8DA 3F01A 3QARA 4MXWH 2DJUA 2XACC 4AL8L 3EJYC 2R2EB 4GQQA 4G6JH 4HXBL 1KB3A 3PQYD 5DHYA 2X6VA 1FF5A 5FGCE 4S2SB 4Z3GA 3DROA 2AQPA 3EJZC 4KXBA 4R96B 3FSZA 5EO9B 3OKNB 2X12A 3GHPA 4FLSA 3HG1E 1N5AB 4LSPH 4FZEH 5HVHB 4XBMA 4XNUH 4QTIH 1S7RA 1WH0A 1XCQB 2RBLA 3P0YH 5D1ZD 5DVMA 5EB9A 1RZ7H 3SBWC 3TWCL 3L7FA 4CC4C 1AZBA 1XF3A 4J4PD 1ADQA 3NIDB 5FIEA 5HY9B 4DPCX 5MI0C 4JRWA 2OMUA 4KO9A 3QEHB 3ZKNC 4OGYL 3MJ7B 2C34A 1QWUA 5I16B 2QMJA 2HFTA 1XSIA 3WDHA 4LSSL 3TP4A 1IE4A 1RUKL 1MUJA 3A23A 4RSYA 5K5YA 5E2TL 4XHJD 4A2LA 3OF6D 1U3NA 1JGVH 4HDIA 4DEWA 4RAUB 1RKRA 3DWTA 3KJ6L 3FSVA 2QHRL 1N6VA 3ME0A 2HB0A 1ZT4B 2QQNL 1LDPH 4JFDA 4XVTL 1NDMB 2ZF8A 3BKCH 3QZWB 3PXLA 1D5MA 4A6YL 3U9PL 1B4JL 1BMWA 3FTGB 5G55A 2EH8L 3ECBB 5BVJA 3CFUA 3VXOA 3RILA 1AZCA 3G5WA 2AK4D 2VLRA 1UVQA 2XCMC 1MHHA 4GUQA 4PW3A 5B38A 2PWHA 4OZHF 4AYFA 2WY3B 2L4OA 2GSIA 3B7SA 1FCCA 3UTZB 1KLFB 2B14A 4GAYA 5BRQA 3ABKB 3QORB 3WIHL 5HVWA 3F84A 1J05A 1KN4H 3BZEB 3P30L 3SCMA 4AUYA 4YX2H 1F58H 4GW1B 4UTBH 4WLCA 2NY3B 4HS3B 4I1PA 4KZDH 3K2KA 4A39A 4LIQL 1LK2A 2NUPA 4AC4A 5C09E 4FS0A 1H5BC 1NGWA 1UFUA 2HN7B 5TDNB 1VB9A 4JHUA 5GGRB 5FCSH 3PWNB 4ZS6C 4I88A 2NQ3A 4N3TA 4HKXA 2YWYA 4KXZI 4DETA 5HGAB 3AXLA 4E41E 2ZOLA 1F90L 2D7TL 2JJWA 3B2VL 4Y1AD 1FYTB 3ZE1B 2F8VA 3FQWB 4G72B 3U9WA 5DURB 5C0GA 2J5LC 2YLHA 3WFBH 2VN5A 4JDEB 5E9DA 3U6XS 4NP4H 3P4LA 3UBHA 4RVBA 2F5AL 4HCFA 2HPTA 1I1FB 3VGBA 4NZJA 2BINA 5HHME 3T8XB 4OF5A 3T04D 4L48A 1OW0A 1K85A 1OLLA 5IBTH 5T5FH 3R06A 1BFOB 3JT0A 1AZVA 3FB5A 1SMDA 3DX7A 1XB3A 2Z92B 1AXTL 4FFYH 3CQPA 4JDTH 3QJVB 4PP1C 5IEKA 2A9BA 5T1JA 5F1NA 1WA0X 4QKTA 4AK1A 3IF1B 3KBFA 1YEGL 1ZDQA 2WTRA 5ICXA 3QRFM 3S8WA 4I5BB 4NUGH 3BVNA 4OFIA 4NO5B 4NBYB 1A65A 1GKOA 1ZK9A 3BSZA 4HHGA 2OX5A 1I7UA 5DSCA 1OAUL 4KVPA 1TPXB 3SCMC 5JHAA 5KYXA 4ISVB 5D96B 2MEJB 5FWRA 3CSPA 2QVKA 4OLXL 5H2BA 2DS4A 1AQDA 1PD1A 3LB6C 1TNNA 3CH8A 4NHCL 4WI9A 1CG9B 3NYKA 4PBVC 3NAAL 2DLEA 1KN2H 4QMEA 2UYLB 4YSDA 2AABL 5I6NA 1R3LA 3KLDA 4MJ2A 3R1GL 2I24N 3AJ7A 1O6TA 2OM5A 4OCYH 1JWMA 4KTYA 5EV7A 5F1KC 4FLHA 3RU8H 1R3HA 5DTFB 1A4AA 1MW2A 4RGOL 3VACA 4L9LA 5L9DH 1CCZA 4G8EB 1KYUA 1TTUA 5IM7A 1N59A 4FYTA 4L37B 2CLRA 5DJDA 4KAQL 4LRNL 3TBTB 3X13A 4FKKA 4NN7B 2LVCA 1DVFC 3MRQA 5ACZA 3JYBA 1KB5B 4Q9BA 4N8UA 1MXDA 1E28B 2A7BA 43C9A 2VDLL 1EV2E 5GRVL 4MNHB 2YJQA 3VE0B 3I85A 3D0AA 1VPOL 1KFAH 3GSXB 1BD2D 4IBZA 3AUVA 3DETC 3IJSA 4RGNE 3S34H 5TH2A 4HUCA 5I2IA 1QFWI 3VFPA 2KUTA 2UY6A 3LTVA 3PHOB 4PW9A 5IROA 4DZ8A 4F1ZA 3ZRSA 3LXUX 1TFPA 5DXWA 1HE7A 1JDDA 1U8JA 4WUKL 2P8MB 1KSRA 1G0XA 5DK0A 3I3BA 1K5NA 1GC1L 2YLKA 3IXTA 4HJ0C 4D8OA 1L4IA 3DGCR 2IADB 3SKUD 3WV0A 1CLYH 1XDTT 1WUZA 1AACA 3U4EB 3KLHC 2QQLH 3RVVD 3FUJA 1MIML 1LP9F 3NZSA 4N8CH 4IOIB 5E6ID 1OARL 2HTLC 2IQ9H 4HS6B 2X9WA 3L5XL 5E1HB 1IBBA 1HSAB 4HBCH 4LVOC 2EDQA 3S2CA 4BFBD 4YEEA 4JKPL 1E42A 1D5BB 3PREA 2WWNA 4Y4KA 3MRDA 2ZOOA 4Y4FD 2HRHA 4NBZB 3IU4L 5IGXL 4GMSH 3FUHA 1UM4L 5CILH 3IVKB 1Q9WA 2NYYD 4ZNCD 1U8OB 1P1ZA 2FBRA 1YHPA 3ZL4H 3DRQA 4TUOA 1JFHA 4U49A 1JPST 5GRWA 3RA7L 1D6EA 1BPVA 2V9UA 5D71L 2X4RA 3RWEB 2PPDA 2VYRE 5TF1H 5CHNB 5F21B 2I9TA 2VR6A 3RY6A 2XN1A 5FM4A 5AYQA 4A7GF 4JBSA 5EO0B 2G5BB 3GLDA 2BNRA 1CFNA 2IBGA 5D7HA 4AEEA 1ZHKA 1RXLA 3ELAT 4Z7QE 5EEVA 3X12B 3MREA 1W91A 2ODHA 3OGOE 4G7QB 2DWXA 3TT3H 3QJHA 2JCWA 4PB9L 2V0AA 1J1XL 5KUMA 1OSEA 5DRZB 4KO7A 4W70A 3PP4H 5IOKA 3QUZB 5TK4A 3THMH 4DGVL 3JTSA 3X2QB 3QDJE 1KCWA 1FAIL 1M71A 5L6YL 4J1UB 3BD3A 4FQ2L 3RIFK 1HI6A 2EXYD 5T1DL 3RVXD 4U7SA 4AYMC 3WLBA 1CN4A 3N1PC 2HX9A 3RIFF 2AP2A 5FHBH 1VEPA 1U3YA 4GAJL 4FQLH 3APDA 1O6SA 1WEJH 4Q52A 3NQIA 4R90H 2NCMA 4XVSH 3OKKA 5DHXB 4YBHA 4E5XG 5E9NA 1Z5LB 3K2MC 4U6TA 4XP9H 4UV7L 3CJJA 3P9MB 3PWPE 3D12B 1GGIH 4W6XB 5FW7A 1OPGL 3NFPA 5LAPA 5AYUH 3B43A 4JO8A 1RZFH 5GJTL 1ZE3C 1URIA 5E8NB 3JWNC 1T0PB 2IMNA 3MROB 1AGFA 5D2NE 2IH3A 3TNNA 1U2HA 2ZWNA 3KM1A 5E99H 4ONGH 2R0LL 5I66B 5JHDB 3ML9A 4P2RA 1U8PA 5LNDA 3HR5A 4GQPH 4BH7B 4N90D 3T0EC 2YXFA 1S7SB 4XCNA 4A68A 15C8L 4RFEB 3BPLB 4JFEB 4MNQE 2EO7A 2DQUH 2VW6A 1KGCE 3RZCC 2O5YH 3LIZL 2R7EB 5I5RA 4N2LA 5EU4B 2GBAA 1CICB 1UZ8B 2NZ9D 4MA3B 4PJDE 4XMVA 1JI1A 4PY8I 5DQJA 3RY6C 1B6DA 3W9EA 4OFKA 3QIBB 4WJ5B 5C2BL 5DLML 4PRAA 4YSTA 3NJLA 2AJYL 3D85B 1CZ8H 3GSNA 3I02B 3LX9A 1CTNA 1T21B 3O81A 2NNFA 2GK0A 5ALBL 5IB3B 1Z0NA 4BZ2H 5TE6L 2UZPA 3QUKA 2IG2H 5A40E 2ARWA 2DQGL 2WLLA 3IDMA 3A6BL 5PAZA 3U46B 2ADJA 4IRJB 3EUUA 3HZKA 5CBAB 5JUEH 3PHSA 4YPJA 4XP1H 3LQZB 1PJ9A 4WW1A 4H1LG 3AG3B 5C0EA 4QRAA 4K0OA 2BP3A 2WVUA 2QKIC 4APQA 5FR3A 4MQSB 1PDKA 2AV1A 2NW2B 2YUWA 4A66A 3RTLA 3RVWD 1HE8A 4OUUB 5EUOB 2ZNWA 1TETL 2XDHA 4XTRC 3WHXA 5I30L 2A4CA 3UJTL 1PF3A 4GXFA 3L6FB 5MEOA 3V95A 1IKFL 2I07B 4A67A 1RSFA 3BIBX 5T3XH 1OP3H 2VLJA 4HPOH 1C16B 2ENPA 2AERT 2EYTA 1DQJB 1MREH 4PLKD 3BN9C 5LNGA 5CEYA 3C87A 1IC0A 4Z1PA 2V2XB 4W1TA 5C0CA 3N50A 1PLCA 4PUBH 3ULUC 1DSFL 5E4IA 1CGTA 3HI1A 5GGSB 2R23A 4NRZA 1WD9A 1UD4A 5J89A 2ORBL 4GO9A 3CMOH 3CQQA 2F2HA 5FK9A 4EI6B 3V6OA 2XWZA 5GGQL 2W9EH 2JLPA 5FB8A 3MGAA 4WKXA 2H6PB 2HT4D 1G4MA 2WO2B 3GKWH 1DZBA 1K4CB 4J2QA 2KPWA 2WYTA 2F7QA 3TV3L 1ZLDA 1OTTC 4KKAC 3DMMC 5CJXA 4WWID 4E0RA 4QDGA 3D2UA 5MEQA 2O61B 4O02L 1LO0H 3KL3A 1ECZA 3T2LA 1MQKL 2C1PB 5JOFB 2VLKB 4ZFZA 3KPRE 4XH2B 3BEWA 4QRRB 4OJFL 2B7DT 4Z7QF 2PPCA 4PJEB 1RY7B 1FLTX 1ADWA 4AQZA 3AB0B 3F00A 4LPCA 5K93A 4BDVA 4WUUA 2FATL 2PYEA 3SGJA 2J8UE 1QSFB 3GBMH 1F4XH 3OHMB 1HH9B 2A1WH 5I26A 5KJRH 4FXTA 4Z95L 1LO2H 3BN3B 3EGDA 3KPQA 4XVUD 1P7QA 1YPZA 3RI5K 1SM3H 2L7UA 3OX8A 3HC3L 5GZNA 4LCWD 3RJOA 1KBGL 2EVJA 4YBQC 3RI5F 1E27A 4DAGH 3KPMA 1YZZA 3VI4E 4BE6A 5HHNA 4XB7A 4FA6A 1V3KA 2WYZA 1FL6A 2MOQA 4L8DA 4WKZA 2X2HA 1MDAA 4QHNB 1IJ9A 1SLXA 3WAJA 4RISL 1D2PA 1DEEA 2FJGB 2ZONA 4TLUA 3O4OB 4UCFA 1TTBA 1TZGH 2FO4A 2BSRA 4FQCL 1Y6NR 4UYQA 4E9WA 3GNMH 1RH8A 2EDDA 1MRFL 1CT8A 4G1EA 5E5LA 2O5ZL 4M29A 4NQDA 2O5NA 1Z9SB 5DRXB 4LMQE 2IAND 3BUPA 3ULVE 4ZFGL 1AYRA 1SZNA 1U4EA 4TYUA 3REVA 1U58A 3FFOA 4PJDF 1E6JL 4QO1A 3CPLA 2YK1L 2ZKMX 2C9VA 3DV6B 5FOBA 3V4VA 4ZAKD 1RUKH 2QVMA 4YQXH 3GUTA 1JF1B 3TCTA 3QXUA 3JWOC 4NCC2 1CQYA 3SGJC 1JXDA 4M4RB 4WEEA 3IDYB 1JJUA 5MI0B 3C08H 2CO7A 1HZHH 4AENB 2QHRH 4NKQB 4WAFA 2HAZA 4W9DC 4NQEA 4JN1L 1S7TA 4BQBA 3P02A 3BZFB 4RH4A 4UUJA 1BQLL 4JLRA 3VJ6A 4OV5B 3EG9A 2J7LA 3ML8A 4FLRA 3LS4L 5DUML 3K72B 4NSKB 1F3JB 1EO8L 3QC6X 1UT2A 1GTNA 2BNQD 1OGSA 5CUSL 4FQXD 5GS0C 2VIRA 2DKSA 3QWRD 3VFSB 3BCFA 1QACA 4LHUD 1UCTA 1JPSL 2JIXB 1KIQB 1SJHA 3E3QE 3D52A 4R4BB 5ES4B 5E24E 2KS0A 4N9OB 2CO2A 3ETBF 4KQ0A 2Y1ZA 3P30H 1IAKB 2O5XL 3WELA 1CD1B 3FQ2A 5CU9A 1JK8A 1IGTB 1NWPA 2ZOWA 3L5IA 3PABA 4KX9A 5C0FB 4KXDA 2A9NH 5KYNA 1AIFA 4PN6A 4EO5A 4PM1A 1NIBA 1FV1A 3QDHA 1I8LA 4JM2C 4LIQH 1EA9C 4ZUWB 1MCLA 3C5ZD 3EOYG 5GGVH 4TTDC 4NQCE 4KMTL 3EO9L 3SBQA 3DROB 1EK3A 1BZDA 2IDQA 3UACA 3JV5A 4DN4L 4D94A 5JYLA 1YN7A 2ZXCA 4UYPA 3KPTA 1X5LA 2VJ8A 4ZMPA 5E51A 3HA0A 3D5OF 1H5BB 3FU0A 2XQYK 3L7FB 3KYMA 4FGMA 4HZLA 3EH4B 2YD4A 4L1BA 3N44F 1XF3B 3UP1A 2Y06L 2F5AH 4H20H 5I6MA 1U2YA 2W9LA 4MMYA 2AK1H 4DGUA 2BSSA 2OMUB 2ITDA 4WI6A 3MNVA 3T0WA 5KVGE 1ZA3A 3JV4B 2HSIA 1MZZA 2J8UF 3DURA 3L8QA 4DKFL 1H8NA 1KT2A 1S4IA 2J5LB 4PR5A 5CEZE 1MUJB 4JKWA 4PJFA 1AXTH 1NPUA 4RWYH 4HDIB 3E8UL 4Q9QL 1YYLL 4EXPX 3PJSB 2XX1A 1MCWM 5D8JL 4JFDB 3TEWA 4ZX6A 5GRJL 4OJDH 1QI4A 5LCVA 5MEPA 5FEBA 4JN2A 3VI4F 1CURA 3MOBH 5KBMA 5MENA 4RX4A 2OP4L 3DJTA 1E90A 3LRSB 4XO3A 3T6QC 1OAUH 4JVPA 2NXZD 4ZS7L 4RFOH 1JZ2A 1XFPA 1ZCRA 1YC7A 1PTZA 5BVJB 2H0PA 1CU4L 2QPDB 2VLRB 4JCLA 4QNPE 1UVQB 3IAPA 2BW4A 3OVUB 4HFWA 4AMXA 5B38B 2RQEA 5BXFB 2Z35A 4AYFB 4OFDA 4DP6X 2E86A 2GSIB 2WVSA 1YMMA 3VG0H 5IHWA 4GAYB 4UZSA 2MNWA 3LIUA 4MJ5A 2B3IA 4RGOH 3SCMB 4LASL 4ILDA 2QSVA 4M02A 4ES8A 5JW4M 1AO7B 1WS7A 3C6SA 1RULH 3SEPA 3WTXA 2KDGA 1LK2B 2LVEA 5ACMA 1FORH 3UERA 1H6FA 1SBSH 1NGWB 1IT9H 5ISZD 1J0IA 3K3QA 4PWEA 5JLZB 1C5CL 1R46A 4HKXB 3IWVA 3HZMB 4LF3A 2ESVE 3AXLB 3ES6A 1RJLA 2XN9A 1VPOH 4HAKA 1WTLA 1PVHA 3B1UA 3RGVD 2WB1A 3KPLA 4N2DA 1DVFB 1MJ8L 3QG6A 3JUZA 5KYUA 3KPOB 5C0GB 3EH5B 2XYCA 1UWEL 2NY2D 4WUKH 2WUBH 1BXVA 1MLCB 4UQAA 2X3CA 1DVTA 4O2FA 3QFJE 1J9SA 1CTOA 1KXQA 4ONOA 3AITA 1WG3A 3L1FA 3PWJA 4JJ5A 3VI3E 5KBNC 3F12A 3ARPA 4JFOB 3R06B 3EH2A 4XNYH 2QQKH 3R7RA 4N2NA 3FB5B 3DX7B 1D5XA 1AD0A 4YPGA 1BQ5A 1D5IH 4NC2B 3EOTL 5IEKB 4U31A 2FB4H 1AGBB 2UY7A 4G9FE 3VXMA 3MRKA 1EANA 4JG1L 1AGEA 2X1PA 5ICXB 2Z31D 5DA0B 1IKOP 1PD6A 2D3NA 4MDRA 2V3FA 2JTYA 1UM4H 3BVNB 4N2GA 3SDDA 1IFRA 2BSED 3QPQD 1DYZA 4X7CC 2Q9OA 4B9ZA 5I17A 5I76A 3EJUA 1YEKH 2G2RA 2OX5B 1I7UB 3ARDA 3UBFA 3U7YL 4LVOB 5DSCB 4OCSL 5KYXB 3US1A 1K3IA 4GS7C 3U1QA 3UZQA 1E8XA 5H2BB 1PU0A 3GI8H 2OL3L 1JDAA 3LH2L 1JRHI 2BY0A 4PCTA 4AKQA 4TQEL 1X3DA 2R9HD 1AXIB 4HJSA 5DLLA 1R3LB 5MERA 4LLYB 2GIMA 1WITA 3JQOB 1D7CA 5ICYB 1JWMB 1WZ1L 5A2FA 3OXSA 3ISWA 4PJGE 4L9LB 3VFWA 4XAWH 3CDFA 1DQTA 1F6LL 3MDJA 3DTXB 5IM7B 3ZDXF 1N59B 5CP3A 2CLRB 5DJDB 1L9NA 5SWSE 4DGVH 35C8L 1FVCA 3F65A 4FKHA 5D7KD 3Q8EA 5H37A 4L4VB 1FAIH 5ACZB 4JO3L 4JFVA 2WXMA 3NCEB 3I75A 3NCXA 5T1DH 5A1AA 3QQDB 3OAUH 5C2UB 4ABWA 4IDLA 43C9B 2VR3A 1UB5B 1W8NA 1H3UA 3NTCL 5AB1A 4BEIA 4GAJH 3DX0A 2OXHA 4F92B 1BAFL 2G5RA 4YN3A 3LZQA 1KENH 3QIUA 4KY1H 1IGFL 2ICEA 5TH2B 4A7TA 4BFOA 2UZXA 3NJIA 4LBAA 5I2IB 3WE6A 3VFPB 1Y7VA 3MUGA 1ZJAA 3S3PA 4AQAA 2FQGA 3MBXL 5BS0D 3KGUA 1ACCA 1BG9A 1FFOA 1UXMA 5DK0B 4YWGH 3TEXA 4LLDB 1K5NB 2VXVL 4U6VL 2AEPH 1WUNT 1HXYA 3RWDA 3O2DH 3WEMA 2WN2A 3QHTC 1DBMH 3JWOH 1CXKA 3BUYB 4FQHA 4LLUA 8PAZA 1IGJA 3T5WA 4PJ5B 2HJKA 5HHPA 3SDDC 3P0GB 5JXAL 4XPTH 4AEFA 4KPHL 4QNPF 5JQ6H 2GFBA 2H1PH 5HYSG 2PO6C 3FF7A 1YAIA 5EZPA 3X17A 3MRDB 3P3TA 1OL0A 2CPCA 4N5ED 4B50A 4DVBA 3CUPA 4OFYA 1I85A 5E5UB 4APXA 5AVUB 1Q9WB 3T71A 2F54E 3S36X 4A2MA 4HWEL 1P1ZB 2Y5EA 4D9LH 1OVZA 3HBZA 5GS0H 5F7AA 3PE9A 4NEHB 3KL0A 3DRQB 4TUOB 3SE3A 3UPAA 1X44A 1KNOA 5DEZA 3SOTA 3ULVL 3SGDH 2H9GA 2X4RB 4OCRH 2EAEA 2FVNA 4TNGA 2E9WA 1J10A 5IUCA 4P99A 2BNRB 2IGFL 2V9RA 1CFNB 1EZVX 4DT2A 2ZP8A 1MZYA 4JRXA 3MCKA 3MREB 3ZQWA 3MV7E 1UCBL 2UZIL 2V17H 2X2YA 2ZUQC 3QQ4A 4NNXA 3QJHB 3LNHA 4N2KA 4TM9A 5E8DL 3T09A 2ZZUT 4H5SA 3SJVD 4DTGH 5K9QI 3RUGE 3LCYA 5DD1L 1WF5A 1GOFA 2P5WA 3QIUC 1LDSA 2ICEC 1TETH 1M71B 3ARYA 5K9KA 1DCEA 1ES0A 3D0LA 2GC4C 4HIHA 4LP8A 1IKFH 2AXFA 1C5BL 4AW7A 5IHLB 1K2DA 1CLOH 4LPXA 3WLBB 1N0XL 3K46A 1M56B 2QKIB 2W65A 3FBQA 4LRIC 4RDQF 1KXVA 3W2DH 1O6SB 4PREB 4HIJA 3GQFA 1DSFH 3L1OL 1XV8A 3OKKB 3ZKXB 1AFVL 1GGCL 1N12A 3H7LA 4GMTL 4ABQA 2MPVA 3MCLL 1O7SA 4M7LH 1J0ZA 3IGKA 3S3CB 3EDKA 3NFPB 4PJ9D 3APMA 4PJ6A 2G3MA 1FH5H 3K4AA 2NY7L 1TEFA 3GSQA 4JHWH 3HS0A 1UA7A 4ZW3A 1OGAD 2IH3B 3EJTA 5DMKA 3TNNB 5KG9A 3ZSSA 5FKPA 2MFNA 3HR5B 1KTBA 3HPLB 4LCCA 3BHBA 1FFRA 3VGEA 4JK0D 3VMPA 4AY0A 4XCNB 3CSGA 4PWKA 1OKEA 4O02H 4F8TA 1XR8A 1BP3B 4G70B 3SE3C 2LE9A 3SY6A 1FNSH 4ZRGA 4YJZL 2GIYA 3MRJA 3P2BA 5B4MD 5IB2B 1TZ8A 4XAKE 1BIIA 4RRPG 1BVZA 3UAAA 4PJGF 3W9EB 1MY5A 2OKMA 4HUXA 3DMMB 2ZT9C 4PRAB 1XGYL 4RMTA 4M1DL 1ZWIA 1YY8A 4H8QA 1NBCA 1R0AL 2Z8SA 4Z95H 3HFML 2CIIA 5GSRA 1WBYA 3MRBA 4MKMA 2WLLB 3IDMB 3NP4A 5HHXL 1CGYA 1RL1A 2OMTA 1RZJC 4ABVA 3HZKB 1MF2H 2YGNA 4J5VA 4WW1B 5C0EB 3T8VA 3MCG1 4JPVH 3X1NA 5IFJA 1OB0A 4F2ME 4JGUA 4APQB 2N1TE 2Z9TA 1CC3A 4TOYL 4IHBA 4CADB 4KMLB 4OQTA 5J8OA 1PDKB 2AV1B 4WTQA 3FB6B 3WFCL 2ENQA 3PGFH 5AZEL 1I1YA 4G6AC 2XWTA 2QSQA 2OMYA 4PLOB 3U1SL 3WHXB 5IUSA 3DUHA 5ACLA 4UQEA 5EU3A 2JKTM 3V0JA 3SBPA 2VLJB 2EYTB 2E0PA 1ZIBA 3HG5A 4MD0A 5DRNA 5IFHH 1KGWA 1WA2X 2O5ZH 2Y5TA 3GJEB 5C0CB 4Y5YA 4JO2H 5D1XE 4LCCC 4OT1L 4NZDA 1C7SA 4E42A 1CDBA 5FK9B 5A2LH 1MFCL 2WZAA 3O45A 4NXSA 5FB8B 2VMEA 2FBJL 3L5HA 4Z0BH 2YK1H 2E4TA 1NDGB 4G8FA 4GRLD 3ILQC 4QWWC 4RAVA 3BIKB 3TL5A 4AVIA 1X7TA 5JDSA 3QC5X 2BMKB 4ORGA 3B56A 3X1EA 5LGHL 2YUXA 4E0RB 2IMMA 2W9DL 2A74A 2BX5A 2WMPA 3CXDH 4N2OA 4Y2DA 5CLXA 2P24A 5BRZE 5MEQB 1P6FA 2JKLA 4WO4D 2FJUB 1JMXA 3K80A 5AD0A 3JV6B 1UEMA 1RIHL 4ZFZB 4F9PA 5GJSH 3E0GA 3D06A 5EIIG 1MHCB 2B1HL 2J12B 3IRZA 2XQBH 5JXEC 5HHVL 4QRTA 4IOFD 2EE2A 4ANUA 3RUGF 1MJ7H 3TJEL 5CBEB 2NXYD 4DQOH 4AKOA 3FH8A 1DJXA 1NBYB 1IIKA 3EH3B 3QJTB 3Q05A 1WZAA 2Q76A 3N40P 3O0LA 3KPQB 1I1RA 1JG9A 1P7QB 1YPZB 2PR4L 5CUSH 1KY6A 1SNRA 3WN6A 3OX8B 1OAKH 1JPSH 1BF2A 3ZE1E 1CBJA 1F3DH 4NUJA 7PCYA 4U1IA 3K2IA 1MI5D 5F71A 2LLGA 5CN1A 4YO0A 5SX5H 4ZUVA 5K9OA 4G6FB 3UROR 2NLJA 2QGBA 1FA4A 4L8DB 2NY5C 5HJ3A 4WKZB 3TH3T 2YBRA 4TVPE 3MI6A 5EU5A 4IS6A 4N2AA 5C07D 4FG4A 4GH7B 1I31A 5I18H 3M1OA 4DN4H 1JZ4A 4Z7VE 5HI3C 3U0WH 2FO4B 2C1OA 4IEFB 3VWJD 4HALA 4Y19A 5LXGL 2ENJA 3EBGA 2ZICA 3ZKMC 1YNLL 3MX0A 1HCYA 4KTDL 4HXAH 4EZKA 4PRIB 1CT8B 4G1EB 4D0BA 4NQDB 2MCMA 4XT1C 3IB4A 1JYVA 4Y2DC 3REVB 3CFEB 5G4NA 1U58B 3I9GH 32C2A 5EOCL 4HYTB 1N0LB 1AHKA 1KB9K 1UADC 1K3ZA 3EBHA 1U8IA 5I1EH 5FOBB 4KKZA 4OCWH 3V4VB 4ABUA 3QHFL 1MH5B 1WFUA 4I0PD 3GUTB 1MRCL 3NJFA 1JHKH 1JOIA 1XH1A 2JKXA 1CF8L 2EIBA 4FG6C 2CO7B 4OF7A 4PWGA 1A25A 1FO0H 4HX1B 5D8JH 2NQDA 3N5AA 4XMPL 2QPEB 3PQYA 4ZT1A 2F1BA 4HOWA 1S7TB 4IU2B 1EEYB 4UUJB 1MW3A 4KFMA 1AR1D 3ILEA 4JLRB 3VJ6B 5C3LD 3SYAA 1EHKB 4XN1A 3NCJH 1KEGL 3EKCA 2LU7A 4JQVA 4UQDA 3ULVD 1G0YR 2V6HA 3G5VB 4WFGD 2L7QA 2I25N 2CR3A 3DVGA 1EXUB 2GW5A 5IQLA 2H6UA 2VIRB 3NSDA 2WN3A 1IVTA 4AT6A 1SJHB 4J4PA 3EH1A 4I4WA 1F1DA 1G7JA 3OLEA 3QJRB 2B5IB 2P28B 2VDOL 1NAML 1JK8B 3PABB 4WJG3 3FUEA 1GIGL 3FT3A 4X83A 1S5HA 1AIFB 4WW2C 1FV1B 3NSXA 3GI9L 2W8CA 1OAQL 5LGJA 3O9WD 1Y1DA 3LKQA 1A6UL 4GUOA 3OF6A 5DZAA 1U8KA 1JYXA 5CN3A 3EDEA 5FYJU 1I8UA 1QG3A 2DTMH 2ZYSA 3SB3A 1DR9A 4TRPH 1YN7B 5F1IB 3MUJA 1TTAA 3DTDA 2YD5A 1NM4A 2J1XA 4X0NA 1MJ8H 4KKCD 4CILA 5F7KC 4URKA 4PSRA 3KYMB 4HZLB 3VFGH 4NZRL 5E5RB 4M6ML 4MMYB 2BSSB 1NEZG 1RLBA 2BVTA 5EH1A 2I7SA 2ITDB 3MNVB 4RSVA 5DEFA 2EEBA 1ZA3B 5JIIA 3PP3H 1W9XA 5IQ9B 1KT2B 1LVEA 1RK7A 1WS8A 4M61A 4XWOC 1JUFB 3ZE2B 2JJUA 4H8PA 4S1SH 1MIEL 2CO6B 4HJGA 4JQVC 1X4ZA 2NTFB 1GS7A 1S78D 5LBSL 3ZE1F 3CVIH 5MEPB 3KM2A 3M6DA 4JN2B 1RZQA 3L2NA 5AVZB 3C5JB 5MENB 4KJPC 3P3SA 3IDUA 3P54A 3UAFA 2APBA 2QDWA 1DE4B 1EAQA 3U7YH 1U9KA 3UTTE 1SFDA 3LEVL 1RZJH 4ZTOH 1KPRA 2YEQA 1S5IL 4N26A 4Y1AA 2GJ6D 2Q2LA 5A6LA 1RCYA 4N8VG 4HFWB 2NZ1A 5GHWL 1MDTA 3C9NA 4L1HA 1JMZA 1TQVA 4Z7VF 4X5WA 4D9QD 1HHJA 4J3TA 1YMMB 2C7UA 1AHWC 2R1WB 3FTWA 3QWQB 3AACA 4QRPD 5KSBE 1YNTF 4XR8C 3LJ3A 4MJ5B 3NCYS 4JFHE 2LU5A 3AFLA 4GS7B 4IRZL 4XBEH 3AROA 2H2SC 3C6SB 35C8H 1AY1L 5DJXB 3M7FB 4ADJA 3S8GB 1XGUA 4S11A 4IQHA 5K9QG 1U93A 5AWNL 1Q4NX 2VDNL 3BC9A 1T66D 4ZDHB 4AIXA 2ZXBA 3BEVA 3O3EB 2DJMA 4QRSA 3MRGA 12E8L 2FNBA 2CIKA 1RJLB 2XN9B 3ES6B 3FFDA 4KRLB 1CGSL 3QJUB 1I53A 4JFEE 1FAKT 2BPBA 3KPLB 3AG2B 2BCKA 3QG6B 4YHML 4M3JA 5KYUB 4HMEA 1T7XA 4AXWA 1KLUB 4OD2A 3AS3A 3B2DC 4KI5E 5I1HH 4TN9A 2FIKA 2QR0A 1O9VA 4FG2A 2KZ1B 2VXVH 4K8RL 2YAMA 4O2FB 4TL5A 3UYRH 1OE1A 3PWJB 4JJ5B 4W9KC 1CE1L 3F12B 3U79A 4WSKA 3AVEA 3QJSB 3UG3A 2BVPB 1J9RA 5JXAH 5E2VH 2K8MA 3GO1H 1D5XB 1AD0B 3W82A 3N3EA 4QJ5B 5CR1A 4KPHH 1NFKA 4E9LA 2WLKA 5BV7C 3TA3D 2UY7B 3VXMB 3MRKB 2AITA 2DJSA 1AKPA 1AGEB 3PWVB 3QUHA 3I6GA 1FNGB 1P7BA 2V37A 4AMKL 2CSPA 3F83A 1X9UA 3SDDB 1XGTB 3L5WA 5IB1B 5EA0H 2ZNXA 4PJCA 2QELA 2YZ1A 1WQVT 4HWEH 2DQDH 5I17B 5GPRA 4OQTH 2G2RB 4B27A 4OI7A 3KWWA 1VFAA 3UTQA 1NWOA 2WXHA 4F2EA 2PO6B 4N0CC 3UZQB 3RVTD 3K81A 3KBEA 2UZYA 2PCFB 3IGAA 2VO5A 2AQSA 4UZGA 5B1KA 3L3GA 1FO0B 2CDFA 1DJWA 2NY1D 5MERB 1JV5A 1RZPA 2QTVA 3DX2A 4L5FE 1JWSA 1U8HA 3QNZB 4X8CA 3VFWB 5KBDA 2DH2A 2XZZA 2B3RA 2XV6B 1TLMA 2YQ3A 4HUUA 5B7EA 4PRHE 4RFNC 1I9RH 1O75A 5E6IA 1FVCB 3JTBA 5ALCL 4NHUB 2ZXGA 4QLWA 3QK0A 2EIKB 4LGPB 1BZ8A 3I75B 3JVFC 3LH9A 1RIUL 1C5BH 2BP0A 2QSTA 1VCBC 5E2WH 2A99A 4XO9A 3UBXI 2ZUQB 5ICZB 5D1QD 2WWKT 3T2QA 3H42H 3FQNA 2LAAA 2OXHB 4Y4FA 2JCCA 3QIUB 5EEZA 2ICEB 2ZJSL 1HN1A 2EEDA 1VZGA 2UZXB 2CE6A 3WE6B 3H6JA 1QI5A 4JO4H 3NGBC 1E4KA 4AQAB 4BFIB 4EOWH 1L7IL 2ZAIA 4PJEE 2F61A 2WD0A 1FFOB 4FI8A 3EZJB 4I48B 5KZCD 1X5KA 2IGTA 2VITA 1IAIH 2NY7H 4MAUL 4YE4H 4CA4A 2WCSA 4UV4H 1HXYB 3RWDB 4HCRA 3O2WH 4L3ED 3BVXA 3SKOA 1IBFA 1QSFE 4FQHB 1FVDA 4LLUB 1EWHA 1IGJB 2VDQB 3AC0A 3WMQA 2HJKB 5HHPB 3G5YB 2P80D 1HYSD 4J3SA 3AGWA 3IKCA 4V1DD 2EUWA 3WEAA 2WIIB 1T1WA 3QR1A 2GFBB 3AADB 1YEWA 3O2VH 4ADGA 1EAPB 4HOMA 5IMKB 1I9IL 1A14L 5AOKA 5F6IB 3CUPB 4APXB 6PCYA 2YPLE 2GQHA 4HJTA 4M1DH 1X5IA 4HIEA 1HQ4A 3DECA 5FLVA 3QCTL 1GZHC 4CSTA 1NGQL 2XQYG 1NIEA 2J55A 1OGTA 4P46D 1NH6A 3EYSH 4EZJA 5E7FA 1LE9A 1EHLL 3V9FA 2H9GB 1UOLA 3RVVC 1ITCA 5E6IC 2W60A 1QUNB 4PRDB 3OG4B 5HHXH 4GPVA 3HN3A 4UWQB 1E4JA 1VHPA 1KC5L 3GXTA 1VF5C 4JRXB 3MCKB 2GVYA 1G4RA 3QQ4B 1G9MC 4WK4B 4H5SB 3WN5A 4TOYH 2NX5B 4RIRA 1MCOL 4G7VL 3BGFC 2P5WB 4KI5F 1TYEB 2EDMA 1SY6L 4DKAA 1GHFL 1Z5YD 1HKLH 2NYYC 4AH2A 1URLA 3UZEC 2AEOA 2ED9A 2PETA 5K9KB 1BVKA 1E4KC 2C5DC 4LESA 2XC8A 1ES0B 4TQHA 5TQ2L 3MHZA 4MAYA 4YDJA 2AXFB 1K2DB 1NC2D 5D7SH 5ETUA 2W65B 1AGCB 4A6YA 1XQ4A 2YWZA 4JY6A 1KXTA 3CWGA 4HIJB 4I9XA 3ZYOA 4Z76A 5EEUA 1RU9H 4I77H 4PD4K 4CKVX 5AW2B 3SOBL 5AVRB 3II2A 2KZBA 1Q0XL 4WCYH 4GP5B 3HG2A 1KELH 2VT0A 3GSQB 3A67H 3QUXA 5HHOD 5I1IL 4ZMLA 4S1RH 2AQQA 3GK8H 4Z7IA 2ZXDA 5KG9B 1LL1A 3H1ZA 3KH3A 4KH9A 1LMIA 3WIHA 3IBEA 4U1JB 4B60A 5F8QC 4LCCB 3BHBB 3RVXC 2QSCL 2IOMA 5E1AA 5F96H 3QWNA 3QXDA 1XR8B 4G7SB 4AQ8A 3C2AH 1YUHA 3ZMRA 1RIHH 1TJIL 2MHAA 3ARFA 1UJTA 3MRJB 2OZNA 4LE8A 2G4EA 4IKNA 1SVZA 2APVA 1BIIB 4HISA 1QUPA 5F7YC 5HHVH 4V2CB 4HUXB 3ATEA 3FU6A 5D70L 1E4HA 4KVNL 3TBCA 2AEQH 4AZ8A 1ZWIB 2JI2A 1YY8B 2DL9A 3BSGA 3MCYA 4WZ9A 3RVUC 1EGJL 4X2UA 3W11D 4O4YL 4GUPB 1WD8A 4D8PA 5I1CL 2CIIB 1MCBA 3MLTA 4QT5A 5GSRB 1T1YA 1SBBA 1WBYB 3MRBB 3O3AA 3P69A 1VRSA 1ZHNA 1U8LA 2CGYA 1XF2A 1N9PA 5CLWA 2BSCA 4LFHG 3ERXA 2OMTB 1TCRA 1YEFL 1ULVA 4KKBD 1I8KA 1DN0A 2ARJQ 4MMXA 3ZN6A 4MAYC 2V5YA 3KVQA 2WXKA 1HH6B 3KS0J 5C08D 4JR9L 4MDIA 1CXHA 3EJQA 5C0RH 5I24A 5IFJB 4FMVA 1E50A 2J4WL 2N4IA 2GCYB 4Y4HC 1AZZC 4JY5L 4PJEF 1UC6A 4YHKL 4EAEA 1I1YB 4XC1L 2XWTB 2FX9L 2OMYB 4P9MH 1W72L 2EDOA 3CVHL 5I19L 7PAZA 3BKYL 4I3SH 5EU3B 4DN3L 5GQBA 4E9SA 3QXWA 4MSWA 3QUXC 4PI0A 3JUYA 3BPNC 4NGHL 3D0VB 1TVDA 5DRNB 3TESA 4MD0B 4FULA 3H9SD 5EIVA 4Y5YB 5E6SB 4PP2A 4L1TA 3MXWL 1L3NA 5DFAA 5LN4A 3P9LA 4E42B 4G11A 4XCEB 4OGQC 4K8RD 5KVDL 2VB5A 5IY5B 4YS4A 5GISH 1WIPA 3O45B 3OPUA 4AQ8C 1M7IA 5C7ZA 5J3HD 3FHAA 3V0DA 3FO2A 1Q72L 2LT9A 4G8FB 1ZIAA 3ARFC 4RAVB 1KWGA 3EHBD 1A7PL 4N3UA 3WKMH 5MHSD 2CNZA 5BV7H 1QHOA 4RZCA 1XCXA 1UA3A 2Y7MA 4ORGB 4TKWA 3F64A 4XN2A 3FSAA 5DD3L 1WRFA 2WMPB 2A74B 3IU3A 4JB9H 4Y2DB 2P24B 2CMRH 1EVTC 1ET7A 1YA5A 4LSTH 5E56A 5J6HB 3RG1C 2LU3A 3BJLA 4OH2A 4OQ1A 5LBGA 5AD0B 1ZVYA 4FERA 1F4YL 1DQKA 2DMCA 4JREB 4QRTB 1DJHA 3MRFA 2WWKO 1BZOA 5E03A 3RRQA 1AQKH 4J3XA 5D9SA 4X9GA 4AM0A 1KEGH 1BLNA 4F7MB 5C70A 5A3IC 2HT4C 3RP1A 5E08L 2HWZH 2Q76B 2PWFA 1R5VA 3FOLA 2FJFA 3L9YA 4GW4A 1ED3A 3Q3GA 3AT9A 4WU7B 3VO0A 3ZLQC 3HS9A 4EUPA 2R69L 5LB1A 1HQRA 2PN5A 3DHJA 2CHNA 3ARED 4J12A 1XAUA 4KXZH 4ATWA 4ELKA 2HXAA 1CF1A 4NUJB 5L2KD 4U1IB 2VDOH 1EIBA 1NAMH 5JOPE 3TEUA 5E9DE 4WI8A 1KGJA 4F33A 3IGFA 2VXUH 4YO0B 3QAZC 5K9OB 5AAPA 2NLJB 4GI8A 4EIZC 5HJ3B 2YBRB 1T5KA 3FZUC 4IS6B 2WINA 2PPFA 1X5JA 3CQFA 4FQ1L 2XQ0A 1A7RL 4A2HA 1PIFA 1OCRB 5DJZA 2ADIA 1MRDH 4GJTB 3LPGA 4OZHA 4UM8B 4X6DA 4Y19B 2ADFL 5AW4B 4ZW7A 4KVCL 3MX0B 1QHPA 5IIEA 1DQIA 1FC1A 4RDBA 3V5HA 4FFWD 1CVSC 3VXUE 1NUFA 5HTSA 1J8SA 2JFCA 1RUPL 5MP6H 1L7TL 4NZRH 4M6MH 4R2GC 3QDGA 1KUMA 4BSVA 1KCVL 32C2B 4JRFA 4TPRL 2BNQA 5JO5B 1L0YA 4FQXA 4L5FL 2XXFA 4WI0A 5T3ZH 2AF2A 2HMID 1VSCA 4LHUA 3K6OA 5AKSA 1UH3A 2X6AA 3TIEB 2GY5A 2WW8A 3Q2NA 1VAHA 4TVPD 2YSSA 3ARWA 2X5PA 2D3LA 3TNMA 2HFGL 4ENED 4RDQG 1RZKC 4JVWA 1PG7H 3AUWB 4O2CB 4UDUA 3C5ZA 1W0YT 3EF4A 4U3CA 4C56A 2WSKA 4RZKA 4ZK8A 3TO4C 1HZLA 4P5KA 3BMWA 4QRFA 5C0AE 4FTVE 1YQVL 2R2HA 2VLMD 2GHWB 4ACTA 1QBAA 1PKQA 2EYRA 2X0UA 4P4KD 1NOAA 4ERSL 1VENA 4OCNC 3KAAA 1S3KL 1UWXH 4GKZA 4I0KA 1VLXA 4FYSA 5DRWA 5EPMA 3ZTNL 1MFEH 3K8LA 2V7HA 2ZYRA 5F7NC 2OTWA 5GHWH 1DP0A 1DQVA 5KEZA 3N1MC 1RHHA 2YPKA 2XVGA 1NCAH 3JT2A 5IHUH 4PY7A 2H8PA 4PB0L 4DFHA 1GS8A 1G9MH 4Z3JA 1Q1PA 1G7JB 1WFOA 1AAJA 1ZKAA 5CR8A 2I9LA 2K4WA 4YZFE 4O58H 2VTFA 1OCZB 4I18A 4J7RA 2AV7B 3FT3B 2M8XA 2DL2A 1S5HB 3MRNB 1QFWH 4MLSA 4XCFL 3SDCD 5DC4B 1XH3A 3FAXA 5T8IA 4JPWH 2YKKA 4X6BA 3S96A 2EVIA 4WK0B 2AJVL 4MXQC 1B0RB 1V8HA 3LKQB 3O6MH 3WUZA 3QPKA 4E36A 1AHWB 1N4XH 1IGYA 3ZRFC 1U8KB 2XKNB 2CM5A 1SMOA 3OZ9H 3V0WH 1V7NL 5ILTL 3LIZA 4DOHB 2JELH 4H0LC 5FYLH 3AM8A 4JPQA 2R2BA 4FQXC 1U6AL 4H0HB 3VAEA 4DUVA 4KOBA 1HINL 3TBWB 3UBXG 3FU7A 3G5XA 3NJKA 4TSAH 5FFLA 1GJIA 5DZPA 3ESUF 2GAZA 3L4XA 4P5SA 1M6UA 4K8RH 3RL1A 5AVTB 4PJIA 4MB3A 1BLIA 4DK6A 4NPYA 5DEFB 4AYSA 3C5ZC 1PAZA 4K3DL 1ETB1 3OAYH 4KFZC 1RUQL 2L04A 4KNQA 3V8CA 3VXQA 4M61B 3CXHJ 4UTAH 2YKLL 3EFDH 3KCPA 4P5TC 1QBML 1ZSDB 3U4BL 4YFDB 1IQDB 5LUMA 4YUEL 1TYRA 2N7BA 4ZOEA 5DEGA 1FGNL 4HWBA 3GWJA 4P3WA 2YRLA 1LK3H 5ISZA 4P2YA 3H9HA 3NN8A 4IKJA 4K23H 2GT9A 4UT7H 1MXGA 3HE6D 4KK5D 2A5UA 4N24A 2YGOA 4QKXB 4Y5VC 5F72S 1U95A 4Y1AB 3RGVA 2BSBA 5AL0A 4PRNA 1NCHA 3ZGIA 4M7KH 2XZQL 3PCYA 5I73C 3QDMD 2D7OA 2C7UB 1QZ1A 2IDCA 3U82B 4HD5A 3TN0D 4OW6A 1SDYA 1C12A 3CHQA 4G9DA 3WE1A 2Z8RA 3TBBA 2AANA 4ZOBA 1M7XA 3H6AA 1FLRL 3W5NA 3VX0A 1IL1A 5FYJL 1E7VA 4ECNA 4B95C 1K4DA 2VZUA 3S35H 1CLZH 1XGUB 1YYMH 3FONA 5C09A 1RIUH 2CO1A 3O6FD 4QY8B 4P2RE 2MTAA 3BDBA 3HKFA 3BEVB 4YNYA 3RAJL 3UO8B 1R75A 4YDIL 4A7GA 2CIKB 2Z31A 3FFDB 2R2CA 5AW9B 1ZOXA 4EDXA 4RFNB 3MLUH 1AG6A 3CSBA 3VVWA 2BCKB 1N8OE 2BSEA 3RPIA 1A4JB 4AXWB 4BFNA 4YGVA 1OANA 1MPAL 1T4WA 1WCBB 2OPCA 4OD2B 4ENZA 4HIXL 2FIKB 2HYMA 2QR0B 4GBXA 3HHRB 1T0MA 4MAUH 2X4NA 2XWBA 4GG6E 2R4RH 3IDGA 3GPSA 1GH7A 4AYDC 3PDDA 2N0MA 1ODUA 3EOBA 1DBAH 2H0EA 1UD8A 3KXFB 2AMUA 2NY0D 3A5VA 3R4DA 4ANKA 2XPZA 4LHQB 4X80L 4L3CA 4RNRB 3IFPA 4PTUA 3RDTA 2C3VA 3I6GB 3QQ9C 1QKZL 4GSDH 2EADA 3C60D 4X9FA 4YZFF 3L5WB 4XBPA 1L9MA 4UINH 4GINA 5L4MA 2DN7A 3F58H 1PS3A 4X6EA 1NGQH 4OM1L 3BYTA 5SWZE 3KWWB 3FB7A 1VFAB 3MRIA 3CN0A 1EHLH 2DKUA 3CX2A 2Q8BH 1JPGB 3BP4A 3IGAB 4YZWA 4TUKL 2IDUA 3L3GB 2CDFB 4JCWA 1JV5B 3D69A 3FNKA 4I8DA 5DWUH 2OK0L 1FBIL 1I3VA 1JWSB 3UEQA 4PRPD 4CU8A 1BZQK 3MA9H 3NEXA 2NT1A 2B0SL 3FRUB 3QDAA 2Z31C 1AH1A 5HI4D 3H56A 4HUUB 3V6OE 3LZLA 1GHFH 5E6IB 4R4FL 1NCDH 2BNUA 4PIBA 5TQ2H 4PBDA 3LEXA 2B39A 4LP5A 3BO8A 2XPYA 2BP0B 4GBXC 3GBLA 1MG2C 5DD5L 5HXMA 1NUDA 3EDDA 2BFGA 3FQNB 1MFAH 3MXVH 4Y4FB 3WDJA 3OJDB 2JCCB 3BGFB 1BFVL 2NMSA 2OXGA 1SOSA 2X40A 5DJ0A 3F8UB 5DYOB 3SOBH 2MMXA 1AZNA 4LVNB 3KPPB 1A4CA 3FS9A 2DQJL 1FN4B 1VESA 1MFVA 4OGAC 3NZHH 4WUUE 3KLKA 3QZWG 2PYEE 1MAJA 2K3TA 3CHOA 4KJYA 3RDTC 5E94A 3SKOB 4J3VA 1FVDB 1KV7A 5E2JA 1UUSA 1SOQA 2DKMA 4HLJA 2R56L 4TNEA 5FUZL 4WWKC 4B7LA 4K55A 1ZPUA 4PRHD 3BP6A 4AGNA 1RZKH 4POYA 1H3PL 1DSYA 2QSCH 1HTYA 4FOMA 4FZ8H 3IKCB 4XMZA 3MODH 1AJ7L 5T1MA 3TX4A 1T1WB 5B3SB 3SJVA 4M3KB 1YY9D 5LHDA 2QGDA 2F7OA 1UJ3C 1TJIH 4BQCA 4PS7A 4DKEH 2E7HA 1JXJA 4XOAA 3UJIL 1NMAL 5CO1A 3CLWA 4R7NA 3K0WA 5D70H 2JLLA 4GI9A 4KVNH 3MV11 1HQ4B 3AS0A 3DHUA 5J1TC 1EGJH 1WFJA 4O4YH 5FV2A 3BOVA 1BAWA 1OGTB 1OAZL 5I1KL 4PJAE 5DMIL 1G5AA 1LE9B 1TZHA 1T2QL 2EUXA 2N3JA 4YVUA 2JQMA 2NZIA 1QI3A 4N2IA 1NSNL 3ULUF 1ZVHA 1JNLL 1Z6JT 3CH1B 3GLAA 1S46A 4PJ9A 5DD0H 5ITFA 5ID0A 1RZ8A 5DF0A 2VCOA 4NQDE 5I82A 4K7PH 2J4WH 1OGAA 3WN5B 2WXOA 4PGDA 1QSEE 1XXDC 3EYFA 4F20A 3QBTB 5GSVA 4RIRB 4JG0H 4N5EC 4MCNA 1UXLA 4XMTA 2WNKA 3P0VH 5E1IA 4XC1H 4RGNC 2FX9H 4FA7B 4EPSA 3QDJA 1ZHBA 4XNAA 5FUOL 2DQFA 4U4IA 3OLGA 4X6FA 3EADA 4DUXA 4MAYB 1DBKL 4X4MA 3HPJB 5DI8A 4DN3H 2ZCKL 4ZQTA 1HHKA 4RQQA 4NGHH 5GRUH 4AJWA 2VQUA 3QP3A 2O26U 4Y4HB 4H0IA 3CGTA 4JY6B 1KXTB 4IKKA 1JAEA 1KYFA 1U33A 4KJWC 3MXWH 4QXUL 3WD5L 4BK8A 3SSGA 4NQEE 1OY3B 2D31A 4R6UA 1QRNE 4ANVA 3QUXB 4PS4H 3Q6FB 2UXGA 1JTOA 4JPIB 3BPNB 4Q4IA 1U21A 1FYHB 2KHAA 3MNZA 3FC8A 3KD4A 5HVGB 4EE2A 4WFHE 3SE8H 4JQIL 4FA8A 1TG8A 5JW4N 4NKIH 4J23A 2X2IA 5DD3H 3WS6C 4G7YH 4OLVL 5E1AB 2XXMB 4OM0L 2YA2A 3QXDB 5EZJA 1EFXA 4J6IA 2Y69B 3HCVB 4HK0B 4MNQA 2DMHA 1CBVH 1YCSA 1YUHB 3FFCE 3MNDA 4QHMA 4U1MB 5DK3A 2GBTA 2MHAB 3ARFB 5T33H 1QYGL 3WENA 1QLRA 4QPEA 2VM9A 2A0LD 5F89A 4PJ9C 4CSSA 1TZIA 5IVXE 1MKFA 3GTVA 4D8PB 3MLTB 3L13A 3MUUA 4GKOA 1A9VA 1T1YB 1XF2B 3O3AB 2FCBA 1ZHNB 3FTSA 1U8LB 3S5ZA 3TT1H 3R19A 1UOWA 3HHMA 5DHEA 3D39E 1WPCA 4UT9L 1X9RA 1DN0B 1I8KB 3ESNA 5J4MA 4JHAL 3TTSA 2VR5A 1DQLL 4HJJL 4F2FA 1F13A 4ZMZA 4JFZH 5HGGS 1P0SE 4MDIB 3WFEL 5IF0A 4GRLA 1DQML 5FYJD 1CI3M 3KWUA 5B4MC 1MCKA 1RFDL 2V33A 5DD6A 5EOCJ 3S36L 4HUVA 4PHZA 5GS1A 4JVUA 3QQ3A 4Z5RA 3IPBA 4FQ1H 5JHBA 4JFYA 4WO4A 5K9JL 2J1YA 4YXKL 4CJ1A 2H45A 3LZFH 3WFHB 4PJFE 4MSWB 2ADFH 4KVCH 3QAZB 2F7PA 3FCTA 5D2NC 4WRLA 1IUZA 2LABA 3KJ4C 2VXTL 5D7IE 1K6QL 1J87A 3OZKA 3IJHA 4PP2B 4QYOB 4PYHA 4ZQKA 5FO7B 5IZ7A 4Q9RL 2NUTB 3P9LB 3BUIA 3WO4C 3SPCA 5JZ7D 4XNXH 4FXGA 1NCCL 1M7IB 2YQ2A 3FL7A 4JFFE 2G9KA 1A6ZA 2YPVL 3FO2B 5IBLC 4N6RA 4EN3D 3FW6A 4XVJH 3Q1SL 1HDMA 4M7ZC 5GGTL 5TQ0L 2HX8A 3T9WA 4RZCB 2WANA 5T1LB 5CJOH 4NC0B 4PJAF 3TPUA 4PGCA 4WNSA 4K5LA 3IU3B 1MI5A 4R2GB 2HFGH 5DZVA 5TE4L 4AV4A 4XO5A 4WU5A 1OP9A 4KK9D 2MSPA 3WEBA 7TAAA 2EYSA 3IJEB 1JL8A 2W81C 5C07A 2VDLB 4LSVH 3MRFB 4Q0XL 4WHCA 4AM0B 3VWJA 3ZTNH 2GJPA 1BLNB 1SLVA 4Y2LA 2FR4B 4G8GD 1NIAA 1JGLL 1UB6A 1JGUH 3FOLB 2FJFB 2RCSL 4GW4B 4HW6A 1ED3B 3UP6A 2K8QA 3D05A 3RGBA 1T2JA 3LS5L 2XN9E 4ODVH 4EUPB 4HMCA 5AB0A 4A7VA 3QRBA 4FQJH 2BRRL 4HSAC 4XPGL 5AQ0A 5EZLB 5CM1A 4WO4C 4BZ1L 2FWLB 3IJ7A 1T20A 1HWGB 2HTKC 4F33B 4M7JH 2J20A 3T2NL 3GTNA 4JAMA 3WG7B 1CFVH 4M1CD 1NCTA 5BOPA 3S88L 2OCCB 4I0PA 1F02I 1KXQE 2DH3A 4IOFC 5EEYA 2WINB 3RE0A 2FGWH 1A3LH 2DQHL 3HNTH 2XG4B 2O93L 1V7NH 5DJZB 4P4RB 2CHDA 4OZHB 3OKLA 3HAEA 4X6DB 2O6DA 5KSUA 3KR3H 4ZMYA 4BQ6A 4LXFA 2F58L 4OZFH 4UIMA 2EDXA 4TLTA 1KCRH 3BAEH 4ZOAA 5IIEB 1A4KA 3MRLA 3VXME 4AEHL 4QAMB 3V5HB 5JMRA 2IV9A 5IWLA 3FH7A 1UXWA 3Q01A 4GXVH 4N4YB 3QJXA 4X8JA 5JOEA 4QXWA 5F9AC 3UPRA 5F6HJ 2XXCB 1YNKH 4JPKH 3SPVA 3FRPA 3QDGB 4BSVB 1JFQL 4DK5A 3ZT7A 4MJ4A 1LWHA 4FQXB 2AW2A 4WI0B 2MIZA 3V52L 1KTKE 1F4WH 2R0WH 3GIVA 1CR9L 3NP3A 3TBYB 3VA6A 2Y9RT 4B5EA 3UIZA 4HU2A 3CZEA 1JVKA 4NPKA 4UANA 4PJHA 4LLQB 1QBMH 1JZFA 4GIPD 3TNMB 1JRHH 4WHDA 5DC2A 5A2CA 2H26A 2X89D 4W9EC 4YUEH 1IC4L 5JMOC 4LCYA 2G3ZA 2EDEA 3LMJL 1FGNH 1YECL 3C5ZB 4UDUB 2YS4A 3O9WA 4C56B 3QEQD 3RDJA 3W9DA 4P5KB 4ZOCA 4ZW5A 4HG4J 3K4ZA 5E1QA 4U1SA 1PKQB 1U8MA 2DZEA 2EYRB 2JB6A 4FYQA 4LPWA 4P5TB 4GKZB 1L3WA 5DRWB 5EG6C 4YLCA 1J1OL 5TGBB 2OTWB 5CXPA 4TQIA 4KQ3L 4QTHA 1E8WA 3RJQB 1RHHB 2YPKB 2E59A 1MEXL 4PJFF 2EXWD 2H8PB 4NC1E 5C0BB 4Y2OB 4ZUSA 3GMQA 3QIWD 4CUCA 1HNGA 3DX9A 2B1AL 4L3FA 2I85A 4KZCA 1DL7H 2GTQA 3UDWC 5LVEA 2I9LB 2J88H 4KROD 2NYKA 4E9YA 3SQBA 4XPFL 1Q0EA 2DD8H 4Y5VB 1FLRH 5BCAA 4N2FA 4Y8AA 5BUGA 1MFBH 4X6BB 3S96B 1FZMA 3F6LA 2K3HA 5I73B 4RA3A 4Q9QH 1IGYB 3UGXA 4LNVA 4KRPC 3IJ9A 5FGCB 3ULVC 1OAYH 2XV3A 4KK8D 4Y7MA 3GBDA 5CSGA 4NT6A 2R2BB 4YDVA 1BGXL 5EZIL 3HG1B 1LO3H 3O0RH 3VWKA