2J73A

Alpha-glucan rcognition by a family 41 carbohydrate-binding module from thermotoga maritima pullulanase pula
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
103
structure length
103
Chain Sequence
FTETTIVVHYHRYDGKYDGWNLWIWPVEPVSQEGKAYQFTGEDDFGKVAVVKLPMDLTKVGIIVRLNEWQAKDVAKDRFIEIKDGKAEVWILQGVEEIFYEKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis of Alpha-Glucan Recognition by a Family 41 Carbohydrate-Binding Module from Thermotoga Maritima
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords PULLULANASE
total genus 21
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature ec 3.2.1.41: Pullulanase.
pdb deposition date 2006-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03714 PUD Bacterial pullanase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2j73A00
3V0EA 2J73A 3V0FA 3V0JA 2J44A 2YOCA 3V0GA 2FHCA 3V0IA 5BZXA 3AWGA 2J43A 3V0HA 2YA1A 2FHBA 2J72A 2FHFA 3N0AA 3AWFA 5BUGA 2J71A 5BZZA 1D5RA 3AWEA 3V0DA
chains in the Genus database with same CATH superfamily
3OKMB 1WBXA 2AZUA 2FRGP 3LH9A 2X6VA 3KE0A 1JF6A 1DLHA 5HGHB 2EUVA 2AXFA 2WUBH 2V5RA 1CK0H 3LQAH 5D1XD 1FLRH 2EXWC 1DQIA 2KMWA 5TK2A 4LDOB 4X42A 3DGDA 3JQOB 4NP4L 1UGKA 5IVXA 2DWDB 4MNQA 1HDMB 1NAML 1N8OE 3N1MC 2JKIS 4LU5H 1AO7E 1N67A 3P3RA 5EN2A 3KCWA 3UMNA 4L3CA 2HPOA 2DMGA 1Q9OA 1P9MA 2IAMB 4MNQE 5HHVL 2Y24A 3SDAD 4ZNEE 3OX8B 4WFHD 2R0ZL 4WW2F 2ZUXA 5LN4A 5CWSB 1IILE 2I26N 2DIAA 5L88L 2YR3A 3HCVB 5JTWA 6PAZA 4YNYA 3VXUE 5BQDA 3EYFA 2E3VA 3T2OA 1LWRA 3LEXA 5FB8B 1EEUA 2VXVH 3KJ6L 2Q7NA 4FJ6A 5JMOC 3O3BA 5I9QC 3VW3H 3IJSB 4TLTA 3D1MC 5AVXB 5JIMA 2R2EB 3QQ9C 4AQ1B 2YQGA 1KXQE 2CK0L 3BDXA 2BVYA 2O1AA 1DJGA 2DWTA 4QUOA 1T5WB 3UMTA 5HPMB 1MKFA 3H55A 2XFGB 3ARFB 1RZPA 4HUUB 1L0XA 4FNQA 3SN6N 4HF5H 4QCIB 2BMKB 5IFHH 1DLFH 4ZUWA 5FYKU 4W9HC 3WNNA 4X4XA 5JUEH 4X5PA 1NEZA 2GTWA 1TJIL 1QPPA 4F2ME 2EYTB 2Y7NA 1CDYA 3EJUA 4XP6H 2M2DA 3EOBB 1SY6H 1FNSH 1NCWH 2RFXB 5F7DA 5JPMB 5CFHA 1TTCA 3ZKQD 2H32B 2GTQA 2YSSB 3R18A 2BSED 3BPLB 4A6YL 1DEDA 4UM9A 4KI5E 4TNEA 3EOYG 4X5QA 4EPSA 3TCLB 5SX5K 2CBTA 5E5UB 2GI0A 4XMLL 3TIEB 3FRPA 4N0FB 4WTXA 3T0BA 3DMMB 5FECA 2EXYC 2H1PH 1QBMH 3VXTB 1KGCE 4MJIB 2OMZB 1CCZA 1MHEA 4PJAA 4RAVB 1TVBB 5JQIB 2N1TE 3T1WA 3BT2H 1HVXA 3QJRB 5F1KC 1YEKH 2YBRB 4GYBA 2PR4H 1TZAA 2NXZD 1C8QA 4G43A 2WZ5A 3QXVA 3WEXB 1PD0A 2AVFA 2DJ4A 1B4TA 4FTVE 3QZBA 4MNHB 4UDTA 1D9KB 2FLMA 4MAUH 2VDPH 3FCBA 3PNRB 4K5LA 3FB5A 5D71L 4J2XA 5AYTA 3BE1L 2OP4H 3LNHA 4PRBB 4YMPA 3L54A 3T2LA 1IX2A 1DHKA 2VSKB 2CR3A 3NTCL 3ZOAA 3CFCH 2CH8A 4LSQL 4R7XA 3IDMB 5LAXA 4BZ2H 1YNTF 1JGDB 4KTDL 4KKBC 5LQBL 5MEPA 4QKXB 2F7OA 2R1XB 3AY2A 4YE4L 3MGTB 3IDIB 3TO2B 2R39A 2WLYA 1VPOL 4DTGL 3L3IB 4Q8BA 5C6WH 4PUBH 1S5HB 1O6SA 4W9FC 3RPBA 1L9QA 2VR9A 3KL0A 4C56D 1MVYA 1SN2A 3GBEA 4JY4B 2B39A 5HGAA 3W0WA 3D34A 4Z7WF 1F3RB 4UBDC 2FTAA 1OWRM 4MCZB 5EULV 5TDNA 5ICYB 3QJZA 5HDQH 2VMEA 3RTQD 1S7QA 1BF2A 2F1EA 3MJ8A 2YPVL 1V7NH 3ZKXB 8FABB 5B39G 1ZTXH 4UANA 1SOKA 3DGCR 3FJTA 2D4DA 1D5IH 1FFPA 2X44D 3QXDB 2H6UA 4HFUL 2Y6TE 1R3KB 3CBRA 3T8XA 1ES0B 1OB0A 2X3BA 4G3YL 3S35H 5C0RH 4O4YL 4EVNB 4AE0A 4FHKA 3QJXA 2WC7A 2GFBB 1Z9NA 3DRTA 3CQPA 3GSRA 2JJUA 1BPVA 2EADA 5DVNA 3QZLA 1XF3B 4F7CB 1F56A 3SY6A 2ESVB 1B6DA 1TETH 1X5LA 4XNAA 1ZDQA 3QWOB 4ELMF 3LEVH 4ELMA 5HP5A 4EI0A 5HI4C 4F2MB 4BQ6A 4JN1L 4CILA 1N18A 5EHFA 4RAUA 5FW7A 1IARB 1X9RA 2P3YA 3I9GL 4NKMA 3E80A 4HXAH 4NSKB 2QT6A 5BJTB 3WTXA 4WKXA 3EADA 5FYJL 4KKBD 1FZOA 2X2HA 1Q90A 3BWAA 3QEGH 2KZWA 3MRJB 1WT5C 5JORA 1JS4A 3TS8A 3BGAA 1CD1B 3IDGB 3NQKA 5JOPE 3VFNB 2GJ6D 3X2QB 4WNQA 4QTFA 3L3KA 1OALA 4X7SH 3VFRA 3JWNC 4PS4L 2J6EH 3WJJC 1LM8V 2JKRM 2NW2A 3JT2A 3ZUNC 3WHXA 2APXA 2XV2A 1MFCL 4HIJB 4YSTA 5C0CB 3L5XL 4KK8D 4EZMA 4H8WL 2O5YH 3ECBA 5M94B 3EFDL 3NDZE 4JG9A 4RRPA 4RNRB 5FKPA 2BK8A 4DK3A 1KEGH 1Q1JH 2JJVA 4R4FH 2YUXA 3L9YA 4PY7A 1NJ9B 4QGYA 5F88A 3D8MA 4IU2B 2DMBA 4J1UA 1L6PA 2CIIA 4NM8L 2C7UB 4AZ8B 2WBWB 2HT4C 5D8JH 3TZVB 3ROOA 1HJBC 1LHZA 5DF0A 4AIZB 1CO1A 2CO6A 5CLXA 2X6CA 3AUWB 4GAJL 4I4WB 3V4UL 2UUDH 5T5FH 2AJSH 2RTTA 3ZO9A 4JDVB 3D7PA 4K94H 4YVNA 2W9LA 4A2EA 3K1KC 3CLEH 3ZUCA 5IB2A 3IFLL 2EH7H 3GTVA 1RHFA 2MPVA 1QD0A 5DMYA 1UGNA 1S9YB 4UIKL 1WAPA 3CZLA 2ARJQ 3NJKA 5J89A 4WJ5B 4LRNH 5IHZB 1CF8L 1GGUA 4BSVB 1HAWA 1P5UC 2GVYA 2JELH 2Z0UA 3D39B 3QC5X 3EYFB 4PWKA 3SOBL 2UZIL 2XXMB 2K7PA 3KGSA 4Z5RA 1DQDH 1GGYA 3KH3A 5L6YH 2GT9B 4XT1C 4YC2B 4HG4K 3FQRB 4HEME 3O4LD 1IGTB 4XWGL 5CUSL 5IMLB 2XWXA 3LEVL 1SQMA 5E94B 5EBMB 1YEHH 3RZCA 4P23C 5C71A 1DJWA 4IRZA 1R5WA 2PCPA 3M45A 1KULA 4N6RB 1BF8A 3ABZA 3A6OA 4G7VH 1BQHG 1TZIB 1ED3B 1NMAH 2R0WH 4EI5D 4G3YH 2CO3A 4YHPA 2WINB 3LHPL 2OSLB 2R56L 2AERT 1OT2A 5JPMC 1K6QL 3ARBB 2EDTA 3BPOB 1LP9A 3QVAA 4H8VA 4NS0A 3RWDA 1SJMA 4AW7A 2HVJA 1CF1A 5D7SL 5B39B 7TAAA 1HI6B 2YD1A 2C26A 2NY1B 1KTLA 1PEZA 4OCRL 4FLRA 5GZNC 5IQ7H 1GR7A 1ASOA 4JHAL 5HDRA 1TJMA 5IW3A 1EJOL 4M7ZC 4J4PC 1SVCP 4Q6YA 4AYFA 3QR0A 3P73B 1E2VA 4TQHA 1C16A 3PGCB 1T2QH 1R3IH 3TM6A 3GINA 2AI0H 4HZLB 5IMKB 1BAWA 1XR9A 2DQGH 2GSGB 5F0LB 2HTLD 2YBGA 3ZTNH 3PABB 3VYPA 3RVUD 4PYGA 3QPQC 5D2LE 1E2ZA 3LN5A 4XTRC 5DI8B 3S5YA 4YSQA 1LO4L 5BS0B 3LS4L 3OXSA 4YDLC 5DLMH 3HKZA 2V17H 5T1KB 3UFIA 5KVMC 4AM0A 4HWBH 5BXFB 2ZOTA 6PCYA 5CGBA 4K3GA 3OR7A 1A7OL 2AEQH 1ETA1 3DUUB 4B95C 5HGBA 4NN6C 1O7VA 2Y2WA 4ZAKA 3MHZA 3WXWL 1J7VR 2W0LA 1N0LB 4KRPD 3O4OB 3O9WB 1GH7A 4MJ5B 4GFXA 1CLOH 2F18A 2QSVA 3NABL 1QFHA 1V10A 2OTWB 3MRMB 1JUFA 3CIQA 4B7LA 4DPAX 1W0WB 4JFOB 4DGWC 2EXSA 3V8CA 4UM9D 1DVFA 1T1ZB 1U3HA 4L23A 5I71B 1AR1B 4CKQA 2AAAA 1NMBH 3BZDA 2WP3T 5D7LB 1JGIA 5BZDA 5GZOC 2WKOA 1UD8A 4EZKA 4PJCF 2C9SA 4EXKA 4TSCL 3MX0A 1AY1H 4LL1A 2FJGB 3OHXA 4ZNEA 1KXTB 4AH2B 3FU6A 1Z0NA 2FWUA 2VABB 4J3OH 3AS2A 5J6HB 4HUNB 1G7HB 3L1OH 3RFZA 4BJLA 1T20A 5TGBB 1HIMH 1NGWB 3KS0J 5CN3A 5JHLA 5EU6B 4GPVA 3NFNA 4OF8A 1MFMA 2R69H 1TJIH 5DQDH 3N6YA 3P4NA 4MKMA 2VM9A 2OTUA 4IRZL 4TPRL 3QBTB 1HSAB 2BMKA 1B3JA 1C5CH 2PPCA 1OCCB 1WCBB 1OM3L 3X17A 1ZE3H 4RETB 5EIIG 4PGBA 3ZDXF 4TUKL 1OSPH 3LIZH 2WNXA 5IHUH 1SM3H 5C0BD 5DD6B 5DJ8B 3VUAA 1QTYT 2E56A 1JMZA 1RZQA 1OW0A 4OIIL 2ZONA 4XN9A 1F4XL 2EIKB 3GBMH 1CD0A 3OR6B 1GHFL 1ZTXE 4M6OH 2HLAB 1BZ8A 4FQCH 5EZJB 1VZHA 1DBBH 4LAQL 1HOCA 3EJRA 4QRRE 2FIKA 1DBBL 1Y1DA 1T1XB 2ZXAA 2PR4L 3BVXA 3G08B 1KGUA 3ZE1F 3O45A 4OQTA 3WOVA 5E08H 1L9OA 5DJYA 5DD5L 3VXSD 1G1CA 1NGXA 4JZJB 1UXMA 3CZNA 4RGNE 1KNOB 1U91B 3C5ZD 1BXXA 5C08D 3BFQG 4NZTL 4FEMA 4Y1TA 5AOKA 1A25A 4IEFB 4F33B 2UY6B 1ZTMA 5HVHC 2DH3A 2DQDH 1GY2A 1EX0A 1IJNA 3MRGA 3IU4L 1F1GA 1FL5B 2BS8A 4UF7C 5KYWB 2AK4E 2HKHH 4Y19E 4ZO8A 3QUMA 3ZK0A 4I0CC 2HT2D 4N28A 3O4OC 2OSXA 1HL4A 5DEZA 1ZJAA 2ZWZA 4FC3E 3TZVA 3GPSA 1DVTA 5I15H 2H45A 1IE4A 2DIEA 2DEWX 3IPFA 3IKKA 3OC8A 3O3DB 3RVTC 2A99A 3EO9H 1WIOA 2Q76A 2VXQA 43C9A 3AB0B 4HIPA 1MWAA 1I1CA 2J55A 3RURA 4OZHB 3SBWA 1SDDA 1HSBA 4R90H 4FG6C 3NIDF 1GJIA 3CCHB 1KJ2A 2HWZL 1VKXA 4Q9QL 3GSVB 2DBLH 2GSIA 1NGPH 3PDDA 3QQDA 7FABL 3MJ8B 1ICTA 2GY5A 4BM7A 1THCA 3AM8C 5HGDA 4N90D 1XEDA 3FN9A 2A0LC 2J8UF 2WK2A 3GGWA 2DQTH 1AQ8A 3F84A 3LQMA 4GMSH 1E6JH 3GIVB 3T4AA 3UJIL 1CICD 1ORQB 4FQXD 2AEQL 1JCVA 2PWEA 4P23B 1MCKA 2ZT9C 1JNHA 2FGWL 1S3KH 2YKLH 4LP8A 4BK8A 1S3KL 4PBVC 1JZDC 4FYQA 3CD4A 1MZYA 5IHLB 2BINA 4JY5L 1RI8A 1X5FA 1XFPA 2Z31D 3EJCA 3TJEL 5PCYA 2PCPB 2WKLA 4LQFH 2OX5B 3TT1H 1E9QA 1KGXA 2VSDA 2FNBA 4FFWD 4OU3A 5J12C 2P80D 4DP1X 4FG6D 1WSST 4XN5A 1XF5B 4PN6A 4ZFGL 4MNGA 1D7FA 4UOW1 1U8OB 2VDLB 2WUBL 4YUEL 3RNQA 2B08A 2AS5M 3FHEA 3K81A 1PLBA 3LV3B 2AK1L 4BKSC 1E7UA 3MTXA 4LDEB 4YHLH 4F3FA 4J3OG 5I0XA 4RISH 5EFIB 4ZMYA 4R9HA 1KGIA 5GS1B 5KS9F 2PP7A 3Q9QA 2YRZA 3QUXA 4YQXH 1YEDB 2UY7A 3T71A 3FFCA 1OCRB 1HQ4A 1UB5B 3IMBA 2R56H 5GGSA 3RFRA 5BVJB 1KB5B 3GBDA 4WO4A 4XNYH 3GSUB 5BZWA 5HJDA 3BN9D 3DURB 2COQA 5F89B 3NPSC 1QUNB 4WGKA 5CU5A 5IMKA 1VLXA 5LGJA 3QJVB 4M9PA 1YRKA 2NZ1A 4HP5A 1FL6A 1NIEA 5BW7A 3SKMA 5AZEH 2G9HB 1E5YA 5BS0A 2HLEB 5EUOF 5C0JA 4U0RC 1DQVA 4Y4HD 4BUHA 3K6DA 1GKEA 1BP3B 5CP3H 4NN6B 5SWZB 3ZVVA 3B3IB 3H9SA 2HYMA 1FO0H 1DL7H 3QEQD 3WO3B 5F0JB 1PAZA 4Z3IA 4DZBA 1G9MH 4FMFA 2BZDA 4ZXBD 1NDGB 3JVGA 4CGTA 2K45A 2Y6SC 1QI4A 3UBHA 3H1ZA 1IC7L 2FX7L 4IGBA 5I16B 3ARQA 2HT4D 2NYZA 5TPWL 2DIBA 1AYOA 3B7SA 2IALA 2ROXA 3BJLA 3RVWC 1J8SA 3GD1C 1D2OA 4X5WB 1SBSL 1NCDH 4NNPH 4KKCC 3CLFL 5LN8A 1UA7A 1NIFA 1DVFD 5D9SB 2A6IA 2ZJSL 1CGSH 4GI6A 4P57A 3B34A 3UC0H 3WTUA 3MCG1 4HUWB 4BINA 2XA8L 2HPTA 4LKCB 2EDDA 3GO1L 2HH0H 4TUKH 2PW2B 4P04A 5TGBA 1DVXA 1AGFA 5CJOH 1VFMA 3GSOB 4HJUA 4PGCA 4BEIA 4J3UA 5CLYA 4NUGL 1BECA 1KCSL 4KKLC 1I1AD 4WI2A 4Y0GA 1MFCH 5CZKA 3UBXA 5JO5A 1CGXA 2NR6C 5IJVA 1DQML 1JVLA 1MAMH 2OXHB 2F7RA 3NIGB 4NO5A 5BW7C 4NBXB 3D2UA 5A3IC 2KC0A 1A6VH 1HE8A 3ENEA 3Q8EA 3W39B 6FABH 2H2PC 2PPAA 3NRQA 1OSYA 1FG2B 5B22A 5CBAB 4BE6A 3TH4T 2MOQA 1YUKB 3D18A 5BUGA 3VGEA 1Z9SB 2DI8A 5D4HA 2YAPA 3PIQB 3LNFA 3V52H 5M95B 4N9OB 3WYRA 5DC4B 1RUQL 1QFWI 3K2KA 4FGMA 5D6DC 3GZKA 3M17B 4NQVB 2XN9E 4AYFB 3QQ4B 1MLBB 3LKNB 1BYPA 2WIIA 4P4KC 2A1WL 4E9QA 1J0ZA 5F7UA 4IRJB 3WHE0 1JPGB 3K72B 1AR2A 4S10A 3OPUA 5I75C 1N7ML 5DJ0A 4BUGA 1YEWA 4G6FB 2EECA 3PAZA 4JNXA 3RWGA 5E8OB 4YSAA 1B9ZA 4YVUA 3OQRA 4PJCB 3BD3A 2XYBA 4S1QL 1ZRUA 2OJZL 5L2KB 1XL4A 2PYFA 4XCEB 1TVDA 4WI6A 3V6ZB 4BFKA 3ZDZE 1SGKA 2VC2H 2BHFA 1KTJA 5KSAD 1YVLA 2HTKD 3EBGA 4Z7VE 3VXRD 4XNMB 3DMMC 1IC4H 2I7OA 2VZ1A 4NI6A 3U7AA 2IDTA 3MLRL 5JOPD 1S8DA 2EDFA 2EABA 4U1HA 4PP1D 1PZDA 3BKCL 1NCAL 3BZFB 3F3HA 3V5HA 3OKNA 1DSWA 4ABVA 3U4KA 2GJZA 2W0FA 4U1SB 4CNIA 3K46A 1D7DA 5GXBB 2GC7C 5D7SH 3WTSA 4W70A 4OF7A 2QADD 3G9VA 1NGZB 1NAKL 2NUPA 3KXFB 1CE6A 4GSUA 4IMLA 3WFBL 5FHBH 1QHPA 5CD5C 2PLTA 1X5HA 5K9KA 1I3RB 2VO8A 2J1XA 3QRGH 1YNKL 1ZLDA 4HG4J 3FT3A 3O81A 1L4IA 4PGEA 2YGPA 4R26H 1AGBA 5IMMB 4F7EA 2XICA 1KJ3H 1NCJA 2BXYA 1NUFA 2WXPA 3ARFC 3MV11 4YDIL 2LLLA 5HDOA 1IQWH 3K4ZA 3VXNB 2V2WA 2B59B 3FQNB 4EQ2A 1ES0A 2FAUA 5E23A 4N3TA 1LK2A 4N25A 4E41D 3IDXL 4U1KB 2CJUL 2VOTA 1R3JB 2AK4A 3L9EA 4I89A 4XTRD 4D8PB 3GIZL 2XRAH 5GGSY 1NEZB 5I1KH 1KCKA 1QBBA 3P3SA 2FEDC 3P4MB 4PV8B 4Y16A 2UZIH 2FDBP 3V6OC 2BM3A 5DS1A 3STBA 3ATFA 5J6GB 2BS9A 4R2GC 3KVQA 4KJYA 3G6JE 2QELA 5F9WC 5C0AB 3HC0A 2GITB 4N2DA 4XXWA 4IK6A 1KBGH 3ME0A 3CFEA 4BA8A 4M7JH 1XD1A 2CLZB 3AQDA 4NWUH 4RWYL 3GSNH 4FXGB 3DMMA 1KPVB 4JFFB 3CLEL 3V4VB 2NY2D 1J0HA 2UUDK 3SQBA 4IDLA 1C5DA 4Z95L 1JZJA 4WEBL 4ZOAA 3OXRA 1Z9OA 4IM8A 1PS3A 1HHHB 1EANA 2VMDA 4PJBE 3L13A 3TN0A 4QYOA 3S48A 1VACB 5I6NA 1Z32X 4BZ1A 2NX5A 2Q3ZA 4PRHD 4ZK8A 2ZG3A 4F15B 1ANUA 1F4YH 1FL6B 2BVOA 2IPUK 4QHLB 3BX7C 1UXLA 3QNZA 3BI9X 4CBPA 1X5XA 3L3JB 2CK0H 4WHTB 1TTAA 3EDEA 5DJCB 3SKJH 3THML 3VXRB 1D9KC 1Z5LB 2ZUVA 1SOXA 2FATL 2YEZA 3BN9C 4JO1L 5E95B 4M5TA 3WIIL 4PRNA 1TFPA 1TPXC 3CVHA 5HHOD 4JO5A 1ZLWK 4YSUA 2HG5B 5B3NA 1YN6B 3J7HA 3PL6B 3NP4A 3UTTB 4NO2B 5JHBA 3EH4B 4F7TB 1S5HA 3EO0A 5EU6D 3SCMB 3LRSA 2WWNA 1GOHA 1HXMB 1NIBA 2WKGA 2IALB 1I9JH 5FIEA 1ASQA 5LWYL 4HLJA 5EEZA 3MOBL 3GSVA 2DYPA 1U2YA 2PCXA 3NJNA 5TDNB 4AC2A 2RCSL 4AOFA 4PJ6A 3CFIC 5D4JA 5BCAA 5IHHA 3WFEL 1LEKA 3RI5F 2NNRA 5HXMA 3IDXH 3REVB 1U6AH 3TBBA 4ANVA 4YO0A 3EYSL 3KPLB 3SJVB 3D69A 5F7NC 4K07A 1LO0L 2IV8A 2WZPA 4ZTEA 1OGAD 2YXMA 5TE4H 9PCYA 3CZUB 1IL1B 3H9SD 3RY6A 2H1XA 4FOMA 3UZEC 5IQ9A 1BM3H 3OJ2C 3ROLA 3BAXA 1FPTL 4PGCB 3ASNB 4WGVB 3LN9A 4J6RL 2PUQT 1FHNA 3ARVA 4OQ1A 5MEND 3PGDA 3QWOA 2IDSA 2ZD0A 3LKRB 4IGBD 4R0LC 2XBZA 3BESR 1CDBA 2ZX7A 3D25B 4XNXH 3CPLB 2WWKT 3HHRB 5T1DL 3M1BB 7CGTA 4HCIA 3MA9H 1EQWA 2B3RA 2EKSB 1VGKB 1YYLH 4F3FB 3S5LG 4Z7QB 2VXTH 1CVSC 2VLLA 4KK9D 3GJEB 5JORB 1GRWA 4FQXB 1LDSA 1SLVA 4XH2A 1XGYL 1MFAL 3FT2B 1TQBB 3MV9A 1MWAH 1NBVH 4AYID 3NGBB 5DTFA 3ZU8A 4ZBJA 2EE0A 3IWUA 4OF6A 4O02B 5I1HL 5JXEA 1WHPA 4DKEH 4X8CA 2L7QA 3CFCL 4JKKA 4FFTA 1T3FB 5D1QA 1PLGH 3EDDA 2BOCB 1OGTA 4APQA 4C4KO 1OO2A 2APWA 1ZVHA 3T3PE 2BW4A 4GXUM 1IBFA 5K1NA 4ANWA 2O6FA 2G2RA 1XL6A 2ZNXA 3ECWA 3BP6B 3VRIA 4B9CA 2ITDB 3G3LA 3H54A 4FNLH 1I7UB 2WXOA 3LXAA 3MUGB 2XV3A 4JM4L 3ILQC 4DQOL 4FI8A 1H6FA 5FYKD 3A0OA 5SX5H 2CKBA 1OY3B 5DURB 4U0QB 3V5KB 5D7JD 2BO0A 3ABLB 1M2OA 4F8TA 2VAAA 2J88L 3BAYA 4HEMA 1CD9B 1I8KB 4MXVE 3NCYS 4LQ1A 2IQ9H 3I50H 3HG3A 5DC2A 3BZEB 2ADIB 5A2CA 3UABA 2YD6A 2WYHA 1KYOJ 1J1XH 4ES8A 1EUTA 3LVTA 2EIZA 1ZT1B 3ARYA 3OG4B 4M7LL 3O6KL 4ZAKC 3NSDA 4FN0A 1A47A 1HKLL 3TA3B 2C9RA 2GUYA 3SKUD 1TYEB 4B6ZA 2F68X 5CINL 2VB5A 4GJTB 3MUUA 1BEXA 1RK0A 4HUWA 4MHHG 4C56E 1A7NL 4LKCA 5D7EA 1KCSH 1ZLVH 2XWDA 4Y1SA 3JWDH 1MNUH 1BQLL 1G7HA 4R7DB 4UYQA 3RFZB 4N8CL 5E6IA 1DLFL 2EIBA 3M86A 3F6IA 4M8VA 4PGEB 1NGWA 4UT6L 3Q06A 1BVLB 4NZJA 1QWHA 3HG1D 3HRZB 1PG7H 1KACB 3MUY1 5DYFA 2QHLA 2QKIB 3KLHC 5J57B 5KJ7E 5KSVA 4DAGL 5I30L 4MBRA 1OK8A 1QVOB 5JOEA 2X0UA 5K59E 3V79C 3O6MH 1XXDC 3GUTB 1KF9B 2YXWA 1HK6A 1NCDL 1UD4A 2GEEA 4LHQB 5I1DA 2NY2C 4YS4A 2G5BB 1G1YA 4UV4H 1HE7A 2IFFH 3MRRB 1XH0A 4OGAD 1L9NA 3P11H 4NOFA 3HC0B 4KX8A 1CN4A 4GKSA 2APSA 1WEJL 3ZE2B 2FIKB 5FO7A 4OJCA 5JYLA 3H2WA 4PP2A 1LEIA 1MCNA 2ICWA 3WJLA 3P73A 5DZ9A 4AL8H 4ODVL 3ZMRA 3DJ9A 1NBZA 4WUKL 4NQDD 1MHCA 2XPZA 1FC2D 2XQYK 1URZA 4OD3H 2GAZB 4PJIE 3H7BB 5C09E 1O6TA 3DJZA 2YQBA 2V9RA 2VGLM 1LE9A 4Z7UB 1SNRA 4G9FB 3OAYH 3CUPB 1SMDA 4HEPA 2BVQB 1G5AA 3PWPA 3OPZH 3L5WB 3BKJH 3UIZA 1RZKL 2HP4A 1OD9A 1CE1L 3T6ZA 3BAEL 3OKKA 4UT7H 3HBQA 2EH8L 1F45A 5KOVC 2F53B 3UPRA 2ZCLH 3H42H 1FL3B 3LOWA 1IKFH 2K3TA 3PQYE 3MJ9L 2A77L 3MOQA 5SX4I 2NY3B 4JRYB 3GTTA 1T66D 4NI3A 3VTAA 3KMDA 2R2CA 2B0SH 2WXJA 3BD4A 3Q7JA 1CB4A 4HA1A 2MWCA 1U8MB 4XPAL 3FH5A 1CFTB 3VFMB 3VMNA 3C60B 1JPSL 3OBAA 3EGSB 3DX2A 3PREA 2DI7A 2ROYA 3BZFA 1NIDA 2NLJB 4UM9B 2AJYL 4PJHE 2F74A 4NZFA 3FCTB 3U1SH 3EYUL 4RZKA 1Q9KB 4YHZH 1OSEA 1S9WA 3BAKA 1ONQB 3VRJB 4RMTA 4YHYB 1U8KB 1FGVL 4UINL 1CR9H 5FECB 4HS3A 2WVTA 3V4PH 4HWZA 4IS6B 1KXQA 2K8MA 1NZRA 4M8QB 1TVBA 1U92A 5HGDB 1OEZW 4XXDB 3BVNA 2R29H 1JWUB 1I9JL 4OTXH 1UXSA 2Y1ZA 4KZ0A 43CAA 1M1SA 4K71B 4XI5C 4YDNA 2UYLA 3S36L 1MCIA 3BGMA 1I3VA 4QHNB 4QPEA 1K5NB 5GSRA 5CKGA 4PGBB 1HZKA 2X89D 2X70B 3I9PA 1FFNB 3QYMA 3G5YA 4LNVA 4X6CE 1HHGB 3VCLA 2AGJH 4XCFH 4OT1H 1A21A 2H1LM 2W07B 1NSNH 2VXUH 1KELL 1I8LA 4MMXC 3EDFA 3ZE0B 4OZGA 3O2DA 4LCVA 3DECA 3KPTA 1TSRA 3AXHA 2CLZA 1KTDB 1K5WA 1OTSC 1UC6A 2YEQA 3IF1B 5DUML 1NMAL 2QQNH 2R0WL 3P54A 5DJYB 2FLRT 4CC4C 1N0XH 3RG1C 1F11B 1JK8A 3FFCB 3QFJE 4PJEE 4Y7MA 3LZLA 3NIFB 1OP4A 2XOTA 3X11A 1E40A 4ZNCD 3AU1B 4CC1A 3V8OA 1B4LA 1G6RL 4HHAA 4NWUL 5D1QB 3MCYA 2XWBB 3ZT7A 5I1LB 2F53D 4WI7A 2VC2B 5B3JF 1Q72H 3CXDH 3ABMB 3MLXL 3VG9B 4OIBA 1JRHH 3IMSA 4JHBA 4N22A 4F24A 2FZ3B 1BZDA 5K69A 4YGVA 4LEEA 3CH8A 3UXFA 3SDYL 4JFQA 5C97A 1KPUB 3ZZ1A 5GIRB 3MV9D 1JHKL 4PJ7A 1P84K 4XBEH 1XEUA 3BPLC 2E75C 4P99A 3FAWA 1HQRA 4FFVD 5GRZA 4Z78B 3K4AA 1M57B 1YEIH 5BZXA 4LVHB 5B38B 1QSFB 3SBQA 3UTQB 1F3JB 4QTHB 1L0YA 1A7RL 4LPVA 4XWOD 2JQZA 1XF2B 1OARH 4YHOH 2ZAIA 5DHVB 4MLIA 3OF6A 4EN2A 2Q76B 2HX9A 2VDNL 1BJ1H 3G04A 2Z8VC 5T3XD 3OMIB 3QDGB 4EUPG 3NJJA 1KJ3L 4KMTL 5AWNL 1RUPH 3C5SA 3HPJA 4OCYL 3BPNB 4KTEL 4UQEA 4XBPA 1CVRA 2CGZA 1SMOA 4HWEL 1CLVA 4AV5A 5E7BA 1XWVA 1RSYA 2AJVL 4WCYL 5EN3A 1NAMA 2DPKA 3BSZH 1EA9C 1GW0A 2C4XA 2W65B 4K9JA 1JHTB 3ZSSA 1NCGA 3GNML 1C12A 4L4TE 1OAQH 2RACA 3J8F7 3CN1A 3UTZB 1UOVA 1C5CL 3BZ4B 2FBOJ 1F4WH 1LTXA 3VFTA 4XCCH 4G9DA 2PF6A 1SOSA 3T4AB 5I0VA 2C3XA 2MPAH 2QL1A 2R69L 4Y8DC 5E6IB 1JZHA 4P2OC 1F1DA 1XGQB 3VXQA 3TA4D 1PVHA 3KNBA 4TSAH 5A2AA 3E2HB 5ABAA 2GABA 1OQOA 1YJDC 3T2NL 3P2BA 3C5JA 4YWGL 1KJVB 3B9KA 4M61B 2DKMA 2O5ZL 5IJVB 2C9VA 3OKOA 3QHZH 4M93C 4H8QA 4NO5B 1F3DH 1ZLWH 4AZ8A 2COVD 2DQUL 2MKWA 1YMMA 3LVEA 1AGCB 5H94B 1OB1B 3T77A 3EHBB 2JJWA 3IMRA 1HH6B 4OR1A 1FDLH 2NY5C 2VERA 2Q7YA 2H6PA 4RLDA 3FUNA 1KTCA 1XH3A 3OVUB 4BKLA 1GYWA 2XTJE 4ZUVA 4ORGA 4EIUA 1Q0YL 4GXVH 2A9NH 4XZUB 4L8DA 1JF5A 4UU9B 3U0TB 2JCCA 2P8PA 3GMRA 2YXVA 1AD0B 3PCYA 2Q8AH 3U36B 4OFKA 3MV7B 3BEVB 1AXIB 4TXVB 3QUYA 5DMKA 1A3RH 1Z3GL 1BZOA 5D7IA 3ALXA 2CUHA 1AXSA 1S4IA 2XG5B 5M7QA 4IRJC 4XMUA 5DJ0B 4XC1L 1NAKH 3KM1A 2PR9A 1ERNA 4B27A 5F1IA 2H8PB 3DUSA 4LRIC 4QMEA 3CUPA 3F05A 1V7NL 2HX7A 1MJUL 3MLUL 2BSSA 1XSKA 4IQHA 5D6DA 2YAFA 4JR9L 5HHNA 4B9YA 4FNSA 4N0CC 2DZEA 4J8QA 1SLUA 4Y5VA 4YLQT 2IFGA 2F8VA 2JI3A 3MRBB 2N56A 3O2WH 3JTTA 4MJJA 3RP1A 1CDGA 4HISA 3PRZA 2WJ7A 1HCYA 4Y2DA 4DEPC 1PBYA 4WENB 1BIIA 3I02B 3VSTA 3NEEA 3ZGIA 4PG9A 4KZEL 5B1AB 4GXVL 1IMHC 1QAWA 1LP9B 1NCBH 1EXUB 2F08A 1RZFL 4YLBA 3PJSB 4KO9A 3VSQA 4ATWA 2HSIA 3JVFC 4L37A 3LHPH 1CL7H 4QHUA 1EIBA 4PJFA 1CICA 2EEBA 5TDPB 2TAAA 2YLHA 3OKDB 3FCUB 4P2QB 4XO8A 3FKUS 5DD3L 3TH3T 3TO4D 3VRJA 1A9VA 4KI5D 4APXA 2CBPA 3GMQB 1IE5A 1TQUA 1TKWA 3EBHA 5H35B 3QUZC 2J8OA 1WWAX 2XHNA 4XHJD 4X6DF 2FWOA 4NQSB 3WL9B 2AZAA 4BFJA 3IJYA 2P49B 4OV5A 3BUIA 4MMZC 5IMMA 1N59B 3P9WB 4HC1H 4LARL 2H2PD 2X4UA 4F91B 1YSOA 5IWLA 5ETUB 5GGQL 5KSVB 4FQ2H 3OKMA 4XBEL 1JI2A 5HGBB 3BZ5A 3EHBD 3UJJL 5BRZB 2F61A 2YPVA 4BWUA 5IB1B 3GSWA 4ZFQA 4JUSA 3PL6D 2E8YA 1G9ML 2E4TA 3G5YB 3L9BA 3ZTDC 1RJYB 2HFGH 1XGUA 5E9AA 4KRNA 2ZP8A 2UXFA 4A6YH 3SJVE 4GQRA 2I5YH 1U3HB 1UUSA 3PU7A 4N2FA 4XHJC 4EUPH 1MCRA 3K2UH 5E6UB 3UAAA 2WLLB 2CKBL 1WAAE 5I76A 2XIBA 1U36A 3LKNA 3M46A 5ESAB 4YX2L 2BC4B 5FUZH 1F11A 1JK8B 1OAQL 4NYLB 2PO6D 3FRPG 1ZVYA 1SUJA 4NM8H 1GGCH 3B6SA 1JV2B 3DBSA 1AS6A 2BCMA 3L3OB 1BZ7B 2UZYB 4KO5A 2FYYB 2X4PB 4M1CD 3TURA 3HNVL 3O3BB 4G6ML 5DFVD 4YQXL 3DX8A 3RUGB 4RSVA 2X4NB 2IQAB 4MS8C 1Y6NR 4KHXL 4MB1A 3IBOA 1QX1A 4TVSa 1ODUA 1XMWA 4FLSA 2Q6WB 5I8KL 2H6OA 4P46A 1F0LA 4YFDB 5D55A 2A2QT 3IGAB 3HNSH 3L3JA 1F42A 1F6AA 1OARL 1SBSH 4G8EB 5LBSH 4F9PA 3LS5L 1KLUB 4F2FA 3L1FA 3VFUB 3NH7H 2WZ0A 3BVWA 3WY4A 5TPWH 1QZ1A 3FB6B 4Z0BH 2P45B 3TCTA 3BLPX 4MAYA 1I9RH 3P0YH 3SGDH 1VCBC 4W93A 4NNXA 5EOQL 1YJDH 2PXYC 2NNFA 3B4NA 3TGXA 3ILDA 3MJWA 3B1UA 4TNVK 1S8DB 4U1HB 3GMLA 4MWFB 1JRHL 5HDLA 4AMKH 2BVPB 5IBUB 4JE0A 1XF4B 5SX4H 3T2PA 3WCYA 1L3WA 3BGFC 4WGWB 1AR1D 3IKCB 4I9WE 1KBPA 5EMYA 2ZZUT 3SDDD 1WTGT 1C5BH 4NDMB 4JFEB 5L8JB 4Y9EA 1T0PB 4I18C 4L8CA 3RHWF 1YEJL 3FO9B 3VXTA 2EDJA 4JFXA 1E43A 2BXZA 2A74C 1PSKL 4F7KA 4P2RA 5EO0A 1Y7VA 4UQ3B 2VZUA 4Q6IA 1E2WA 1BVZA 1WBXB 4LPWA 2Y72A 2F8OA 4FX5A 2Y5QA 1D5MB 1AZVA 4G1MA 4L9LB 1F90H 2JJSC 2LVCA 1FFNA 4YHLL 2OTPA 3P9MA 3QO0B 1SVZA 2V2XB 3P4MA 4LCWD 4Y16B 2IG2L 5KBDA 2F58L 4GQ9L 2BNQA 4YSEA 4GAAA 4I1NB 2VXQH 3NVQA 1UZ8A 2H9GB 1TMQA 1TUPA 5KANI 4DVRL 5DMGC 4EOWH 4EJ1C 1HH6A 3R19A 2YPKA 5EWIH 2DQDL 1MFEL 3QZMA 1TCRB 4PRPA 2DEYX 3KXFE 3K4DA 1NCCL 3SQBB 1B4JL 3KLQA 4FQXA 3FSZA 4UU9A 3JTSB 3C2SA 5I8OH 1CBJA 4TULL 4Z7NF 2OPCA 3QIWA 1UYWH 1GZHC 3P11L 1IKFL 1IB5A 4CRPA 3IDJB 1VACA 5DUBA 4PVBA 2XWBA 3RQ3A 1ACYH 3SDAB 4EMZA 3CDGA 1L9MA 3D2UD 3CZGA 4PJEA 1NGPL 2ICWJ 4PS7A 5EUOA 2Y07H 5LVEA 1FFPB 3QXDA 4E68A 4WHTA 1WS8A 2Z8SA 3FYEB 1DJXA 4PJDB 5A2FA 4PJ5A 3GWJA 1V8HA 5EC2A 1A4AA 2CM6A 4PVNA 5F7HA 3MUHL 1E9OB 3C60D 5TF0A 4D8OA 1ZT4B 2D0FA 3M7FB 4D0BB 5FV2A 3QUYD 1JRHI 2AEPL 3MN8A 3DHJA 4L5FE 2YA2A 4G11A 4Y5XC 5J5EA 1Y07A 3QXWA 4JM0A 4Y5YA 3RGVC 3WNPA 3UAEA 2ZNWA 3EFOA 3EZ8A 3LNEA 4K7PH 3AXIA 3MV7E 4Z7UE 5IK3B 1BVNP 2BP0A 3Q48A 3G04B 1SRDA 4Z3TA 4JPVL 2WTRA 3HS9A 1A7NH 2WTOA 4MVBD 3C6LB 5A1AA 3ZSTA 4NFCA 5C0EB 3VYNA 5IZ7A 1SY6L 3CC5A 3PPEA 1JZIA 3GJFH 1QNIA 3AUVA 3I3BA 2V3EA 1NAMB 3IT8D 2VXSL 3FZUD 4ZSOB 4HX1A 4EN3B 4JCWA 2VIRA 5KYNA 4G7SB 1QASA 1L7TL 1X5JA 4G9DB 2HUHA 4LPYA 1UWXK 2EO1A 4J3VA 3FQYA 3ET9F 4TNWK 3WHXB 4MSWA 2DQHH 2W80C 4NJ9L 4UV4L 3VD9A 1UJ3C 1IGYA 3UAJA 3WHE1 5I18L 1GTFA 1CQYA 4WUUA 4PGZA 4WI8A 3QRLA 5CF3A 4TUJB 1SBBA 2CDFB 3NFPA 5TFSL 3F5WB 3NIGE 2XNAA 3MCLL 3NA9H 3DVNB 1H8NA 2B2XH 3UCQA 3DV6B 3TASA 3RA7H 1EXHA 3IDMA 1BCIA 3BFWA 1M7IA 3BVTA 3GMPB 2XN9D 3RGVB 4LLWB 3FNKA 3HFMH 4HOZA 4DKAA 2IADA 3SPVA 5KVEL 1ECZA 3O6KH 4GRWB 4XC3H 4V2CB 2Y3AA 4MX7A 2EJ1A 2WWMC 2V3FA 5KN5A 3BD5A 3NOIA 4LP4A 1AMYA 5KBKA 5LXGH 4BRVA 1CI5A 1KN4H 4Y5YC 2NY0B 3WLBA 1AR1C 4DK6A 4PRHE 3TO4A 3BWUF 1AQMA 4DP4X 2OMYB 3DKHA 2KLTA 3VI3F 1FYTB 2H3NB 4MLSA 2XQBL 2H0FA 4WJ5A 3G6DH 4YDLB 1PZAA 1T6VN 4P3WA 5D9SA 2VXQL 1E4HA 3DHMA 4MDRA 1S7SB 5ESQA 3WS6C 3QJSB 5MENB 5K1VA 3U2JA 1G7LA 1JCKA 5FYJU 4ZFFA 2ETWA 4QD2E 2BDNL 2KI6A 3QB7C 3QIUC 2F19H 1HXKA 2G2RB 3EGDB 4G6KH 5DRZB 5IW6A 3KPSA 3L4VA 4ISVB 2MCAA 2BVQA 3PWPB 3QRBA 4D9QE 3F7PC 2FB4H 3GSRB 3M1CA 3L5WA 1FORH 2DLEA 1V3KA 1KXVC 5AZUA 5TQ0H 5I6OA 1F86A 3RX9A 3CIAA 4BFBD 2AKRB 2WXMA 2WQXA 3VFGL 5EIIB 5I1HH 2ODHA 4GP4B 1A9EB 4J2QA 5DFVC 1II4E 2E9JA 4MVBC 3MRCA 1ZE3C 1J1OL 2E7BA 4KZCA 3D50A 5CLWA 4J3WA 2CDEB 1MDTA 3E8UL 5AVTB 5FS5A 3IK2A 1ZT1A 1IM3B 5ITFB 2I07B 1D5BA 2CLVA 4ZFZA 1N26A 4N2IA 4OM0H 3Q9PA 4OZIB 1YYLL 3QORC 4PIBA 3A5VA 1OAYL 5I1IL 2IGFL 4B9GA 4OGAC 1BZQK 3WKNA 2BFVH 4MAYD 4G42A 1MIEH 4CN4A 4LPCA 4GXFA 3TA3D 2C3VB 2CQVA 4QXVA 4WTWA 4Z7IA 4K5MA 1SXCA 2GG1A 4EI6B 4X6CB 4Z7QE 2B4CH 3MA7B 4NQSA 3WL9A 4LESA 4KK5C 3TO4C 1U92B 1D7CA 2QKIC 2J5WA 1Z5HA 3KLAA 5HHMD 3CH1B 4JFDD 4OUOA 4J8RB 4NO0D 1FZJA 2E5EA 4I5BB 1CGYA 1ZVSB 3KPOA 4U1NB 3TEWA 5I8EA 4H20L 2PYFB 2F6AA 4HPYL 4XCEA 3S3BB 1BD2A 4JJHA 2CCWA 3GEWB 3NMEA 3RVVD 3W2DL 2HRHA 3SKJL 3EG9A 3MKGA 1QFOA 2V7HB 3VI4B 1SLXA 5E7FA 1CG9A 4P5MA 4X80H 5ALBH 3TT3L 4FXKB 2VJ0A 3I84A 1KLGA 2VDQH 2NY4D 1G6VK 5FFLA 1FPTH 1RP9A 5AEAA 3TA3C 3RJQB 3MRRA 4JLRA 1DQJA 2VDLH 3DUHA 3O11B 3TJHC 4XN7A 2W9DH 5F93C 5HD8C 1NC2B 3L2LA 4H25A 2BSBA 4KNQA 5A7EA 3LIZA 3CSFA 2LU5A 5IBTL 1U6AL 1SF3A 4FDWA 4UOJA 1ZWIA 3QUKB 4HLEA 5DEFB 3TPUB 3TBTB 4RAHA 2X4QA 2X05A 5DO8A 1TEGA 5HVGB 3HNSL 2FX8H 4EI5A 2BFGA 4FQQB 4MMXA 4XMKH 1D2PA 1Q9WA 1R24A 1UG9A 2KLSA 4G9FA 1CUOA 4EIBA 2G4GA 5DD1H 1BXAA 1T21B 1Q0EA 1DYZA 3WFCL 2ZUQC 2N59A 5EBLB 3FTYA 2QQLH 4MXWL 1OOAA 1F4HA 2Y5TA 1BVKA 2CRIA 4KAQL 4KU1A 4MA7L 2AC0A 4PJDA 1UM4H 4ZDHA 4URKA 4C4KT 1E9OA 4PJ9B 3TL5A 2CD0A 1R3JA 2AK4B 2XLLA 4JB9L 5JW4N 3FU9A 5T3XE 2CR6A 4AYMC 4ZZFA 4NT6B 3QXAB 3RL1B 5IF0A 1V54B 1FNEB 3CX2A 4I48B 4LOUC 4QGTA 3U30C 1RAMA 1WFTA 4OLYL 4D0DB 1HI6A 4V1DD 2N1KA 2BVPA 2R2HB 4ODSH 2A9ML 5D96C 3UYRL 3HW7A 1XF4A 1TF4A 5FOJA 5BV7C 4PRPD 3TNNA 1T03L 1KG0B 5F1NB 3SGDI 1P7QA 5KSUA 2XTLA 2XVLA 4PRHA 1GCFA 3CFEB 4A7SA 2FIRT 2CRYA 3FU0A 4OJYA 2W95A 1JZFA 3JWNH 1G7QA 2VR4A 3Q3GA 1AGDA 4ZOEA 3O9WD 4XB7A 3V4VA 2AVGA 4XAKE 5EV7A 3FH8A 4F7MB 2DWXA 4FADA 2JKLA 3OMAB 2NQ3A 5H37H 5F6HJ 4XRCB 2HUEA 5IGXH 1RIHL 1FNGB 4GINA 5KVDL 2O4EA 1XCTA 3DO3A 5BXFA 3GS4A 1CWVA 2C9PA 1KB9J 4Q6KA 1FNHA 2NCMA 3BH8A 1NWOA 5BOJA 2JKNA 4LSVH 4AJWA 3LRGA 3PNWB 4RFEA 1LO3L 5IREA 3WNIA 2PO6C 1IGYB 3TEYA 4RQQB 3WJMB 1PZ5B 3AG3B 5F97E 5D93C 1YNKH 4HXAL 3GBNH 3KLDA 3TWYA 5I5RA 3TYGL 4W9IC 1X6NA 2IPTH 2W07A 3GMNB 4MDJB 1WZLA 2YMXL 4HD9A 5C8JA 5D71H 5I0ZA 4AI7A 2QGDA 3VA2C 1D7BA 2CDGA 4ZUUB 2J8HA 2Q8AL 1W16A 3CJJA 4NQDA 4RGMC 4KZEH 3D4GA 4LSVL 3QSKB 3K80A 5I5JA 2I25N 1YNTB 4UNUA 1MW2A 1AIFB 3OZ9H 1EDYA 2AJUL 2EEAA 3DVIA 5I5IA 2GHWB 5EEYA 2OMVA 1DE4A 3PWNB 4ODBD 1WTLA 4X7TB 1VGEL 1QEWA 5GGRB 5D70H 4JFFD 2FWSA 3CE1A 1NUDA 2Z6FA 2DQUH 3AU1A 3W57A 1YEGH 1DN2A 1Z3RA 4R5XA 4G6JH 5ID1A 4WSGA 1JVOA 2EXYD 1S7SA 5MENA 35C8L 4RFOH 1R5VB 4PJ9D 3MFFA 3VFSB 5F7EH 1ACCA 4XBMA 1QBAA 2XWJA 3T2NH 2DQFA 4ZFFB 2VT0A 3DJRA 4N85A 4JDZA 3KPSB 4XVJH 3QCTL 2F54A 1GS7A 3IN0A 3Q1SH 4Q2ZA 3CHQA 4K7PY 3D39D 3CTTA 4N2BA 4ENZA 1QNZH 1X3DA 3CSGA 1XXFC 4UQ2A 4XNQA 5EUOE 2EYTA 5CCGE 4KK6C 3B1TA 1WICA 1RUKH 2WOYA 3ESVF 2VL5A 5F7DB 4H13C 2FVNA 3BSZL 3K5RA 2VN3A 3DIVA 3OKLB 4S1QH 3B2UC 1U95A 3ULSA 1WZKA 4BWTA 3WNOA 2MRYA 2DEXX 3ELQA 1LWHA 3PWLB 3ZBMA 3W5NA 1RUPL 4QRFA 5AW4B 4ETYA 5FLVA 1LO3H 3WY3A 3HKFA 4Y5VC 1AXTH 1I3GH 2PP9A 4GI8A 5ILTL 2W65A 3OKDA 5F21B 3L95B 4TNFA 1Z9PA 3MNVA 5DMGD 4E9TA 4NM4H 4JANA 2X6AA 3GSUA 4ODUB 3D85D 1RIHH 5F96L 4LCIL 5TE7H 5G4NA 1CFNB 2VDOL 5IBTH 3ZHFA 1NMCC 4BHUI 4QAWA 2FEDD 1N3NA 3RPIB 1K4DB 2O5XL 3N0AA 3WFCH 2ZXBA 4IHOA 4D7BA 2IBZX 3NK4A 2AJZB 2DWEA 5CJOL 1BQ5A 2N0KA 4XN2A 4GO9A 1QACA 3QNYB 4YDVA 5GJSL 5GPRA 5LG1A 2YD2A 3QUMB 3L4YA 4YHML 2ITDA 5INDB 3ARGA 2WBJD 5J13B 5LB1A 4EKXA 2QBWA 5EZIH 3T0EC 1E42A 3CFTA 3FOLA 3NCEB 4RA0C 1T66C 5IB1A 3BRGC 1LD9B 1ZAGA 4JRYD 5TH2A 1K4CA 2EEXA 4QLWA 5KJRL 4KMTH 2XVBA 5DRXA 1SXBA 4KJWC 2KDGA 4KJQD 2CJ3A 2J8UE 2K9UA 2XVGA 1MN4A 1T7XA 4WFGD 2D3VA 4JY6B 1F6LL 2VDLL 3SOTA 2R0LH 4TVPD 1DQJB 1CT8B 4X98B 1SLWA 4XMTA 4KAQH 1IAIH 3IN2A 2VZ3A 2Y69B 1RVFL 4WKZA 4NQEA 2CA3A 4P9HH 5I1EH 2ZJSH 5E6RB 4NQCB 4LSPH 4G6AD 1ZCRA 3GHEH 1UOWA 5E2UL 5BNXD 1J9RA 1GCYA 3LSOA 1E0OB 3VW3L 1AS7A 3CLFH 1AFVH 2VN5A 2JIXD 2AK1H 4NXKA 1JNNH 2V6HA 2FYYA 5DRZA 4MMXB 1Q8MA 3SGEH 3ULVH 1HL9A 2H3KA 4P23A 4EE2A 3FUDA 1T21A 2RALA 4CAGA 1KSRA 5HDWA 3LTVA 4FA6A 2B4CL 1PFOA 5F3HA 2OI9C 5D5MB 5KJ4A 5AOLA 4ERSH 3LD8C 2ZUSA 4AZUA 5I19H 1BGXL 4KC3B 5C2BH 4MA8L 3DX7B 3U46A 2OYPA 3NEXA 4DUVA 5JLZA 4DUXA 3D0LA 4L29B 4FNUA 1GSKA 1UHVA 4RFNB 3U4EB 1NAMH 3BSZA 5E99L 1CTNA 4JDEB 3B7TA 1FORL 1GPOL 5C0CD 3IDNB 4XWOC 1P6FA 3W2DH 5CZVL 4LASL 5EFIA 1FLRL 4K4KA 5E8DH 4HOMA 1AACA 3MRJA 1KWGA 1YEDA 2UY7B 5D5ME 1J0JA 1RULL 2X0VA 1KT2B 5T1MA 3NUKA 3J27A 4JKPH 4HS6B 5I0DA 4N8VG 3G6JB 4JG5A 3UL4A 5CILL 5HJGA 1TJXA 2CXGA 4GMTL 3L3KB 4YK4B 4APXB 3DURA 2BVEA 1MFBL 2D2OA 2FUTA 2EEFA 4B60A 4CSSA 3RJDA 5ANMA 3TJEH 1CURA 2LAGB 1EHLH 4JBSA 3KLAB 2QPDB 3FU3A 2AMUA 3RWGB 2FGWH 2YKLL 2ZOLA 4WW2C 1D6VH 1HX0A 5SWZA 4AG4L 2MH4A 3DK0A 3RGVD 3V4PL 3RX5A 1JTPA 2K4AA 4J1UB 2WSKA 4Z7VF 1CR9L 3T0XA 1Q9LA 3V6ZA 3QHFH 3HHSB 1UA6L 1M6OA 3E8UH 3FULA 2GPZA 3GMMB 3H9HA 3NCFB 4HW6A 4AM0Q 2B2XL 1IAOB 3HB3D 1H19A 3E3QE 4ZTOH 2IPKB 5ID0B 1NLDL 1RUAH 4IBTA 3PAYA 1XV8A 2F2HA 1JGLL 1GZQB 2LVEA 3LH2L 5TFSH 1X7QB 4XPBL 2NNXA 1ZS2A 2CLRB 2Z92B 1J5HA 5EOCH 2H9GA 1W91A 2IH9A 2LU3A 4X5WA 4DN3H 3DROB 3MGAA 3WD5H 4UNIA 3E7JA 5EO9B 3S2CA 4XPFH 5E2VH 1NGYB 1A1MA 2KL6A 4JUTA 4HOXA 3KDPB 1JN6B 3T8VA 5HHPA 3ZKSD 1B0IA 4X8XA 3MVSA 2D31B 4LEOA 2EO9A 3KW7A 4WW1B 1UM5H 5DJZA 2YWZA 1JZ7A 4XI5D 2VXSH 2O61B 3DDFA 1XVSA 2NUPB 3KXFA 4L9LC 1ZLSL 4LAQH 2X4PA 3JV6B 3TNMB 5I66B 4AMXA 1R24B 3QUGA 1MXDA 4JJOA 2X4NA 1QFUH 1FCGA 2WXGA 2ZSVA 3KYMB 3HZYB 1QR4A 2CU9A 4X9GA 2WD0A 3HI1B 5CD3A 4P46B 2EDNA 5DT1L 3BQUC 2X4OA 5CN1A 1YN7A 1INDL 3MNZA 4G7YL 4IOIA 5EEVA 3B2XA 1CZ8L 3MBED 2ZXCA 1JTOA 3KBHE 5KYYB 1K5NA 3LAFA 1KEML 4FCAA 4BZ1H 4OLVH 1E3XA 1DN0B 1EEYA 3KGTA 1ZEAL 1CLCA 2AEIT 3I6LE 5CJXC 5CBAA 1KC5L 4JHUA 3S5LA 3GMLB 1P4BL 2CZNA 3FN0L 1DJSA 4RDQF 1NFKA 4DEWA 3C5XA 5F1NA 2EINB 5B1JA 2XIIA 3IU3A 5ISZE 1ID2A 3U0PA 4TSBL 5BJTA 5MP6L 1A4JA 1U8QB 3IF1A 1JD7A 1B0GA 3ILPA 4L4JA 1F6FB 3D0AA 4C55A 3G5ZB 3CGTA 3ABKB 3OQ3B 3QCVH 5IHWA 1ZA6A 4GIPD 1ESOA 4KMQA 4C8XA 3BKML 4RMBA 3D05A 1IGCH 4K7FB 3FTGA 5E2TH 1PY0A 1OE3A 2HG0A 3OXSB 3GEFA 4N2MA 5E8OA 3O2VL 4YZFF 4N8CH 1K4DA 3MLYL 3PPSA 4GB9A 4WY7H 3DX0A 4ZOCA 4HKXA 1M1XB 2ICWI 1RURH 1W72A 2AJZA 2DWEB 5A2IH 5AW7B 3ZO0A 3TBCA 3APMA 1AKPA 3WAJA 4HBCL 3UZQB 4XMZA 4FQLH 4QRPA 3SSGA 2ZIDA 2DWYA 2IG2H 2R83A 2CIIB 2B16A 3GMNA 4BQ9A 4OQTL 4L3ED 1A7OH 4CN6A 4L9DA 4QXTB 4NRXB 1M6UA 4K7PL 4EZJA 1WRFA 3RWCB 5CEYB 3RILA 2K1MA 2YD7A 1G7JB 3KAAA 3UPAA 1KN2H 4JFVA 3X1FA 2DLIA 2DV6A 3R8BB 3DETD 2VRQA 3QDGA 4HLZH 2X6MA 3RU8L 3AU0A 4QRSA 3C5SB 4KH9A 1JYNA 3GRWA 4WAFA 4UTBA 4QRTB 3L1OL 4YIQA 3OM3B 5C0FA 3ULUF 3P1VA 2BS71 4TOYL 1UM5L 1HZLA 1IC0A 4B3EA 3T6QC 1ACZA 4JZOB 4HDIB 3FMGH 4YXLH 4ZUTB 1U58B 3CDGB 2VLRD 3GHBH 3MMEA 5E2VL 2HVKA 4ZMVA 1AJ7H 4AVJA 5D1XB 2QSTA 3PAVA 5I2IA 1DQQA 4KVNH 5D7KD 3UTPD 1MJ8H 1KJMA 4NO0B 1NCCH 5FK9A 3WMSA 2WO3B 3RZWA 1WT5A 3RGBA 1OAZH 1MWAL 4U1GB 2X1OA 3PHQA 4TQ8A 4CUCA 3BYTA 1OTTD 5CMAA 3V0WL 1C5BL 3HZ3A 5AL8A 2VR3A 5HYJB 1UM6H 1M71A 2JJTC 3ZTEA 3OR6A 4IOFC 2JCWA 2WZPD 2J1KA 2MCPL 1S9VB 3L6FA 2CDEA 1KGJA 3QEUB 3WS3B 4PFEA 4OCRH 3ZHDA 1CDJA 1MI5A 3P4OB 1D5ZA 4AW4A 4ORZC 5EOQH 1TMCB 5ITBH 4WEEA 3P0VH 5L7XH 4XODA 1C16B 2GBAA 3MO1B 4I3GA 3SCMC 1JSYA 3F04A 4YEFA 2X40A 1RIVL 4GUPB 4PAZA 3AZUA 3QIBA 4WSJA 1R3LA 1QBLL 3LZRA 5FYJD 3BUDA 5KJRH 2OYKA 3X12B 1O7SA 3V0JA 1TPXB 2WGNB 5D7JC 2L0DA 3NCWA 5HHNB 3DIFA 1WZMA 3DX6A 2RCSH 4HCFA 1DLHB 5HGHA 2QVMA 2DYPD 2CGYA 4H0LC 3K0YA 5CCHE 3RWJB 1D6EB 1M4KA 1WA2X 3OJDB 2DJSA 3VFVB 2Q9OA 1IAOA 1XCQB 1BMWA 5C0AE 4F7TA 1EJFA 5GSVB 2A9AA 1YHPA 3RAJH 1EHNA 1R33A 5SWZD 3OV6A 1MWAB 2N3JA 1Q9OB 2IAMA 3UROR 2OS7A 1AP2B 4L3AA 4HUCA 1UENA 5D7LA 3N0PB 4NZRH 2FQDA 5GRYA 3O11A 1NIAA 1JNNL 4WKZB 4JRXB 3SE9L 4X6BA 2V9TA 3ESPA 1H9VA 3MBWA 5CWSA 3VD1A 3X3FL 1G9NH 3WGUB 5J8OA 2JELL 4KHTL 5KVFE 3JWOL 3NZHL 5J13C 4JFPA 2NDGA 3WXVL 1UOKA 3MDJA 1DVZA 2EVHA 3AREA 3H2PA 2D9CA 4O02L 2EYRA 3B8SA 2FWOB 2VJ8A 3BEWB 5FO8A 5J1SC 4HGWB 1IKNC 3L7EB 1JOIA 3HZYA 3EFDH 1YMME 3HI1A 5DZPA 5FYKH 5C3LD 2NY4B 4R4BA 3C8KB 4Z9KB 4IMKC 3WUWG 4HSAC 4N8PA 2B5IC 3R0MA 2UWEE 2XWEA 3PP3K 2XT1B 5DJDB 4MA1B 4AIOA 3T09A 1BYNA 3JWOC 2DQEL 4OKVA 2ZSWB 1U3JA 4QJ5B 1KBGL 4MXVF 1IVLA 4MFHA 5D7JA 4AGMA 4X50A 5ITBL 4KX9A 4G82A 3KEDA 3HZKB 5CAYB 3NCMA 3IDYC 2VDRL 2WNGA 4Z7VB 1INEL 2FECI 1ND0B 4HKZA 4YSRA 3DSFL 1P7QB 3WNKA 4DZ8A 2YD8A 2G5RA 5GJTH 3IVKB 3CSBA 2J56A 2WGXA 3CFBA 4IBUA 1AHKA 3K2IA 4TVPH 5FUOH 3ZX1A 1ZXKA 4O02A 3OLEA 3LKSB 5G55A 2KQNA 4B3VA 4ZPTB 3SGKC 2MFNA 2WXRA 3VB8A 2JCCF 2W92A 4XRCA 5IJCC 3QFDB 5FM4A 1J8RA 3G6AB 3SKMB 3OSVA 1BEYL 1UD3A 3H9ZA 5CHNB 3K71A 2YBRA 4ZS6C 2R0KH 2ZOLB 3L45A 3JWNG 1RZIA 3FUEA 1NOAA 4H8PA 1A4CA 2X0WA 1GGBL 3V7AG 5FDYA 3W9DA 1GGBH 4ZRGA 2FEJA 2ESVE 3ZL2A 3AREC 4UDTB 1AJ7L 3ULUE 4ZI8A 1PKQE 2WXKA 2CUAA 1AS8A 3T6VA 2XN9B 4WDIB 5SV3A 1XO8A 1A1OB 1KFAL 2WQRA 2ZWNA 3DXAA 1W6LA 2A9NL 4NKDA 4A2GA 4A38A 1AGEB 5IBLC 5I82A 4I7ZC 4GW5B 4TM9A 2YD4A 2A1WH 4YAQB 2OK0L 1HYSD 4CJ1A 2UXVA 3C60A 5D2NE 5DMIL 3SDXF 1FA4A 4ZMZA 4M9OA 4I3RL 1BZ9A 1U8LA 3MNWB 1TEFA 1IM9A 5HGAB 4C54A 5FKAB 3MLUH 3TF7C 2MQCA 1ZWIB 4AEIL 1X5MA 3TBTA 3ES6A 5FO9B 5C0FB 3CXHK 3MRFA 4I2XB 4G5ZH 5JW5A 1UKSA 2B3IA 4PM1A 3T9WA 5I66A 5IFAH 5ICYA 3ULUH 5K39B 1WA0X 1MHPL 4ACPA 3WEAA 2OP4L 3BT0A 3OZ9L 5TF1H 2WUCH 4OLYH 1BVLA 1J48A 2X88A 1JWUA 1MAML 1PF3A 1R5VA 2FNWA 3L3DA 4IBYA 3OKEB 3HN8A 4UQ3A 4C56B 1UACL 4P3DB 4QRAA 4HULB 4EVNA 3REWB 1MNNA 4AX3A 5H2BA 2VM3A 1EO8H 3GLDA 2BOBA 1I4FA 2YMXH 2YGQA 4ZUWB 4N2OA 4PJ8D 5I1AA 3GMOB 1KDJA 1V27A 4LDCA 1DN0A 1EEYB 2VLMD 5AKSA 3G5XA 3P77A 2R7EB 1J87A 2Y7QB 1CGSL 5LNEA 4ZTPH 4G1EA 3SDYH 4MAUL 2R2HA 3UTSD 5C3IA 3D4CA 1A6UH 3AWFA 5BV7B 5D96B 2IXQA 2HTKC 1EAPB 4GKSB 5IIEB 3PQYD 1LILA 2X9YA 3ATDA 2XG4A 5KS9B 3BIKB 1TCRA 3UIYA 2NY3C 4TVUA 5D1XC 1L7IH 1WC7B 1FFRA 1GYUA 4CL7A 1HHJB 2DY2A 2P8LA 3NIGF 1IJ9A 4RAVA 2F15A 1N68A 4OLZH 3II3A 3N41B 4B53A 2Q8BH 4XMPH 4CA4A 1QTSA 2W8CA 4MMYB 1F97A 4MHHI 3U30B 4F93B 2NW3A 3QIBB 4WCYH 3EJZD 4PW4A 1D9KA 5KYXB 4LSSH 4ONHB 1FH2A 5C86A 2HT3C 4Z77B 2P8MB 3NJLA 1F41A 2XZAL 1I8AA 4P3CH 2O72A 3GLEA 3Q6FB 4OI9A 5AVYB 2CO2A 2RB8A 4KRLB 4MDJA 4P05A 5KG9B 2P1YA 2ZUQB 2ZX9A 4NRYB 3D2TA 3WNMA 1SHXA 3NJFA 3VD5A 1E90A 4P2YA 4I85A 3K6SB 5C0BE 2A4CA 1XT5A 2GJZB 3AVEA 1S9WB 2W0FB 3C6LA 1CGUA 3HHMA 4POZC 4FULA 4R84A 4Z3JA 2DKUA 4KNSA 5C0EA 2AGJL 1LP9F 1R4XA 4XCFL 3STLB 1XSOA 4BIKA 5L4MA 4B41A 1A66A 5C0BA 5CEXB 2KS0A 3N1QC 4P4KD 4UM8B 4JQXA 4IJ3C 4JM2A 1A7PH 5GS0H 1KMGA 4YUEH 2JKTM 1INQA 2G5UA 5E5MB 2WQ8A 5D1ZB 3Q8FA 1WGOA 3S36H 5D1XA 4CSPA 3CK0L 3FFCD 3HLKA 4MAYC 2BNQE 4JDZB 2IMNA 2PW2A 1G6RB 2DN7A 3KPQB 4H4NA 4PRAB 3ZYIA 2PP8A 2VKWA 2VN4A 1JPST 1KCVH 2QFRA 2XKSA 1LNUA 5AYUH 2OMBA 2NMSA 4LGSB 4TUJA 5ALBL 3TT3H 4C4BA 3UBXB 1YC7A 5IB4B 3I6SA 4LCYA 3C5JB 5I28A 2AQPA 1FGVH 1GXEA 4LKXB 1H5BA 4KDVA 2V4LA 3ESMA 3EJPA 3QORB 2VXUL 2VR5A 3P3UA 4PJHA 3GMPA 4JL1A 3PDOA 1DO5A 2NNCA 1GTNA 4HXBL 4WSKA 4B9PA 3MXWH 2HRGA 8CGTA 4HXBH 3MUZ1 3E6FB 4OFYD 4ODHL 2VQ1A 1L6ZA 1VB9A 3UTTE 5E8DL 4RMRA 2CBMA 4H8HA 1OT4A 4DZ8B 4JJ5A 3JYBA 3QQ4A 4BZ2A 4R8WH 2QKSA 3ZYJA 1YY9D 1LO5B 3JVGC 1MCQA 5T3ZL 4LLQB 5CS7A 4HZLA 3WY2A 1RZKH 1H0DB 3QG6A 5EF1A 1NCTA 2A7BA 4ERSL 3MYZA 3HFML 4G6AC 1E6JL 4QT5A 4MQSB 5FA3B 1CMOA 4OLXH 1T22B 3RBGA 2IH1B 1KLFB 3QNYA 2H8PA 4GBXC 3APCA 3EGDA 3VXRA 1YDPA 5GRVK 3O8XA 5F0MB 1RURL 5C0ND 1S7VA 1IVTA 3MODL 4PJEF 5ERWB 3W9DB 3ZZLA 4P59H 1VFAB 2WB1A 3K74B 1YMHB 3I9AA 2W60A 3ELAT 5CZXC 2YJQA 3O2VH 4AIZA 4DEUA 5B38A 4FYRA 3HHSA 3TFKC 1IU1A 3BKMH 4XP1L 4WWNA 1BIIB 3MRMA 4KKRA 4FFYH 3PWVA 4AYDC 4XNMA 4JFOA 4R7VA 1X7QA 5BUPA 1FJ1B 3IDUA 3I3DA 2HXAA 1OKEA 2A9DA 1HXMA 2E9WA 3INUL 2QTEA 4JZJC 4X6BB 2BIHA 1WUZA 1MZZA 1X9QA 4TSBH 4ZFZB 4Q9CA 2VQTA 1CLZL 3HUJA 1JGVL 3V95A 4CDHA 5HVHB 3VG0H 1FNLA 1MREL 4WQOA 7PAZA 4ZX5A 4HUXB 3AITA 4OIIH 3VRLE 3DVGB 1JK9A 2ARJB 2ZWKA 4DGIH 4JW3A 1HKLH 3RIFK 1GVIA 2XXCB 5CGYD 1QRND 4Z18A 1KEMH 3U79A 1SJVA 4YHMH 4C59B 1XGQA 2WLZA 2XWTA 4BZYA 1MIML 4P2QE 2RGSA 4Y4FD 4F7EB 3L3DB 2BSDA 2EE9A 4HKBA 4U2YA 2Q8BL 4LVEA 3ZHKA 1MCFA 3JWDL 4B5ZA 2Y2YA 4FTVB 2E8ZA 1HSAA 4LEXL 1LK2B 1JG9A 2R9HC 4U1KA 5ANHA 4KY1L 1N6QH 5FYLE 1MREH 1FAKT 4NZDA 2J6WA 1P1ZB 3BO8A 5I73C 4S0SD 5I1AB 3JV4A 3GSWB 5F2FA 2WINA 2E27H 2FBRA 2OSLA 3FT9A 2SEBA 5ACMA 4KK6D 5ILTH 3MTRA 5KVFH 1A6UL 3VJ6A 3BN3B 4IIZA 4RZCB 2LTQC 5JXAL 1MPAH 4W9GC 5IOKA 3L3GA 4OD1H 3B43A 4FFYL 2DDQH 3ARWA 2J88H 2WMPA 5KVDE 3AY4C 3PL6C 2XQ0A 1U8QA 5I76B 3D12B 1BFOA 4UIMA 2BNRD 4OLUH 3EJJX 1N5YH 1XIWA 3F6LA 5DMKB 1IQDA 3ZE2F 5EF0A 2AANA 4JZJA 3WSQL 3C8DA 3RKDD 1ZT7A 4I13B 3SDXB 3AAZB 5I8CB 1A14H 2WM0A 4I0PA 3HJ0A 3QHFL 1AI1L 2QZQA 1P4UA 2UY6A 4FI7A 1ZJBA 3QZOA 4AWJC 3GB7B 3IRPX 2UXGA 4XCYA 1YYML 1MW1A 1A0QL 1FL5A 3MV7D 1F6AB 3K1DA 2V17L 3P3TA 1WH0A 1A1OA 2VWEC 4Y2DB 5CGTA 1NM4A 2X12A 3JV5A 1AMXA 2R8SL 4AQEA 3DX1A 1DVFB 1T1ZA 3QJTB 4NNXB 3QXAA 5IF0B 3RL1A 5BVPH 1IZKA 4J6RH 1FNEA 4G80B 4I48A 3VA6A 2JTYA 3RNKA 4WWKC 2F7IA 2ZG2A 1NFIB 3LEYL 4L37B 4Z8FL 2Y07L 2ATPB 5EO9A 1RULH 1IM9B 1BREA 4E36A 1QLEL 3ARRA 4PJBA 3V7MA 3T0WA 5KSBF 4U1LB 3OAZK 1IAIM 1CICB 1YA5A 2WIMA 4M5SA 1HYSC 1XR8B 5CZVH 4RMQA 4FMVA 2BH0A 2D31A 4LEOB 2CJSA 1QHOA 1W15A 1K3IA 2XJKA 1O0VA 3FUMA 1A6WH 4XPHH 4AGOA 5DRWA 1FVDA 2V5SA 2C9UA 1GC1H 2GUOA 3AADB 2YC1B 2OZNA 4PJFF 3OMNB 4U6XB 5EC1A 3UTTD 3MOBH 4DKEL 3H6JA 2GJ6B 4HCRH 4JRWA 5DEGB 3TWCL 3B2VL 4N20A 1ET8A 4H1LG 3GXUB 1I1FB 2X4OB 5CD5D 4WI0A 3MJ7B 4FKEA 4PRAA 5GGTH 3PNWA 1WCBA 5C0AD 1F18A 3RZCD 5AFAA 1CBVL 2R2BB 3QP3A 3S0PA 3QDGE 4XWGH 3QJHB 3AS3A 4RQQA 2FHCA 3WGVB 2BWDA 4Q0XH 3V0VB 3QE5A 5L0QC 4FRWA 4LCYB 5CJQL 1E9QB 4GKNA 1AFVL 1U93A 5E9DA 4CSZA 4ZW5A 3NZ8B 5HTSA 1F90L 2PXYD 3QORA 2V0AA 3KPRE 3PXHA 4X4ZA 2A83B 4P2AA 3IFPA 1OCWH 3KPPA 3SE4C 3LRKA 4LAJH 3V4PB 1P4LA 2A74B 4YZWA 1J8KA 3SQOL 3U0PB 5KSAC 4IDJL 3G08A 1GGCL 1B0GB 2L7UA 2DQEH 4N2CA 2HN7B 5EEXA 4PRPB 3W11D 3O6LL 1WC7A 2QGBA 5I1GH 4MJIA 2WXQA 1YEJH 1JZGA 1R5IB 3MV9B 4P3CL 4LVOB 2DQCL 4H2CA 5JZ7C 1WZAA 3QZWA 4DN4L 1PY4A 1QEWB 5T5FL 3MRNA 4O58H 4Q58C 3D07A 3THMH 4F58H 2XWZA 2Z31B 4PP1C 3MLWL 3T1FA 4ODTH 2K6WA 5EZIL 2FHFA 3SDDB 2L4OA 1DP0A 3NIFE 4JG1H 2K6ZA 3VGGA 32C2A 4H1LB 4PJEB 2G9HA 4Z6AT 2WYZA 3AABA 4UQIM 3VQ2C 5D1ZC 3EFFA 1TEYA 1T04A 3AC0A 4YFLF 1I8UA 3UJJH 1LXMA 1S7VB 1BWWA 3VYOA 1P53A 2NTFB 3DIFB 3DX6B 3WFDL 1ADWA 1FFOA 2HJLB 1I9RL 3LKQA 5LJYH 4Z95H 4NRXA 2I9LB 4UQ2B 4Z0BL 3JXAA 5TE7L 3FF7A 4P46C 2MNJB 4LARH 2FUQA 4X7SL 1MAJA 2G3XA 5EZLA 2VAAB 3RB7A 3VDAA 5H8DA 1JWSB 5D1ZI 3ZGHA 2CHZA 5AW6B 4FERA 3KWVA 1J88A 4OV6F 1T6BX 5GRXG 2AJSL 4E41A 3JV0A 1EEZA 3LRHA 4ZTPL 1AP2A 5F8QC 1T0NA 1UJTA 2OSWA 1S3RA 1P1VA 3B9DA 4GP8B 4NWTH 3RVXC 4OCMC 4ZUSA 4HZAA 1AZZC 1G1KA 1K2DA 4JFPB 4W4NA 1IFRA 1CFVH 2NY5L 5IB5B 4AVHA 3L5XH 5MI0B 3MBXL 2VN7A 2HKFH 1KJMB 1V3LA 2VLRB 1RJCA 3VXUD 3RX7A 4RWYH 2NOYA 1LNUB 3KHOA 4GRLA 4DQAA 3ULVF 1SXSA 2WN2A 3G9AB 4DGVL 4LT7A 1LDPL 3BHBB 5A3ID 5D1QD 4BH8B 4G5ZL 4XNZC 4RFOL 4ZMOA 3OAZH 4Y1AE 1HILB 5AKVA 2MCMA 4N1HB 1PJWA 1U8OA 4PU2A 4ZQKA 3DV6A 4Z76A 5JXEC 2AQ3A 1AHWA 4EZLA 2P52A 4AKPA 5CM1A 1UZ8B 2IGFH 4APQC 4KXZI 4LLWA 1PW3A 3F01A 4IKLA 4FJYA 1TSHA 4YBLB 1RJLA 2F7QA 3GJFA 3GXDA 5E1AA 3IYLW 3SPIA 5IEHA 1MI5B 4Z7VA 1OE1A 4LGRB 1ND0A 5DZJA 3LXCA 2VMFA 3QAZB 3UJTH 4AYSA 4R7NB 3EH2A 3QYNA 3F8UB 1BFOB 1DDTA 4UIMB 2L8AA 4HAGA 5T5FA 2WIIB 3MO1A 4N0UE 1FRGL 3VFRB 4I1RA 1FE8L 2PO6A 2IANE 3WY1A 4IRJA 4IYKA 4PJIB 4FL4C 3BWZA 3EIFA 3V0HA 1CFMA 1WVZA 3DJSA 4GS7B 1BAFH 1E6OL 1NWPA 4Z7UF 4UNVA 3BE1H 3C87A 1RZ8A 3OLDA 3UAJD 3QAQA 5IJBC 1DBAH 3EW3B 4K3HA 4YXLL 1Z9MA 2VDPL 4C83B 4WIQA 3I6LD 2YUWA 3MV8A 5IVOA 3FTVA 4QYAA 4PJ7B 2QMJA 5D5MA 4AJVA 2C7UA 2R4RH 3B56A 3P02A 1YZZA 3SBPA 2JV6A 3CDYA 5AVRB 2L7EA 3B9EA 4ZZKA 3OB8A 2FQGA 3RU8H 3UTQA 4OJAA 4KY2A 3SGKA 4S2SB 4U6YA 4LEXH 2XIDA 2I85A 3MRCB 1A1NB 4XVTH 5IK3A 4AQEB 3ULVD 1INEH 3OWEA 2XTJC 2BIMA 3U4AA 1JYXA 4RX4D 3QS3A 2EVGA 3EF7A 4NCC2 5KBPA 3ECQA 2P4AB 2AJXL 3WN6A 4JVPA 3R7RA 3Q6GH 2CUMA 3HMXH 4FG2A 3F7LA 4DP5X 2WWOA 2WVVA 3S8FB 2H26B 1DANT 4OCYH 3K6IA 4XP6L 4CVXA 3AREB 4KQ3L 1X4YA 1B0RA 2VZVA 3CNKA 2H41A 1T89A 1PIGA 2ORBL 2PW1B 3DRQB 2KLRA 4FQJL 4MMZA 4JB9H 4YL4A 3UZVA 3O4LB 2WNKA 5DSCA 3ML9A 1T4KB 2BSTB 1G94A 2VH5H 1I8MA 4P0DA 4OCXL 2V33A 2Y2TA 3QS2A 4Q14A 2QQLL 4W9LC 1QEXA 4E9WA 4K7PX 4HS8H 3TXAA 1N10A 1QBML 3S34L 3CFDB 4R96B 3JWOH 3IJ9A 5C0IA 4D8PA 1A4KB 2DKSA 4HMEA 1YQVL 1E50A 2D7MA 2Q1EA 1FG2A 3Q5OA 1NPJA 4PV8A 3KZ8A 4MKTA 4D9QD 3EUUA 3N40P 3VAEA 4RESB 1JF1A 1JGEB 1E8WA 4GUQA 2CG9X 3IDYB 4OIAA 4HKZB 1QLRA 4YR6B 1Z7JA 1IT9H 3IJ8A 4NQVA 4BZ1L 3PJNA 1XD0A 4R97B 4NPYB 4LVHC 4U1GC 4F20A 1T1WB 2C1OB 3HR5B 3T3PB 4BUQA 2Z34A 1JN6A 2ZOKB 3PGCA 3HC3H 3LKSA 5DD0L 5F3FA 3QUKA 5C3TA 4L3FA 4DPCX 3H9SE 1GGTA 5D7IB 2EILB 1MLCA 5ESQB 4E5XB 1CU4L 1CXIA 2P80A 3ECVA 5FB8A 5I9QB 3LQAC 1NQBA 3JYCA 1JHLL 4KTEH 4M7KL 4Q4EA 4D0CB 2NXZC 3N43B 4D7PA 4Q74A 5BS0E 1KELH 3DUSB 2DICA 3VG0L 3T1FB 3ZZQA 2WXLA 1UH3A 3TEZA 2XWCA 3CSYB 8PAZA 4F9PC 4ZYKB 5EBGA 4WTZG 5EBLA 4KZDL 2D03H 3K6OA 3QNXB 4GW4B 3VXMD 3PJLA 4JKMA 3NPZB 3NYKA 3AGWA 2H4EA 3PXLA 1A9EA 3BW9B 2RD0A 3HMXA 2PXYA 3QORD 3IE9A 4NKDB 1JUFB 4X4XB 1E67A 1NFAA 3U1PA 5B38G 5EORH 3M6DA 4NRYA 3D3VB 4Y4FA 1NDMB 2IEPA 5SWSA 1GMIA 2H32A 1D5BB 2CLVB 1Q72L 3CXDL 3CU7A 3CMOH 1T0MA 1TTRA 3MODH 1OTUD 2E0PA 3P0GB 4MJID 4WWKD 5D2NA 1C1EL 4NNYA 1WS7A 3S2AA 1E3ZA 5C08B 1ZD6A 4OBRA 3MROA 4KRMB 2F58H 3KWWB 3VGAC 4ZMQA 3LJ3A 2DBLL 2ICES 7FABH 2VR7A 4JM2B 1L9SA 4PR5B 3FT3B 5I75B 2QJDA 4MAZA 3WG7B 2Y6SD 1XBRA 2PWGA 3LKOA 2H0JA 3P4NB 5GHWH 5EUKA 1KTKE 4ZX4A 1FZJB 3C6LC 2FB4L 5B1CA 4LVOC 2B8OT 1ZPLA 2EE2A 3EUDA 1IL1A 3GBLA 3N3EA 5DVLA 1DUZA 4UT7L 2IVFC 4E2OA 1DQTA 3ARPA 3IJHB 3U0WL 4WU5A 3B7RL 4LHUD 3U0WH 3PGDB 2BP3A 2YMOA 4K71C 3PWPD 4LCUA 4Z76B 4ANKA 2XACC 4S0TD 5FGSA 5GS2D 1S6NA 4M7KH 4LLUA 1GPOH 1M7UA 2FT6A 12E8L 2ENPA 3MPCA 1KCVL 2KZBA 2VLKB 2K7QA 3W82A 5LHDA 1P0SE 2YD9A 5DJXB 2PTTA 3RTQB 2P8LB 4KDTA 1NGXB 3TH2T 3B5TA 4WW2A 4FQLL 1BZ7A 1QHQA 2PCFB 4MCZA 1K8DA 1KIPA 2G9KA 5GGRA 4OF0A 3PP3H 3UPCA 1GY1A 5E08L 1UASA 2D3JA 3IU4H 3S3PA 2R69A 3ULVL 8FABA 3MRLA 4OAWB 3CVBA 2KPNA 2VITB 2HVKB 2O30A 4HPOH 4QT5B 5FA3A 2DQFB 2HZHA 3B2PA 4DOHB 4QTIL 5FDWA 4NZTH 3A21A 2IH3A 4XNUH 4HEPG 4NN5B 1EFQA 1JTTA 3CDZB 3S4SB 4DAGH 3MV8B 2ICEC 5ERWA 3FB6A 1ZA3A 1H8OA 2YAMA 4Y5XA 5EA0L 3E1F1 1KYAA 3ULUC 1OPOA 1CU4H 1XF3A 3MOAL 1J05B 2IGLA 1L7TH 3MC0A 1HCFX 1OHZA 2OXGB 4KFMA 4X5XA 3CVIL 4KQ4H 2MCG1 4DPBX 5IR1A 3BWSA 1URLA 5I15L 3I02A 2IANA 4KZDH 5ACLA 3AT8A 4ODWA 4HJEA 3AQXA 4G59C 3RUGF 4FABL 4W9JC 3SDXE 1IT9L 3OKLA 3ARBC 3BPOC 4BDVB 1PZSA 3DSNA 2W9EL 3NEOA 1BM7A 2JNZA 1RK1B 3VGFA 1D5ZB 3NSJA 3Q3GB 4FG0A 4FQ1L 2UVEA 3QQDB 4HKJB 2B4CC 1MHEB 4PJAB 4N2GA 4S1RL 5IFAL 1S9KC 1P2CA 4MNQD 3L95A 4BFOA 1KB3A 3TF4A 3TFKD 1XGTA 4S0HA 3MRQA 3QEQA 4HQQL 2ARJA 2X42A 3VFPA 1U4FA 2HKAA 3NCBB 3QG7L 1G6RA 4I3RH 4XB3A 4K3EH 2DRUA 2Q10A 3GZPA 1O7DC 4LCIH 3ROLB 1NFDA 1NFDF 2P48B 1N4XH 4HKBB 4KKCD 5FGCE 4JHWL 2RA1A 1PFCA 4GAYA 5ADPL 2ZTBA 1XGRA 4ONFL 3WE1A 2OX5A 3WDJA 4FQJH 4AGNA 4WJKB 1KFAH 4M6OL 4PBDA 4LHUG 4LF3B 2HRPL 4MNGB 1AHWB 3M1BA 4HIHA 1F4XH 5ADOH 3HOGA 4X6EA 1AVAA 3HAEB 1FH5L 3PYCA 4NQDB 3IFNH 3F58H 2VE6A 4PJAE 1NCIA 5AAWA 3VVWA 2FSEA 2J71A 2X1PA 1HCVA 4OGYH 2OMXB 1NBYB 4Y2OB 1VEOA 4R5TA 1SJHA 1S78C 1JGLH 4N6QA 5DWUL 1MNUL 3IAGC 1G84A 4L1TA 4JFYB 3PWNA 5DZVA 1JZEA 3LD8B 4DVRH 1LYQA 2P24A 1SEQH 3MZGB 2C1OA 4LSRL 3I6KA 2JB6A 3RKDC 4NYLA 3WUZA 3GDCA 1SJEA 2F8IA 2NY7H 3QDJD 3U83A 4L4VB 3WS6A 1MHCB 2ADGA 1XZWA 3IRCA 5DK2B 5JHAA 3QG6B 4NFBA 4AEFA 4NC2B 5F9OL 3ZIMA 2GT9A 35C8H 5FXCH 4GOSA 2DLTA 4TSCH 1MJUH 3QI9A 2X4TA 4I9XA 2R1WB 5JIKA 2YMTA 1ECYA 5KW9L 3GI8L 2DI9A 5EG6C 3VGHA 5F72S 1K6QH 2EIEA 5C7XL 3F7KA 3KCPB 1ZV5A 3ESNA 3H4FA 4UQCA 1E5BA 5DMIH 5B8CB 5LKNA 3NRFA 4XXWC 4ZMPA 4L5FL 4ZODA 1BYOA 4KQ0A 3TTSA 4LK4A 3OGCB 4LMQE 3BW9A 1QW9A 3HG2A 2PYED 2BP0B 4WK2B 4G72B 4HZ1A 3VX0A 4CU6A 2AXGA 1BBDL 1YEHL 3FB8B 5IEKA 3PWLA 4WFED 3WFEH 2VLKE 1KIQA 4LCCB 4NX0A 3MGOB 4O02H 3S96A 4BRJA 2CRZA 1E4JA 5TDOB 2EUWA 4AMKL 4LHUB 5IJKA 4G7VL 4HWBL 1P5UA 3MACH 2A6IB 4N26A 1OGAE 3FTXA 4JZNB 4KJPD 4UV7H 4NDMA 1E8XA 4WV1A 1OP3H 2PW1A 1R1CA 1KBWA 3P0YL 2K78A 3D39E 4HBQA 5DHMC 4PWJA 3SE9H 3PABA 2Z35A 4WWKA 5CLTA 5FFOA 1IBBA 5E8EA 3FDWA 2CMRH 4KO6A 3LKOB 4AM0B 5E4OA 2N7AA 3DPBA 3NFPB 4PY7B 4HALA 3F7YB 3A47A 1Z2KA 4Y1AB 5IB3A 3SODB 3DSFH 1U21A 5T33L 2F1BA 3DVNA 1DUZB 3GHEL 3VWJD 4WNSA 4NQEE 4P2RD 1N0LA 3RVTD 3IJHA 1M6OB 1QMUA 3IETB 1M42A 4JDTH 3TYFB 1U93B 4ZW6A 2YD0A 4RZCA 1WG3A 3QFJD